F482287
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 822 | 341 | 1644 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100025177|Ga0068868_1000251775 |
| Length | 191 |
| Sequence | MRDKSESECKEMKLNQIKDNKGARQSRVRVGRGIGSXXXXTXXRGQKGAKARSGVSIAGFEGGQMPLHMRLPKRGFNNIFARDYAEVNIGAVQKAIDAGKLDMKGVLDQAALNAAGLSRGGKDGVRLLGKGELKAKLNFKIAGVSKGAREAVEKAGGSIELIERKDPAELAAAKKGKVREQRLADRAAAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 96 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 164 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 201 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 202 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 203 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 204 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 205 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 206 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 207 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 208 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 257 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 258 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 259 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 272 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 276 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 278 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 282 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 283 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 284 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 285 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 292 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 293 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 298 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 299 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 300 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 301 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 302 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 303 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 304 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 305 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 306 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 307 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 308 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 309 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 310 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 311 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 312 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 313 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 314 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 315 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 316 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 317 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 318 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 319 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 320 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 321 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 322 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 323 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 324 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 325 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 326 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 327 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 328 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 329 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 330 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 331 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 332 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 333 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 334 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 335 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 336 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 337 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 338 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 339 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 340 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 341 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.28 |
| Metatranscriptomes | 0.36 |
| Isolates | 5.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 4.62 |
| Rhizoplane | 2.68 |
| Rhizosphere | 89.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068868_100025177 | 3300005338 | Bacteria | 4521 |
| 2 | JGI24741J21665_1010075 | 3300001915 | Bacteria | 1709 |
| 3 | JGI24741J21665_1010189 | 3300001915 | Bacteria | 1694 |
| 4 | JGI24740J21852_10001392 | 3300001979 | Bacteria | 11043 |
| 5 | JGI24740J21852_10006828 | 3300001979 | Bacteria | 4686 |
| 6 | JGI24740J21852_10037057 | 3300001979 | Bacteria | 1509 |
| 7 | JGI24739J22299_10010528 | 3300001989 | Bacteria | 3432 |
| 8 | JGI24739J22299_10041361 | 3300001989 | Bacteria | 1534 |
| 9 | JGI24737J22298_10063939 | 3300001990 | Bacteria | 1104 |
| 10 | JGI24735J21928_10019234 | 3300002067 | Bacteria | 2100 |
| 11 | JGI24735J21928_10162953 | 3300002067 | Bacteria | 644 |
| 12 | JGI24738J21930_10002194 | 3300002075 | Bacteria | 5202 |
| 13 | JGI24738J21930_10019404 | 3300002075 | Bacteria | 1417 |
| 14 | JGI24744J21845_10000034 | 3300002077 | Bacteria | 15838 |
| 15 | Ga0065715_10244338 | 3300005293 | Bacteria | 1188 |
| 16 | Ga0065715_10273178 | 3300005293 | Bacteria | 1090 |
| 17 | Ga0070658_10013640 | 3300005327 | Bacteria | 6520 |
| 18 | Ga0070658_10020583 | 3300005327 | Bacteria | 5288 |
| 19 | Ga0070658_10057953 | 3300005327 | Bacteria | 3151 |
| 20 | Ga0070658_10091541 | 3300005327 | Bacteria | 2506 |
| 21 | Ga0070658_10173973 | 3300005327 | Bacteria | 1810 |
| 22 | Ga0070658_10493973 | 3300005327 | Bacteria | 1057 |
| 23 | Ga0070676_10435944 | 3300005328 | Bacteria | 918 |
| 24 | Ga0070676_10446567 | 3300005328 | Bacteria | 908 |
| 25 | Ga0070683_100094211 | 3300005329 | Bacteria | 2814 |
| 26 | Ga0070683_100097247 | 3300005329 | Bacteria | 2769 |
| 27 | Ga0070683_100177271 | 3300005329 | Bacteria | 2023 |
| 28 | Ga0070683_100243466 | 3300005329 | Bacteria | 1711 |
| 29 | Ga0070683_101442549 | 3300005329 | Bacteria | 661 |
| 30 | Ga0070690_100012042 | 3300005330 | Bacteria | 5078 |
| 31 | Ga0070670_100000075 | 3300005331 | Bacteria | 97494 |
| 32 | Ga0070670_100026404 | 3300005331 | Bacteria | 4998 |
| 33 | Ga0070670_100037046 | 3300005331 | Bacteria | 4197 |
| 34 | Ga0070670_100037322 | 3300005331 | Bacteria | 4180 |
| 35 | Ga0070677_10027811 | 3300005333 | Bacteria | 2132 |
| 36 | Ga0068869_100150340 | 3300005334 | Bacteria | 1805 |
| 37 | Ga0068869_100360088 | 3300005334 | Bacteria | 1188 |
| 38 | Ga0070666_10003597 | 3300005335 | Bacteria | 9395 |
| 39 | Ga0070666_10068528 | 3300005335 | Bacteria | 2411 |
| 40 | Ga0070666_10090661 | 3300005335 | Bacteria | 2099 |
| 41 | Ga0070666_10128663 | 3300005335 | Bacteria | 1759 |
| 42 | Ga0070680_100103412 | 3300005336 | Bacteria | 2366 |
| 43 | Ga0070682_100034188 | 3300005337 | Bacteria | 3094 |
| 44 | Ga0070682_100274812 | 3300005337 | Bacteria | 1225 |
| 45 | Ga0070682_100822228 | 3300005337 | Bacteria | 757 |
| 46 | Ga0068868_100089899 | 3300005338 | Bacteria | 2472 |
| 47 | Ga0068868_100107056 | 3300005338 | Bacteria | 2269 |
| 48 | Ga0070660_100002891 | 3300005339 | Bacteria | 11818 |
| 49 | Ga0070660_100007791 | 3300005339 | Bacteria | 7468 |
| 50 | Ga0070660_100013592 | 3300005339 | Bacteria | 5846 |
| 51 | Ga0070660_100015088 | 3300005339 | Bacteria | 5575 |
| 52 | Ga0070660_100032871 | 3300005339 | Bacteria | 3907 |
| 53 | Ga0070660_100502673 | 3300005339 | Bacteria | 1008 |
| 54 | Ga0070661_100000378 | 3300005344 | Bacteria | 34966 |
| 55 | Ga0070661_100255929 | 3300005344 | Bacteria | 1352 |
| 56 | Ga0070661_100620340 | 3300005344 | Bacteria | 876 |
| 57 | Ga0070692_10028912 | 3300005345 | Bacteria | 2759 |
| 58 | Ga0070668_100023561 | 3300005347 | Bacteria | 4657 |
| 59 | Ga0070668_100179313 | 3300005347 | Bacteria | 1729 |
| 60 | Ga0070668_100381347 | 3300005347 | Bacteria | 1200 |
| 61 | Ga0070669_100054545 | 3300005353 | Bacteria | 2927 |
| 62 | Ga0070669_100101961 | 3300005353 | Bacteria | 2166 |
| 63 | Ga0070669_100160283 | 3300005353 | Bacteria | 1747 |
| 64 | Ga0070669_100423805 | 3300005353 | Bacteria | 1093 |
| 65 | Ga0070675_100025299 | 3300005354 | Bacteria | 4759 |
| 66 | Ga0070675_100060735 | 3300005354 | Bacteria | 3120 |
| 67 | Ga0070675_100725811 | 3300005354 | Bacteria | 906 |
| 68 | Ga0070671_100029750 | 3300005355 | Bacteria | 4505 |
| 69 | Ga0070671_100060355 | 3300005355 | Bacteria | 3157 |
| 70 | Ga0070671_100066753 | 3300005355 | Bacteria | 2998 |
| 71 | Ga0070671_100151152 | 3300005355 | Bacteria | 1961 |
| 72 | Ga0070671_100182567 | 3300005355 | Bacteria | 1776 |
| 73 | Ga0070671_100691263 | 3300005355 | Bacteria | 884 |
| 74 | Ga0070674_100128556 | 3300005356 | Bacteria | 1885 |
| 75 | Ga0070674_100319241 | 3300005356 | Bacteria | 1245 |
| 76 | Ga0070673_100054262 | 3300005364 | Bacteria | 3152 |
| 77 | Ga0070673_100079951 | 3300005364 | Bacteria | 2648 |
| 78 | Ga0070673_100195999 | 3300005364 | Bacteria | 1737 |
| 79 | Ga0070673_100216124 | 3300005364 | Bacteria | 1657 |
| 80 | Ga0070673_100486337 | 3300005364 | Bacteria | 1115 |
| 81 | Ga0070673_100497276 | 3300005364 | Bacteria | 1103 |
| 82 | Ga0070673_101161406 | 3300005364 | Bacteria | 722 |
| 83 | Ga0070659_100011523 | 3300005366 | Bacteria | 6542 |
| 84 | Ga0070659_100127240 | 3300005366 | Bacteria | 2067 |
| 85 | Ga0070659_100137500 | 3300005366 | Bacteria | 1987 |
| 86 | Ga0070659_100499768 | 3300005366 | Bacteria | 1036 |
| 87 | Ga0070659_100519321 | 3300005366 | Bacteria | 1017 |
| 88 | Ga0070667_100000039 | 3300005367 | Bacteria | 170228 |
| 89 | Ga0070667_100011640 | 3300005367 | Bacteria | 7273 |
| 90 | Ga0070667_100068943 | 3300005367 | Bacteria | 3009 |
| 91 | Ga0070667_100248567 | 3300005367 | Bacteria | 1590 |
| 92 | Ga0070714_100175931 | 3300005435 | Bacteria | 1945 |
| 93 | Ga0070714_100525585 | 3300005435 | Bacteria | 1130 |
| 94 | Ga0070714_100776941 | 3300005435 | Bacteria | 927 |
| 95 | Ga0070713_100323140 | 3300005436 | Bacteria | 1425 |
| 96 | Ga0070694_100007775 | 3300005444 | Bacteria | 6540 |
| 97 | Ga0070663_100025097 | 3300005455 | Bacteria | 4021 |
| 98 | Ga0070663_100031065 | 3300005455 | Bacteria | 3667 |
| 99 | Ga0070663_100067856 | 3300005455 | Bacteria | 2588 |
| 100 | Ga0070678_100076029 | 3300005456 | Bacteria | 2528 |
| 101 | Ga0070678_100151644 | 3300005456 | Bacteria | 1868 |
| 102 | Ga0070678_100158074 | 3300005456 | Bacteria | 1833 |
| 103 | Ga0070662_100004163 | 3300005457 | Bacteria | 9105 |
| 104 | Ga0070662_100017760 | 3300005457 | Bacteria | 4800 |
| 105 | Ga0070662_100037731 | 3300005457 | Bacteria | 3427 |
| 106 | Ga0070662_100103846 | 3300005457 | Bacteria | 2155 |
| 107 | Ga0070662_100195622 | 3300005457 | Bacteria | 1601 |
| 108 | Ga0070662_100251285 | 3300005457 | Bacteria | 1421 |
| 109 | Ga0070662_100377300 | 3300005457 | Bacteria | 1167 |
| 110 | Ga0070681_10169060 | 3300005458 | Bacteria | 2108 |
| 111 | Ga0070681_10513451 | 3300005458 | Bacteria | 1111 |
| 112 | Ga0070681_10601878 | 3300005458 | Bacteria | 1013 |
| 113 | Ga0068867_100004535 | 3300005459 | Bacteria | 9763 |
| 114 | Ga0068867_100006865 | 3300005459 | Bacteria | 8052 |
| 115 | Ga0070679_100113172 | 3300005530 | Bacteria | 2699 |
| 116 | Ga0070684_100057452 | 3300005535 | Bacteria | 3398 |
| 117 | Ga0070684_100095295 | 3300005535 | Bacteria | 2651 |
| 118 | Ga0070684_100173736 | 3300005535 | Bacteria | 1957 |
| 119 | Ga0068853_100000371 | 3300005539 | Bacteria | 30925 |
| 120 | Ga0068853_100003315 | 3300005539 | Bacteria | 12321 |
| 121 | Ga0068853_100305111 | 3300005539 | Bacteria | 1472 |
| 122 | Ga0068853_100338138 | 3300005539 | Bacteria | 1398 |
| 123 | Ga0068853_100547001 | 3300005539 | Bacteria | 1096 |
| 124 | Ga0070672_100035836 | 3300005543 | Bacteria | 3773 |
| 125 | Ga0070672_100117164 | 3300005543 | Bacteria | 2177 |
| 126 | Ga0070672_100425167 | 3300005543 | Bacteria | 1141 |
| 127 | Ga0070672_100831257 | 3300005543 | Bacteria | 814 |
| 128 | Ga0070696_100013365 | 3300005546 | Bacteria | 5507 |
| 129 | Ga0070696_100110546 | 3300005546 | Bacteria | 1978 |
| 130 | Ga0070696_101073688 | 3300005546 | Bacteria | 676 |
| 131 | Ga0070693_100001061 | 3300005547 | Bacteria | 12277 |
| 132 | Ga0070693_100033553 | 3300005547 | Bacteria | 2833 |
| 133 | Ga0070665_100021441 | 3300005548 | Bacteria | 6498 |
| 134 | Ga0070665_100023728 | 3300005548 | Bacteria | 6178 |
| 135 | Ga0070665_100025177 | 3300005548 | Bacteria | 5996 |
| 136 | Ga0070665_100029734 | 3300005548 | Bacteria | 5498 |
| 137 | Ga0070665_100117624 | 3300005548 | Bacteria | 2661 |
| 138 | Ga0068855_100001629 | 3300005563 | Bacteria | 28166 |
| 139 | Ga0068855_100292663 | 3300005563 | Bacteria | 1805 |
| 140 | Ga0068855_100504310 | 3300005563 | Bacteria | 1314 |
| 141 | Ga0070664_100002298 | 3300005564 | Bacteria | 15361 |
| 142 | Ga0070664_100124865 | 3300005564 | Bacteria | 2256 |
| 143 | Ga0070664_100128418 | 3300005564 | Bacteria | 2225 |
| 144 | Ga0070664_100130693 | 3300005564 | Bacteria | 2205 |
| 145 | Ga0068857_100014445 | 3300005577 | Bacteria | 6888 |
| 146 | Ga0068857_100039350 | 3300005577 | Bacteria | 4187 |
| 147 | Ga0068857_100055675 | 3300005577 | Bacteria | 3509 |
| 148 | Ga0068857_100096146 | 3300005577 | Bacteria | 2654 |
| 149 | Ga0068854_100036953 | 3300005578 | Bacteria | 3425 |
| 150 | Ga0068854_100145560 | 3300005578 | Bacteria | 1822 |
| 151 | Ga0068854_100269812 | 3300005578 | Bacteria | 1366 |
| 152 | Ga0068854_100310613 | 3300005578 | Bacteria | 1278 |
| 153 | Ga0068854_100358554 | 3300005578 | Bacteria | 1196 |
| 154 | Ga0068856_100001149 | 3300005614 | Bacteria | 27839 |
| 155 | Ga0068856_100065317 | 3300005614 | Bacteria | 3596 |
| 156 | Ga0068856_100223268 | 3300005614 | Bacteria | 1899 |
| 157 | Ga0068856_100292261 | 3300005614 | Bacteria | 1646 |
| 158 | Ga0068856_100719533 | 3300005614 | Bacteria | 1018 |
| 159 | Ga0068856_101201918 | 3300005614 | Bacteria | 774 |
| 160 | Ga0068852_100022870 | 3300005616 | Bacteria | 5022 |
| 161 | Ga0068852_100048453 | 3300005616 | Bacteria | 3630 |
| 162 | Ga0068852_100058630 | 3300005616 | Bacteria | 3336 |
| 163 | Ga0068852_100153654 | 3300005616 | Bacteria | 2142 |
| 164 | Ga0068852_100435191 | 3300005616 | Bacteria | 1296 |
| 165 | Ga0068859_100084174 | 3300005617 | Bacteria | 3225 |
| 166 | Ga0068859_101101518 | 3300005617 | Bacteria | 874 |
| 167 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 168 | Ga0068864_100005877 | 3300005618 | Bacteria | 10055 |
| 169 | Ga0068864_100014693 | 3300005618 | Bacteria | 6503 |
| 170 | Ga0068864_100439607 | 3300005618 | Bacteria | 1246 |
| 171 | Ga0068864_100536480 | 3300005618 | Bacteria | 1129 |
| 172 | Ga0068864_101158988 | 3300005618 | Bacteria | 771 |
| 173 | Ga0068866_10054825 | 3300005718 | Bacteria | 2044 |
| 174 | Ga0068866_10113156 | 3300005718 | Bacteria | 1518 |
| 175 | Ga0068861_101338323 | 3300005719 | Bacteria | 698 |
| 176 | Ga0068851_10014198 | 3300005834 | Bacteria | 3779 |
| 177 | Ga0068851_10018029 | 3300005834 | Bacteria | 3398 |
| 178 | Ga0068870_10072422 | 3300005840 | Bacteria | 1883 |
| 179 | Ga0068870_10552141 | 3300005840 | Bacteria | 776 |
| 180 | Ga0068863_100000033 | 3300005841 | Bacteria | 170238 |
| 181 | Ga0068863_100109342 | 3300005841 | Bacteria | 2631 |
| 182 | Ga0068863_100118096 | 3300005841 | Bacteria | 2528 |
| 183 | Ga0068863_100119724 | 3300005841 | Bacteria | 2509 |
| 184 | Ga0068863_100122714 | 3300005841 | Bacteria | 2478 |
| 185 | Ga0068863_100631205 | 3300005841 | Bacteria | 1062 |
| 186 | Ga0068858_100036141 | 3300005842 | Bacteria | 4580 |
| 187 | Ga0068858_100055697 | 3300005842 | Bacteria | 3655 |
| 188 | Ga0068858_100089325 | 3300005842 | Bacteria | 2867 |
| 189 | Ga0068858_100205265 | 3300005842 | Bacteria | 1864 |
| 190 | Ga0068860_100022352 | 3300005843 | Bacteria | 6119 |
| 191 | Ga0068860_100114263 | 3300005843 | Bacteria | 2582 |
| 192 | Ga0068860_100205727 | 3300005843 | Bacteria | 1909 |
| 193 | Ga0068860_100264367 | 3300005843 | Bacteria | 1678 |
| 194 | Ga0068860_100483376 | 3300005843 | Bacteria | 1234 |
| 195 | Ga0068860_100748923 | 3300005843 | Bacteria | 988 |
| 196 | Ga0068862_100000040 | 3300005844 | Bacteria | 167832 |
| 197 | Ga0068862_100484321 | 3300005844 | Bacteria | 1171 |
| 198 | Ga0081539_10015398 | 3300005985 | Bacteria | 5559 |
| 199 | Ga0070717_10007362 | 3300006028 | Bacteria | 8173 |
| 200 | Ga0070716_100374378 | 3300006173 | Bacteria | 1016 |
| 201 | Ga0097621_100162639 | 3300006237 | Bacteria | 1920 |
| 202 | Ga0097621_100202842 | 3300006237 | Bacteria | 1722 |
| 203 | Ga0068871_100065028 | 3300006358 | Bacteria | 2986 |
| 204 | Ga0075434_100355198 | 3300006871 | Bacteria | 1486 |
| 205 | Ga0068865_100268959 | 3300006881 | Bacteria | 1352 |
| 206 | Ga0075436_100707040 | 3300006914 | Bacteria | 747 |
| 207 | Ga0097620_100084175 | 3300006931 | Bacteria | 3225 |
| 208 | Ga0097620_101101476 | 3300006931 | Bacteria | 874 |
| 209 | Ga0079104_1032594 | 3300006946 | Bacteria | 1283 |
| 210 | Ga0105251_10004716 | 3300009011 | Bacteria | 9147 |
| 211 | Ga0105245_10072535 | 3300009098 | Bacteria | 3128 |
| 212 | Ga0105245_11321456 | 3300009098 | Bacteria | 770 |
| 213 | Ga0105245_11417475 | 3300009098 | Bacteria | 745 |
| 214 | Ga0105247_10018821 | 3300009101 | Bacteria | 4146 |
| 215 | Ga0114129_11270946 | 3300009147 | Bacteria | 914 |
| 216 | Ga0105243_10069992 | 3300009148 | Bacteria | 2832 |
| 217 | Ga0105242_10158169 | 3300009176 | Bacteria | 1981 |
| 218 | Ga0105248_10000021 | 3300009177 | Bacteria | 276159 |
| 219 | Ga0105248_10001425 | 3300009177 | Bacteria | 26705 |
| 220 | Ga0105248_10010652 | 3300009177 | Bacteria | 10141 |
| 221 | Ga0105248_10022689 | 3300009177 | Bacteria | 6965 |
| 222 | Ga0105248_10043820 | 3300009177 | Bacteria | 5018 |
| 223 | Ga0105248_10065969 | 3300009177 | Bacteria | 4064 |
| 224 | Ga0105248_10504523 | 3300009177 | Bacteria | 1364 |
| 225 | Ga0105238_10456040 | 3300009551 | Bacteria | 1276 |
| 226 | Ga0105238_10469713 | 3300009551 | Bacteria | 1256 |
| 227 | Ga0105238_10555783 | 3300009551 | Bacteria | 1152 |
| 228 | Ga0105249_10001881 | 3300009553 | Bacteria | 18180 |
| 229 | Ga0105249_10520247 | 3300009553 | Bacteria | 1237 |
| 230 | Ga0105239_10468251 | 3300010375 | Bacteria | 1431 |
| 231 | Ga0105246_10161931 | 3300011119 | Bacteria | 1705 |
| 232 | Ga0157373_10021771 | 3300013100 | Bacteria | 4652 |
| 233 | Ga0157373_10064751 | 3300013100 | Bacteria | 2587 |
| 234 | Ga0157373_10406158 | 3300013100 | Bacteria | 977 |
| 235 | Ga0157371_10020175 | 3300013102 | Bacteria | 4905 |
| 236 | Ga0157371_10033548 | 3300013102 | Bacteria | 3687 |
| 237 | Ga0157371_10089328 | 3300013102 | Bacteria | 2182 |
| 238 | Ga0157371_10374672 | 3300013102 | Bacteria | 1039 |
| 239 | Ga0157371_10468101 | 3300013102 | Bacteria | 928 |
| 240 | Ga0157371_10698031 | 3300013102 | Bacteria | 759 |
| 241 | Ga0157370_10002611 | 3300013104 | Bacteria | 21670 |
| 242 | Ga0157370_10098071 | 3300013104 | Bacteria | 2749 |
| 243 | Ga0157370_10100722 | 3300013104 | Bacteria | 2707 |
| 244 | Ga0157370_10154252 | 3300013104 | Bacteria | 2137 |
| 245 | Ga0157370_10262965 | 3300013104 | Bacteria | 1594 |
| 246 | Ga0157370_10486950 | 3300013104 | Bacteria | 1133 |
| 247 | Ga0157369_10012264 | 3300013105 | Bacteria | 9733 |
| 248 | Ga0157369_10211906 | 3300013105 | Bacteria | 2030 |
| 249 | Ga0157369_10545908 | 3300013105 | Bacteria | 1198 |
| 250 | Ga0157374_10188509 | 3300013296 | Bacteria | 2017 |
| 251 | Ga0157378_10098206 | 3300013297 | Bacteria | 2670 |
| 252 | Ga0157378_10511783 | 3300013297 | Bacteria | 1201 |
| 253 | Ga0163162_10545435 | 3300013306 | Bacteria | 1288 |
| 254 | Ga0163162_10592138 | 3300013306 | Bacteria | 1235 |
| 255 | Ga0157375_10524144 | 3300013308 | Bacteria | 1348 |
| 256 | Ga0163163_10002656 | 3300014325 | Bacteria | 15124 |
| 257 | Ga0163163_10064459 | 3300014325 | Bacteria | 3636 |
| 258 | Ga0157380_11337360 | 3300014326 | Bacteria | 765 |
| 259 | Ga0157377_10112415 | 3300014745 | Bacteria | 1639 |
| 260 | Ga0157377_10134202 | 3300014745 | Bacteria | 1515 |
| 261 | Ga0157379_10051816 | 3300014968 | Bacteria | 3664 |
| 262 | Ga0157379_10060038 | 3300014968 | Bacteria | 3399 |
| 263 | Ga0157379_10562570 | 3300014968 | Bacteria | 1062 |
| 264 | Ga0157379_10769217 | 3300014968 | Bacteria | 907 |
| 265 | Ga0183363_1006 | 3300015690 | Bacteria | 400466 |
| 266 | Ga0213873_10000021 | 3300021358 | Bacteria | 113830 |
| 267 | Ga0213876_10000050 | 3300021384 | Bacteria | 144836 |
| 268 | Ga0213876_10005218 | 3300021384 | Bacteria | 7160 |
| 269 | Ga0213876_10015842 | 3300021384 | Bacteria | 3989 |
| 270 | Ga0209026_1013989 | 3300025250 | Bacteria | 1352 |
| 271 | Ga0209675_1024192 | 3300025291 | Bacteria | 1557 |
| 272 | Ga0209676_1004347 | 3300025292 | Bacteria | 7943 |
| 273 | Ga0209050_1031105 | 3300025298 | Bacteria | 1670 |
| 274 | Ga0207697_10120618 | 3300025315 | Bacteria | 1128 |
| 275 | Ga0207697_10149067 | 3300025315 | Bacteria | 1017 |
| 276 | Ga0207656_10005222 | 3300025321 | Bacteria | 4573 |
| 277 | Ga0207656_10021936 | 3300025321 | Bacteria | 2557 |
| 278 | Ga0207656_10155001 | 3300025321 | Bacteria | 1087 |
| 279 | Ga0207713_1070882 | 3300025735 | Bacteria | 1287 |
| 280 | Ga0207682_10007605 | 3300025893 | Bacteria | 4312 |
| 281 | Ga0207682_10049275 | 3300025893 | Bacteria | 1738 |
| 282 | Ga0207710_10004955 | 3300025900 | Bacteria | 5769 |
| 283 | Ga0207688_10462528 | 3300025901 | Bacteria | 792 |
| 284 | Ga0207680_10004230 | 3300025903 | Bacteria | 6795 |
| 285 | Ga0207680_10006079 | 3300025903 | Bacteria | 5814 |
| 286 | Ga0207680_10034048 | 3300025903 | Bacteria | 2911 |
| 287 | Ga0207680_10077641 | 3300025903 | Bacteria | 2078 |
| 288 | Ga0207647_10002583 | 3300025904 | Bacteria | 13704 |
| 289 | Ga0207647_10007170 | 3300025904 | Bacteria | 8081 |
| 290 | Ga0207647_10009661 | 3300025904 | Bacteria | 6848 |
| 291 | Ga0207647_10108367 | 3300025904 | Bacteria | 1643 |
| 292 | Ga0207647_10154111 | 3300025904 | Bacteria | 1342 |
| 293 | Ga0207645_10007046 | 3300025907 | Bacteria | 8004 |
| 294 | Ga0207645_10075152 | 3300025907 | Bacteria | 2163 |
| 295 | Ga0207645_10367224 | 3300025907 | Bacteria | 964 |
| 296 | Ga0207643_10052301 | 3300025908 | Bacteria | 2319 |
| 297 | Ga0207643_10206399 | 3300025908 | Bacteria | 1198 |
| 298 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 299 | Ga0207705_10000484 | 3300025909 | Bacteria | 34139 |
| 300 | Ga0207705_10001745 | 3300025909 | Bacteria | 17203 |
| 301 | Ga0207705_10001825 | 3300025909 | Bacteria | 16767 |
| 302 | Ga0207705_10003572 | 3300025909 | Bacteria | 11842 |
| 303 | Ga0207705_10012492 | 3300025909 | Bacteria | 6135 |
| 304 | Ga0207705_10026379 | 3300025909 | Bacteria | 4143 |
| 305 | Ga0207705_10038076 | 3300025909 | Bacteria | 3442 |
| 306 | Ga0207705_10049071 | 3300025909 | Bacteria | 3038 |
| 307 | Ga0207705_10062137 | 3300025909 | Bacteria | 2698 |
| 308 | Ga0207705_10950109 | 3300025909 | Bacteria | 665 |
| 309 | Ga0207707_10049693 | 3300025912 | Bacteria | 3653 |
| 310 | Ga0207707_10328138 | 3300025912 | Bacteria | 1320 |
| 311 | Ga0207707_10447734 | 3300025912 | Bacteria | 1105 |
| 312 | Ga0207707_10912621 | 3300025912 | Bacteria | 725 |
| 313 | Ga0207695_10031682 | 3300025913 | Bacteria | 5794 |
| 314 | Ga0207660_10112179 | 3300025917 | Bacteria | 2053 |
| 315 | Ga0207660_10129339 | 3300025917 | Bacteria | 1920 |
| 316 | Ga0207662_10016667 | 3300025918 | Bacteria | 4149 |
| 317 | Ga0207662_10178877 | 3300025918 | Bacteria | 1364 |
| 318 | Ga0207657_10000223 | 3300025919 | Bacteria | 59285 |
| 319 | Ga0207657_10001247 | 3300025919 | Bacteria | 27200 |
| 320 | Ga0207657_10007500 | 3300025919 | Bacteria | 11182 |
| 321 | Ga0207657_10010881 | 3300025919 | Bacteria | 9053 |
| 322 | Ga0207657_10035997 | 3300025919 | Bacteria | 4434 |
| 323 | Ga0207657_10109681 | 3300025919 | Bacteria | 2280 |
| 324 | Ga0207657_10216014 | 3300025919 | Bacteria | 1537 |
| 325 | Ga0207657_10243090 | 3300025919 | Bacteria | 1437 |
| 326 | Ga0207649_10000659 | 3300025920 | Bacteria | 23023 |
| 327 | Ga0207649_10010463 | 3300025920 | Bacteria | 5097 |
| 328 | Ga0207649_10065124 | 3300025920 | Bacteria | 2306 |
| 329 | Ga0207649_10186581 | 3300025920 | Bacteria | 1455 |
| 330 | Ga0207649_10272597 | 3300025920 | Bacteria | 1227 |
| 331 | Ga0207652_10065349 | 3300025921 | Bacteria | 3150 |
| 332 | Ga0207681_10149198 | 3300025923 | Bacteria | 1750 |
| 333 | Ga0207681_10218785 | 3300025923 | Bacteria | 1472 |
| 334 | Ga0207681_10227030 | 3300025923 | Bacteria | 1447 |
| 335 | Ga0207694_10018876 | 3300025924 | Bacteria | 5212 |
| 336 | Ga0207694_10049198 | 3300025924 | Bacteria | 3263 |
| 337 | Ga0207694_10353041 | 3300025924 | Bacteria | 1217 |
| 338 | Ga0207694_10353483 | 3300025924 | Bacteria | 1217 |
| 339 | Ga0207694_10363345 | 3300025924 | Bacteria | 1200 |
| 340 | Ga0207694_10856658 | 3300025924 | Bacteria | 768 |
| 341 | Ga0207650_10000069 | 3300025925 | Bacteria | 138442 |
| 342 | Ga0207650_10024733 | 3300025925 | Bacteria | 4273 |
| 343 | Ga0207650_10037959 | 3300025925 | Bacteria | 3513 |
| 344 | Ga0207650_10480781 | 3300025925 | Bacteria | 1036 |
| 345 | Ga0207659_10169367 | 3300025926 | Bacteria | 1722 |
| 346 | Ga0207687_10360079 | 3300025927 | Bacteria | 1187 |
| 347 | Ga0207687_10374109 | 3300025927 | Bacteria | 1166 |
| 348 | Ga0207700_10007574 | 3300025928 | Bacteria | 6652 |
| 349 | Ga0207664_10118545 | 3300025929 | Bacteria | 2211 |
| 350 | Ga0207664_10426069 | 3300025929 | Bacteria | 1182 |
| 351 | Ga0207644_10002343 | 3300025931 | Bacteria | 12231 |
| 352 | Ga0207644_10012564 | 3300025931 | Bacteria | 5628 |
| 353 | Ga0207644_10270886 | 3300025931 | Bacteria | 1360 |
| 354 | Ga0207644_10580671 | 3300025931 | Bacteria | 929 |
| 355 | Ga0207690_10000528 | 3300025932 | Bacteria | 24871 |
| 356 | Ga0207690_10004734 | 3300025932 | Bacteria | 8038 |
| 357 | Ga0207690_10020755 | 3300025932 | Bacteria | 4063 |
| 358 | Ga0207690_10061840 | 3300025932 | Bacteria | 2547 |
| 359 | Ga0207690_10124323 | 3300025932 | Bacteria | 1879 |
| 360 | Ga0207690_10185781 | 3300025932 | Bacteria | 1568 |
| 361 | Ga0207690_10346062 | 3300025932 | Bacteria | 1174 |
| 362 | Ga0207690_10423859 | 3300025932 | Bacteria | 1065 |
| 363 | Ga0207706_10000616 | 3300025933 | Bacteria | 37795 |
| 364 | Ga0207706_10029984 | 3300025933 | Bacteria | 4855 |
| 365 | Ga0207706_10040732 | 3300025933 | Bacteria | 4118 |
| 366 | Ga0207706_10145127 | 3300025933 | Bacteria | 2087 |
| 367 | Ga0207706_10226977 | 3300025933 | Bacteria | 1634 |
| 368 | Ga0207709_10023662 | 3300025935 | Bacteria | 3498 |
| 369 | Ga0207709_10180387 | 3300025935 | Bacteria | 1491 |
| 370 | Ga0207669_10173791 | 3300025937 | Bacteria | 1536 |
| 371 | Ga0207669_10317751 | 3300025937 | Bacteria | 1190 |
| 372 | Ga0207704_10039542 | 3300025938 | Bacteria | 2748 |
| 373 | Ga0207704_10279339 | 3300025938 | Bacteria | 1268 |
| 374 | Ga0207704_10375805 | 3300025938 | Bacteria | 1114 |
| 375 | Ga0207704_10618799 | 3300025938 | Bacteria | 889 |
| 376 | Ga0207665_10027914 | 3300025939 | Bacteria | 3728 |
| 377 | Ga0207691_10040981 | 3300025940 | Bacteria | 4278 |
| 378 | Ga0207691_10095473 | 3300025940 | Bacteria | 2659 |
| 379 | Ga0207691_10140643 | 3300025940 | Bacteria | 2127 |
| 380 | Ga0207711_10000025 | 3300025941 | Bacteria | 289972 |
| 381 | Ga0207711_10002648 | 3300025941 | Bacteria | 15820 |
| 382 | Ga0207711_10004929 | 3300025941 | Bacteria | 11336 |
| 383 | Ga0207711_10009023 | 3300025941 | Bacteria | 8335 |
| 384 | Ga0207711_10014312 | 3300025941 | Bacteria | 6589 |
| 385 | Ga0207711_10017709 | 3300025941 | Bacteria | 5919 |
| 386 | Ga0207711_10572788 | 3300025941 | Bacteria | 1053 |
| 387 | Ga0207689_10022353 | 3300025942 | Bacteria | 5319 |
| 388 | Ga0207689_10170390 | 3300025942 | Bacteria | 1794 |
| 389 | Ga0207689_10410168 | 3300025942 | Bacteria | 1130 |
| 390 | Ga0207661_10016172 | 3300025944 | Bacteria | 5499 |
| 391 | Ga0207661_10171262 | 3300025944 | Bacteria | 1890 |
| 392 | Ga0207661_10787368 | 3300025944 | Bacteria | 875 |
| 393 | Ga0207679_10000479 | 3300025945 | Bacteria | 28104 |
| 394 | Ga0207679_10163688 | 3300025945 | Bacteria | 1824 |
| 395 | Ga0207679_10187253 | 3300025945 | Bacteria | 1717 |
| 396 | Ga0207679_10368414 | 3300025945 | Bacteria | 1257 |
| 397 | Ga0207679_10627920 | 3300025945 | Bacteria | 970 |
| 398 | Ga0207679_10652008 | 3300025945 | Bacteria | 952 |
| 399 | Ga0207667_10010498 | 3300025949 | Bacteria | 10822 |
| 400 | Ga0207667_10059037 | 3300025949 | Bacteria | 4020 |
| 401 | Ga0207667_10272095 | 3300025949 | Bacteria | 1731 |
| 402 | Ga0207651_10003835 | 3300025960 | Bacteria | 7453 |
| 403 | Ga0207651_10030265 | 3300025960 | Bacteria | 3444 |
| 404 | Ga0207651_10057545 | 3300025960 | Bacteria | 2682 |
| 405 | Ga0207651_10065446 | 3300025960 | Bacteria | 2549 |
| 406 | Ga0207712_10000723 | 3300025961 | Bacteria | 25323 |
| 407 | Ga0207712_10005054 | 3300025961 | Bacteria | 8350 |
| 408 | Ga0207668_10000062 | 3300025972 | Bacteria | 88123 |
| 409 | Ga0207668_10188385 | 3300025972 | Bacteria | 1633 |
| 410 | Ga0207668_10418953 | 3300025972 | Bacteria | 1136 |
| 411 | Ga0207640_10049362 | 3300025981 | Bacteria | 2724 |
| 412 | Ga0207640_10054766 | 3300025981 | Bacteria | 2609 |
| 413 | Ga0207640_10072842 | 3300025981 | Bacteria | 2319 |
| 414 | Ga0207640_10111900 | 3300025981 | Bacteria | 1937 |
| 415 | Ga0207640_10426957 | 3300025981 | Bacteria | 1086 |
| 416 | Ga0207640_10581031 | 3300025981 | Bacteria | 946 |
| 417 | Ga0207658_10005476 | 3300025986 | Bacteria | 8703 |
| 418 | Ga0207658_10010246 | 3300025986 | Bacteria | 6368 |
| 419 | Ga0207658_10158701 | 3300025986 | Bacteria | 1851 |
| 420 | Ga0207658_10343760 | 3300025986 | Bacteria | 1297 |
| 421 | Ga0207677_10002162 | 3300026023 | Bacteria | 10328 |
| 422 | Ga0207703_10005190 | 3300026035 | Bacteria | 10525 |
| 423 | Ga0207703_10019493 | 3300026035 | Bacteria | 5302 |
| 424 | Ga0207703_10028602 | 3300026035 | Bacteria | 4395 |
| 425 | Ga0207703_10125792 | 3300026035 | Bacteria | 2207 |
| 426 | Ga0207639_10000546 | 3300026041 | Bacteria | 25792 |
| 427 | Ga0207639_10001294 | 3300026041 | Bacteria | 16898 |
| 428 | Ga0207639_10033955 | 3300026041 | Bacteria | 3767 |
| 429 | Ga0207639_10303397 | 3300026041 | Bacteria | 1412 |
| 430 | Ga0207639_10396244 | 3300026041 | Bacteria | 1243 |
| 431 | Ga0207639_10568869 | 3300026041 | Bacteria | 1042 |
| 432 | Ga0207678_10008075 | 3300026067 | Bacteria | 9280 |
| 433 | Ga0207678_10013749 | 3300026067 | Bacteria | 7109 |
| 434 | Ga0207678_10028891 | 3300026067 | Bacteria | 4840 |
| 435 | Ga0207678_10054170 | 3300026067 | Bacteria | 3454 |
| 436 | Ga0207678_10225761 | 3300026067 | Bacteria | 1603 |
| 437 | Ga0207702_10012978 | 3300026078 | Bacteria | 6931 |
| 438 | Ga0207702_10020714 | 3300026078 | Bacteria | 5438 |
| 439 | Ga0207702_10047612 | 3300026078 | Bacteria | 3614 |
| 440 | Ga0207702_10141558 | 3300026078 | Bacteria | 2177 |
| 441 | Ga0207702_10324438 | 3300026078 | Bacteria | 1467 |
| 442 | Ga0207702_10754755 | 3300026078 | Bacteria | 960 |
| 443 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 444 | Ga0207641_10020933 | 3300026088 | Bacteria | 5376 |
| 445 | Ga0207641_10042964 | 3300026088 | Bacteria | 3793 |
| 446 | Ga0207641_10067620 | 3300026088 | Bacteria | 3061 |
| 447 | Ga0207641_10209119 | 3300026088 | Bacteria | 1803 |
| 448 | Ga0207648_10008052 | 3300026089 | Bacteria | 10268 |
| 449 | Ga0207648_10009676 | 3300026089 | Bacteria | 9220 |
| 450 | Ga0207648_10012702 | 3300026089 | Bacteria | 7870 |
| 451 | Ga0207676_10000044 | 3300026095 | Bacteria | 161679 |
| 452 | Ga0207676_10010620 | 3300026095 | Bacteria | 6564 |
| 453 | Ga0207676_10022848 | 3300026095 | Bacteria | 4605 |
| 454 | Ga0207676_10247685 | 3300026095 | Bacteria | 1602 |
| 455 | Ga0207674_10048053 | 3300026116 | Bacteria | 4371 |
| 456 | Ga0207674_10149917 | 3300026116 | Bacteria | 2290 |
| 457 | Ga0207675_100301257 | 3300026118 | Bacteria | 1561 |
| 458 | Ga0207675_100353123 | 3300026118 | Bacteria | 1441 |
| 459 | Ga0207675_101236096 | 3300026118 | Bacteria | 767 |
| 460 | Ga0207683_10007887 | 3300026121 | Bacteria | 9107 |
| 461 | Ga0207683_10034570 | 3300026121 | Bacteria | 4392 |
| 462 | Ga0207683_10039250 | 3300026121 | Bacteria | 4130 |
| 463 | Ga0207683_10108426 | 3300026121 | Bacteria | 2485 |
| 464 | Ga0207683_11038906 | 3300026121 | Bacteria | 760 |
| 465 | Ga0207698_10012178 | 3300026142 | Bacteria | 5615 |
| 466 | Ga0209967_1008386 | 3300027364 | Bacteria | 1422 |
| 467 | Ga0209974_10034981 | 3300027876 | Bacteria | 1668 |
| 468 | Ga0209974_10195648 | 3300027876 | Bacteria | 745 |
| 469 | Ga0268266_10000733 | 3300028379 | Bacteria | 44017 |
| 470 | Ga0268266_10027292 | 3300028379 | Bacteria | 4855 |
| 471 | Ga0268266_10053791 | 3300028379 | Bacteria | 3459 |
| 472 | Ga0268266_10118901 | 3300028379 | Bacteria | 2349 |
| 473 | Ga0268266_10158155 | 3300028379 | Bacteria | 2048 |
| 474 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 475 | Ga0268265_10009247 | 3300028380 | Bacteria | 6660 |
| 476 | Ga0268264_10045694 | 3300028381 | Bacteria | 3636 |
| 477 | Ga0268264_10205367 | 3300028381 | Bacteria | 1805 |
| 478 | Ga0268264_10229824 | 3300028381 | Bacteria | 1712 |
| 479 | Ga0268264_10539944 | 3300028381 | Bacteria | 1142 |
| 480 | Ga0268264_10602394 | 3300028381 | Bacteria | 1083 |
| 481 | Ga0265338_10084073 | 3300028800 | Bacteria | 2659 |
| 482 | Ga0265338_10098220 | 3300028800 | Bacteria | 2396 |
| 483 | Ga0316180_1083564 | 3300030736 | Bacteria | 743 |
| 484 | Ga0307509_10592510 | 3300031507 | Bacteria | 782 |
| 485 | Ga0307408_100044067 | 3300031548 | Bacteria | 3178 |
| 486 | Ga0265313_10016941 | 3300031595 | Bacteria | 4166 |
| 487 | Ga0307508_10004384 | 3300031616 | Bacteria | 13803 |
| 488 | Ga0307405_10088296 | 3300031731 | Bacteria | 2045 |
| 489 | Ga0307405_10109637 | 3300031731 | Bacteria | 1867 |
| 490 | Ga0307413_10169219 | 3300031824 | Bacteria | 1544 |
| 491 | Ga0307413_10320839 | 3300031824 | Bacteria | 1183 |
| 492 | Ga0307413_10878938 | 3300031824 | Bacteria | 759 |
| 493 | Ga0307410_10036572 | 3300031852 | Bacteria | 3198 |
| 494 | Ga0307410_10064289 | 3300031852 | Bacteria | 2520 |
| 495 | Ga0307410_10104548 | 3300031852 | Bacteria | 2036 |
| 496 | Ga0307410_10477646 | 3300031852 | Bacteria | 1022 |
| 497 | Ga0307410_10690448 | 3300031852 | Bacteria | 859 |
| 498 | Ga0307406_10012911 | 3300031901 | Bacteria | 4773 |
| 499 | Ga0307406_10088249 | 3300031901 | Bacteria | 2080 |
| 500 | Ga0307406_10169327 | 3300031901 | Bacteria | 1579 |
| 501 | Ga0307406_10285417 | 3300031901 | Bacteria | 1261 |
| 502 | Ga0307407_10034803 | 3300031903 | Bacteria | 2761 |
| 503 | Ga0307409_100010580 | 3300031995 | Bacteria | 5748 |
| 504 | Ga0307409_100039888 | 3300031995 | Bacteria | 3489 |
| 505 | Ga0307409_100119335 | 3300031995 | Bacteria | 2229 |
| 506 | Ga0307409_100361320 | 3300031995 | Bacteria | 1373 |
| 507 | Ga0307409_100600802 | 3300031995 | Bacteria | 1087 |
| 508 | Ga0307409_100672773 | 3300031995 | Bacteria | 1031 |
| 509 | Ga0307409_101084433 | 3300031995 | Bacteria | 821 |
| 510 | Ga0307416_100022017 | 3300032002 | Bacteria | 4589 |
| 511 | Ga0307414_10014366 | 3300032004 | Bacteria | 4746 |
| 512 | Ga0307414_10027901 | 3300032004 | Bacteria | 3654 |
| 513 | Ga0307414_10052296 | 3300032004 | Bacteria | 2841 |
| 514 | Ga0307414_10060390 | 3300032004 | Bacteria | 2681 |
| 515 | Ga0307414_11005772 | 3300032004 | Bacteria | 767 |
| 516 | Ga0307411_10011344 | 3300032005 | Bacteria | 4806 |
| 517 | Ga0307411_10029834 | 3300032005 | Bacteria | 3336 |
| 518 | Ga0307411_10038989 | 3300032005 | Bacteria | 3002 |
| 519 | Ga0307411_10050369 | 3300032005 | Bacteria | 2711 |
| 520 | Ga0307411_10052077 | 3300032005 | Bacteria | 2674 |
| 521 | Ga0307411_10372842 | 3300032005 | Bacteria | 1171 |
| 522 | Ga0307415_100005316 | 3300032126 | Bacteria | 6819 |
| 523 | Ga0307415_100039321 | 3300032126 | Bacteria | 3125 |
| 524 | Ga0307415_100052250 | 3300032126 | Bacteria | 2778 |
| 525 | Ga0307415_100693019 | 3300032126 | Bacteria | 918 |
| 526 | Ga0307415_101574756 | 3300032126 | Bacteria | 630 |
| 527 | Ga0373949_0021042 | 3300035090 | Bacteria | 1497 |
| 528 | Ga0373952_0063600 | 3300035092 | Bacteria | 908 |
| 529 | Ga0373932_0025680 | 3300035112 | Bacteria | 1597 |
| 530 | Ga0373936_0054026 | 3300035113 | Bacteria | 1629 |
| 531 | Ga0373941_0178523 | 3300035115 | Bacteria | 795 |
| 532 | Ga0373954_0047929 | 3300035118 | Bacteria | 2001 |
| 533 | Ga0373943_0024258 | 3300035170 | Bacteria | 2827 |
| 534 | Ga0373946_0016952 | 3300035171 | Bacteria | 2782 |
| 535 | Ga0373961_0013736 | 3300035241 | Bacteria | 2046 |
| 536 | Ga0373962_0132032 | 3300035242 | Bacteria | 805 |
| 537 | Ga0373931_0004862 | 3300035691 | Bacteria | 6172 |
| 538 | Ga0373931_0303033 | 3300035691 | Bacteria | 987 |
| 539 | Ga0373935_0035783 | 3300035692 | Bacteria | 3100 |
| 540 | Ga0373935_0657379 | 3300035692 | Bacteria | 769 |
| 541 | Ga0373927_0095889 | 3300035695 | Bacteria | 1928 |
| 542 | Ga0373933_0054385 | 3300035724 | Bacteria | 2399 |
| 543 | Ga0373933_0144089 | 3300035724 | Bacteria | 1506 |
| 544 | Ga0373937_0004874 | 3300036401 | Bacteria | 11407 |
| 545 | Ga0373937_0536967 | 3300036401 | Bacteria | 1111 |
| 546 | Ga0373937_0593682 | 3300036401 | Bacteria | 1051 |
| 547 | Ga0395899_0000973 | 3300037312 | Bacteria | 26472 |
| 548 | Ga0395899_0003333 | 3300037312 | Bacteria | 12734 |
| 549 | Ga0395899_0004515 | 3300037312 | Bacteria | 10849 |
| 550 | Ga0395899_0007993 | 3300037312 | Bacteria | 8146 |
| 551 | Ga0395899_0018580 | 3300037312 | Bacteria | 5282 |
| 552 | Ga0395899_0032872 | 3300037312 | Bacteria | 3898 |
| 553 | Ga0395899_0034409 | 3300037312 | Bacteria | 3804 |
| 554 | Ga0395899_0065531 | 3300037312 | Bacteria | 2669 |
| 555 | Ga0395899_0198723 | 3300037312 | Bacteria | 1399 |
| 556 | Ga0395899_0264762 | 3300037312 | Bacteria | 1174 |
| 557 | Ga0395899_0287023 | 3300037312 | Bacteria | 1117 |
| 558 | Ga0395899_0417332 | 3300037312 | Bacteria | 885 |
| 559 | Ga0395899_0614466 | 3300037312 | Bacteria | 691 |
| 560 | Ga0395900_0000221 | 3300037418 | Bacteria | 89883 |
| 561 | Ga0395900_0000777 | 3300037418 | Bacteria | 42484 |
| 562 | Ga0395900_0001512 | 3300037418 | Bacteria | 27627 |
| 563 | Ga0395900_0016898 | 3300037418 | Bacteria | 7448 |
| 564 | Ga0395900_0019486 | 3300037418 | Bacteria | 6917 |
| 565 | Ga0395900_0032553 | 3300037418 | Bacteria | 5361 |
| 566 | Ga0395900_0037027 | 3300037418 | Bacteria | 5030 |
| 567 | Ga0395900_0052767 | 3300037418 | Bacteria | 4185 |
| 568 | Ga0395900_0063383 | 3300037418 | Bacteria | 3799 |
| 569 | Ga0395900_0073832 | 3300037418 | Bacteria | 3507 |
| 570 | Ga0395900_0077937 | 3300037418 | Bacteria | 3405 |
| 571 | Ga0395900_0194556 | 3300037418 | Bacteria | 2055 |
| 572 | Ga0395900_0205610 | 3300037418 | Bacteria | 1990 |
| 573 | Ga0395900_0206850 | 3300037418 | Bacteria | 1983 |
| 574 | Ga0395900_0376050 | 3300037418 | Bacteria | 1389 |
| 575 | Ga0395900_0393339 | 3300037418 | Bacteria | 1352 |
| 576 | Ga0395900_0508537 | 3300037418 | Bacteria | 1154 |
| 577 | Ga0395900_0545717 | 3300037418 | Bacteria | 1104 |
| 578 | Ga0395900_0849529 | 3300037418 | Bacteria | 838 |
| 579 | Ga0395898_0000053 | 3300037466 | Bacteria | 279600 |
| 580 | Ga0395898_0004457 | 3300037466 | Bacteria | 15305 |
| 581 | Ga0395898_0015175 | 3300037466 | Bacteria | 7908 |
| 582 | Ga0395898_0024657 | 3300037466 | Bacteria | 6067 |
| 583 | Ga0395898_0101641 | 3300037466 | Bacteria | 2760 |
| 584 | Ga0395898_0122083 | 3300037466 | Bacteria | 2496 |
| 585 | Ga0395898_0158880 | 3300037466 | Bacteria | 2162 |
| 586 | Ga0395898_0302953 | 3300037466 | Bacteria | 1524 |
| 587 | Ga0395898_0881500 | 3300037466 | Bacteria | 833 |
| 588 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 589 | Ga0395905_0001351 | 3300037471 | Bacteria | 29880 |
| 590 | Ga0395905_0006929 | 3300037471 | Bacteria | 11331 |
| 591 | Ga0395905_0011337 | 3300037471 | Bacteria | 8620 |
| 592 | Ga0395905_0018068 | 3300037471 | Bacteria | 6694 |
| 593 | Ga0395905_0021621 | 3300037471 | Bacteria | 6084 |
| 594 | Ga0395905_0040916 | 3300037471 | Bacteria | 4348 |
| 595 | Ga0395905_0082765 | 3300037471 | Bacteria | 3007 |
| 596 | Ga0395905_0083769 | 3300037471 | Bacteria | 2987 |
| 597 | Ga0395905_0094768 | 3300037471 | Bacteria | 2800 |
| 598 | Ga0395905_0101879 | 3300037471 | Bacteria | 2695 |
| 599 | Ga0395905_0121007 | 3300037471 | Bacteria | 2460 |
| 600 | Ga0395905_0130924 | 3300037471 | Bacteria | 2359 |
| 601 | Ga0395905_0131969 | 3300037471 | Bacteria | 2349 |
| 602 | Ga0395905_0133874 | 3300037471 | Bacteria | 2331 |
| 603 | Ga0395905_0141893 | 3300037471 | Bacteria | 2259 |
| 604 | Ga0395905_0188908 | 3300037471 | Bacteria | 1933 |
| 605 | Ga0395905_0233950 | 3300037471 | Bacteria | 1718 |
| 606 | Ga0395905_0235648 | 3300037471 | Bacteria | 1711 |
| 607 | Ga0395905_0240529 | 3300037471 | Bacteria | 1691 |
| 608 | Ga0395905_0385604 | 3300037471 | Bacteria | 1295 |
| 609 | Ga0395905_0406618 | 3300037471 | Bacteria | 1256 |
| 610 | Ga0395905_0444862 | 3300037471 | Bacteria | 1193 |
| 611 | Ga0395905_0549238 | 3300037471 | Bacteria | 1056 |
| 612 | Ga0395905_1081499 | 3300037471 | Bacteria | 705 |
| 613 | Ga0395901_0000440 | 3300038443 | Bacteria | 48641 |
| 614 | Ga0395901_0002264 | 3300038443 | Bacteria | 19637 |
| 615 | Ga0395901_0005009 | 3300038443 | Bacteria | 13375 |
| 616 | Ga0395901_0007805 | 3300038443 | Bacteria | 10798 |
| 617 | Ga0395901_0015216 | 3300038443 | Bacteria | 7827 |
| 618 | Ga0395901_0016489 | 3300038443 | Bacteria | 7527 |
| 619 | Ga0395901_0024866 | 3300038443 | Bacteria | 6147 |
| 620 | Ga0395901_0067398 | 3300038443 | Bacteria | 3727 |
| 621 | Ga0395901_0089082 | 3300038443 | Bacteria | 3228 |
| 622 | Ga0395901_0096553 | 3300038443 | Bacteria | 3097 |
| 623 | Ga0395901_0119271 | 3300038443 | Bacteria | 2772 |
| 624 | Ga0395901_0176180 | 3300038443 | Bacteria | 2243 |
| 625 | Ga0395901_0288329 | 3300038443 | Bacteria | 1704 |
| 626 | Ga0395901_0294825 | 3300038443 | Bacteria | 1682 |
| 627 | Ga0395901_0349711 | 3300038443 | Bacteria | 1525 |
| 628 | Ga0436365_0516111 | 3300039437 | Bacteria | 956 |
| 629 | Ga0436365_0591004 | 3300039437 | Bacteria | 16573 |
| 630 | Ga0436365_0789764 | 3300039437 | Bacteria | 2228 |
| 631 | Ga0436365_1801999 | 3300039437 | Bacteria | 28927 |
| 632 | Ga0436362_0385235 | 3300039453 | Bacteria | 33119 |
| 633 | Ga0439438_069322 | 3300041405 | Bacteria | 874 |
| 634 | Ga0451802_2140950 | 3300041460 | Bacteria | 964 |
| 635 | Ga0439448_0007143 | 3300042005 | Bacteria | 3228 |
| 636 | Ga0439448_0032769 | 3300042005 | Bacteria | 1655 |
| 637 | Ga0439455_0005348 | 3300042012 | Bacteria | 2603 |
| 638 | Ga0450920_053062 | 3300042122 | Bacteria | 814 |
| 639 | Ga0450890_005037 | 3300042127 | Bacteria | 1708 |
| 640 | Ga0450905_000429 | 3300042142 | Bacteria | 5145 |
| 641 | Ga0450889_000192 | 3300042144 | Bacteria | 6656 |
| 642 | Ga0439458_0009992 | 3300042157 | Bacteria | 2114 |
| 643 | Ga0439458_0018501 | 3300042157 | Bacteria | 1597 |
| 644 | Ga0439434_0130739 | 3300042435 | Bacteria | 823 |
| 645 | Ga0466969_0044744 | 3300044656 | Bacteria | 2200 |
| 646 | Ga0466972_0097007 | 3300044658 | Bacteria | 1396 |
| 647 | Ga0466965_0095258 | 3300044683 | Bacteria | 1518 |
| 648 | Ga0466966_0017916 | 3300044684 | Bacteria | 4676 |
| 649 | Ga0466966_0029704 | 3300044684 | Bacteria | 3554 |
| 650 | Ga0466966_0391808 | 3300044684 | Bacteria | 834 |
| 651 | Ga0466963_0002507 | 3300044694 | Bacteria | 10277 |
| 652 | Ga0466963_0209017 | 3300044694 | Bacteria | 1365 |
| 653 | Ga0466963_0258016 | 3300044694 | Bacteria | 1224 |
| 654 | Ga0466963_0337192 | 3300044694 | Bacteria | 1061 |
| 655 | Ga0466963_0628365 | 3300044694 | Bacteria | 758 |
| 656 | Ga0466964_0054893 | 3300044706 | Bacteria | 1644 |
| 657 | Ga0466971_0182073 | 3300044719 | Bacteria | 988 |
| 658 | Ga0466970_0003469 | 3300044765 | Bacteria | 7681 |
| 659 | Ga0466970_0178483 | 3300044765 | Bacteria | 1178 |
| 660 | Ga0466957_0021853 | 3300044842 | Bacteria | 3772 |
| 661 | Ga0466957_0033832 | 3300044842 | Bacteria | 3066 |
| 662 | Ga0466957_0058830 | 3300044842 | Bacteria | 2354 |
| 663 | Ga0466957_0066362 | 3300044842 | Bacteria | 2224 |
| 664 | Ga0466957_0897574 | 3300044842 | Bacteria | 633 |
| 665 | Ga0466960_0135974 | 3300044901 | Bacteria | 1301 |
| 666 | Ga0466960_0354915 | 3300044901 | Bacteria | 837 |
| 667 | Ga0466959_0109870 | 3300045049 | Bacteria | 1968 |
| 668 | Ga0466959_0218379 | 3300045049 | Bacteria | 1323 |
| 669 | Ga0466959_0464421 | 3300045049 | Bacteria | 857 |
| 670 | Ga0466958_0000676 | 3300045836 | Bacteria | 14782 |
| 671 | Ga0466958_0050608 | 3300045836 | Bacteria | 2515 |
| 672 | Ga0466958_0259367 | 3300045836 | Bacteria | 1112 |
| 673 | Ga0466967_0002603 | 3300045976 | Bacteria | 11343 |
| 674 | Ga0466967_0004260 | 3300045976 | Bacteria | 9609 |
| 675 | Ga0466967_0019017 | 3300045976 | Bacteria | 5513 |
| 676 | Ga0466967_0091181 | 3300045976 | Bacteria | 2769 |
| 677 | Ga0466967_0220391 | 3300045976 | Bacteria | 1802 |
| 678 | Ga0466967_0240355 | 3300045976 | Bacteria | 1727 |
| 679 | Ga0466967_0487412 | 3300045976 | Bacteria | 1208 |
| 680 | Ga0466967_0594307 | 3300045976 | Bacteria | 1092 |
| 681 | Ga0466967_0824716 | 3300045976 | Bacteria | 921 |
| 682 | Ga0466967_1392654 | 3300045976 | Bacteria | 698 |
| 683 | Ga0495617_006120 | 3300046452 | Bacteria | 4239 |
| 684 | Ga0495582_0266549 | 3300046473 | Bacteria | 983 |
| 685 | Ga0495616_0254005 | 3300046513 | Bacteria | 754 |
| 686 | Ga0495643_0407929 | 3300046522 | Bacteria | 598 |
| 687 | Ga0495663_0014591 | 3300046525 | Bacteria | 2203 |
| 688 | Ga0495663_0015333 | 3300046525 | Bacteria | 2158 |
| 689 | Ga0495642_0341043 | 3300046528 | Bacteria | 658 |
| 690 | Ga0495652_0326049 | 3300046529 | Bacteria | 1108 |
| 691 | Ga0495598_0000288 | 3300046537 | Bacteria | 9105 |
| 692 | Ga0495621_0000258 | 3300046539 | Bacteria | 12621 |
| 693 | Ga0495633_0034072 | 3300046558 | Bacteria | 2451 |
| 694 | Ga0495668_0036982 | 3300046616 | Bacteria | 2733 |
| 695 | Ga0495625_0131550 | 3300046660 | Bacteria | 1695 |
| 696 | Ga0495659_0128080 | 3300046664 | Bacteria | 1005 |
| 697 | Ga0495647_0438268 | 3300046681 | Bacteria | 604 |
| 698 | Ga0495669_0004902 | 3300046684 | Bacteria | 5555 |
| 699 | Ga0495669_0016565 | 3300046684 | Bacteria | 3157 |
| 700 | Ga0495669_0077869 | 3300046684 | Bacteria | 1519 |
| 701 | Ga0495669_0260884 | 3300046684 | Bacteria | 832 |
| 702 | Ga0495670_0000690 | 3300046691 | Bacteria | 16043 |
| 703 | Ga0495687_106026 | 3300047443 | Bacteria | 1044 |
| 704 | Ga0495677_0002083 | 3300047445 | Bacteria | 7960 |
| 705 | Ga0495602_0310362 | 3300048088 | Bacteria | 1151 |
| 706 | Ga0496101_0041762 | 3300048904 | Bacteria | 3272 |
| 707 | Ga0496102_0121289 | 3300048905 | Bacteria | 2442 |
| 708 | Ga0496102_0370806 | 3300048905 | Bacteria | 1347 |
| 709 | Ga0496103_0142207 | 3300048906 | Bacteria | 1535 |
| 710 | Ga0496103_0509593 | 3300048906 | Bacteria | 770 |
| 711 | Ga0496107_0188000 | 3300048910 | Bacteria | 1534 |
| 712 | Ga0496107_0878012 | 3300048910 | Bacteria | 654 |
| 713 | Ga0496108_0029105 | 3300048911 | Bacteria | 4572 |
| 714 | Ga0496109_0006427 | 3300048912 | Bacteria | 9898 |
| 715 | Ga0496109_0179806 | 3300048912 | Bacteria | 1986 |
| 716 | Ga0496109_0996613 | 3300048912 | Bacteria | 775 |
| 717 | Ga0496111_0190768 | 3300048914 | Bacteria | 1523 |
| 718 | Ga0496111_0260005 | 3300048914 | Bacteria | 1288 |
| 719 | Ga0496112_0023006 | 3300048915 | Bacteria | 5947 |
| 720 | Ga0496112_0046192 | 3300048915 | Bacteria | 4270 |
| 721 | Ga0496112_0446365 | 3300048915 | Bacteria | 1231 |
| 722 | Ga0496113_0013267 | 3300048916 | Bacteria | 5576 |
| 723 | Ga0496113_0025913 | 3300048916 | Bacteria | 4187 |
| 724 | Ga0496113_0444333 | 3300048916 | Bacteria | 1042 |
| 725 | Ga0496113_1003976 | 3300048916 | Bacteria | 657 |
| 726 | Ga0496114_0669028 | 3300048917 | Bacteria | 912 |
| 727 | Ga0496117_0034695 | 3300048920 | Bacteria | 3798 |
| 728 | Ga0496118_0019807 | 3300048921 | Bacteria | 6000 |
| 729 | Ga0496126_0061468 | 3300048929 | Bacteria | 3374 |
| 730 | Ga0501306_051874 | 3300049127 | Bacteria | 659 |
| 731 | Ga0501292_000088 | 3300049515 | Bacteria | 16990 |
| 732 | Ga0501294_000241 | 3300049517 | Bacteria | 6800 |
| 733 | Ga0501300_003094 | 3300049523 | Bacteria | 2482 |
| 734 | Ga0501315_014184 | 3300049531 | Bacteria | 1007 |
| 735 | Ga0501033_0071178 | 3300049570 | Bacteria | 2555 |
| 736 | Ga0501034_0076662 | 3300049571 | Bacteria | 3350 |
| 737 | Ga0501047_0025996 | 3300049581 | Bacteria | 5629 |
| 738 | Ga0501067_0022624 | 3300049583 | Bacteria | 3478 |
| 739 | Ga0501067_0136164 | 3300049583 | Bacteria | 1368 |
| 740 | Ga0501068_0371216 | 3300049584 | Bacteria | 921 |
| 741 | Ga0501069_0049843 | 3300049585 | Bacteria | 2328 |
| 742 | Ga0501070_0193460 | 3300049586 | Bacteria | 1671 |
| 743 | Ga0501071_0282657 | 3300049587 | Bacteria | 1256 |
| 744 | Ga0501072_0015507 | 3300049588 | Bacteria | 5840 |
| 745 | Ga0501073_0004494 | 3300049589 | Bacteria | 10476 |
| 746 | Ga0501074_0030693 | 3300049590 | Bacteria | 3895 |
| 747 | Ga0501074_0036865 | 3300049590 | Bacteria | 3543 |
| 748 | Ga0501206_000112 | 3300049653 | Bacteria | 8412 |
| 749 | Ga0501224_000219 | 3300049664 | Bacteria | 6508 |
| 750 | Ga0501227_008045 | 3300049665 | Bacteria | 2263 |
| 751 | Ga0501235_000736 | 3300049669 | Bacteria | 6680 |
| 752 | Ga0501257_050098 | 3300049686 | Bacteria | 1040 |
| 753 | Ga0501259_000816 | 3300049688 | Bacteria | 5117 |
| 754 | Ga0501261_000417 | 3300049690 | Bacteria | 5575 |
| 755 | Ga0501225_0000787 | 3300049705 | Bacteria | 9923 |
| 756 | Ga0501245_003064 | 3300049708 | Bacteria | 2256 |
| 757 | Ga0501080_0034392 | 3300049742 | Bacteria | 4731 |
| 758 | Ga0501080_0369798 | 3300049742 | Bacteria | 1293 |
| 759 | Ga0501279_000074 | 3300049775 | Bacteria | 16852 |
| 760 | Ga0501280_000191 | 3300049776 | Bacteria | 15378 |
| 761 | Ga0501281_00081 | 3300049777 | Bacteria | 11133 |
| 762 | Ga0501282_000381 | 3300049778 | Bacteria | 5364 |
| 763 | Ga0501283_010678 | 3300049779 | Bacteria | 1354 |
| 764 | Ga0501035_0778342 | 3300049822 | Bacteria | 766 |
| 765 | Ga0501044_0536728 | 3300049823 | Bacteria | 1068 |
| 766 | Ga0501044_0947156 | 3300049823 | Bacteria | 734 |
| 767 | nmdc:mga06r32_258210_c1 | 3300050510 | Bacteria | 1730 |
| 768 | nmdc:mga0n895_162161_c1 | 3300050512 | Bacteria | 2267 |
| 769 | Ga0495655_0059720 | 3300053083 | Bacteria | 1036 |
| 770 | Ga0500554_235206 | 3300053102 | Bacteria | 607 |
| 771 | Ga0500595_000405 | 3300053119 | Bacteria | 27569 |
| 772 | Ga0500595_016123 | 3300053119 | Bacteria | 2789 |
| 773 | Ga0500559_0434538 | 3300053136 | Bacteria | 608 |
| 774 | Ga0501084_0074161 | 3300054114 | Bacteria | 2849 |
| 775 | Ga0587084_022667 | 3300059477 | Bacteria | 952 |
| 776 | Ga0501082_0555027 | 3300060353 | Bacteria | 1005 |
| 777 | Ga0466962_0020301 | 3300061719 | Bacteria | 3193 |
| 778 | Ga0466962_0206174 | 3300061719 | Bacteria | 961 |
| 779 | 2507509763 | 2507262055 | Bacteria | 8048963 |
| 780 | 2508543779 | 2508501009 | Bacteria | 7784016 |
| 781 | 2508698433 | 2508501042 | Bacteria | 8719808 |
| 782 | 2515630025 | 2515154112 | Bacteria | 8294334 |
| 783 | 2793060263 | 2791355196 | Bacteria | 7323613 |
| 784 | 2809064865 | 2808606401 | Bacteria | 4586670 |
| 785 | 2809080832 | 2808606404 | Bacteria | 4652788 |
| 786 | 2809085197 | 2808606405 | Bacteria | 4586632 |
| 787 | 2848298250 | 2848297114 | Bacteria | 3608511 |
| 788 | 2874595128 | 2874590934 | Bacteria | 8299676 |
| 789 | 2874632704 | 2874628541 | Bacteria | 8630250 |
| 790 | 2874650989 | 2874645413 | Bacteria | 8214782 |
| 791 | 2876775064 | 2876771140 | Bacteria | 8287509 |
| 792 | 2876823879 | 2876818435 | Bacteria | 8274608 |
| 793 | 2879080507 | 2879074833 | Bacteria | 8279565 |
| 794 | 2879149198 | 2879142872 | Bacteria | 8267021 |
| 795 | 2880521897 | 2880518877 | Bacteria | 5012590 |
| 796 | 2935611378 | 2935608549 | Bacteria | 8203142 |
| 797 | 2935648762 | 2935648319 | Bacteria | 8801166 |
| 798 | 2935657155 | 2935656913 | Bacteria | 8965014 |
| 799 | 2935820855 | 2935819856 | Bacteria | 8261050 |
| 800 | 2935850885 | 2935847175 | Bacteria | 8228321 |
| 801 | 2935913748 | 2935908558 | Bacteria | 8568796 |
| 802 | 2935920262 | 2935916978 | Bacteria | 9113783 |
| 803 | 2935930601 | 2935926038 | Bacteria | 8601059 |
| 804 | 2935939426 | 2935934488 | Bacteria | 8602579 |
| 805 | 2935946375 | 2935942939 | Bacteria | 8599779 |
| 806 | 2935955786 | 2935951376 | Bacteria | 8602333 |
| 807 | 2935972504 | 2935967501 | Bacteria | 8603075 |
| 808 | 2935981665 | 2935975950 | Bacteria | 8347125 |
| 809 | 2935991040 | 2935984226 | Bacteria | 8302647 |
| 810 | 2936011672 | 2936011229 | Bacteria | 8801034 |
| 811 | 2936020267 | 2936019824 | Bacteria | 8804134 |
| 812 | 2936028962 | 2936028420 | Bacteria | 8965941 |
| 813 | 2936046990 | 2936046547 | Bacteria | 8903709 |
| 814 | 2936058130 | 2936055302 | Bacteria | 8785755 |
| 815 | 8006930380 | 8006926726 | Bacteria | 6749210 |
| 816 | 8016632290 | 8016630954 | Bacteria | 9217207 |
| 817 | 8019626842 | 8019619141 | Bacteria | 9218857 |
| 818 | 8019644015 | 8019638758 | Bacteria | 9062356 |
| 819 | 8019663466 | 8019659431 | Bacteria | 8577854 |
| 820 | 8019673080 | 8019668869 | Bacteria | 8791617 |
| 821 | 8019683060 | 8019678201 | Bacteria | 8863603 |
| 822 | 8019688757 | 8019687851 | Bacteria | 8712826 |
| 823 | Ga0068868_100025177 | |||
| 824 | JGI24741J21665_1010075 | |||
| 825 | JGI24741J21665_1010189 | |||
| 826 | JGI24740J21852_10001392 | |||
| 827 | JGI24740J21852_10006828 | |||
| 828 | JGI24740J21852_10037057 | |||
| 829 | JGI24739J22299_10010528 | |||
| 830 | JGI24739J22299_10041361 | |||
| 831 | JGI24737J22298_10063939 | |||
| 832 | JGI24735J21928_10019234 | |||
| 833 | JGI24735J21928_10162953 | |||
| 834 | JGI24738J21930_10002194 | |||
| 835 | JGI24738J21930_10019404 | |||
| 836 | JGI24744J21845_10000034 | |||
| 837 | Ga0065715_10244338 | |||
| 838 | Ga0065715_10273178 | |||
| 839 | Ga0070658_10013640 | |||
| 840 | Ga0070658_10020583 | |||
| 841 | Ga0070658_10057953 | |||
| 842 | Ga0070658_10091541 | |||
| 843 | Ga0070658_10173973 | |||
| 844 | Ga0070658_10493973 | |||
| 845 | Ga0070676_10435944 | |||
| 846 | Ga0070676_10446567 | |||
| 847 | Ga0070683_100094211 | |||
| 848 | Ga0070683_100097247 | |||
| 849 | Ga0070683_100177271 | |||
| 850 | Ga0070683_100243466 | |||
| 851 | Ga0070683_101442549 | |||
| 852 | Ga0070690_100012042 | |||
| 853 | Ga0070670_100000075 | |||
| 854 | Ga0070670_100026404 | |||
| 855 | Ga0070670_100037046 | |||
| 856 | Ga0070670_100037322 | |||
| 857 | Ga0070677_10027811 | |||
| 858 | Ga0068869_100150340 | |||
| 859 | Ga0068869_100360088 | |||
| 860 | Ga0070666_10003597 | |||
| 861 | Ga0070666_10068528 | |||
| 862 | Ga0070666_10090661 | |||
| 863 | Ga0070666_10128663 | |||
| 864 | Ga0070680_100103412 | |||
| 865 | Ga0070682_100034188 | |||
| 866 | Ga0070682_100274812 | |||
| 867 | Ga0070682_100822228 | |||
| 868 | Ga0068868_100089899 | |||
| 869 | Ga0068868_100107056 | |||
| 870 | Ga0070660_100002891 | |||
| 871 | Ga0070660_100007791 | |||
| 872 | Ga0070660_100013592 | |||
| 873 | Ga0070660_100015088 | |||
| 874 | Ga0070660_100032871 | |||
| 875 | Ga0070660_100502673 | |||
| 876 | Ga0070661_100000378 | |||
| 877 | Ga0070661_100255929 | |||
| 878 | Ga0070661_100620340 | |||
| 879 | Ga0070692_10028912 | |||
| 880 | Ga0070668_100023561 | |||
| 881 | Ga0070668_100179313 | |||
| 882 | Ga0070668_100381347 | |||
| 883 | Ga0070669_100054545 | |||
| 884 | Ga0070669_100101961 | |||
| 885 | Ga0070669_100160283 | |||
| 886 | Ga0070669_100423805 | |||
| 887 | Ga0070675_100025299 | |||
| 888 | Ga0070675_100060735 | |||
| 889 | Ga0070675_100725811 | |||
| 890 | Ga0070671_100029750 | |||
| 891 | Ga0070671_100060355 | |||
| 892 | Ga0070671_100066753 | |||
| 893 | Ga0070671_100151152 | |||
| 894 | Ga0070671_100182567 | |||
| 895 | Ga0070671_100691263 | |||
| 896 | Ga0070674_100128556 | |||
| 897 | Ga0070674_100319241 | |||
| 898 | Ga0070673_100054262 | |||
| 899 | Ga0070673_100079951 | |||
| 900 | Ga0070673_100195999 | |||
| 901 | Ga0070673_100216124 | |||
| 902 | Ga0070673_100486337 | |||
| 903 | Ga0070673_100497276 | |||
| 904 | Ga0070673_101161406 | |||
| 905 | Ga0070659_100011523 | |||
| 906 | Ga0070659_100127240 | |||
| 907 | Ga0070659_100137500 | |||
| 908 | Ga0070659_100499768 | |||
| 909 | Ga0070659_100519321 | |||
| 910 | Ga0070667_100000039 | |||
| 911 | Ga0070667_100011640 | |||
| 912 | Ga0070667_100068943 | |||
| 913 | Ga0070667_100248567 | |||
| 914 | Ga0070714_100175931 | |||
| 915 | Ga0070714_100525585 | |||
| 916 | Ga0070714_100776941 | |||
| 917 | Ga0070713_100323140 | |||
| 918 | Ga0070694_100007775 | |||
| 919 | Ga0070663_100025097 | |||
| 920 | Ga0070663_100031065 | |||
| 921 | Ga0070663_100067856 | |||
| 922 | Ga0070678_100076029 | |||
| 923 | Ga0070678_100151644 | |||
| 924 | Ga0070678_100158074 | |||
| 925 | Ga0070662_100004163 | |||
| 926 | Ga0070662_100017760 | |||
| 927 | Ga0070662_100037731 | |||
| 928 | Ga0070662_100103846 | |||
| 929 | Ga0070662_100195622 | |||
| 930 | Ga0070662_100251285 | |||
| 931 | Ga0070662_100377300 | |||
| 932 | Ga0070681_10169060 | |||
| 933 | Ga0070681_10513451 | |||
| 934 | Ga0070681_10601878 | |||
| 935 | Ga0068867_100004535 | |||
| 936 | Ga0068867_100006865 | |||
| 937 | Ga0070679_100113172 | |||
| 938 | Ga0070684_100057452 | |||
| 939 | Ga0070684_100095295 | |||
| 940 | Ga0070684_100173736 | |||
| 941 | Ga0068853_100000371 | |||
| 942 | Ga0068853_100003315 | |||
| 943 | Ga0068853_100305111 | |||
| 944 | Ga0068853_100338138 | |||
| 945 | Ga0068853_100547001 | |||
| 946 | Ga0070672_100035836 | |||
| 947 | Ga0070672_100117164 | |||
| 948 | Ga0070672_100425167 | |||
| 949 | Ga0070672_100831257 | |||
| 950 | Ga0070696_100013365 | |||
| 951 | Ga0070696_100110546 | |||
| 952 | Ga0070696_101073688 | |||
| 953 | Ga0070693_100001061 | |||
| 954 | Ga0070693_100033553 | |||
| 955 | Ga0070665_100021441 | |||
| 956 | Ga0070665_100023728 | |||
| 957 | Ga0070665_100025177 | |||
| 958 | Ga0070665_100029734 | |||
| 959 | Ga0070665_100117624 | |||
| 960 | Ga0068855_100001629 | |||
| 961 | Ga0068855_100292663 | |||
| 962 | Ga0068855_100504310 | |||
| 963 | Ga0070664_100002298 | |||
| 964 | Ga0070664_100124865 | |||
| 965 | Ga0070664_100128418 | |||
| 966 | Ga0070664_100130693 | |||
| 967 | Ga0068857_100014445 | |||
| 968 | Ga0068857_100039350 | |||
| 969 | Ga0068857_100055675 | |||
| 970 | Ga0068857_100096146 | |||
| 971 | Ga0068854_100036953 | |||
| 972 | Ga0068854_100145560 | |||
| 973 | Ga0068854_100269812 | |||
| 974 | Ga0068854_100310613 | |||
| 975 | Ga0068854_100358554 | |||
| 976 | Ga0068856_100001149 | |||
| 977 | Ga0068856_100065317 | |||
| 978 | Ga0068856_100223268 | |||
| 979 | Ga0068856_100292261 | |||
| 980 | Ga0068856_100719533 | |||
| 981 | Ga0068856_101201918 | |||
| 982 | Ga0068852_100022870 | |||
| 983 | Ga0068852_100048453 | |||
| 984 | Ga0068852_100058630 | |||
| 985 | Ga0068852_100153654 | |||
| 986 | Ga0068852_100435191 | |||
| 987 | Ga0068859_100084174 | |||
| 988 | Ga0068859_101101518 | |||
| 989 | Ga0068864_100000016 | |||
| 990 | Ga0068864_100005877 | |||
| 991 | Ga0068864_100014693 | |||
| 992 | Ga0068864_100439607 | |||
| 993 | Ga0068864_100536480 | |||
| 994 | Ga0068864_101158988 | |||
| 995 | Ga0068866_10054825 | |||
| 996 | Ga0068866_10113156 | |||
| 997 | Ga0068861_101338323 | |||
| 998 | Ga0068851_10014198 | |||
| 999 | Ga0068851_10018029 | |||
| 1000 | Ga0068870_10072422 | |||
| 1001 | Ga0068870_10552141 | |||
| 1002 | Ga0068863_100000033 | |||
| 1003 | Ga0068863_100109342 | |||
| 1004 | Ga0068863_100118096 | |||
| 1005 | Ga0068863_100119724 | |||
| 1006 | Ga0068863_100122714 | |||
| 1007 | Ga0068863_100631205 | |||
| 1008 | Ga0068858_100036141 | |||
| 1009 | Ga0068858_100055697 | |||
| 1010 | Ga0068858_100089325 | |||
| 1011 | Ga0068858_100205265 | |||
| 1012 | Ga0068860_100022352 | |||
| 1013 | Ga0068860_100114263 | |||
| 1014 | Ga0068860_100205727 | |||
| 1015 | Ga0068860_100264367 | |||
| 1016 | Ga0068860_100483376 | |||
| 1017 | Ga0068860_100748923 | |||
| 1018 | Ga0068862_100000040 | |||
| 1019 | Ga0068862_100484321 | |||
| 1020 | Ga0081539_10015398 | |||
| 1021 | Ga0070717_10007362 | |||
| 1022 | Ga0070716_100374378 | |||
| 1023 | Ga0097621_100162639 | |||
| 1024 | Ga0097621_100202842 | |||
| 1025 | Ga0068871_100065028 | |||
| 1026 | Ga0075434_100355198 | |||
| 1027 | Ga0068865_100268959 | |||
| 1028 | Ga0075436_100707040 | |||
| 1029 | Ga0097620_100084175 | |||
| 1030 | Ga0097620_101101476 | |||
| 1031 | Ga0079104_1032594 | |||
| 1032 | Ga0105251_10004716 | |||
| 1033 | Ga0105245_10072535 | |||
| 1034 | Ga0105245_11321456 | |||
| 1035 | Ga0105245_11417475 | |||
| 1036 | Ga0105247_10018821 | |||
| 1037 | Ga0114129_11270946 | |||
| 1038 | Ga0105243_10069992 | |||
| 1039 | Ga0105242_10158169 | |||
| 1040 | Ga0105248_10000021 | |||
| 1041 | Ga0105248_10001425 | |||
| 1042 | Ga0105248_10010652 | |||
| 1043 | Ga0105248_10022689 | |||
| 1044 | Ga0105248_10043820 | |||
| 1045 | Ga0105248_10065969 | |||
| 1046 | Ga0105248_10504523 | |||
| 1047 | Ga0105238_10456040 | |||
| 1048 | Ga0105238_10469713 | |||
| 1049 | Ga0105238_10555783 | |||
| 1050 | Ga0105249_10001881 | |||
| 1051 | Ga0105249_10520247 | |||
| 1052 | Ga0105239_10468251 | |||
| 1053 | Ga0105246_10161931 | |||
| 1054 | Ga0157373_10021771 | |||
| 1055 | Ga0157373_10064751 | |||
| 1056 | Ga0157373_10406158 | |||
| 1057 | Ga0157371_10020175 | |||
| 1058 | Ga0157371_10033548 | |||
| 1059 | Ga0157371_10089328 | |||
| 1060 | Ga0157371_10374672 | |||
| 1061 | Ga0157371_10468101 | |||
| 1062 | Ga0157371_10698031 | |||
| 1063 | Ga0157370_10002611 | |||
| 1064 | Ga0157370_10098071 | |||
| 1065 | Ga0157370_10100722 | |||
| 1066 | Ga0157370_10154252 | |||
| 1067 | Ga0157370_10262965 | |||
| 1068 | Ga0157370_10486950 | |||
| 1069 | Ga0157369_10012264 | |||
| 1070 | Ga0157369_10211906 | |||
| 1071 | Ga0157369_10545908 | |||
| 1072 | Ga0157374_10188509 | |||
| 1073 | Ga0157378_10098206 | |||
| 1074 | Ga0157378_10511783 | |||
| 1075 | Ga0163162_10545435 | |||
| 1076 | Ga0163162_10592138 | |||
| 1077 | Ga0157375_10524144 | |||
| 1078 | Ga0163163_10002656 | |||
| 1079 | Ga0163163_10064459 | |||
| 1080 | Ga0157380_11337360 | |||
| 1081 | Ga0157377_10112415 | |||
| 1082 | Ga0157377_10134202 | |||
| 1083 | Ga0157379_10051816 | |||
| 1084 | Ga0157379_10060038 | |||
| 1085 | Ga0157379_10562570 | |||
| 1086 | Ga0157379_10769217 | |||
| 1087 | Ga0183363_1006 | |||
| 1088 | Ga0213873_10000021 | |||
| 1089 | Ga0213876_10000050 | |||
| 1090 | Ga0213876_10005218 | |||
| 1091 | Ga0213876_10015842 | |||
| 1092 | Ga0209026_1013989 | |||
| 1093 | Ga0209675_1024192 | |||
| 1094 | Ga0209676_1004347 | |||
| 1095 | Ga0209050_1031105 | |||
| 1096 | Ga0207697_10120618 | |||
| 1097 | Ga0207697_10149067 | |||
| 1098 | Ga0207656_10005222 | |||
| 1099 | Ga0207656_10021936 | |||
| 1100 | Ga0207656_10155001 | |||
| 1101 | Ga0207713_1070882 | |||
| 1102 | Ga0207682_10007605 | |||
| 1103 | Ga0207682_10049275 | |||
| 1104 | Ga0207710_10004955 | |||
| 1105 | Ga0207688_10462528 | |||
| 1106 | Ga0207680_10004230 | |||
| 1107 | Ga0207680_10006079 | |||
| 1108 | Ga0207680_10034048 | |||
| 1109 | Ga0207680_10077641 | |||
| 1110 | Ga0207647_10002583 | |||
| 1111 | Ga0207647_10007170 | |||
| 1112 | Ga0207647_10009661 | |||
| 1113 | Ga0207647_10108367 | |||
| 1114 | Ga0207647_10154111 | |||
| 1115 | Ga0207645_10007046 | |||
| 1116 | Ga0207645_10075152 | |||
| 1117 | Ga0207645_10367224 | |||
| 1118 | Ga0207643_10052301 | |||
| 1119 | Ga0207643_10206399 | |||
| 1120 | Ga0207705_10000002 | |||
| 1121 | Ga0207705_10000484 | |||
| 1122 | Ga0207705_10001745 | |||
| 1123 | Ga0207705_10001825 | |||
| 1124 | Ga0207705_10003572 | |||
| 1125 | Ga0207705_10012492 | |||
| 1126 | Ga0207705_10026379 | |||
| 1127 | Ga0207705_10038076 | |||
| 1128 | Ga0207705_10049071 | |||
| 1129 | Ga0207705_10062137 | |||
| 1130 | Ga0207705_10950109 | |||
| 1131 | Ga0207707_10049693 | |||
| 1132 | Ga0207707_10328138 | |||
| 1133 | Ga0207707_10447734 | |||
| 1134 | Ga0207707_10912621 | |||
| 1135 | Ga0207695_10031682 | |||
| 1136 | Ga0207660_10112179 | |||
| 1137 | Ga0207660_10129339 | |||
| 1138 | Ga0207662_10016667 | |||
| 1139 | Ga0207662_10178877 | |||
| 1140 | Ga0207657_10000223 | |||
| 1141 | Ga0207657_10001247 | |||
| 1142 | Ga0207657_10007500 | |||
| 1143 | Ga0207657_10010881 | |||
| 1144 | Ga0207657_10035997 | |||
| 1145 | Ga0207657_10109681 | |||
| 1146 | Ga0207657_10216014 | |||
| 1147 | Ga0207657_10243090 | |||
| 1148 | Ga0207649_10000659 | |||
| 1149 | Ga0207649_10010463 | |||
| 1150 | Ga0207649_10065124 | |||
| 1151 | Ga0207649_10186581 | |||
| 1152 | Ga0207649_10272597 | |||
| 1153 | Ga0207652_10065349 | |||
| 1154 | Ga0207681_10149198 | |||
| 1155 | Ga0207681_10218785 | |||
| 1156 | Ga0207681_10227030 | |||
| 1157 | Ga0207694_10018876 | |||
| 1158 | Ga0207694_10049198 | |||
| 1159 | Ga0207694_10353041 | |||
| 1160 | Ga0207694_10353483 | |||
| 1161 | Ga0207694_10363345 | |||
| 1162 | Ga0207694_10856658 | |||
| 1163 | Ga0207650_10000069 | |||
| 1164 | Ga0207650_10024733 | |||
| 1165 | Ga0207650_10037959 | |||
| 1166 | Ga0207650_10480781 | |||
| 1167 | Ga0207659_10169367 | |||
| 1168 | Ga0207687_10360079 | |||
| 1169 | Ga0207687_10374109 | |||
| 1170 | Ga0207700_10007574 | |||
| 1171 | Ga0207664_10118545 | |||
| 1172 | Ga0207664_10426069 | |||
| 1173 | Ga0207644_10002343 | |||
| 1174 | Ga0207644_10012564 | |||
| 1175 | Ga0207644_10270886 | |||
| 1176 | Ga0207644_10580671 | |||
| 1177 | Ga0207690_10000528 | |||
| 1178 | Ga0207690_10004734 | |||
| 1179 | Ga0207690_10020755 | |||
| 1180 | Ga0207690_10061840 | |||
| 1181 | Ga0207690_10124323 | |||
| 1182 | Ga0207690_10185781 | |||
| 1183 | Ga0207690_10346062 | |||
| 1184 | Ga0207690_10423859 | |||
| 1185 | Ga0207706_10000616 | |||
| 1186 | Ga0207706_10029984 | |||
| 1187 | Ga0207706_10040732 | |||
| 1188 | Ga0207706_10145127 | |||
| 1189 | Ga0207706_10226977 | |||
| 1190 | Ga0207709_10023662 | |||
| 1191 | Ga0207709_10180387 | |||
| 1192 | Ga0207669_10173791 | |||
| 1193 | Ga0207669_10317751 | |||
| 1194 | Ga0207704_10039542 | |||
| 1195 | Ga0207704_10279339 | |||
| 1196 | Ga0207704_10375805 | |||
| 1197 | Ga0207704_10618799 | |||
| 1198 | Ga0207665_10027914 | |||
| 1199 | Ga0207691_10040981 | |||
| 1200 | Ga0207691_10095473 | |||
| 1201 | Ga0207691_10140643 | |||
| 1202 | Ga0207711_10000025 | |||
| 1203 | Ga0207711_10002648 | |||
| 1204 | Ga0207711_10004929 | |||
| 1205 | Ga0207711_10009023 | |||
| 1206 | Ga0207711_10014312 | |||
| 1207 | Ga0207711_10017709 | |||
| 1208 | Ga0207711_10572788 | |||
| 1209 | Ga0207689_10022353 | |||
| 1210 | Ga0207689_10170390 | |||
| 1211 | Ga0207689_10410168 | |||
| 1212 | Ga0207661_10016172 | |||
| 1213 | Ga0207661_10171262 | |||
| 1214 | Ga0207661_10787368 | |||
| 1215 | Ga0207679_10000479 | |||
| 1216 | Ga0207679_10163688 | |||
| 1217 | Ga0207679_10187253 | |||
| 1218 | Ga0207679_10368414 | |||
| 1219 | Ga0207679_10627920 | |||
| 1220 | Ga0207679_10652008 | |||
| 1221 | Ga0207667_10010498 | |||
| 1222 | Ga0207667_10059037 | |||
| 1223 | Ga0207667_10272095 | |||
| 1224 | Ga0207651_10003835 | |||
| 1225 | Ga0207651_10030265 | |||
| 1226 | Ga0207651_10057545 | |||
| 1227 | Ga0207651_10065446 | |||
| 1228 | Ga0207712_10000723 | |||
| 1229 | Ga0207712_10005054 | |||
| 1230 | Ga0207668_10000062 | |||
| 1231 | Ga0207668_10188385 | |||
| 1232 | Ga0207668_10418953 | |||
| 1233 | Ga0207640_10049362 | |||
| 1234 | Ga0207640_10054766 | |||
| 1235 | Ga0207640_10072842 | |||
| 1236 | Ga0207640_10111900 | |||
| 1237 | Ga0207640_10426957 | |||
| 1238 | Ga0207640_10581031 | |||
| 1239 | Ga0207658_10005476 | |||
| 1240 | Ga0207658_10010246 | |||
| 1241 | Ga0207658_10158701 | |||
| 1242 | Ga0207658_10343760 | |||
| 1243 | Ga0207677_10002162 | |||
| 1244 | Ga0207703_10005190 | |||
| 1245 | Ga0207703_10019493 | |||
| 1246 | Ga0207703_10028602 | |||
| 1247 | Ga0207703_10125792 | |||
| 1248 | Ga0207639_10000546 | |||
| 1249 | Ga0207639_10001294 | |||
| 1250 | Ga0207639_10033955 | |||
| 1251 | Ga0207639_10303397 | |||
| 1252 | Ga0207639_10396244 | |||
| 1253 | Ga0207639_10568869 | |||
| 1254 | Ga0207678_10008075 | |||
| 1255 | Ga0207678_10013749 | |||
| 1256 | Ga0207678_10028891 | |||
| 1257 | Ga0207678_10054170 | |||
| 1258 | Ga0207678_10225761 | |||
| 1259 | Ga0207702_10012978 | |||
| 1260 | Ga0207702_10020714 | |||
| 1261 | Ga0207702_10047612 | |||
| 1262 | Ga0207702_10141558 | |||
| 1263 | Ga0207702_10324438 | |||
| 1264 | Ga0207702_10754755 | |||
| 1265 | Ga0207641_10000002 | |||
| 1266 | Ga0207641_10020933 | |||
| 1267 | Ga0207641_10042964 | |||
| 1268 | Ga0207641_10067620 | |||
| 1269 | Ga0207641_10209119 | |||
| 1270 | Ga0207648_10008052 | |||
| 1271 | Ga0207648_10009676 | |||
| 1272 | Ga0207648_10012702 | |||
| 1273 | Ga0207676_10000044 | |||
| 1274 | Ga0207676_10010620 | |||
| 1275 | Ga0207676_10022848 | |||
| 1276 | Ga0207676_10247685 | |||
| 1277 | Ga0207674_10048053 | |||
| 1278 | Ga0207674_10149917 | |||
| 1279 | Ga0207675_100301257 | |||
| 1280 | Ga0207675_100353123 | |||
| 1281 | Ga0207675_101236096 | |||
| 1282 | Ga0207683_10007887 | |||
| 1283 | Ga0207683_10034570 | |||
| 1284 | Ga0207683_10039250 | |||
| 1285 | Ga0207683_10108426 | |||
| 1286 | Ga0207683_11038906 | |||
| 1287 | Ga0207698_10012178 | |||
| 1288 | Ga0209967_1008386 | |||
| 1289 | Ga0209974_10034981 | |||
| 1290 | Ga0209974_10195648 | |||
| 1291 | Ga0268266_10000733 | |||
| 1292 | Ga0268266_10027292 | |||
| 1293 | Ga0268266_10053791 | |||
| 1294 | Ga0268266_10118901 | |||
| 1295 | Ga0268266_10158155 | |||
| 1296 | Ga0268265_10000003 | |||
| 1297 | Ga0268265_10009247 | |||
| 1298 | Ga0268264_10045694 | |||
| 1299 | Ga0268264_10205367 | |||
| 1300 | Ga0268264_10229824 | |||
| 1301 | Ga0268264_10539944 | |||
| 1302 | Ga0268264_10602394 | |||
| 1303 | Ga0265338_10084073 | |||
| 1304 | Ga0265338_10098220 | |||
| 1305 | Ga0316180_1083564 | |||
| 1306 | Ga0307509_10592510 | |||
| 1307 | Ga0307408_100044067 | |||
| 1308 | Ga0265313_10016941 | |||
| 1309 | Ga0307508_10004384 | |||
| 1310 | Ga0307405_10088296 | |||
| 1311 | Ga0307405_10109637 | |||
| 1312 | Ga0307413_10169219 | |||
| 1313 | Ga0307413_10320839 | |||
| 1314 | Ga0307413_10878938 | |||
| 1315 | Ga0307410_10036572 | |||
| 1316 | Ga0307410_10064289 | |||
| 1317 | Ga0307410_10104548 | |||
| 1318 | Ga0307410_10477646 | |||
| 1319 | Ga0307410_10690448 | |||
| 1320 | Ga0307406_10012911 | |||
| 1321 | Ga0307406_10088249 | |||
| 1322 | Ga0307406_10169327 | |||
| 1323 | Ga0307406_10285417 | |||
| 1324 | Ga0307407_10034803 | |||
| 1325 | Ga0307409_100010580 | |||
| 1326 | Ga0307409_100039888 | |||
| 1327 | Ga0307409_100119335 | |||
| 1328 | Ga0307409_100361320 | |||
| 1329 | Ga0307409_100600802 | |||
| 1330 | Ga0307409_100672773 | |||
| 1331 | Ga0307409_101084433 | |||
| 1332 | Ga0307416_100022017 | |||
| 1333 | Ga0307414_10014366 | |||
| 1334 | Ga0307414_10027901 | |||
| 1335 | Ga0307414_10052296 | |||
| 1336 | Ga0307414_10060390 | |||
| 1337 | Ga0307414_11005772 | |||
| 1338 | Ga0307411_10011344 | |||
| 1339 | Ga0307411_10029834 | |||
| 1340 | Ga0307411_10038989 | |||
| 1341 | Ga0307411_10050369 | |||
| 1342 | Ga0307411_10052077 | |||
| 1343 | Ga0307411_10372842 | |||
| 1344 | Ga0307415_100005316 | |||
| 1345 | Ga0307415_100039321 | |||
| 1346 | Ga0307415_100052250 | |||
| 1347 | Ga0307415_100693019 | |||
| 1348 | Ga0307415_101574756 | |||
| 1349 | Ga0373949_0021042 | |||
| 1350 | Ga0373952_0063600 | |||
| 1351 | Ga0373932_0025680 | |||
| 1352 | Ga0373936_0054026 | |||
| 1353 | Ga0373941_0178523 | |||
| 1354 | Ga0373954_0047929 | |||
| 1355 | Ga0373943_0024258 | |||
| 1356 | Ga0373946_0016952 | |||
| 1357 | Ga0373961_0013736 | |||
| 1358 | Ga0373962_0132032 | |||
| 1359 | Ga0373931_0004862 | |||
| 1360 | Ga0373931_0303033 | |||
| 1361 | Ga0373935_0035783 | |||
| 1362 | Ga0373935_0657379 | |||
| 1363 | Ga0373927_0095889 | |||
| 1364 | Ga0373933_0054385 | |||
| 1365 | Ga0373933_0144089 | |||
| 1366 | Ga0373937_0004874 | |||
| 1367 | Ga0373937_0536967 | |||
| 1368 | Ga0373937_0593682 | |||
| 1369 | Ga0395899_0000973 | |||
| 1370 | Ga0395899_0003333 | |||
| 1371 | Ga0395899_0004515 | |||
| 1372 | Ga0395899_0007993 | |||
| 1373 | Ga0395899_0018580 | |||
| 1374 | Ga0395899_0032872 | |||
| 1375 | Ga0395899_0034409 | |||
| 1376 | Ga0395899_0065531 | |||
| 1377 | Ga0395899_0198723 | |||
| 1378 | Ga0395899_0264762 | |||
| 1379 | Ga0395899_0287023 | |||
| 1380 | Ga0395899_0417332 | |||
| 1381 | Ga0395899_0614466 | |||
| 1382 | Ga0395900_0000221 | |||
| 1383 | Ga0395900_0000777 | |||
| 1384 | Ga0395900_0001512 | |||
| 1385 | Ga0395900_0016898 | |||
| 1386 | Ga0395900_0019486 | |||
| 1387 | Ga0395900_0032553 | |||
| 1388 | Ga0395900_0037027 | |||
| 1389 | Ga0395900_0052767 | |||
| 1390 | Ga0395900_0063383 | |||
| 1391 | Ga0395900_0073832 | |||
| 1392 | Ga0395900_0077937 | |||
| 1393 | Ga0395900_0194556 | |||
| 1394 | Ga0395900_0205610 | |||
| 1395 | Ga0395900_0206850 | |||
| 1396 | Ga0395900_0376050 | |||
| 1397 | Ga0395900_0393339 | |||
| 1398 | Ga0395900_0508537 | |||
| 1399 | Ga0395900_0545717 | |||
| 1400 | Ga0395900_0849529 | |||
| 1401 | Ga0395898_0000053 | |||
| 1402 | Ga0395898_0004457 | |||
| 1403 | Ga0395898_0015175 | |||
| 1404 | Ga0395898_0024657 | |||
| 1405 | Ga0395898_0101641 | |||
| 1406 | Ga0395898_0122083 | |||
| 1407 | Ga0395898_0158880 | |||
| 1408 | Ga0395898_0302953 | |||
| 1409 | Ga0395898_0881500 | |||
| 1410 | Ga0395905_0000031 | |||
| 1411 | Ga0395905_0001351 | |||
| 1412 | Ga0395905_0006929 | |||
| 1413 | Ga0395905_0011337 | |||
| 1414 | Ga0395905_0018068 | |||
| 1415 | Ga0395905_0021621 | |||
| 1416 | Ga0395905_0040916 | |||
| 1417 | Ga0395905_0082765 | |||
| 1418 | Ga0395905_0083769 | |||
| 1419 | Ga0395905_0094768 | |||
| 1420 | Ga0395905_0101879 | |||
| 1421 | Ga0395905_0121007 | |||
| 1422 | Ga0395905_0130924 | |||
| 1423 | Ga0395905_0131969 | |||
| 1424 | Ga0395905_0133874 | |||
| 1425 | Ga0395905_0141893 | |||
| 1426 | Ga0395905_0188908 | |||
| 1427 | Ga0395905_0233950 | |||
| 1428 | Ga0395905_0235648 | |||
| 1429 | Ga0395905_0240529 | |||
| 1430 | Ga0395905_0385604 | |||
| 1431 | Ga0395905_0406618 | |||
| 1432 | Ga0395905_0444862 | |||
| 1433 | Ga0395905_0549238 | |||
| 1434 | Ga0395905_1081499 | |||
| 1435 | Ga0395901_0000440 | |||
| 1436 | Ga0395901_0002264 | |||
| 1437 | Ga0395901_0005009 | |||
| 1438 | Ga0395901_0007805 | |||
| 1439 | Ga0395901_0015216 | |||
| 1440 | Ga0395901_0016489 | |||
| 1441 | Ga0395901_0024866 | |||
| 1442 | Ga0395901_0067398 | |||
| 1443 | Ga0395901_0089082 | |||
| 1444 | Ga0395901_0096553 | |||
| 1445 | Ga0395901_0119271 | |||
| 1446 | Ga0395901_0176180 | |||
| 1447 | Ga0395901_0288329 | |||
| 1448 | Ga0395901_0294825 | |||
| 1449 | Ga0395901_0349711 | |||
| 1450 | Ga0436365_0516111 | |||
| 1451 | Ga0436365_0591004 | |||
| 1452 | Ga0436365_0789764 | |||
| 1453 | Ga0436365_1801999 | |||
| 1454 | Ga0436362_0385235 | |||
| 1455 | Ga0439438_069322 | |||
| 1456 | Ga0451802_2140950 | |||
| 1457 | Ga0439448_0007143 | |||
| 1458 | Ga0439448_0032769 | |||
| 1459 | Ga0439455_0005348 | |||
| 1460 | Ga0450920_053062 | |||
| 1461 | Ga0450890_005037 | |||
| 1462 | Ga0450905_000429 | |||
| 1463 | Ga0450889_000192 | |||
| 1464 | Ga0439458_0009992 | |||
| 1465 | Ga0439458_0018501 | |||
| 1466 | Ga0439434_0130739 | |||
| 1467 | Ga0466969_0044744 | |||
| 1468 | Ga0466972_0097007 | |||
| 1469 | Ga0466965_0095258 | |||
| 1470 | Ga0466966_0017916 | |||
| 1471 | Ga0466966_0029704 | |||
| 1472 | Ga0466966_0391808 | |||
| 1473 | Ga0466963_0002507 | |||
| 1474 | Ga0466963_0209017 | |||
| 1475 | Ga0466963_0258016 | |||
| 1476 | Ga0466963_0337192 | |||
| 1477 | Ga0466963_0628365 | |||
| 1478 | Ga0466964_0054893 | |||
| 1479 | Ga0466971_0182073 | |||
| 1480 | Ga0466970_0003469 | |||
| 1481 | Ga0466970_0178483 | |||
| 1482 | Ga0466957_0021853 | |||
| 1483 | Ga0466957_0033832 | |||
| 1484 | Ga0466957_0058830 | |||
| 1485 | Ga0466957_0066362 | |||
| 1486 | Ga0466957_0897574 | |||
| 1487 | Ga0466960_0135974 | |||
| 1488 | Ga0466960_0354915 | |||
| 1489 | Ga0466959_0109870 | |||
| 1490 | Ga0466959_0218379 | |||
| 1491 | Ga0466959_0464421 | |||
| 1492 | Ga0466958_0000676 | |||
| 1493 | Ga0466958_0050608 | |||
| 1494 | Ga0466958_0259367 | |||
| 1495 | Ga0466967_0002603 | |||
| 1496 | Ga0466967_0004260 | |||
| 1497 | Ga0466967_0019017 | |||
| 1498 | Ga0466967_0091181 | |||
| 1499 | Ga0466967_0220391 | |||
| 1500 | Ga0466967_0240355 | |||
| 1501 | Ga0466967_0487412 | |||
| 1502 | Ga0466967_0594307 | |||
| 1503 | Ga0466967_0824716 | |||
| 1504 | Ga0466967_1392654 | |||
| 1505 | Ga0495617_006120 | |||
| 1506 | Ga0495582_0266549 | |||
| 1507 | Ga0495616_0254005 | |||
| 1508 | Ga0495643_0407929 | |||
| 1509 | Ga0495663_0014591 | |||
| 1510 | Ga0495663_0015333 | |||
| 1511 | Ga0495642_0341043 | |||
| 1512 | Ga0495652_0326049 | |||
| 1513 | Ga0495598_0000288 | |||
| 1514 | Ga0495621_0000258 | |||
| 1515 | Ga0495633_0034072 | |||
| 1516 | Ga0495668_0036982 | |||
| 1517 | Ga0495625_0131550 | |||
| 1518 | Ga0495659_0128080 | |||
| 1519 | Ga0495647_0438268 | |||
| 1520 | Ga0495669_0004902 | |||
| 1521 | Ga0495669_0016565 | |||
| 1522 | Ga0495669_0077869 | |||
| 1523 | Ga0495669_0260884 | |||
| 1524 | Ga0495670_0000690 | |||
| 1525 | Ga0495687_106026 | |||
| 1526 | Ga0495677_0002083 | |||
| 1527 | Ga0495602_0310362 | |||
| 1528 | Ga0496101_0041762 | |||
| 1529 | Ga0496102_0121289 | |||
| 1530 | Ga0496102_0370806 | |||
| 1531 | Ga0496103_0142207 | |||
| 1532 | Ga0496103_0509593 | |||
| 1533 | Ga0496107_0188000 | |||
| 1534 | Ga0496107_0878012 | |||
| 1535 | Ga0496108_0029105 | |||
| 1536 | Ga0496109_0006427 | |||
| 1537 | Ga0496109_0179806 | |||
| 1538 | Ga0496109_0996613 | |||
| 1539 | Ga0496111_0190768 | |||
| 1540 | Ga0496111_0260005 | |||
| 1541 | Ga0496112_0023006 | |||
| 1542 | Ga0496112_0046192 | |||
| 1543 | Ga0496112_0446365 | |||
| 1544 | Ga0496113_0013267 | |||
| 1545 | Ga0496113_0025913 | |||
| 1546 | Ga0496113_0444333 | |||
| 1547 | Ga0496113_1003976 | |||
| 1548 | Ga0496114_0669028 | |||
| 1549 | Ga0496117_0034695 | |||
| 1550 | Ga0496118_0019807 | |||
| 1551 | Ga0496126_0061468 | |||
| 1552 | Ga0501306_051874 | |||
| 1553 | Ga0501292_000088 | |||
| 1554 | Ga0501294_000241 | |||
| 1555 | Ga0501300_003094 | |||
| 1556 | Ga0501315_014184 | |||
| 1557 | Ga0501033_0071178 | |||
| 1558 | Ga0501034_0076662 | |||
| 1559 | Ga0501047_0025996 | |||
| 1560 | Ga0501067_0022624 | |||
| 1561 | Ga0501067_0136164 | |||
| 1562 | Ga0501068_0371216 | |||
| 1563 | Ga0501069_0049843 | |||
| 1564 | Ga0501070_0193460 | |||
| 1565 | Ga0501071_0282657 | |||
| 1566 | Ga0501072_0015507 | |||
| 1567 | Ga0501073_0004494 | |||
| 1568 | Ga0501074_0030693 | |||
| 1569 | Ga0501074_0036865 | |||
| 1570 | Ga0501206_000112 | |||
| 1571 | Ga0501224_000219 | |||
| 1572 | Ga0501227_008045 | |||
| 1573 | Ga0501235_000736 | |||
| 1574 | Ga0501257_050098 | |||
| 1575 | Ga0501259_000816 | |||
| 1576 | Ga0501261_000417 | |||
| 1577 | Ga0501225_0000787 | |||
| 1578 | Ga0501245_003064 | |||
| 1579 | Ga0501080_0034392 | |||
| 1580 | Ga0501080_0369798 | |||
| 1581 | Ga0501279_000074 | |||
| 1582 | Ga0501280_000191 | |||
| 1583 | Ga0501281_00081 | |||
| 1584 | Ga0501282_000381 | |||
| 1585 | Ga0501283_010678 | |||
| 1586 | Ga0501035_0778342 | |||
| 1587 | Ga0501044_0536728 | |||
| 1588 | Ga0501044_0947156 | |||
| 1589 | nmdc:mga06r32_258210_c1 | |||
| 1590 | nmdc:mga0n895_162161_c1 | |||
| 1591 | Ga0495655_0059720 | |||
| 1592 | Ga0500554_235206 | |||
| 1593 | Ga0500595_000405 | |||
| 1594 | Ga0500595_016123 | |||
| 1595 | Ga0500559_0434538 | |||
| 1596 | Ga0501084_0074161 | |||
| 1597 | Ga0587084_022667 | |||
| 1598 | Ga0501082_0555027 | |||
| 1599 | Ga0466962_0020301 | |||
| 1600 | Ga0466962_0206174 | |||
| 1601 | 2507509763 | |||
| 1602 | 2508543779 | |||
| 1603 | 2508698433 | |||
| 1604 | 2515630025 | |||
| 1605 | 2793060263 | |||
| 1606 | 2809064865 | |||
| 1607 | 2809080832 | |||
| 1608 | 2809085197 | |||
| 1609 | 2848298250 | |||
| 1610 | 2874595128 | |||
| 1611 | 2874632704 | |||
| 1612 | 2874650989 | |||
| 1613 | 2876775064 | |||
| 1614 | 2876823879 | |||
| 1615 | 2879080507 | |||
| 1616 | 2879149198 | |||
| 1617 | 2880521897 | |||
| 1618 | 2935611378 | |||
| 1619 | 2935648762 | |||
| 1620 | 2935657155 | |||
| 1621 | 2935820855 | |||
| 1622 | 2935850885 | |||
| 1623 | 2935913748 | |||
| 1624 | 2935920262 | |||
| 1625 | 2935930601 | |||
| 1626 | 2935939426 | |||
| 1627 | 2935946375 | |||
| 1628 | 2935955786 | |||
| 1629 | 2935972504 | |||
| 1630 | 2935981665 | |||
| 1631 | 2935991040 | |||
| 1632 | 2936011672 | |||
| 1633 | 2936020267 | |||
| 1634 | 2936028962 | |||
| 1635 | 2936046990 | |||
| 1636 | 2936058130 | |||
| 1637 | 8006930380 | |||
| 1638 | 8016632290 | |||
| 1639 | 8019626842 | |||
| 1640 | 8019644015 | |||
| 1641 | 8019663466 | |||
| 1642 | 8019673080 | |||
| 1643 | 8019683060 | |||
| 1644 | 8019688757 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy