F482285

General Info

Members Datasets Scaffolds Average Seq Length
822 657 1644 377

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1002299|Ga0055526_10022996
Length 401
Sequence VPRSKFIPGCRLPAPNAERPDEMSKETVFSNARIVLEDDILSGSILIRDGKIAXISEGSSVAGEDFEGDXVIPGLVELHTDHLEGHYQPRPGIRWNKTAAVQAHDAQIVTSGITTVFDCLRMGADEDGGFEHGEMREMADAIQSAEKEGRLRAEHLLHLRCEVSADNVLEHFADFENDRHVRLVSLMDHAPGQRQFQTMDQYIFYYQKKRGLSDEAFARXVAKRQAXSARNSTPHRNAIAKVCAERGITVASHDDATLSHVDEAIDNGVRLAEFPTSFDAARASHGHGMSVLMGAPNIVRGKSHSGNIAARDLAEMGVLDVLSSDYVPLSLLHAPFILADEVESITLPKAIAMVTSTPARTVSLDDRGRIATGLRADLVRVHRAHGVPVTRSVWRQGRRVA

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
38 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
39 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
45 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
46 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
47 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
48 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
49 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
83 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
92 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
93 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
94 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
153 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
154 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
155 2509276019 Ensifer aridi TW10 Isolate Nodule
156 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
157 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
158 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
159 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
160 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
161 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
162 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
163 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
164 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
165 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
166 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
167 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
168 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
169 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
170 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
171 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
172 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
173 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
174 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
175 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
176 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
177 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
178 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
179 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
180 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
181 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
182 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
183 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
184 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
185 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
186 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
187 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
188 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
189 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
190 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
191 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
192 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
193 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
194 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
195 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
196 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
197 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
198 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
199 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
200 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
201 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
202 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
203 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
204 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
205 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
206 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
207 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
208 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
209 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
210 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
211 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
212 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
213 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
214 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
215 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
216 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
217 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
218 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
219 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
220 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
221 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
222 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
223 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
224 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
225 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
226 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
227 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
228 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
229 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
230 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
231 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
232 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
233 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
234 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
235 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
236 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
237 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
238 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
239 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
240 2643221558 Rhizobium sp. Root149 Isolate Unclassified
241 2643221568 Rhizobium sp. Root564 Isolate Unclassified
242 2643221582 Rhizobium sp. Root651 Isolate Unclassified
243 2643221607 Rhizobium sp. Root73 Isolate Unclassified
244 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
245 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
246 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
247 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
248 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
249 2643221688 Rhizobium sp. Root482 Isolate Unclassified
250 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
251 2643221693 Rhizobium sp. Root491 Isolate Unclassified
252 2643221718 Rhizobium sp. Root268 Isolate Unclassified
253 2643221723 Ensifer sp. Root278 Isolate Unclassified
254 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
255 2718217882 Rhizobium sp. N741 Isolate Nodule
256 2718217927 Rhizobium sp. N324 Isolate Nodule
257 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
258 2718218009 Rhizobium sp. N561 Isolate Nodule
259 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
260 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
261 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
262 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
263 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
264 2718218363 Rhizobium sp. N113 Isolate Nodule
265 2718218365 Rhizobium sp. N731 Isolate Nodule
266 2718218366 Rhizobium sp. N621 Isolate Nodule
267 2718218423 Rhizobium sp. N941 Isolate Nodule
268 2721755514 Rhizobium sp. N6212 Isolate Nodule
269 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
270 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
271 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
272 2721755809 Rhizobium sp. N541 Isolate Nodule
273 2721755810 Rhizobium sp. N871 Isolate Nodule
274 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
275 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
276 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
277 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
278 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
279 2728369365 Rhizobium sp. N1341 Isolate Nodule
280 2728369397 Rhizobium sp. N1314 Isolate Nodule
281 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
282 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
283 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
284 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
285 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
286 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
287 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
288 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
289 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
290 2791355256 Rhizobium sp. M10 Isolate Nodule
291 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
292 2791355260 Rhizobium sp. L9 Isolate Nodule
293 2791355261 Rhizobium sp. J15 Isolate Nodule
294 2791355262 Rhizobium sp. M1 Isolate Nodule
295 2791355263 Rhizobium chutanense C5 Isolate Nodule
296 2791355264 Rhizobium sp. S9 Isolate Nodule
297 2791355265 Rhizobium sp. H4 Isolate Nodule
298 2791355266 Rhizobium sp. L43 Isolate Nodule
299 2791355267 Rhizobium sp. L18 Isolate Nodule
300 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
301 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
302 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
303 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
304 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
305 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
306 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
307 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
308 2802429633 Rhizobium anhuiense J3 Isolate Nodule
309 2802429634 Rhizobium anhuiense S10 Isolate Nodule
310 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
311 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
312 2802429637 Rhizobium anhuiense C15 Isolate Nodule
313 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
314 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
315 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
316 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
317 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
318 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
319 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
320 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
321 2838048938 Rhizobium pisi 27/80 Isolate Nodule
322 2838061910 Rhizobium phaseoli L15 Isolate Nodule
323 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
324 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
325 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
326 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
327 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
328 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
329 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
330 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
331 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
332 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
333 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
334 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
335 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
336 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
337 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
338 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
339 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
340 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
341 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
342 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
343 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
344 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
345 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
346 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
347 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
348 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
349 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
350 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
351 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
352 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
353 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
354 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
355 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
356 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
357 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
358 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
359 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
360 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
361 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
362 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
363 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
364 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
365 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
366 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
367 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
368 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
369 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
370 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
371 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
372 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
373 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
374 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
375 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
376 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
377 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
378 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
379 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
380 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
381 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
382 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
383 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
384 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
385 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
386 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
387 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
388 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
389 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
390 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
391 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
392 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
393 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
394 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
395 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
396 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
397 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
398 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
399 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
400 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
401 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
402 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
403 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
404 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
405 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
406 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
407 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
408 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
409 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
410 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
411 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
412 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
413 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
414 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
415 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
416 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
417 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
418 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
419 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
420 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
421 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
422 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
423 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
424 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
425 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
426 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
427 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
428 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
429 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
430 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
431 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
432 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
433 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
434 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
435 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
436 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
437 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
438 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
439 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
440 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
441 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
442 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
443 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
444 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
445 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
446 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
447 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
448 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
449 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
450 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
451 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
452 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
453 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
454 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
455 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
456 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
457 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
458 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
459 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
460 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
461 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
462 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
463 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
464 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
465 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
466 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
467 2933599457 Rhizobium phaseoli M3 Isolate Nodule
468 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
469 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
470 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
471 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
472 2936381700 Rhizobium chutanense C16 Isolate Unclassified
473 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
474 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
475 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
476 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
477 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
478 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
479 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
480 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
481 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
482 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
483 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
484 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
485 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
486 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
487 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
488 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
489 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
490 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
491 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
492 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
493 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
494 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
495 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
496 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
497 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
498 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
499 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
500 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
501 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
502 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
503 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
504 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
505 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
506 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
507 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
508 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
509 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
510 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
511 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
512 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
513 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
514 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
515 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
516 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
517 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
518 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
519 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
520 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
521 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
522 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
523 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
524 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
525 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
526 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
527 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
528 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
529 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
530 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
531 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
532 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
533 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
534 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
535 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
536 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
537 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
538 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
539 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
540 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
541 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
542 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
543 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
544 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
545 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
546 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
547 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
548 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
549 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
550 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
551 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
552 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
553 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
554 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
555 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
556 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
557 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
558 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
559 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
560 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
561 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
562 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
563 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
564 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
565 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
566 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
567 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
568 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
569 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
570 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
571 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
572 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
573 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
574 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
575 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
576 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
577 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
578 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
579 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
580 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
581 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
582 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
583 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
584 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
585 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
586 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
587 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
588 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
589 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
590 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
591 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
592 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
593 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
594 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
595 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
596 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
597 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
598 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
599 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
600 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
601 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
602 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
603 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
604 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
605 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
606 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
607 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
608 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
609 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
610 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
611 2996887358 Rhizobium sp. R711 Isolate Nodule
612 2996893221 Rhizobium sp. R635 Isolate Nodule
613 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
614 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
615 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
616 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
617 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
618 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
619 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
620 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
621 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
622 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
623 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
624 8005258706 Rhizobium sp. R693 Isolate Nodule
625 8005275841 Rhizobium sp. N4311 Isolate Nodule
626 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
627 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
628 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
629 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
630 8005321885 Rhizobium sp. R72 Isolate Nodule
631 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
632 8005382845 Rhizobium sp. R634 Isolate Nodule
633 8005395548 Rhizobium sp. R339 Isolate Nodule
634 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
635 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
636 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
637 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
638 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
639 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
640 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
641 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
642 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
643 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
644 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
645 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
646 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
647 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
648 8018176218 Rhizobium sp. N122 Isolate Nodule
649 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
650 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
651 8024501048 Rhizobium sp. H4 Isolate Nodule
652 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
653 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
654 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
655 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
656 8056382006 Rhizobium croatiense 13T Isolate Nodule
657 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.32
Metatranscriptomes 0.12
Isolates 61.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 18.25
Nodule 50.49
Rhizoplane 1.46
Rhizosphere 13.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1002299 3300003771 Bacteria 13036
2 JGI25158J39367_1000332 3300002739 Bacteria 10473
3 JGI25152J39213_1001295 3300002773 Bacteria 11199
4 JGI25152J39213_1002525 3300002773 Bacteria 6901
5 JGI25152J39213_1011787 3300002773 Bacteria 1913
6 JGI25150J39212_1000403 3300002774 Bacteria 20227
7 JGI25159J45721_1003404 3300002987 Bacteria 5630
8 JGI25151J46595_10000359 3300003187 Bacteria 48264
9 JGI25151J46595_10000832 3300003187 Bacteria 24601
10 JGI25151J46595_10034012 3300003187 Bacteria 1954
11 JGI25151J46595_10036071 3300003187 Bacteria 1869
12 JGI25153J46596_10003749 3300003215 Bacteria 8389
13 JGI25153J46596_10006477 3300003215 Bacteria 5907
14 rootH1_10022721 3300003316 Bacteria 3987
15 rootL2_10229085 3300003322 Bacteria 3774
16 rootH1_10026043 3300003323 Bacteria 1947
17 JGI25160J50197_1000028 3300003354 Bacteria 179309
18 JGI25160J50197_1000356 3300003354 Bacteria 30340
19 JGI25161J50226_1000220 3300003374 Bacteria 35319
20 JGI25161J50226_1000690 3300003374 Bacteria 13267
21 Ga0006562J51391_1068148 3300003578 Bacteria 2150
22 Ga0055526_1001673 3300003771 Bacteria 15550
23 Ga0055526_1001866 3300003771 Bacteria 14594
24 Ga0055526_1004248 3300003771 Bacteria 8683
25 Ga0055526_1013249 3300003771 Bacteria 3503
26 Ga0055524_1001455 3300003775 Bacteria 13533
27 Ga0055524_1005547 3300003775 Bacteria 5609
28 Ga0055524_1008073 3300003775 Bacteria 4402
29 Ga0055524_1012332 3300003775 Bacteria 3283
30 Ga0055524_1018245 3300003775 Bacteria 2443
31 Ga0055536_1002763 3300003781 Bacteria 9717
32 Ga0055528_1000113 3300003790 Bacteria 65323
33 Ga0055528_1001439 3300003790 Bacteria 14541
34 Ga0055528_1003016 3300003790 Bacteria 8695
35 Ga0055528_1003086 3300003790 Bacteria 8550
36 Ga0055528_1027356 3300003790 Bacteria 1608
37 Ga0055540_1000305 3300003792 Bacteria 43619
38 Ga0055540_1001030 3300003792 Bacteria 17854
39 Ga0055531_10006253 3300003794 Bacteria 6795
40 Ga0055531_10010845 3300003794 Bacteria 4476
41 Ga0058692_1000701 3300003856 Bacteria 13751
42 Ga0058692_1001140 3300003856 Bacteria 10309
43 Ga0055543_1000069 3300004625 Bacteria 94040
44 Ga0055543_1000081 3300004625 Bacteria 84575
45 Ga0055543_1000187 3300004625 Bacteria 50429
46 Ga0065165_1000061 3300005262 Bacteria 179347
47 Ga0065165_1007776 3300005262 Bacteria 5177
48 Ga0065165_1011154 3300005262 Bacteria 3787
49 Ga0065165_1015661 3300005262 Bacteria 2882
50 Ga0070669_100096831 3300005353 Bacteria 2220
51 Ga0070671_100032611 3300005355 Bacteria 4305
52 Ga0070667_100237693 3300005367 Bacteria 1626
53 Ga0070665_100002030 3300005548 Bacteria 22776
54 Ga0070665_100100468 3300005548 Bacteria 2897
55 Ga0070665_100146852 3300005548 Bacteria 2361
56 Ga0070665_100156353 3300005548 Bacteria 2282
57 Ga0075365_10000462 3300006038 Bacteria 15239
58 Ga0075368_10024181 3300006042 Bacteria 2325
59 Ga0075368_10027266 3300006042 Bacteria 2202
60 Ga0075364_10000011 3300006051 Bacteria 62606
61 Ga0075362_10003308 3300006177 Bacteria 5614
62 Ga0075367_10003224 3300006178 Bacteria 7712
63 Ga0075369_10010781 3300006186 Bacteria 3581
64 Ga0075369_10045182 3300006186 Bacteria 1893
65 Ga0075370_10029233 3300006353 Bacteria 3068
66 Ga0075370_10032138 3300006353 Bacteria 2932
67 Ga0079104_1000082 3300006946 Bacteria 137722
68 Ga0079104_1006410 3300006946 Bacteria 4460
69 Ga0079104_1012243 3300006946 Bacteria 2711
70 Ga0099826_10000676 3300006948 Bacteria 17684
71 Ga0099826_10014273 3300006948 Bacteria 5999
72 Ga0105243_10008491 3300009148 Bacteria 7884
73 Ga0105249_10136408 3300009553 Bacteria 2348
74 Ga0123341_1000017 3300009765 Bacteria 82963
75 Ga0123342_1011104 3300009766 Bacteria 10012
76 Ga0123342_1045413 3300009766 Bacteria 1452
77 Ga0157316_1002769 3300012510 Bacteria 1217
78 Ga0157373_10011886 3300013100 Bacteria 6395
79 Ga0157371_10000004 3300013102 Bacteria 512593
80 Ga0157371_10011990 3300013102 Bacteria 6645
81 Ga0157370_10001019 3300013104 Bacteria 35264
82 Ga0157369_10062769 3300013105 Bacteria 4003
83 Ga0214544_1000279 3300021320 Bacteria 85706
84 Ga0214542_1000014 3300021321 Bacteria 233825
85 Ga0214543_1000056 3300021327 Bacteria 134292
86 Ga0228711_1000011 3300022739 Bacteria 133208
87 Ga0228710_1000058 3300022740 Bacteria 83050
88 Ga0209436_100208 3300025208 Bacteria 27108
89 Ga0207425_1000621 3300025245 Bacteria 20281
90 Ga0207425_1000822 3300025245 Bacteria 15523
91 Ga0207425_1003797 3300025245 Bacteria 4716
92 Ga0209129_1000066 3300025258 Bacteria 226820
93 Ga0209129_1000141 3300025258 Bacteria 119150
94 Ga0209129_1000373 3300025258 Bacteria 36420
95 Ga0209129_1000963 3300025258 Bacteria 17298
96 Ga0209129_1003117 3300025258 Bacteria 7457
97 Ga0209129_1003764 3300025258 Bacteria 6390
98 Ga0209129_1004633 3300025258 Bacteria 5263
99 Ga0209673_1000024 3300025273 Bacteria 409632
100 Ga0209673_1000358 3300025273 Bacteria 82232
101 Ga0209673_1000526 3300025273 Bacteria 62641
102 Ga0209673_1001893 3300025273 Bacteria 16802
103 Ga0209673_1001900 3300025273 Bacteria 16769
104 Ga0209673_1005069 3300025273 Bacteria 6778
105 Ga0209673_1018877 3300025273 Bacteria 2492
106 Ga0209673_1023051 3300025273 Bacteria 2131
107 Ga0209130_1000002 3300025284 Bacteria 722648
108 Ga0209130_1000068 3300025284 Bacteria 179361
109 Ga0209130_1012504 3300025284 Bacteria 2217
110 Ga0209130_1017916 3300025284 Bacteria 1675
111 Ga0209675_1013033 3300025291 Bacteria 2634
112 Ga0209676_1000600 3300025292 Bacteria 53201
113 Ga0209025_1000144 3300025294 Bacteria 181446
114 Ga0209025_1000203 3300025294 Bacteria 145210
115 Ga0209025_1000274 3300025294 Bacteria 119322
116 Ga0209025_1000275 3300025294 Bacteria 119220
117 Ga0209025_1000436 3300025294 Bacteria 82202
118 Ga0209025_1001405 3300025294 Bacteria 31958
119 Ga0209025_1009405 3300025294 Bacteria 6815
120 Ga0209025_1011947 3300025294 Bacteria 5641
121 Ga0209025_1024304 3300025294 Bacteria 3131
122 Ga0209025_1039623 3300025294 Bacteria 2052
123 Ga0209564_1000081 3300025295 Bacteria 261592
124 Ga0209564_1000474 3300025295 Bacteria 67143
125 Ga0209564_1000486 3300025295 Bacteria 66011
126 Ga0209564_1001875 3300025295 Bacteria 18956
127 Ga0209564_1003601 3300025295 Bacteria 10318
128 Ga0209564_1008097 3300025295 Bacteria 5260
129 Ga0209564_1009234 3300025295 Bacteria 4725
130 Ga0209758_1000229 3300025297 Bacteria 119657
131 Ga0209758_1000466 3300025297 Bacteria 66920
132 Ga0209758_1000699 3300025297 Bacteria 49788
133 Ga0209758_1000753 3300025297 Bacteria 46946
134 Ga0209758_1002355 3300025297 Bacteria 19482
135 Ga0209758_1002879 3300025297 Bacteria 16654
136 Ga0209758_1003016 3300025297 Bacteria 16089
137 Ga0209050_1000815 3300025298 Bacteria 43516
138 Ga0209050_1005767 3300025298 Bacteria 7629
139 Ga0209050_1006134 3300025298 Bacteria 7241
140 Ga0209256_1000756 3300025299 Bacteria 42072
141 Ga0209256_1001194 3300025299 Bacteria 29088
142 Ga0209256_1002146 3300025299 Bacteria 17058
143 Ga0209256_1002539 3300025299 Bacteria 14617
144 Ga0209256_1003874 3300025299 Bacteria 9932
145 Ga0209256_1006903 3300025299 Bacteria 5813
146 Ga0209256_1007415 3300025299 Bacteria 5415
147 Ga0209256_1007754 3300025299 Bacteria 5194
148 Ga0207426_1000013 3300025302 Bacteria 721897
149 Ga0207426_1000142 3300025302 Bacteria 194023
150 Ga0207426_1000155 3300025302 Bacteria 179361
151 Ga0209051_1000170 3300025303 Bacteria 119026
152 Ga0209051_1000704 3300025303 Bacteria 36587
153 Ga0209051_1001758 3300025303 Bacteria 17210
154 Ga0209051_1002353 3300025303 Bacteria 13679
155 Ga0209051_1010177 3300025303 Bacteria 4782
156 Ga0209051_1030822 3300025303 Bacteria 2075
157 Ga0209257_1001648 3300025304 Bacteria 25481
158 Ga0209257_1003427 3300025304 Bacteria 13624
159 Ga0209257_1005376 3300025304 Bacteria 9040
160 Ga0207681_10081114 3300025923 Bacteria 2290
161 Ga0207712_10092573 3300025961 Bacteria 2229
162 Ga0207658_10209736 3300025986 Bacteria 1632
163 Ga0207639_10002007 3300026041 Bacteria 13718
164 Ga0207678_10065616 3300026067 Bacteria 3117
165 Ga0209281_1000043 3300027111 Bacteria 341543
166 Ga0209281_1000087 3300027111 Bacteria 246142
167 Ga0209281_1000188 3300027111 Bacteria 141823
168 Ga0209371_1000009 3300027312 Bacteria 963030
169 Ga0209371_1001705 3300027312 Bacteria 13931
170 Ga0209282_1000008 3300027666 Bacteria 248526
171 Ga0209282_1001362 3300027666 Bacteria 13351
172 Ga0209813_10013587 3300027866 Bacteria 2177
173 Ga0209813_10018614 3300027866 Bacteria 1921
174 Ga0268266_10008315 3300028379 Bacteria 9240
175 Ga0268266_10096273 3300028379 Bacteria 2601
176 Ga0307515_10001124 3300028794 Bacteria 61171
177 Ga0307515_10003222 3300028794 Bacteria 34542
178 Ga0307515_10012584 3300028794 Bacteria 15904
179 Ga0268256_1000010 3300030500 Bacteria 963034
180 Ga0268256_1001297 3300030500 Bacteria 15456
181 Ga0307513_10053854 3300031456 Bacteria 4320
182 Ga0307405_10000258 3300031731 Bacteria 19401
183 Ga0307406_10018696 3300031901 Bacteria 4053
184 Ga0307412_10098888 3300031911 Bacteria 2058
185 Ga0315914_1000011 3300031967 Bacteria 170175
186 Ga0307409_100173433 3300031995 Bacteria 1901
187 Ga0315913_1000008 3300033430 Bacteria 155397
188 Ga0315915_1000009 3300033464 Bacteria 252178
189 Ga0373927_0000147 3300035695 Bacteria 55399
190 Ga0373925_0033978 3300037068 Bacteria 3758
191 Ga0395900_0270195 3300037418 Bacteria 1695
192 Ga0395898_0148707 3300037466 Bacteria 2242
193 Ga0395901_0197816 3300038443 Bacteria 2107
194 Ga0451789_0533060 3300041443 Bacteria 1759
195 Ga0451837_0833251 3300041494 Bacteria 2093
196 Ga0451839_0590446 3300041496 Bacteria 3264
197 Ga0451841_0425635 3300041498 Bacteria 4398
198 Ga0451845_0860936 3300041501 Bacteria 1793
199 Ga0451855_0101514 3300041511 Bacteria 1741
200 Ga0439449_0020283 3300042007 Bacteria 2491
201 Ga0439462_0017433 3300042015 Bacteria 1860
202 Ga0450920_007311 3300042122 Bacteria 2000
203 Ga0495638_0011727 3300046460 Bacteria 6036
204 Ga0495605_0008697 3300046474 Bacteria 5733
205 Ga0495606_0044694 3300046507 Bacteria 2943
206 Ga0495606_0123599 3300046507 Bacteria 1546
207 Ga0495616_0025019 3300046513 Bacteria 3194
208 Ga0495620_0044205 3300046515 Bacteria 1936
209 Ga0495643_0003658 3300046522 Bacteria 11157
210 Ga0495643_0034400 3300046522 Bacteria 2797
211 Ga0495654_0001076 3300046530 Bacteria 19900
212 Ga0495633_0006558 3300046558 Bacteria 6878
213 Ga0495633_0057540 3300046558 Bacteria 1826
214 Ga0495668_0016704 3300046616 Bacteria 4267
215 Ga0495625_0021733 3300046660 Bacteria 4932
216 Ga0495625_0060450 3300046660 Bacteria 2684
217 Ga0495671_0136588 3300046692 Bacteria 1195
218 Ga0495649_0121593 3300046694 Bacteria 1380
219 Ga0495660_0007811 3300046810 Bacteria 6282
220 Ga0495672_0058954 3300047320 Bacteria 2223
221 Ga0495626_0029185 3300048091 Bacteria 2671
222 Ga0496106_0007791 3300048909 Bacteria 7925
223 Ga0496111_0006423 3300048914 Bacteria 7632
224 Ga0496113_0124273 3300048916 Bacteria 2020
225 Ga0496116_0005145 3300048919 Bacteria 12279
226 Ga0496116_0008908 3300048919 Bacteria 8631
227 Ga0496116_0073533 3300048919 Bacteria 2154
228 Ga0496117_0000002 3300048920 Bacteria 2483758
229 Ga0496117_0001643 3300048920 Bacteria 31420
230 Ga0496117_0056555 3300048920 Bacteria 2731
231 Ga0496117_0067272 3300048920 Bacteria 2425
232 Ga0496117_0110777 3300048920 Bacteria 1711
233 Ga0496118_0007536 3300048921 Bacteria 11494
234 Ga0496118_0020770 3300048921 Bacteria 5812
235 Ga0496118_0038970 3300048921 Bacteria 3800
236 Ga0496118_0115894 3300048921 Bacteria 1762
237 Ga0496119_0010621 3300048922 Bacteria 7722
238 Ga0496119_0084503 3300048922 Bacteria 1820
239 Ga0496119_0151061 3300048922 Bacteria 1244
240 Ga0496120_0000498 3300048923 Bacteria 61391
241 Ga0496120_0029057 3300048923 Bacteria 3379
242 Ga0496120_0055269 3300048923 Bacteria 2245
243 Ga0496121_0006050 3300048924 Bacteria 15233
244 Ga0496121_0009357 3300048924 Bacteria 11284
245 Ga0496121_0016894 3300048924 Bacteria 7501
246 Ga0496121_0067719 3300048924 Bacteria 2892
247 Ga0496122_0000001 3300048925 Bacteria 1827766
248 Ga0496122_0000018 3300048925 Bacteria 426350
249 Ga0496122_0000494 3300048925 Bacteria 81969
250 Ga0496122_0004730 3300048925 Bacteria 16701
251 Ga0496122_0008268 3300048925 Bacteria 11284
252 Ga0496122_0035476 3300048925 Bacteria 4056
253 Ga0496122_0055650 3300048925 Bacteria 2957
254 Ga0496123_0000001 3300048926 Bacteria 1831497
255 Ga0496123_0000015 3300048926 Bacteria 426088
256 Ga0496123_0000442 3300048926 Bacteria 74540
257 Ga0496123_0007919 3300048926 Bacteria 9868
258 Ga0496123_0030256 3300048926 Bacteria 3966
259 Ga0496123_0049004 3300048926 Bacteria 2836
260 Ga0496124_0003101 3300048927 Bacteria 20649
261 Ga0496124_0004061 3300048927 Bacteria 17351
262 Ga0496124_0005665 3300048927 Bacteria 13932
263 Ga0496124_0009679 3300048927 Bacteria 9868
264 Ga0496124_0123030 3300048927 Bacteria 2070
265 Ga0496124_0229344 3300048927 Bacteria 1389
266 Ga0496124_0267357 3300048927 Bacteria 1254
267 Ga0496125_0000422 3300048928 Bacteria 78615
268 Ga0496125_0005797 3300048928 Bacteria 13569
269 Ga0496125_0007258 3300048928 Bacteria 11808
270 Ga0496126_0000212 3300048929 Bacteria 128871
271 Ga0496126_0001831 3300048929 Bacteria 31033
272 Ga0496126_0044693 3300048929 Bacteria 4077
273 Ga0501031_0042144 3300049568 Bacteria 2980
274 Ga0501032_0059115 3300049569 Bacteria 2573
275 Ga0501032_0089020 3300049569 Bacteria 2049
276 Ga0501033_0034254 3300049570 Bacteria 3810
277 Ga0501033_0042342 3300049570 Bacteria 3395
278 Ga0501033_0196164 3300049570 Bacteria 1443
279 Ga0501034_0041736 3300049571 Bacteria 4642
280 Ga0501034_0046432 3300049571 Bacteria 4389
281 Ga0501034_0057991 3300049571 Bacteria 3892
282 Ga0501034_0071837 3300049571 Bacteria 3469
283 Ga0501034_0217980 3300049571 Bacteria 1861
284 Ga0501037_0081201 3300049573 Bacteria 2351
285 Ga0501039_0014548 3300049575 Bacteria 6025
286 Ga0501043_0059152 3300049579 Bacteria 3007
287 Ga0501043_0135206 3300049579 Bacteria 1931
288 Ga0501083_0033302 3300049744 Bacteria 3530
289 Ga0501035_0009122 3300049822 Bacteria 9222
290 Ga0501035_0039382 3300049822 Bacteria 4277
291 Ga0501035_0072146 3300049822 Bacteria 3057
292 Ga0501044_0067841 3300049823 Bacteria 3634
293 Ga0501044_0136156 3300049823 Bacteria 2447
294 nmdc:mga00v17_1172_c1 3300050491 Bacteria 13780
295 nmdc:mga00v17_71_c1 3300050491 Bacteria 60964
296 nmdc:mga0yw44_186_c1 3300050492 Bacteria 21913
297 nmdc:mga06z11_46921_c1 3300050494 Bacteria 2192
298 nmdc:mga04h51_22154_c1 3300050495 Bacteria 1919
299 nmdc:mga0sz30_293_c1 3300050516 Bacteria 19162
300 Ga0500644_0002086 3300053088 Bacteria 5076
301 Ga0500569_009868 3300053109 Bacteria 2230
302 Ga0500618_000459 3300053125 Bacteria 26538
303 Ga0500618_002274 3300053125 Bacteria 7424
304 Ga0500658_0000443 3300053134 Bacteria 17677
305 Ga0500561_0000160 3300053137 Bacteria 12684
306 Ga0500573_0001625 3300053140 Bacteria 10872
307 Ga0500604_0027430 3300053151 Bacteria 1647
308 Ga0500616_0004031 3300053153 Bacteria 10688
309 Ga0500616_0012953 3300053153 Bacteria 4859
310 Ga0500616_0016275 3300053153 Bacteria 4236
311 Ga0500622_0002146 3300053156 Bacteria 14643
312 Ga0500622_0007405 3300053156 Bacteria 6237
313 Ga0500624_000820 3300053157 Bacteria 7148
314 Ga0500633_0003427 3300053160 Bacteria 3459
315 Ga0500636_0000022 3300053177 Bacteria 93090
316 Ga0500636_0002909 3300053177 Bacteria 9591
317 2509109132 2508501122 Bacteria 6292184
318 2509377615 2509276019 Bacteria 6802256
319 2509389030 2509276021 Bacteria 7634384
320 2509444621 2509276033 Bacteria 7180565
321 2510135632 2510065019 Bacteria 6903379
322 2510303791 2510065057 Bacteria 6649661
323 2510897101 2510461076 Bacteria 8618824
324 2511172018 2510917026 Bacteria 7046020
325 2511185371 2510917028 Bacteria 6185411
326 2511194296 2510917030 Bacteria 7460662
327 2511498086 2511231052 Bacteria 6974333
328 2512529243 2512047086 Bacteria 6850303
329 2512969403 2512875026 Bacteria 6861065
330 2513570794 2513237084 Bacteria 7231967
331 2513574993 2513237085 Bacteria 7695351
332 2513583849 2513237086 Bacteria 7265287
333 2513595573 2513237088 Bacteria 6927906
334 2513604956 2513237089 Bacteria 6553624
335 2513617372 2513237091 Bacteria 6900273
336 2513633776 2513237093 Bacteria 7545552
337 2513707624 2513237103 Bacteria 7647401
338 2513865418 2513237138 Bacteria 7368160
339 2513882390 2513237140 Bacteria 7076289
340 2513906654 2513237143 Bacteria 6664116
341 2513910958 2513237144 Bacteria 7530820
342 2513924272 2513237146 Bacteria 7166346
343 2513983810 2513237156 Bacteria 6402557
344 2514006668 2513237160 Bacteria 6650282
345 2514023640 2513237162 Bacteria 7468464
346 2515114795 2515075009 Bacteria 7288508
347 2515612109 2515154107 Bacteria 6795637
348 2515635851 2515154113 Bacteria 7807172
349 2515641465 2515154114 Bacteria 7848616
350 2515659354 2515154116 Bacteria 7552979
351 2515741220 2515154134 Bacteria 7220242
352 2516896268 2516653046 Bacteria 6989037
353 2517038411 2516653077 Bacteria 7555578
354 2517078689 2516653085 Bacteria 7346596
355 2517097431 2517093000 Bacteria 7412387
356 2517408885 2517287029 Bacteria 6905599
357 2517565716 2517487022 Bacteria 7227575
358 2523467396 2523231067 Bacteria 5230452
359 2524449698 2524023207 Bacteria 6813453
360 2530648381 2529292951 Bacteria 6916614
361 2537877308 2537561587 Bacteria 5425293
362 2551676252 2551306084 Bacteria 8942552
363 2551685719 2551306085 Bacteria 7347181
364 2551696952 2551306086 Bacteria 6843938
365 2551697973 2551306087 Bacteria 7351905
366 2551709895 2551306089 Bacteria 7162724
367 2551720804 2551306090 Bacteria 7953713
368 2551724848 2551306091 Bacteria 7086830
369 2551735510 2551306092 Bacteria 6992595
370 2551742764 2551306093 Bacteria 7064773
371 2554246205 2554235003 Bacteria 5877155
372 2558865154 2558860100 Bacteria 8458965
373 2559293428 2558860242 Bacteria 5568029
374 2561469101 2558860983 Bacteria 4133860
375 2585166637 2582581283 Bacteria 6030556
376 2585201238 2582581294 Bacteria 6626667
377 2585223211 2582581298 Bacteria 7315509
378 2585230907 2582581299 Bacteria 6518058
379 2585256374 2582581304 Bacteria 5831370
380 2585267027 2582581306 Bacteria 6450535
381 2585388068 2582581865 Bacteria 6644329
382 2585396575 2582581866 Bacteria 6859583
383 2585399046 2582581867 Bacteria 7184437
384 2585523996 2585427526 Bacteria 7258840
385 2585542154 2585427528 Bacteria 6842387
386 2585546193 2585427529 Bacteria 7395659
387 2585818833 2585427590 Bacteria 6824633
388 2585840650 2585427593 Bacteria 7141551
389 2585843739 2585427594 Bacteria 6180594
390 2585998383 2585427633 Bacteria 6413184
391 2586002945 2585427634 Bacteria 6455027
392 2599335778 2599185156 Bacteria 5403036
393 2599419772 2599185170 Bacteria 7295545
394 2599604311 2599185210 Bacteria 5624189
395 2599718619 2599185236 Bacteria 6875203
396 2600193016 2599185352 Bacteria 7228948
397 2600376779 2600254933 Bacteria 4750527
398 2601609553 2600255279 Bacteria 5605316
399 2601746328 2600255308 Bacteria 5611129
400 2616293997 2615840624 Bacteria 6557588
401 2643777946 2643221551 Bacteria 3750538
402 2643796394 2643221555 Bacteria 3749717
403 2643812471 2643221558 Bacteria 5460675
404 2643814338 2643221558 Bacteria 5460675
405 2643857564 2643221568 Bacteria 5187270
406 2643920584 2643221582 Bacteria 5804683
407 2644052307 2643221607 Bacteria 6314006
408 2644191256 2643221634 Bacteria 6705461
409 2644201310 2643221636 Bacteria 6583769
410 2644209536 2643221637 Bacteria 5345260
411 2644237624 2643221643 Bacteria 5749658
412 2644484585 2643221686 Bacteria 6310811
413 2644495005 2643221688 Bacteria 5260751
414 2644499373 2643221689 Bacteria 6042950
415 2644519606 2643221693 Bacteria 5513853
416 2644653064 2643221718 Bacteria 5345506
417 2644672858 2643221723 Bacteria 7095460
418 2692318703 2690316117 Bacteria 6800650
419 2719183296 2718217882 Bacteria 6556348
420 2719388054 2718217927 Bacteria 6972593
421 2719667677 2718217997 Bacteria 6740740
422 2719734013 2718218009 Bacteria 6478651
423 2720494097 2718218199 Bacteria 6740745
424 2720615561 2718218232 Bacteria 6720332
425 2720622344 2718218233 Bacteria 6662049
426 2720633698 2718218235 Bacteria 6630699
427 2720777398 2718218269 Bacteria 6906114
428 2721149408 2718218363 Bacteria 6524337
429 2721160811 2718218365 Bacteria 6274507
430 2721166245 2718218366 Bacteria 6425255
431 2721401687 2718218423 Bacteria 6438183
432 2722842415 2721755514 Bacteria 6424414
433 2723028995 2721755556 Bacteria 6745503
434 2723562611 2721755684 Bacteria 6859907
435 2723569305 2721755685 Bacteria 6704835
436 2724040501 2721755809 Bacteria 6438790
437 2724046769 2721755810 Bacteria 6479005
438 2724092005 2721755819 Bacteria 6906405
439 2724106570 2721755822 Bacteria 6726041
440 2724112377 2721755823 Bacteria 6752556
441 2725949737 2724679232 Bacteria 7646494
442 2730109931 2728369352 Bacteria 6745171
443 2730166531 2728369365 Bacteria 6555560
444 2730300443 2728369397 Bacteria 6274511
445 2738946738 2738541317 Bacteria 5340176
446 2739037389 2738541333 Bacteria 7106503
447 2753458009 2751185821 Bacteria 6189929
448 2766067199 2765235942 Bacteria 7445910
449 2776915929 2775507049 Bacteria 6284736
450 2792619647 2791355091 Bacteria 6135441
451 2792627419 2791355092 Bacteria 6248105
452 2792639685 2791355094 Bacteria 7011481
453 2793283580 2791355253 Bacteria 5171699
454 2793298422 2791355256 Bacteria 6798008
455 2793315737 2791355259 Bacteria 7254731
456 2793323520 2791355260 Bacteria 6598818
457 2793327533 2791355261 Bacteria 6661293
458 2793335604 2791355262 Bacteria 6774204
459 2793340998 2791355263 Bacteria 6872478
460 2793350323 2791355264 Bacteria 6429314
461 2793354732 2791355265 Bacteria 6539969
462 2793358571 2791355266 Bacteria 7116587
463 2793369022 2791355267 Bacteria 7222458
464 2802720625 2802428858 Bacteria 6636079
465 2802726604 2802428859 Bacteria 6667919
466 2802732652 2802428860 Bacteria 6525526
467 2802739773 2802428861 Bacteria 6534206
468 2802746136 2802428862 Bacteria 6633353
469 2802748749 2802428863 Bacteria 6410669
470 2805928947 2802429605 Bacteria 6875453
471 2805934568 2802429606 Bacteria 6346811
472 2806047116 2802429633 Bacteria 7341974
473 2806054885 2802429634 Bacteria 7083200
474 2806061887 2802429635 Bacteria 7650140
475 2806069590 2802429636 Bacteria 7597525
476 2806076039 2802429637 Bacteria 7067217
477 2808986802 2808606387 Bacteria 5697198
478 2819556875 2818991439 Bacteria 6907412
479 2819685782 2818991461 Bacteria 7026071
480 2821123172 2821123053 Bacteria 7836056
481 2838020904 2838016132 Bacteria 6577831
482 2838026809 2838022645 Bacteria 6494267
483 2838039697 2838035591 Bacteria 7166484
484 2838044894 2838042994 Bacteria 6046894
485 2838052947 2838048938 Bacteria 6044578
486 2838064740 2838061910 Bacteria 6794874
487 2838070484 2838068647 Bacteria 6208656
488 2838663973 2838661181 Bacteria 7385261
489 2838672572 2838668709 Bacteria 6671819
490 2838677612 2838675328 Bacteria 4909118
491 2838685547 2838680041 Bacteria 6545511
492 2838689878 2838686498 Bacteria 7807632
493 2838695997 2838694306 Bacteria 6853137
494 2838705105 2838701080 Bacteria 6669771
495 2838713396 2838707686 Bacteria 6619912
496 2838716501 2838714209 Bacteria 5525906
497 2838719699 2838719591 Bacteria 5523910
498 2838727252 2838724970 Bacteria 4908691
499 2838731426 2838729681 Bacteria 7400765
500 2838739804 2838736955 Bacteria 5760694
501 2838744367 2838742623 Bacteria 7396178
502 2841844072 2841840854 Bacteria 5761912
503 2841846630 2841846520 Bacteria 5345850
504 2841852907 2841851746 Bacteria 7532261
505 2841860840 2841859092 Bacteria 5436171
506 2841870247 2841864319 Bacteria 6742987
507 2842082630 2842077413 Bacteria 6508645
508 2842112786 2842110456 Bacteria 7656360
509 2842123811 2842118031 Bacteria 7033875
510 2842127341 2842124991 Bacteria 5346824
511 2842132505 2842130223 Bacteria 4909145
512 2842143793 2842140634 Bacteria 5759631
513 2842150099 2842146304 Bacteria 5957337
514 2842152326 2842152218 Bacteria 4908957
515 2842160234 2842156927 Bacteria 6894975
516 2842165788 2842163707 Bacteria 6916235
517 2842172746 2842170452 Bacteria 5525737
518 2842175945 2842175837 Bacteria 4908771
519 2842184100 2842180545 Bacteria 6888678
520 2842189608 2842187318 Bacteria 5524014
521 2842196405 2842192696 Bacteria 6147454
522 2842202474 2842198810 Bacteria 6608673
523 2842208870 2842205361 Bacteria 6340321
524 2842213922 2842211629 Bacteria 5523832
525 2842219464 2842217011 Bacteria 7497767
526 2842224460 2842224351 Bacteria 5524473
527 2842231682 2842229732 Bacteria 7475766
528 2842242866 2842237096 Bacteria 6620661
529 2842245849 2842243621 Bacteria 7421798
530 2842254785 2842250916 Bacteria 6579627
531 2842260227 2842257432 Bacteria 7401195
532 2842267114 2842264693 Bacteria 6472963
533 2842273638 2842271015 Bacteria 7807131
534 2842282440 2842278818 Bacteria 6340002
535 2842290022 2842285085 Bacteria 6011953
536 2842296939 2842291075 Bacteria 7076806
537 2842308510 2842304105 Bacteria 7023636
538 2842312186 2842311132 Bacteria 6616990
539 2842321779 2842317721 Bacteria 6793725
540 2842344693 2842341865 Bacteria 7003929
541 2842367732 2842363717 Bacteria 6844742
542 2842376067 2842370503 Bacteria 7038661
543 2842383277 2842377471 Bacteria 7140707
544 2842390410 2842384541 Bacteria 7057858
545 2842397879 2842395702 Bacteria 6780583
546 2842407631 2842402390 Bacteria 6681310
547 2842414262 2842409023 Bacteria 6687331
548 2842420878 2842415677 Bacteria 6596907
549 2842424098 2842422224 Bacteria 6239196
550 2842431190 2842428310 Bacteria 6767288
551 2842437525 2842434925 Bacteria 6502746
552 2842444340 2842441272 Bacteria 6769273
553 2842451234 2842447887 Bacteria 6754142
554 2842465333 2842462802 Bacteria 6588055
555 2842472198 2842469257 Bacteria 6752936
556 2842494067 2842489311 Bacteria 6620893
557 2842501286 2842495871 Bacteria 6820686
558 2842517625 2842515876 Bacteria 5436280
559 2842926434 2842922631 Bacteria 5824079
560 2844456626 2844454524 Bacteria 7952546
561 2847422800 2847417321 Bacteria 6913799
562 2848997793 2848992105 Bacteria 6810864
563 2850084867 2850079185 Bacteria 6848280
564 2854900898 2854896431 Bacteria 5869725
565 2854918923 2854916844 Bacteria 5725939
566 2855828906 2855825444 Bacteria 6785811
567 2855844028 2855839649 Bacteria 7135830
568 2855872696 2855872281 Bacteria 6964271
569 2857520922 2857516855 Bacteria 7787325
570 2857533876 2857531043 Bacteria 6754041
571 2858806728 2858800743 Bacteria 6603254
572 2891375598 2891373044 Bacteria 5202277
573 2894822130 2894817345 Bacteria 4892941
574 2896389490 2896384573 Bacteria 7700774
575 2899794334 2899792073 Bacteria 4926588
576 2899808277 2899803654 Bacteria 5577784
577 2899845716 2899845264 Bacteria 5672268
578 2913296933 2913295892 Bacteria 6333755
579 2913311904 2913308742 Bacteria 5350706
580 2915982009 2915980308 Bacteria 6624279
581 2915990523 2915986958 Bacteria 6739310
582 2915994684 2915993759 Bacteria 7016183
583 2916004016 2916000859 Bacteria 6865702
584 2916014532 2916007675 Bacteria 6898660
585 2916016236 2916014648 Bacteria 6946486
586 2916022761 2916021584 Bacteria 6854472
587 2916031696 2916028427 Bacteria 6748433
588 2916036094 2916035215 Bacteria 6755766
589 2916044474 2916041962 Bacteria 6820487
590 2916053504 2916048683 Bacteria 6543552
591 2916061234 2916055098 Bacteria 6758838
592 2916065419 2916061851 Bacteria 6737736
593 2916075929 2916068649 Bacteria 6943657
594 2916080812 2916076590 Bacteria 6596108
595 2919101910 2919100787 Bacteria 7710546
596 2919116718 2919114240 Bacteria 5700270
597 2919166450 2919166419 Bacteria 4952238
598 2919172524 2919171160 Bacteria 6499771
599 2920765203 2920760137 Bacteria 7427611
600 2921207444 2921201388 Bacteria 6926299
601 2921213496 2921208531 Bacteria 6745326
602 2921237686 2921237296 Bacteria 6876710
603 2921249404 2921244191 Bacteria 6568419
604 2921251854 2921250672 Bacteria 6677771
605 2921262240 2921257292 Bacteria 6808382
606 2921265683 2921263974 Bacteria 6864552
607 2921282429 2921282425 Bacteria 6826397
608 2921290790 2921289301 Bacteria 7316391
609 2921301303 2921296804 Bacteria 7176999
610 2923556227 2923556063 Bacteria 6793593
611 2924145924 2924144063 Bacteria 6883928
612 2924157541 2924150972 Bacteria 7169444
613 2924159667 2924158325 Bacteria 7188855
614 2924170203 2924165586 Bacteria 7260590
615 2924178151 2924172951 Bacteria 6749356
616 2924185669 2924179722 Bacteria 6843264
617 2924190571 2924186466 Bacteria 6876637
618 2924199544 2924193448 Bacteria 6955718
619 2924205093 2924200457 Bacteria 6757188
620 2924208409 2924207177 Bacteria 6917007
621 2924217705 2924214083 Bacteria 7080103
622 2924226670 2924221636 Bacteria 7113495
623 2924229133 2924228884 Bacteria 6633132
624 2926754727 2926754445 Bacteria 5964435
625 2926761894 2926760298 Bacteria 5505990
626 2933006973 2933006813 Bacteria 4912075
627 2933015436 2933011516 Bacteria 5439334
628 2933574959 2933570622 Bacteria 7023390
629 2933588325 2933586486 Bacteria 7667493
630 2933594176 2933594066 Bacteria 5594265
631 2933601289 2933599457 Bacteria 5858799
632 2935900015 2935894831 Bacteria 6620579
633 2935902287 2935901341 Bacteria 7341747
634 2936369579 2936367885 Bacteria 7324495
635 2936380319 2936375103 Bacteria 6652732
636 2936385222 2936381700 Bacteria 7006523
637 2937002037 2936996657 Bacteria 6298727
638 2937008087 2937002841 Bacteria 6934057
639 2937015804 2937009748 Bacteria 6746052
640 2937022607 2937016420 Bacteria 6782579
641 2937024247 2937023124 Bacteria 6815156
642 2937031450 2937029754 Bacteria 6424026
643 2937040111 2937036028 Bacteria 6846469
644 2937046036 2937042894 Bacteria 6741576
645 2937051341 2937049772 Bacteria 6757901
646 2937059936 2937056579 Bacteria 7107896
647 2937069316 2937063883 Bacteria 7199456
648 2937074023 2937071275 Bacteria 6984483
649 2937083496 2937078374 Bacteria 6610289
650 2937087154 2937084907 Bacteria 6618516
651 2937096645 2937091812 Bacteria 6979387
652 2937105248 2937098957 Bacteria 7249374
653 2937112156 2937106411 Bacteria 6947143
654 2937114440 2937113482 Bacteria 6505872
655 2937122827 2937119839 Bacteria 6597547
656 2937129997 2937126314 Bacteria 6771275
657 2957379232 2957375807 Bacteria 6425588
658 2957384140 2957382221 Bacteria 6737050
659 2957390473 2957388812 Bacteria 6778072
660 2957401056 2957395598 Bacteria 6822399
661 2957408079 2957402308 Bacteria 6741770
662 2957409815 2957408893 Bacteria 6558585
663 2957420686 2957415311 Bacteria 6991633
664 2957427803 2957422303 Bacteria 7172205
665 2957436089 2957430029 Bacteria 7022557
666 2957441311 2957437181 Bacteria 6568994
667 2957448758 2957443900 Bacteria 6869977
668 2957452480 2957450854 Bacteria 6765715
669 2957462862 2957457609 Bacteria 6967680
670 2957467483 2957464669 Bacteria 6568877
671 2957475747 2957471148 Bacteria 6797643
672 2957484625 2957478035 Bacteria 6756658
673 2957488178 2957484790 Bacteria 6703082
674 2957497443 2957491536 Bacteria 6695180
675 2957501608 2957498199 Bacteria 7126688
676 2957512774 2957505466 Bacteria 7253085
677 2960587042 2960584000 Bacteria 6864594
678 2960594283 2960591022 Bacteria 6622873
679 2960598542 2960597568 Bacteria 6550735
680 2960605854 2960603979 Bacteria 6898737
681 2960615397 2960610863 Bacteria 6691244
682 2960622875 2960617483 Bacteria 6727748
683 2960630495 2960624210 Bacteria 6875384
684 2960632454 2960631154 Bacteria 6732508
685 2960641850 2960637947 Bacteria 7296468
686 2960648155 2960645483 Bacteria 7211087
687 2960653909 2960652885 Bacteria 7083688
688 2960664704 2960660292 Bacteria 7041660
689 2960667867 2960667422 Bacteria 6763020
690 2960674855 2960674078 Bacteria 6609048
691 2960682074 2960680706 Bacteria 6624464
692 2960687959 2960687367 Bacteria 6535474
693 2960700202 2960693952 Bacteria 6749742
694 2964613229 2964607997 Bacteria 7101408
695 2964616041 2964615318 Bacteria 6809089
696 2964624987 2964621998 Bacteria 6834995
697 2964632318 2964628898 Bacteria 7083044
698 2964637155 2964636051 Bacteria 7091832
699 2964648380 2964643177 Bacteria 6820887
700 2964656118 2964649959 Bacteria 6675118
701 2964659104 2964656573 Bacteria 7100150
702 2964670570 2964663802 Bacteria 7019362
703 2964673438 2964670856 Bacteria 6851364
704 2964681058 2964678106 Bacteria 6792020
705 2964688337 2964685014 Bacteria 6839111
706 2964697190 2964691889 Bacteria 6802758
707 2964702743 2964698721 Bacteria 6765331
708 2964709552 2964705432 Bacteria 7114648
709 2964713876 2964712639 Bacteria 6695970
710 2964721456 2964719344 Bacteria 7286602
711 2967667290 2967664464 Bacteria 6948836
712 2967674001 2967671571 Bacteria 7021409
713 2967682479 2967678726 Bacteria 7264382
714 2967692794 2967686174 Bacteria 6678622
715 2967693804 2967693043 Bacteria 6804451
716 2967703158 2967699805 Bacteria 6854538
717 2967711042 2967706974 Bacteria 7186053
718 2967715460 2967714385 Bacteria 7000047
719 2967724558 2967721400 Bacteria 7073753
720 2967731203 2967728569 Bacteria 6641507
721 2967736148 2967735183 Bacteria 6827012
722 2967742281 2967742019 Bacteria 6794534
723 2967751229 2967748971 Bacteria 6733771
724 2967762185 2967755722 Bacteria 6814706
725 2967768341 2967762386 Bacteria 6923502
726 2967775361 2967769361 Bacteria 6587838
727 2967777885 2967775926 Bacteria 6738189
728 2970023016 2970019648 Bacteria 7072033
729 2970033503 2970026789 Bacteria 6785236
730 2970038001 2970033650 Bacteria 7118744
731 2970042304 2970040964 Bacteria 6731123
732 2970049250 2970047711 Bacteria 7088379
733 2970055387 2970054988 Bacteria 6611507
734 2970062133 2970061556 Bacteria 7099761
735 2970074716 2970068827 Bacteria 7123112
736 2970080584 2970076120 Bacteria 6697332
737 2970088767 2970082768 Bacteria 6183754
738 2970093866 2970088815 Bacteria 6933825
739 2970100419 2970095765 Bacteria 6936963
740 2970103641 2970102677 Bacteria 6812532
741 2970114611 2970109326 Bacteria 6863976
742 2970116640 2970116247 Bacteria 6501857
743 2970127198 2970122695 Bacteria 6625855
744 2970130603 2970129317 Bacteria 6806560
745 2970140120 2970136068 Bacteria 7207982
746 2970145906 2970143518 Bacteria 6446480
747 2970155070 2970149975 Bacteria 6779706
748 2970160992 2970156795 Bacteria 7168044
749 2970165848 2970164137 Bacteria 6861252
750 2970177520 2970170962 Bacteria 6876229
751 2970183520 2970177841 Bacteria 6768001
752 2970189760 2970184632 Bacteria 7054431
753 2970192067 2970191845 Bacteria 7032787
754 2977518544 2977516862 Bacteria 6940108
755 2977530638 2977523885 Bacteria 6960446
756 2977533228 2977530762 Bacteria 6951399
757 2977538855 2977537788 Bacteria 6929320
758 2977551507 2977544691 Bacteria 6875412
759 2977552432 2977551784 Bacteria 7125765
760 2977563790 2977558990 Bacteria 6863948
761 2977570664 2977565890 Bacteria 6901543
762 2977579413 2977572785 Bacteria 6763888
763 2977580957 2977579622 Bacteria 6772100
764 2978972842 2978969890 Bacteria 5400756
765 2979092839 2979089926 Bacteria 5670289
766 2979099772 2979095461 Bacteria 5669583
767 2979104810 2979100975 Bacteria 5423623
768 2984513390 2984509177 Bacteria 5274802
769 2984520241 2984518228 Bacteria 5277463
770 2984539537 2984537506 Bacteria 5277481
771 2984591095 2984587000 Bacteria 5263363
772 2984601765 2984601300 Bacteria 5455244
773 2989772832 2989771324 Bacteria 5605128
774 2989780866 2989776772 Bacteria 4843317
775 2996888015 2996887358 Bacteria 5795980
776 2996897562 2996893221 Bacteria 5823108
777 3005410592 3005409236 Bacteria 7188837
778 3005450023 3005445848 Bacteria 6906074
779 3005456401 3005452660 Bacteria 5889319
780 639646030 639633055 Bacteria 7751309
781 643823185 643692032 Bacteria 6891900
782 648737638 648276728 Bacteria 6968865
783 650738664 650716007 Bacteria 5573770
784 8003572209 8003570095 Bacteria 5747666
785 8003996601 8003992118 Bacteria 7266902
786 8004004199 8003999396 Bacteria 7063185
787 8005250549 8005246636 Bacteria 4933972
788 8005261420 8005258706 Bacteria 6184835
789 8005278256 8005275841 Bacteria 6929066
790 8005282709 8005282627 Bacteria 6675747
791 8005291681 8005289223 Bacteria 6634003
792 8005305443 8005301065 Bacteria 6614431
793 8005310217 8005307578 Bacteria 7395396
794 8005322542 8005321885 Bacteria 5795980
795 8005378136 8005376324 Bacteria 6590079
796 8005384144 8005382845 Bacteria 6732062
797 8005399578 8005395548 Bacteria 6806915
798 8005433831 8005430974 Bacteria 6689030
799 8005465491 8005460587 Bacteria 7157962
800 8005498074 8005497431 Bacteria 6477605
801 8005559939 8005556819 Bacteria 6908598
802 8005564565 8005563573 Bacteria 7153261
803 8005571251 8005570704 Bacteria 6957481
804 8005619283 8005619151 Bacteria 7030230
805 8005627848 8005626139 Bacteria 6534237
806 8005669482 8005668836 Bacteria 6953162
807 8005692805 8005688590 Bacteria 6610080
808 8005701507 8005695170 Bacteria 6912330
809 8018132501 8018127388 Bacteria 7351159
810 8018153653 8018150411 Bacteria 5549903
811 8018153886 8018150411 Bacteria 5549903
812 8018167643 8018163183 Bacteria 7277977
813 8018176656 8018176218 Bacteria 6896178
814 8023681307 8023680758 Bacteria 7729763
815 8024481862 8024479707 Bacteria 6954785
816 8024506298 8024501048 Bacteria 6427847
817 8046768733 8046767195 Bacteria 7547379
818 8054460970 8054460903 Bacteria 4872905
819 8054561192 8054558443 Bacteria 5204801
820 8056381225 8056375014 Bacteria 7006639
821 8056382717 8056382006 Bacteria 6408074
822 8057877155 8057874678 Bacteria 7494653
823 Ga0055526_1002299
824 JGI25158J39367_1000332
825 JGI25152J39213_1001295
826 JGI25152J39213_1002525
827 JGI25152J39213_1011787
828 JGI25150J39212_1000403
829 JGI25159J45721_1003404
830 JGI25151J46595_10000359
831 JGI25151J46595_10000832
832 JGI25151J46595_10034012
833 JGI25151J46595_10036071
834 JGI25153J46596_10003749
835 JGI25153J46596_10006477
836 rootH1_10022721
837 rootL2_10229085
838 rootH1_10026043
839 JGI25160J50197_1000028
840 JGI25160J50197_1000356
841 JGI25161J50226_1000220
842 JGI25161J50226_1000690
843 Ga0006562J51391_1068148
844 Ga0055526_1001673
845 Ga0055526_1001866
846 Ga0055526_1004248
847 Ga0055526_1013249
848 Ga0055524_1001455
849 Ga0055524_1005547
850 Ga0055524_1008073
851 Ga0055524_1012332
852 Ga0055524_1018245
853 Ga0055536_1002763
854 Ga0055528_1000113
855 Ga0055528_1001439
856 Ga0055528_1003016
857 Ga0055528_1003086
858 Ga0055528_1027356
859 Ga0055540_1000305
860 Ga0055540_1001030
861 Ga0055531_10006253
862 Ga0055531_10010845
863 Ga0058692_1000701
864 Ga0058692_1001140
865 Ga0055543_1000069
866 Ga0055543_1000081
867 Ga0055543_1000187
868 Ga0065165_1000061
869 Ga0065165_1007776
870 Ga0065165_1011154
871 Ga0065165_1015661
872 Ga0070669_100096831
873 Ga0070671_100032611
874 Ga0070667_100237693
875 Ga0070665_100002030
876 Ga0070665_100100468
877 Ga0070665_100146852
878 Ga0070665_100156353
879 Ga0075365_10000462
880 Ga0075368_10024181
881 Ga0075368_10027266
882 Ga0075364_10000011
883 Ga0075362_10003308
884 Ga0075367_10003224
885 Ga0075369_10010781
886 Ga0075369_10045182
887 Ga0075370_10029233
888 Ga0075370_10032138
889 Ga0079104_1000082
890 Ga0079104_1006410
891 Ga0079104_1012243
892 Ga0099826_10000676
893 Ga0099826_10014273
894 Ga0105243_10008491
895 Ga0105249_10136408
896 Ga0123341_1000017
897 Ga0123342_1011104
898 Ga0123342_1045413
899 Ga0157316_1002769
900 Ga0157373_10011886
901 Ga0157371_10000004
902 Ga0157371_10011990
903 Ga0157370_10001019
904 Ga0157369_10062769
905 Ga0214544_1000279
906 Ga0214542_1000014
907 Ga0214543_1000056
908 Ga0228711_1000011
909 Ga0228710_1000058
910 Ga0209436_100208
911 Ga0207425_1000621
912 Ga0207425_1000822
913 Ga0207425_1003797
914 Ga0209129_1000066
915 Ga0209129_1000141
916 Ga0209129_1000373
917 Ga0209129_1000963
918 Ga0209129_1003117
919 Ga0209129_1003764
920 Ga0209129_1004633
921 Ga0209673_1000024
922 Ga0209673_1000358
923 Ga0209673_1000526
924 Ga0209673_1001893
925 Ga0209673_1001900
926 Ga0209673_1005069
927 Ga0209673_1018877
928 Ga0209673_1023051
929 Ga0209130_1000002
930 Ga0209130_1000068
931 Ga0209130_1012504
932 Ga0209130_1017916
933 Ga0209675_1013033
934 Ga0209676_1000600
935 Ga0209025_1000144
936 Ga0209025_1000203
937 Ga0209025_1000274
938 Ga0209025_1000275
939 Ga0209025_1000436
940 Ga0209025_1001405
941 Ga0209025_1009405
942 Ga0209025_1011947
943 Ga0209025_1024304
944 Ga0209025_1039623
945 Ga0209564_1000081
946 Ga0209564_1000474
947 Ga0209564_1000486
948 Ga0209564_1001875
949 Ga0209564_1003601
950 Ga0209564_1008097
951 Ga0209564_1009234
952 Ga0209758_1000229
953 Ga0209758_1000466
954 Ga0209758_1000699
955 Ga0209758_1000753
956 Ga0209758_1002355
957 Ga0209758_1002879
958 Ga0209758_1003016
959 Ga0209050_1000815
960 Ga0209050_1005767
961 Ga0209050_1006134
962 Ga0209256_1000756
963 Ga0209256_1001194
964 Ga0209256_1002146
965 Ga0209256_1002539
966 Ga0209256_1003874
967 Ga0209256_1006903
968 Ga0209256_1007415
969 Ga0209256_1007754
970 Ga0207426_1000013
971 Ga0207426_1000142
972 Ga0207426_1000155
973 Ga0209051_1000170
974 Ga0209051_1000704
975 Ga0209051_1001758
976 Ga0209051_1002353
977 Ga0209051_1010177
978 Ga0209051_1030822
979 Ga0209257_1001648
980 Ga0209257_1003427
981 Ga0209257_1005376
982 Ga0207681_10081114
983 Ga0207712_10092573
984 Ga0207658_10209736
985 Ga0207639_10002007
986 Ga0207678_10065616
987 Ga0209281_1000043
988 Ga0209281_1000087
989 Ga0209281_1000188
990 Ga0209371_1000009
991 Ga0209371_1001705
992 Ga0209282_1000008
993 Ga0209282_1001362
994 Ga0209813_10013587
995 Ga0209813_10018614
996 Ga0268266_10008315
997 Ga0268266_10096273
998 Ga0307515_10001124
999 Ga0307515_10003222
1000 Ga0307515_10012584
1001 Ga0268256_1000010
1002 Ga0268256_1001297
1003 Ga0307513_10053854
1004 Ga0307405_10000258
1005 Ga0307406_10018696
1006 Ga0307412_10098888
1007 Ga0315914_1000011
1008 Ga0307409_100173433
1009 Ga0315913_1000008
1010 Ga0315915_1000009
1011 Ga0373927_0000147
1012 Ga0373925_0033978
1013 Ga0395900_0270195
1014 Ga0395898_0148707
1015 Ga0395901_0197816
1016 Ga0451789_0533060
1017 Ga0451837_0833251
1018 Ga0451839_0590446
1019 Ga0451841_0425635
1020 Ga0451845_0860936
1021 Ga0451855_0101514
1022 Ga0439449_0020283
1023 Ga0439462_0017433
1024 Ga0450920_007311
1025 Ga0495638_0011727
1026 Ga0495605_0008697
1027 Ga0495606_0044694
1028 Ga0495606_0123599
1029 Ga0495616_0025019
1030 Ga0495620_0044205
1031 Ga0495643_0003658
1032 Ga0495643_0034400
1033 Ga0495654_0001076
1034 Ga0495633_0006558
1035 Ga0495633_0057540
1036 Ga0495668_0016704
1037 Ga0495625_0021733
1038 Ga0495625_0060450
1039 Ga0495671_0136588
1040 Ga0495649_0121593
1041 Ga0495660_0007811
1042 Ga0495672_0058954
1043 Ga0495626_0029185
1044 Ga0496106_0007791
1045 Ga0496111_0006423
1046 Ga0496113_0124273
1047 Ga0496116_0005145
1048 Ga0496116_0008908
1049 Ga0496116_0073533
1050 Ga0496117_0000002
1051 Ga0496117_0001643
1052 Ga0496117_0056555
1053 Ga0496117_0067272
1054 Ga0496117_0110777
1055 Ga0496118_0007536
1056 Ga0496118_0020770
1057 Ga0496118_0038970
1058 Ga0496118_0115894
1059 Ga0496119_0010621
1060 Ga0496119_0084503
1061 Ga0496119_0151061
1062 Ga0496120_0000498
1063 Ga0496120_0029057
1064 Ga0496120_0055269
1065 Ga0496121_0006050
1066 Ga0496121_0009357
1067 Ga0496121_0016894
1068 Ga0496121_0067719
1069 Ga0496122_0000001
1070 Ga0496122_0000018
1071 Ga0496122_0000494
1072 Ga0496122_0004730
1073 Ga0496122_0008268
1074 Ga0496122_0035476
1075 Ga0496122_0055650
1076 Ga0496123_0000001
1077 Ga0496123_0000015
1078 Ga0496123_0000442
1079 Ga0496123_0007919
1080 Ga0496123_0030256
1081 Ga0496123_0049004
1082 Ga0496124_0003101
1083 Ga0496124_0004061
1084 Ga0496124_0005665
1085 Ga0496124_0009679
1086 Ga0496124_0123030
1087 Ga0496124_0229344
1088 Ga0496124_0267357
1089 Ga0496125_0000422
1090 Ga0496125_0005797
1091 Ga0496125_0007258
1092 Ga0496126_0000212
1093 Ga0496126_0001831
1094 Ga0496126_0044693
1095 Ga0501031_0042144
1096 Ga0501032_0059115
1097 Ga0501032_0089020
1098 Ga0501033_0034254
1099 Ga0501033_0042342
1100 Ga0501033_0196164
1101 Ga0501034_0041736
1102 Ga0501034_0046432
1103 Ga0501034_0057991
1104 Ga0501034_0071837
1105 Ga0501034_0217980
1106 Ga0501037_0081201
1107 Ga0501039_0014548
1108 Ga0501043_0059152
1109 Ga0501043_0135206
1110 Ga0501083_0033302
1111 Ga0501035_0009122
1112 Ga0501035_0039382
1113 Ga0501035_0072146
1114 Ga0501044_0067841
1115 Ga0501044_0136156
1116 nmdc:mga00v17_1172_c1
1117 nmdc:mga00v17_71_c1
1118 nmdc:mga0yw44_186_c1
1119 nmdc:mga06z11_46921_c1
1120 nmdc:mga04h51_22154_c1
1121 nmdc:mga0sz30_293_c1
1122 Ga0500644_0002086
1123 Ga0500569_009868
1124 Ga0500618_000459
1125 Ga0500618_002274
1126 Ga0500658_0000443
1127 Ga0500561_0000160
1128 Ga0500573_0001625
1129 Ga0500604_0027430
1130 Ga0500616_0004031
1131 Ga0500616_0012953
1132 Ga0500616_0016275
1133 Ga0500622_0002146
1134 Ga0500622_0007405
1135 Ga0500624_000820
1136 Ga0500633_0003427
1137 Ga0500636_0000022
1138 Ga0500636_0002909
1139 2509109132
1140 2509377615
1141 2509389030
1142 2509444621
1143 2510135632
1144 2510303791
1145 2510897101
1146 2511172018
1147 2511185371
1148 2511194296
1149 2511498086
1150 2512529243
1151 2512969403
1152 2513570794
1153 2513574993
1154 2513583849
1155 2513595573
1156 2513604956
1157 2513617372
1158 2513633776
1159 2513707624
1160 2513865418
1161 2513882390
1162 2513906654
1163 2513910958
1164 2513924272
1165 2513983810
1166 2514006668
1167 2514023640
1168 2515114795
1169 2515612109
1170 2515635851
1171 2515641465
1172 2515659354
1173 2515741220
1174 2516896268
1175 2517038411
1176 2517078689
1177 2517097431
1178 2517408885
1179 2517565716
1180 2523467396
1181 2524449698
1182 2530648381
1183 2537877308
1184 2551676252
1185 2551685719
1186 2551696952
1187 2551697973
1188 2551709895
1189 2551720804
1190 2551724848
1191 2551735510
1192 2551742764
1193 2554246205
1194 2558865154
1195 2559293428
1196 2561469101
1197 2585166637
1198 2585201238
1199 2585223211
1200 2585230907
1201 2585256374
1202 2585267027
1203 2585388068
1204 2585396575
1205 2585399046
1206 2585523996
1207 2585542154
1208 2585546193
1209 2585818833
1210 2585840650
1211 2585843739
1212 2585998383
1213 2586002945
1214 2599335778
1215 2599419772
1216 2599604311
1217 2599718619
1218 2600193016
1219 2600376779
1220 2601609553
1221 2601746328
1222 2616293997
1223 2643777946
1224 2643796394
1225 2643812471
1226 2643814338
1227 2643857564
1228 2643920584
1229 2644052307
1230 2644191256
1231 2644201310
1232 2644209536
1233 2644237624
1234 2644484585
1235 2644495005
1236 2644499373
1237 2644519606
1238 2644653064
1239 2644672858
1240 2692318703
1241 2719183296
1242 2719388054
1243 2719667677
1244 2719734013
1245 2720494097
1246 2720615561
1247 2720622344
1248 2720633698
1249 2720777398
1250 2721149408
1251 2721160811
1252 2721166245
1253 2721401687
1254 2722842415
1255 2723028995
1256 2723562611
1257 2723569305
1258 2724040501
1259 2724046769
1260 2724092005
1261 2724106570
1262 2724112377
1263 2725949737
1264 2730109931
1265 2730166531
1266 2730300443
1267 2738946738
1268 2739037389
1269 2753458009
1270 2766067199
1271 2776915929
1272 2792619647
1273 2792627419
1274 2792639685
1275 2793283580
1276 2793298422
1277 2793315737
1278 2793323520
1279 2793327533
1280 2793335604
1281 2793340998
1282 2793350323
1283 2793354732
1284 2793358571
1285 2793369022
1286 2802720625
1287 2802726604
1288 2802732652
1289 2802739773
1290 2802746136
1291 2802748749
1292 2805928947
1293 2805934568
1294 2806047116
1295 2806054885
1296 2806061887
1297 2806069590
1298 2806076039
1299 2808986802
1300 2819556875
1301 2819685782
1302 2821123172
1303 2838020904
1304 2838026809
1305 2838039697
1306 2838044894
1307 2838052947
1308 2838064740
1309 2838070484
1310 2838663973
1311 2838672572
1312 2838677612
1313 2838685547
1314 2838689878
1315 2838695997
1316 2838705105
1317 2838713396
1318 2838716501
1319 2838719699
1320 2838727252
1321 2838731426
1322 2838739804
1323 2838744367
1324 2841844072
1325 2841846630
1326 2841852907
1327 2841860840
1328 2841870247
1329 2842082630
1330 2842112786
1331 2842123811
1332 2842127341
1333 2842132505
1334 2842143793
1335 2842150099
1336 2842152326
1337 2842160234
1338 2842165788
1339 2842172746
1340 2842175945
1341 2842184100
1342 2842189608
1343 2842196405
1344 2842202474
1345 2842208870
1346 2842213922
1347 2842219464
1348 2842224460
1349 2842231682
1350 2842242866
1351 2842245849
1352 2842254785
1353 2842260227
1354 2842267114
1355 2842273638
1356 2842282440
1357 2842290022
1358 2842296939
1359 2842308510
1360 2842312186
1361 2842321779
1362 2842344693
1363 2842367732
1364 2842376067
1365 2842383277
1366 2842390410
1367 2842397879
1368 2842407631
1369 2842414262
1370 2842420878
1371 2842424098
1372 2842431190
1373 2842437525
1374 2842444340
1375 2842451234
1376 2842465333
1377 2842472198
1378 2842494067
1379 2842501286
1380 2842517625
1381 2842926434
1382 2844456626
1383 2847422800
1384 2848997793
1385 2850084867
1386 2854900898
1387 2854918923
1388 2855828906
1389 2855844028
1390 2855872696
1391 2857520922
1392 2857533876
1393 2858806728
1394 2891375598
1395 2894822130
1396 2896389490
1397 2899794334
1398 2899808277
1399 2899845716
1400 2913296933
1401 2913311904
1402 2915982009
1403 2915990523
1404 2915994684
1405 2916004016
1406 2916014532
1407 2916016236
1408 2916022761
1409 2916031696
1410 2916036094
1411 2916044474
1412 2916053504
1413 2916061234
1414 2916065419
1415 2916075929
1416 2916080812
1417 2919101910
1418 2919116718
1419 2919166450
1420 2919172524
1421 2920765203
1422 2921207444
1423 2921213496
1424 2921237686
1425 2921249404
1426 2921251854
1427 2921262240
1428 2921265683
1429 2921282429
1430 2921290790
1431 2921301303
1432 2923556227
1433 2924145924
1434 2924157541
1435 2924159667
1436 2924170203
1437 2924178151
1438 2924185669
1439 2924190571
1440 2924199544
1441 2924205093
1442 2924208409
1443 2924217705
1444 2924226670
1445 2924229133
1446 2926754727
1447 2926761894
1448 2933006973
1449 2933015436
1450 2933574959
1451 2933588325
1452 2933594176
1453 2933601289
1454 2935900015
1455 2935902287
1456 2936369579
1457 2936380319
1458 2936385222
1459 2937002037
1460 2937008087
1461 2937015804
1462 2937022607
1463 2937024247
1464 2937031450
1465 2937040111
1466 2937046036
1467 2937051341
1468 2937059936
1469 2937069316
1470 2937074023
1471 2937083496
1472 2937087154
1473 2937096645
1474 2937105248
1475 2937112156
1476 2937114440
1477 2937122827
1478 2937129997
1479 2957379232
1480 2957384140
1481 2957390473
1482 2957401056
1483 2957408079
1484 2957409815
1485 2957420686
1486 2957427803
1487 2957436089
1488 2957441311
1489 2957448758
1490 2957452480
1491 2957462862
1492 2957467483
1493 2957475747
1494 2957484625
1495 2957488178
1496 2957497443
1497 2957501608
1498 2957512774
1499 2960587042
1500 2960594283
1501 2960598542
1502 2960605854
1503 2960615397
1504 2960622875
1505 2960630495
1506 2960632454
1507 2960641850
1508 2960648155
1509 2960653909
1510 2960664704
1511 2960667867
1512 2960674855
1513 2960682074
1514 2960687959
1515 2960700202
1516 2964613229
1517 2964616041
1518 2964624987
1519 2964632318
1520 2964637155
1521 2964648380
1522 2964656118
1523 2964659104
1524 2964670570
1525 2964673438
1526 2964681058
1527 2964688337
1528 2964697190
1529 2964702743
1530 2964709552
1531 2964713876
1532 2964721456
1533 2967667290
1534 2967674001
1535 2967682479
1536 2967692794
1537 2967693804
1538 2967703158
1539 2967711042
1540 2967715460
1541 2967724558
1542 2967731203
1543 2967736148
1544 2967742281
1545 2967751229
1546 2967762185
1547 2967768341
1548 2967775361
1549 2967777885
1550 2970023016
1551 2970033503
1552 2970038001
1553 2970042304
1554 2970049250
1555 2970055387
1556 2970062133
1557 2970074716
1558 2970080584
1559 2970088767
1560 2970093866
1561 2970100419
1562 2970103641
1563 2970114611
1564 2970116640
1565 2970127198
1566 2970130603
1567 2970140120
1568 2970145906
1569 2970155070
1570 2970160992
1571 2970165848
1572 2970177520
1573 2970183520
1574 2970189760
1575 2970192067
1576 2977518544
1577 2977530638
1578 2977533228
1579 2977538855
1580 2977551507
1581 2977552432
1582 2977563790
1583 2977570664
1584 2977579413
1585 2977580957
1586 2978972842
1587 2979092839
1588 2979099772
1589 2979104810
1590 2984513390
1591 2984520241
1592 2984539537
1593 2984591095
1594 2984601765
1595 2989772832
1596 2989780866
1597 2996888015
1598 2996897562
1599 3005410592
1600 3005450023
1601 3005456401
1602 639646030
1603 643823185
1604 648737638
1605 650738664
1606 8003572209
1607 8003996601
1608 8004004199
1609 8005250549
1610 8005261420
1611 8005278256
1612 8005282709
1613 8005291681
1614 8005305443
1615 8005310217
1616 8005322542
1617 8005378136
1618 8005384144
1619 8005399578
1620 8005433831
1621 8005465491
1622 8005498074
1623 8005559939
1624 8005564565
1625 8005571251
1626 8005619283
1627 8005627848
1628 8005669482
1629 8005692805
1630 8005701507
1631 8018132501
1632 8018153653
1633 8018153886
1634 8018167643
1635 8018176656
1636 8023681307
1637 8024481862
1638 8024506298
1639 8046768733
1640 8054460970
1641 8054561192
1642 8056381225
1643 8056382717
1644 8057877155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

96

401

0.83

PF01979

Amidohydro_1

Amidohydrolase family

70

400

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ymy-assembly1.cif.gz_B crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 0.7625 5 379
1ymy-assembly1.cif.gz_B crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 0.754 5 379
1yrr-assembly1.cif.gz_B-2 crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution 0.7378 6 378
1yrr-assembly1.cif.gz_B-2 crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution 0.7277 6 378
3egj-assembly2.cif.gz_B-2 n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae. 0.6887 3 377
ID Description Score Start End Superfamily
af_P16689_1_268_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9671 5 269 3.20.20.70
af_P16689_1_268_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.953 5 269 3.20.20.70
2ftyB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8524 5 51 2.30.40.10
3hm7F01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8239 5 49 2.30.40.10
1j6pA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8205 6 50 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A143ZB58-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase 0.9906 1 379 GO:0016810
GO:0019700
AF-A0A143ZB58-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase 0.988 1 379 GO:0016810
GO:0019700
AF-A0A353G5X0-F1-model_v4 Phosphonate metabolism protein PhnM 0.987 1 379 GO:0016810
GO:0019700
AF-A0A353G5X0-F1-model_v4 Phosphonate metabolism protein PhnM 0.9844 1 379 GO:0016810
GO:0019700
AF-A0A833G043-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (EC 3.6.1.63) 0.9825 1 272 GO:0016810

Map