F482287

General Info

Members Datasets Scaffolds Average Seq Length
822 341 1644 166

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100025177|Ga0068868_1000251775
Length 191
Sequence MRDKSESECKEMKLNQIKDNKGARQSRVRVGRGIGSXXXXTXXRGQKGAKARSGVSIAGFEGGQMPLHMRLPKRGFNNIFARDYAEVNIGAVQKAIDAGKLDMKGVLDQAALNAAGLSRGGKDGVRLLGKGELKAKLNFKIAGVSKGAREAVEKAGGSIELIERKDPAELAAAKKGKVREQRLADRAAAKA

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
205 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
206 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
207 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
257 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
258 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
259 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
272 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
277 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
278 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
279 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
282 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
283 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
284 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
285 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
291 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
299 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
300 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
301 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
302 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
303 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
304 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
305 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
306 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
307 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
308 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
309 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
310 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
311 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
312 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
313 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
314 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
315 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
316 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
317 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
318 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
319 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
320 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
321 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
322 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
323 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
324 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
325 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
326 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
327 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
328 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
329 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
330 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
331 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
332 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
333 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
334 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
335 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
336 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
337 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
338 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
339 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
340 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
341 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.28
Metatranscriptomes 0.36
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 4.62
Rhizoplane 2.68
Rhizosphere 89.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100025177 3300005338 Bacteria 4521
2 JGI24741J21665_1010075 3300001915 Bacteria 1709
3 JGI24741J21665_1010189 3300001915 Bacteria 1694
4 JGI24740J21852_10001392 3300001979 Bacteria 11043
5 JGI24740J21852_10006828 3300001979 Bacteria 4686
6 JGI24740J21852_10037057 3300001979 Bacteria 1509
7 JGI24739J22299_10010528 3300001989 Bacteria 3432
8 JGI24739J22299_10041361 3300001989 Bacteria 1534
9 JGI24737J22298_10063939 3300001990 Bacteria 1104
10 JGI24735J21928_10019234 3300002067 Bacteria 2100
11 JGI24735J21928_10162953 3300002067 Bacteria 644
12 JGI24738J21930_10002194 3300002075 Bacteria 5202
13 JGI24738J21930_10019404 3300002075 Bacteria 1417
14 JGI24744J21845_10000034 3300002077 Bacteria 15838
15 Ga0065715_10244338 3300005293 Bacteria 1188
16 Ga0065715_10273178 3300005293 Bacteria 1090
17 Ga0070658_10013640 3300005327 Bacteria 6520
18 Ga0070658_10020583 3300005327 Bacteria 5288
19 Ga0070658_10057953 3300005327 Bacteria 3151
20 Ga0070658_10091541 3300005327 Bacteria 2506
21 Ga0070658_10173973 3300005327 Bacteria 1810
22 Ga0070658_10493973 3300005327 Bacteria 1057
23 Ga0070676_10435944 3300005328 Bacteria 918
24 Ga0070676_10446567 3300005328 Bacteria 908
25 Ga0070683_100094211 3300005329 Bacteria 2814
26 Ga0070683_100097247 3300005329 Bacteria 2769
27 Ga0070683_100177271 3300005329 Bacteria 2023
28 Ga0070683_100243466 3300005329 Bacteria 1711
29 Ga0070683_101442549 3300005329 Bacteria 661
30 Ga0070690_100012042 3300005330 Bacteria 5078
31 Ga0070670_100000075 3300005331 Bacteria 97494
32 Ga0070670_100026404 3300005331 Bacteria 4998
33 Ga0070670_100037046 3300005331 Bacteria 4197
34 Ga0070670_100037322 3300005331 Bacteria 4180
35 Ga0070677_10027811 3300005333 Bacteria 2132
36 Ga0068869_100150340 3300005334 Bacteria 1805
37 Ga0068869_100360088 3300005334 Bacteria 1188
38 Ga0070666_10003597 3300005335 Bacteria 9395
39 Ga0070666_10068528 3300005335 Bacteria 2411
40 Ga0070666_10090661 3300005335 Bacteria 2099
41 Ga0070666_10128663 3300005335 Bacteria 1759
42 Ga0070680_100103412 3300005336 Bacteria 2366
43 Ga0070682_100034188 3300005337 Bacteria 3094
44 Ga0070682_100274812 3300005337 Bacteria 1225
45 Ga0070682_100822228 3300005337 Bacteria 757
46 Ga0068868_100089899 3300005338 Bacteria 2472
47 Ga0068868_100107056 3300005338 Bacteria 2269
48 Ga0070660_100002891 3300005339 Bacteria 11818
49 Ga0070660_100007791 3300005339 Bacteria 7468
50 Ga0070660_100013592 3300005339 Bacteria 5846
51 Ga0070660_100015088 3300005339 Bacteria 5575
52 Ga0070660_100032871 3300005339 Bacteria 3907
53 Ga0070660_100502673 3300005339 Bacteria 1008
54 Ga0070661_100000378 3300005344 Bacteria 34966
55 Ga0070661_100255929 3300005344 Bacteria 1352
56 Ga0070661_100620340 3300005344 Bacteria 876
57 Ga0070692_10028912 3300005345 Bacteria 2759
58 Ga0070668_100023561 3300005347 Bacteria 4657
59 Ga0070668_100179313 3300005347 Bacteria 1729
60 Ga0070668_100381347 3300005347 Bacteria 1200
61 Ga0070669_100054545 3300005353 Bacteria 2927
62 Ga0070669_100101961 3300005353 Bacteria 2166
63 Ga0070669_100160283 3300005353 Bacteria 1747
64 Ga0070669_100423805 3300005353 Bacteria 1093
65 Ga0070675_100025299 3300005354 Bacteria 4759
66 Ga0070675_100060735 3300005354 Bacteria 3120
67 Ga0070675_100725811 3300005354 Bacteria 906
68 Ga0070671_100029750 3300005355 Bacteria 4505
69 Ga0070671_100060355 3300005355 Bacteria 3157
70 Ga0070671_100066753 3300005355 Bacteria 2998
71 Ga0070671_100151152 3300005355 Bacteria 1961
72 Ga0070671_100182567 3300005355 Bacteria 1776
73 Ga0070671_100691263 3300005355 Bacteria 884
74 Ga0070674_100128556 3300005356 Bacteria 1885
75 Ga0070674_100319241 3300005356 Bacteria 1245
76 Ga0070673_100054262 3300005364 Bacteria 3152
77 Ga0070673_100079951 3300005364 Bacteria 2648
78 Ga0070673_100195999 3300005364 Bacteria 1737
79 Ga0070673_100216124 3300005364 Bacteria 1657
80 Ga0070673_100486337 3300005364 Bacteria 1115
81 Ga0070673_100497276 3300005364 Bacteria 1103
82 Ga0070673_101161406 3300005364 Bacteria 722
83 Ga0070659_100011523 3300005366 Bacteria 6542
84 Ga0070659_100127240 3300005366 Bacteria 2067
85 Ga0070659_100137500 3300005366 Bacteria 1987
86 Ga0070659_100499768 3300005366 Bacteria 1036
87 Ga0070659_100519321 3300005366 Bacteria 1017
88 Ga0070667_100000039 3300005367 Bacteria 170228
89 Ga0070667_100011640 3300005367 Bacteria 7273
90 Ga0070667_100068943 3300005367 Bacteria 3009
91 Ga0070667_100248567 3300005367 Bacteria 1590
92 Ga0070714_100175931 3300005435 Bacteria 1945
93 Ga0070714_100525585 3300005435 Bacteria 1130
94 Ga0070714_100776941 3300005435 Bacteria 927
95 Ga0070713_100323140 3300005436 Bacteria 1425
96 Ga0070694_100007775 3300005444 Bacteria 6540
97 Ga0070663_100025097 3300005455 Bacteria 4021
98 Ga0070663_100031065 3300005455 Bacteria 3667
99 Ga0070663_100067856 3300005455 Bacteria 2588
100 Ga0070678_100076029 3300005456 Bacteria 2528
101 Ga0070678_100151644 3300005456 Bacteria 1868
102 Ga0070678_100158074 3300005456 Bacteria 1833
103 Ga0070662_100004163 3300005457 Bacteria 9105
104 Ga0070662_100017760 3300005457 Bacteria 4800
105 Ga0070662_100037731 3300005457 Bacteria 3427
106 Ga0070662_100103846 3300005457 Bacteria 2155
107 Ga0070662_100195622 3300005457 Bacteria 1601
108 Ga0070662_100251285 3300005457 Bacteria 1421
109 Ga0070662_100377300 3300005457 Bacteria 1167
110 Ga0070681_10169060 3300005458 Bacteria 2108
111 Ga0070681_10513451 3300005458 Bacteria 1111
112 Ga0070681_10601878 3300005458 Bacteria 1013
113 Ga0068867_100004535 3300005459 Bacteria 9763
114 Ga0068867_100006865 3300005459 Bacteria 8052
115 Ga0070679_100113172 3300005530 Bacteria 2699
116 Ga0070684_100057452 3300005535 Bacteria 3398
117 Ga0070684_100095295 3300005535 Bacteria 2651
118 Ga0070684_100173736 3300005535 Bacteria 1957
119 Ga0068853_100000371 3300005539 Bacteria 30925
120 Ga0068853_100003315 3300005539 Bacteria 12321
121 Ga0068853_100305111 3300005539 Bacteria 1472
122 Ga0068853_100338138 3300005539 Bacteria 1398
123 Ga0068853_100547001 3300005539 Bacteria 1096
124 Ga0070672_100035836 3300005543 Bacteria 3773
125 Ga0070672_100117164 3300005543 Bacteria 2177
126 Ga0070672_100425167 3300005543 Bacteria 1141
127 Ga0070672_100831257 3300005543 Bacteria 814
128 Ga0070696_100013365 3300005546 Bacteria 5507
129 Ga0070696_100110546 3300005546 Bacteria 1978
130 Ga0070696_101073688 3300005546 Bacteria 676
131 Ga0070693_100001061 3300005547 Bacteria 12277
132 Ga0070693_100033553 3300005547 Bacteria 2833
133 Ga0070665_100021441 3300005548 Bacteria 6498
134 Ga0070665_100023728 3300005548 Bacteria 6178
135 Ga0070665_100025177 3300005548 Bacteria 5996
136 Ga0070665_100029734 3300005548 Bacteria 5498
137 Ga0070665_100117624 3300005548 Bacteria 2661
138 Ga0068855_100001629 3300005563 Bacteria 28166
139 Ga0068855_100292663 3300005563 Bacteria 1805
140 Ga0068855_100504310 3300005563 Bacteria 1314
141 Ga0070664_100002298 3300005564 Bacteria 15361
142 Ga0070664_100124865 3300005564 Bacteria 2256
143 Ga0070664_100128418 3300005564 Bacteria 2225
144 Ga0070664_100130693 3300005564 Bacteria 2205
145 Ga0068857_100014445 3300005577 Bacteria 6888
146 Ga0068857_100039350 3300005577 Bacteria 4187
147 Ga0068857_100055675 3300005577 Bacteria 3509
148 Ga0068857_100096146 3300005577 Bacteria 2654
149 Ga0068854_100036953 3300005578 Bacteria 3425
150 Ga0068854_100145560 3300005578 Bacteria 1822
151 Ga0068854_100269812 3300005578 Bacteria 1366
152 Ga0068854_100310613 3300005578 Bacteria 1278
153 Ga0068854_100358554 3300005578 Bacteria 1196
154 Ga0068856_100001149 3300005614 Bacteria 27839
155 Ga0068856_100065317 3300005614 Bacteria 3596
156 Ga0068856_100223268 3300005614 Bacteria 1899
157 Ga0068856_100292261 3300005614 Bacteria 1646
158 Ga0068856_100719533 3300005614 Bacteria 1018
159 Ga0068856_101201918 3300005614 Bacteria 774
160 Ga0068852_100022870 3300005616 Bacteria 5022
161 Ga0068852_100048453 3300005616 Bacteria 3630
162 Ga0068852_100058630 3300005616 Bacteria 3336
163 Ga0068852_100153654 3300005616 Bacteria 2142
164 Ga0068852_100435191 3300005616 Bacteria 1296
165 Ga0068859_100084174 3300005617 Bacteria 3225
166 Ga0068859_101101518 3300005617 Bacteria 874
167 Ga0068864_100000016 3300005618 Bacteria 292454
168 Ga0068864_100005877 3300005618 Bacteria 10055
169 Ga0068864_100014693 3300005618 Bacteria 6503
170 Ga0068864_100439607 3300005618 Bacteria 1246
171 Ga0068864_100536480 3300005618 Bacteria 1129
172 Ga0068864_101158988 3300005618 Bacteria 771
173 Ga0068866_10054825 3300005718 Bacteria 2044
174 Ga0068866_10113156 3300005718 Bacteria 1518
175 Ga0068861_101338323 3300005719 Bacteria 698
176 Ga0068851_10014198 3300005834 Bacteria 3779
177 Ga0068851_10018029 3300005834 Bacteria 3398
178 Ga0068870_10072422 3300005840 Bacteria 1883
179 Ga0068870_10552141 3300005840 Bacteria 776
180 Ga0068863_100000033 3300005841 Bacteria 170238
181 Ga0068863_100109342 3300005841 Bacteria 2631
182 Ga0068863_100118096 3300005841 Bacteria 2528
183 Ga0068863_100119724 3300005841 Bacteria 2509
184 Ga0068863_100122714 3300005841 Bacteria 2478
185 Ga0068863_100631205 3300005841 Bacteria 1062
186 Ga0068858_100036141 3300005842 Bacteria 4580
187 Ga0068858_100055697 3300005842 Bacteria 3655
188 Ga0068858_100089325 3300005842 Bacteria 2867
189 Ga0068858_100205265 3300005842 Bacteria 1864
190 Ga0068860_100022352 3300005843 Bacteria 6119
191 Ga0068860_100114263 3300005843 Bacteria 2582
192 Ga0068860_100205727 3300005843 Bacteria 1909
193 Ga0068860_100264367 3300005843 Bacteria 1678
194 Ga0068860_100483376 3300005843 Bacteria 1234
195 Ga0068860_100748923 3300005843 Bacteria 988
196 Ga0068862_100000040 3300005844 Bacteria 167832
197 Ga0068862_100484321 3300005844 Bacteria 1171
198 Ga0081539_10015398 3300005985 Bacteria 5559
199 Ga0070717_10007362 3300006028 Bacteria 8173
200 Ga0070716_100374378 3300006173 Bacteria 1016
201 Ga0097621_100162639 3300006237 Bacteria 1920
202 Ga0097621_100202842 3300006237 Bacteria 1722
203 Ga0068871_100065028 3300006358 Bacteria 2986
204 Ga0075434_100355198 3300006871 Bacteria 1486
205 Ga0068865_100268959 3300006881 Bacteria 1352
206 Ga0075436_100707040 3300006914 Bacteria 747
207 Ga0097620_100084175 3300006931 Bacteria 3225
208 Ga0097620_101101476 3300006931 Bacteria 874
209 Ga0079104_1032594 3300006946 Bacteria 1283
210 Ga0105251_10004716 3300009011 Bacteria 9147
211 Ga0105245_10072535 3300009098 Bacteria 3128
212 Ga0105245_11321456 3300009098 Bacteria 770
213 Ga0105245_11417475 3300009098 Bacteria 745
214 Ga0105247_10018821 3300009101 Bacteria 4146
215 Ga0114129_11270946 3300009147 Bacteria 914
216 Ga0105243_10069992 3300009148 Bacteria 2832
217 Ga0105242_10158169 3300009176 Bacteria 1981
218 Ga0105248_10000021 3300009177 Bacteria 276159
219 Ga0105248_10001425 3300009177 Bacteria 26705
220 Ga0105248_10010652 3300009177 Bacteria 10141
221 Ga0105248_10022689 3300009177 Bacteria 6965
222 Ga0105248_10043820 3300009177 Bacteria 5018
223 Ga0105248_10065969 3300009177 Bacteria 4064
224 Ga0105248_10504523 3300009177 Bacteria 1364
225 Ga0105238_10456040 3300009551 Bacteria 1276
226 Ga0105238_10469713 3300009551 Bacteria 1256
227 Ga0105238_10555783 3300009551 Bacteria 1152
228 Ga0105249_10001881 3300009553 Bacteria 18180
229 Ga0105249_10520247 3300009553 Bacteria 1237
230 Ga0105239_10468251 3300010375 Bacteria 1431
231 Ga0105246_10161931 3300011119 Bacteria 1705
232 Ga0157373_10021771 3300013100 Bacteria 4652
233 Ga0157373_10064751 3300013100 Bacteria 2587
234 Ga0157373_10406158 3300013100 Bacteria 977
235 Ga0157371_10020175 3300013102 Bacteria 4905
236 Ga0157371_10033548 3300013102 Bacteria 3687
237 Ga0157371_10089328 3300013102 Bacteria 2182
238 Ga0157371_10374672 3300013102 Bacteria 1039
239 Ga0157371_10468101 3300013102 Bacteria 928
240 Ga0157371_10698031 3300013102 Bacteria 759
241 Ga0157370_10002611 3300013104 Bacteria 21670
242 Ga0157370_10098071 3300013104 Bacteria 2749
243 Ga0157370_10100722 3300013104 Bacteria 2707
244 Ga0157370_10154252 3300013104 Bacteria 2137
245 Ga0157370_10262965 3300013104 Bacteria 1594
246 Ga0157370_10486950 3300013104 Bacteria 1133
247 Ga0157369_10012264 3300013105 Bacteria 9733
248 Ga0157369_10211906 3300013105 Bacteria 2030
249 Ga0157369_10545908 3300013105 Bacteria 1198
250 Ga0157374_10188509 3300013296 Bacteria 2017
251 Ga0157378_10098206 3300013297 Bacteria 2670
252 Ga0157378_10511783 3300013297 Bacteria 1201
253 Ga0163162_10545435 3300013306 Bacteria 1288
254 Ga0163162_10592138 3300013306 Bacteria 1235
255 Ga0157375_10524144 3300013308 Bacteria 1348
256 Ga0163163_10002656 3300014325 Bacteria 15124
257 Ga0163163_10064459 3300014325 Bacteria 3636
258 Ga0157380_11337360 3300014326 Bacteria 765
259 Ga0157377_10112415 3300014745 Bacteria 1639
260 Ga0157377_10134202 3300014745 Bacteria 1515
261 Ga0157379_10051816 3300014968 Bacteria 3664
262 Ga0157379_10060038 3300014968 Bacteria 3399
263 Ga0157379_10562570 3300014968 Bacteria 1062
264 Ga0157379_10769217 3300014968 Bacteria 907
265 Ga0183363_1006 3300015690 Bacteria 400466
266 Ga0213873_10000021 3300021358 Bacteria 113830
267 Ga0213876_10000050 3300021384 Bacteria 144836
268 Ga0213876_10005218 3300021384 Bacteria 7160
269 Ga0213876_10015842 3300021384 Bacteria 3989
270 Ga0209026_1013989 3300025250 Bacteria 1352
271 Ga0209675_1024192 3300025291 Bacteria 1557
272 Ga0209676_1004347 3300025292 Bacteria 7943
273 Ga0209050_1031105 3300025298 Bacteria 1670
274 Ga0207697_10120618 3300025315 Bacteria 1128
275 Ga0207697_10149067 3300025315 Bacteria 1017
276 Ga0207656_10005222 3300025321 Bacteria 4573
277 Ga0207656_10021936 3300025321 Bacteria 2557
278 Ga0207656_10155001 3300025321 Bacteria 1087
279 Ga0207713_1070882 3300025735 Bacteria 1287
280 Ga0207682_10007605 3300025893 Bacteria 4312
281 Ga0207682_10049275 3300025893 Bacteria 1738
282 Ga0207710_10004955 3300025900 Bacteria 5769
283 Ga0207688_10462528 3300025901 Bacteria 792
284 Ga0207680_10004230 3300025903 Bacteria 6795
285 Ga0207680_10006079 3300025903 Bacteria 5814
286 Ga0207680_10034048 3300025903 Bacteria 2911
287 Ga0207680_10077641 3300025903 Bacteria 2078
288 Ga0207647_10002583 3300025904 Bacteria 13704
289 Ga0207647_10007170 3300025904 Bacteria 8081
290 Ga0207647_10009661 3300025904 Bacteria 6848
291 Ga0207647_10108367 3300025904 Bacteria 1643
292 Ga0207647_10154111 3300025904 Bacteria 1342
293 Ga0207645_10007046 3300025907 Bacteria 8004
294 Ga0207645_10075152 3300025907 Bacteria 2163
295 Ga0207645_10367224 3300025907 Bacteria 964
296 Ga0207643_10052301 3300025908 Bacteria 2319
297 Ga0207643_10206399 3300025908 Bacteria 1198
298 Ga0207705_10000002 3300025909 Bacteria 2046852
299 Ga0207705_10000484 3300025909 Bacteria 34139
300 Ga0207705_10001745 3300025909 Bacteria 17203
301 Ga0207705_10001825 3300025909 Bacteria 16767
302 Ga0207705_10003572 3300025909 Bacteria 11842
303 Ga0207705_10012492 3300025909 Bacteria 6135
304 Ga0207705_10026379 3300025909 Bacteria 4143
305 Ga0207705_10038076 3300025909 Bacteria 3442
306 Ga0207705_10049071 3300025909 Bacteria 3038
307 Ga0207705_10062137 3300025909 Bacteria 2698
308 Ga0207705_10950109 3300025909 Bacteria 665
309 Ga0207707_10049693 3300025912 Bacteria 3653
310 Ga0207707_10328138 3300025912 Bacteria 1320
311 Ga0207707_10447734 3300025912 Bacteria 1105
312 Ga0207707_10912621 3300025912 Bacteria 725
313 Ga0207695_10031682 3300025913 Bacteria 5794
314 Ga0207660_10112179 3300025917 Bacteria 2053
315 Ga0207660_10129339 3300025917 Bacteria 1920
316 Ga0207662_10016667 3300025918 Bacteria 4149
317 Ga0207662_10178877 3300025918 Bacteria 1364
318 Ga0207657_10000223 3300025919 Bacteria 59285
319 Ga0207657_10001247 3300025919 Bacteria 27200
320 Ga0207657_10007500 3300025919 Bacteria 11182
321 Ga0207657_10010881 3300025919 Bacteria 9053
322 Ga0207657_10035997 3300025919 Bacteria 4434
323 Ga0207657_10109681 3300025919 Bacteria 2280
324 Ga0207657_10216014 3300025919 Bacteria 1537
325 Ga0207657_10243090 3300025919 Bacteria 1437
326 Ga0207649_10000659 3300025920 Bacteria 23023
327 Ga0207649_10010463 3300025920 Bacteria 5097
328 Ga0207649_10065124 3300025920 Bacteria 2306
329 Ga0207649_10186581 3300025920 Bacteria 1455
330 Ga0207649_10272597 3300025920 Bacteria 1227
331 Ga0207652_10065349 3300025921 Bacteria 3150
332 Ga0207681_10149198 3300025923 Bacteria 1750
333 Ga0207681_10218785 3300025923 Bacteria 1472
334 Ga0207681_10227030 3300025923 Bacteria 1447
335 Ga0207694_10018876 3300025924 Bacteria 5212
336 Ga0207694_10049198 3300025924 Bacteria 3263
337 Ga0207694_10353041 3300025924 Bacteria 1217
338 Ga0207694_10353483 3300025924 Bacteria 1217
339 Ga0207694_10363345 3300025924 Bacteria 1200
340 Ga0207694_10856658 3300025924 Bacteria 768
341 Ga0207650_10000069 3300025925 Bacteria 138442
342 Ga0207650_10024733 3300025925 Bacteria 4273
343 Ga0207650_10037959 3300025925 Bacteria 3513
344 Ga0207650_10480781 3300025925 Bacteria 1036
345 Ga0207659_10169367 3300025926 Bacteria 1722
346 Ga0207687_10360079 3300025927 Bacteria 1187
347 Ga0207687_10374109 3300025927 Bacteria 1166
348 Ga0207700_10007574 3300025928 Bacteria 6652
349 Ga0207664_10118545 3300025929 Bacteria 2211
350 Ga0207664_10426069 3300025929 Bacteria 1182
351 Ga0207644_10002343 3300025931 Bacteria 12231
352 Ga0207644_10012564 3300025931 Bacteria 5628
353 Ga0207644_10270886 3300025931 Bacteria 1360
354 Ga0207644_10580671 3300025931 Bacteria 929
355 Ga0207690_10000528 3300025932 Bacteria 24871
356 Ga0207690_10004734 3300025932 Bacteria 8038
357 Ga0207690_10020755 3300025932 Bacteria 4063
358 Ga0207690_10061840 3300025932 Bacteria 2547
359 Ga0207690_10124323 3300025932 Bacteria 1879
360 Ga0207690_10185781 3300025932 Bacteria 1568
361 Ga0207690_10346062 3300025932 Bacteria 1174
362 Ga0207690_10423859 3300025932 Bacteria 1065
363 Ga0207706_10000616 3300025933 Bacteria 37795
364 Ga0207706_10029984 3300025933 Bacteria 4855
365 Ga0207706_10040732 3300025933 Bacteria 4118
366 Ga0207706_10145127 3300025933 Bacteria 2087
367 Ga0207706_10226977 3300025933 Bacteria 1634
368 Ga0207709_10023662 3300025935 Bacteria 3498
369 Ga0207709_10180387 3300025935 Bacteria 1491
370 Ga0207669_10173791 3300025937 Bacteria 1536
371 Ga0207669_10317751 3300025937 Bacteria 1190
372 Ga0207704_10039542 3300025938 Bacteria 2748
373 Ga0207704_10279339 3300025938 Bacteria 1268
374 Ga0207704_10375805 3300025938 Bacteria 1114
375 Ga0207704_10618799 3300025938 Bacteria 889
376 Ga0207665_10027914 3300025939 Bacteria 3728
377 Ga0207691_10040981 3300025940 Bacteria 4278
378 Ga0207691_10095473 3300025940 Bacteria 2659
379 Ga0207691_10140643 3300025940 Bacteria 2127
380 Ga0207711_10000025 3300025941 Bacteria 289972
381 Ga0207711_10002648 3300025941 Bacteria 15820
382 Ga0207711_10004929 3300025941 Bacteria 11336
383 Ga0207711_10009023 3300025941 Bacteria 8335
384 Ga0207711_10014312 3300025941 Bacteria 6589
385 Ga0207711_10017709 3300025941 Bacteria 5919
386 Ga0207711_10572788 3300025941 Bacteria 1053
387 Ga0207689_10022353 3300025942 Bacteria 5319
388 Ga0207689_10170390 3300025942 Bacteria 1794
389 Ga0207689_10410168 3300025942 Bacteria 1130
390 Ga0207661_10016172 3300025944 Bacteria 5499
391 Ga0207661_10171262 3300025944 Bacteria 1890
392 Ga0207661_10787368 3300025944 Bacteria 875
393 Ga0207679_10000479 3300025945 Bacteria 28104
394 Ga0207679_10163688 3300025945 Bacteria 1824
395 Ga0207679_10187253 3300025945 Bacteria 1717
396 Ga0207679_10368414 3300025945 Bacteria 1257
397 Ga0207679_10627920 3300025945 Bacteria 970
398 Ga0207679_10652008 3300025945 Bacteria 952
399 Ga0207667_10010498 3300025949 Bacteria 10822
400 Ga0207667_10059037 3300025949 Bacteria 4020
401 Ga0207667_10272095 3300025949 Bacteria 1731
402 Ga0207651_10003835 3300025960 Bacteria 7453
403 Ga0207651_10030265 3300025960 Bacteria 3444
404 Ga0207651_10057545 3300025960 Bacteria 2682
405 Ga0207651_10065446 3300025960 Bacteria 2549
406 Ga0207712_10000723 3300025961 Bacteria 25323
407 Ga0207712_10005054 3300025961 Bacteria 8350
408 Ga0207668_10000062 3300025972 Bacteria 88123
409 Ga0207668_10188385 3300025972 Bacteria 1633
410 Ga0207668_10418953 3300025972 Bacteria 1136
411 Ga0207640_10049362 3300025981 Bacteria 2724
412 Ga0207640_10054766 3300025981 Bacteria 2609
413 Ga0207640_10072842 3300025981 Bacteria 2319
414 Ga0207640_10111900 3300025981 Bacteria 1937
415 Ga0207640_10426957 3300025981 Bacteria 1086
416 Ga0207640_10581031 3300025981 Bacteria 946
417 Ga0207658_10005476 3300025986 Bacteria 8703
418 Ga0207658_10010246 3300025986 Bacteria 6368
419 Ga0207658_10158701 3300025986 Bacteria 1851
420 Ga0207658_10343760 3300025986 Bacteria 1297
421 Ga0207677_10002162 3300026023 Bacteria 10328
422 Ga0207703_10005190 3300026035 Bacteria 10525
423 Ga0207703_10019493 3300026035 Bacteria 5302
424 Ga0207703_10028602 3300026035 Bacteria 4395
425 Ga0207703_10125792 3300026035 Bacteria 2207
426 Ga0207639_10000546 3300026041 Bacteria 25792
427 Ga0207639_10001294 3300026041 Bacteria 16898
428 Ga0207639_10033955 3300026041 Bacteria 3767
429 Ga0207639_10303397 3300026041 Bacteria 1412
430 Ga0207639_10396244 3300026041 Bacteria 1243
431 Ga0207639_10568869 3300026041 Bacteria 1042
432 Ga0207678_10008075 3300026067 Bacteria 9280
433 Ga0207678_10013749 3300026067 Bacteria 7109
434 Ga0207678_10028891 3300026067 Bacteria 4840
435 Ga0207678_10054170 3300026067 Bacteria 3454
436 Ga0207678_10225761 3300026067 Bacteria 1603
437 Ga0207702_10012978 3300026078 Bacteria 6931
438 Ga0207702_10020714 3300026078 Bacteria 5438
439 Ga0207702_10047612 3300026078 Bacteria 3614
440 Ga0207702_10141558 3300026078 Bacteria 2177
441 Ga0207702_10324438 3300026078 Bacteria 1467
442 Ga0207702_10754755 3300026078 Bacteria 960
443 Ga0207641_10000002 3300026088 Bacteria 981004
444 Ga0207641_10020933 3300026088 Bacteria 5376
445 Ga0207641_10042964 3300026088 Bacteria 3793
446 Ga0207641_10067620 3300026088 Bacteria 3061
447 Ga0207641_10209119 3300026088 Bacteria 1803
448 Ga0207648_10008052 3300026089 Bacteria 10268
449 Ga0207648_10009676 3300026089 Bacteria 9220
450 Ga0207648_10012702 3300026089 Bacteria 7870
451 Ga0207676_10000044 3300026095 Bacteria 161679
452 Ga0207676_10010620 3300026095 Bacteria 6564
453 Ga0207676_10022848 3300026095 Bacteria 4605
454 Ga0207676_10247685 3300026095 Bacteria 1602
455 Ga0207674_10048053 3300026116 Bacteria 4371
456 Ga0207674_10149917 3300026116 Bacteria 2290
457 Ga0207675_100301257 3300026118 Bacteria 1561
458 Ga0207675_100353123 3300026118 Bacteria 1441
459 Ga0207675_101236096 3300026118 Bacteria 767
460 Ga0207683_10007887 3300026121 Bacteria 9107
461 Ga0207683_10034570 3300026121 Bacteria 4392
462 Ga0207683_10039250 3300026121 Bacteria 4130
463 Ga0207683_10108426 3300026121 Bacteria 2485
464 Ga0207683_11038906 3300026121 Bacteria 760
465 Ga0207698_10012178 3300026142 Bacteria 5615
466 Ga0209967_1008386 3300027364 Bacteria 1422
467 Ga0209974_10034981 3300027876 Bacteria 1668
468 Ga0209974_10195648 3300027876 Bacteria 745
469 Ga0268266_10000733 3300028379 Bacteria 44017
470 Ga0268266_10027292 3300028379 Bacteria 4855
471 Ga0268266_10053791 3300028379 Bacteria 3459
472 Ga0268266_10118901 3300028379 Bacteria 2349
473 Ga0268266_10158155 3300028379 Bacteria 2048
474 Ga0268265_10000003 3300028380 Bacteria 949201
475 Ga0268265_10009247 3300028380 Bacteria 6660
476 Ga0268264_10045694 3300028381 Bacteria 3636
477 Ga0268264_10205367 3300028381 Bacteria 1805
478 Ga0268264_10229824 3300028381 Bacteria 1712
479 Ga0268264_10539944 3300028381 Bacteria 1142
480 Ga0268264_10602394 3300028381 Bacteria 1083
481 Ga0265338_10084073 3300028800 Bacteria 2659
482 Ga0265338_10098220 3300028800 Bacteria 2396
483 Ga0316180_1083564 3300030736 Bacteria 743
484 Ga0307509_10592510 3300031507 Bacteria 782
485 Ga0307408_100044067 3300031548 Bacteria 3178
486 Ga0265313_10016941 3300031595 Bacteria 4166
487 Ga0307508_10004384 3300031616 Bacteria 13803
488 Ga0307405_10088296 3300031731 Bacteria 2045
489 Ga0307405_10109637 3300031731 Bacteria 1867
490 Ga0307413_10169219 3300031824 Bacteria 1544
491 Ga0307413_10320839 3300031824 Bacteria 1183
492 Ga0307413_10878938 3300031824 Bacteria 759
493 Ga0307410_10036572 3300031852 Bacteria 3198
494 Ga0307410_10064289 3300031852 Bacteria 2520
495 Ga0307410_10104548 3300031852 Bacteria 2036
496 Ga0307410_10477646 3300031852 Bacteria 1022
497 Ga0307410_10690448 3300031852 Bacteria 859
498 Ga0307406_10012911 3300031901 Bacteria 4773
499 Ga0307406_10088249 3300031901 Bacteria 2080
500 Ga0307406_10169327 3300031901 Bacteria 1579
501 Ga0307406_10285417 3300031901 Bacteria 1261
502 Ga0307407_10034803 3300031903 Bacteria 2761
503 Ga0307409_100010580 3300031995 Bacteria 5748
504 Ga0307409_100039888 3300031995 Bacteria 3489
505 Ga0307409_100119335 3300031995 Bacteria 2229
506 Ga0307409_100361320 3300031995 Bacteria 1373
507 Ga0307409_100600802 3300031995 Bacteria 1087
508 Ga0307409_100672773 3300031995 Bacteria 1031
509 Ga0307409_101084433 3300031995 Bacteria 821
510 Ga0307416_100022017 3300032002 Bacteria 4589
511 Ga0307414_10014366 3300032004 Bacteria 4746
512 Ga0307414_10027901 3300032004 Bacteria 3654
513 Ga0307414_10052296 3300032004 Bacteria 2841
514 Ga0307414_10060390 3300032004 Bacteria 2681
515 Ga0307414_11005772 3300032004 Bacteria 767
516 Ga0307411_10011344 3300032005 Bacteria 4806
517 Ga0307411_10029834 3300032005 Bacteria 3336
518 Ga0307411_10038989 3300032005 Bacteria 3002
519 Ga0307411_10050369 3300032005 Bacteria 2711
520 Ga0307411_10052077 3300032005 Bacteria 2674
521 Ga0307411_10372842 3300032005 Bacteria 1171
522 Ga0307415_100005316 3300032126 Bacteria 6819
523 Ga0307415_100039321 3300032126 Bacteria 3125
524 Ga0307415_100052250 3300032126 Bacteria 2778
525 Ga0307415_100693019 3300032126 Bacteria 918
526 Ga0307415_101574756 3300032126 Bacteria 630
527 Ga0373949_0021042 3300035090 Bacteria 1497
528 Ga0373952_0063600 3300035092 Bacteria 908
529 Ga0373932_0025680 3300035112 Bacteria 1597
530 Ga0373936_0054026 3300035113 Bacteria 1629
531 Ga0373941_0178523 3300035115 Bacteria 795
532 Ga0373954_0047929 3300035118 Bacteria 2001
533 Ga0373943_0024258 3300035170 Bacteria 2827
534 Ga0373946_0016952 3300035171 Bacteria 2782
535 Ga0373961_0013736 3300035241 Bacteria 2046
536 Ga0373962_0132032 3300035242 Bacteria 805
537 Ga0373931_0004862 3300035691 Bacteria 6172
538 Ga0373931_0303033 3300035691 Bacteria 987
539 Ga0373935_0035783 3300035692 Bacteria 3100
540 Ga0373935_0657379 3300035692 Bacteria 769
541 Ga0373927_0095889 3300035695 Bacteria 1928
542 Ga0373933_0054385 3300035724 Bacteria 2399
543 Ga0373933_0144089 3300035724 Bacteria 1506
544 Ga0373937_0004874 3300036401 Bacteria 11407
545 Ga0373937_0536967 3300036401 Bacteria 1111
546 Ga0373937_0593682 3300036401 Bacteria 1051
547 Ga0395899_0000973 3300037312 Bacteria 26472
548 Ga0395899_0003333 3300037312 Bacteria 12734
549 Ga0395899_0004515 3300037312 Bacteria 10849
550 Ga0395899_0007993 3300037312 Bacteria 8146
551 Ga0395899_0018580 3300037312 Bacteria 5282
552 Ga0395899_0032872 3300037312 Bacteria 3898
553 Ga0395899_0034409 3300037312 Bacteria 3804
554 Ga0395899_0065531 3300037312 Bacteria 2669
555 Ga0395899_0198723 3300037312 Bacteria 1399
556 Ga0395899_0264762 3300037312 Bacteria 1174
557 Ga0395899_0287023 3300037312 Bacteria 1117
558 Ga0395899_0417332 3300037312 Bacteria 885
559 Ga0395899_0614466 3300037312 Bacteria 691
560 Ga0395900_0000221 3300037418 Bacteria 89883
561 Ga0395900_0000777 3300037418 Bacteria 42484
562 Ga0395900_0001512 3300037418 Bacteria 27627
563 Ga0395900_0016898 3300037418 Bacteria 7448
564 Ga0395900_0019486 3300037418 Bacteria 6917
565 Ga0395900_0032553 3300037418 Bacteria 5361
566 Ga0395900_0037027 3300037418 Bacteria 5030
567 Ga0395900_0052767 3300037418 Bacteria 4185
568 Ga0395900_0063383 3300037418 Bacteria 3799
569 Ga0395900_0073832 3300037418 Bacteria 3507
570 Ga0395900_0077937 3300037418 Bacteria 3405
571 Ga0395900_0194556 3300037418 Bacteria 2055
572 Ga0395900_0205610 3300037418 Bacteria 1990
573 Ga0395900_0206850 3300037418 Bacteria 1983
574 Ga0395900_0376050 3300037418 Bacteria 1389
575 Ga0395900_0393339 3300037418 Bacteria 1352
576 Ga0395900_0508537 3300037418 Bacteria 1154
577 Ga0395900_0545717 3300037418 Bacteria 1104
578 Ga0395900_0849529 3300037418 Bacteria 838
579 Ga0395898_0000053 3300037466 Bacteria 279600
580 Ga0395898_0004457 3300037466 Bacteria 15305
581 Ga0395898_0015175 3300037466 Bacteria 7908
582 Ga0395898_0024657 3300037466 Bacteria 6067
583 Ga0395898_0101641 3300037466 Bacteria 2760
584 Ga0395898_0122083 3300037466 Bacteria 2496
585 Ga0395898_0158880 3300037466 Bacteria 2162
586 Ga0395898_0302953 3300037466 Bacteria 1524
587 Ga0395898_0881500 3300037466 Bacteria 833
588 Ga0395905_0000031 3300037471 Bacteria 286757
589 Ga0395905_0001351 3300037471 Bacteria 29880
590 Ga0395905_0006929 3300037471 Bacteria 11331
591 Ga0395905_0011337 3300037471 Bacteria 8620
592 Ga0395905_0018068 3300037471 Bacteria 6694
593 Ga0395905_0021621 3300037471 Bacteria 6084
594 Ga0395905_0040916 3300037471 Bacteria 4348
595 Ga0395905_0082765 3300037471 Bacteria 3007
596 Ga0395905_0083769 3300037471 Bacteria 2987
597 Ga0395905_0094768 3300037471 Bacteria 2800
598 Ga0395905_0101879 3300037471 Bacteria 2695
599 Ga0395905_0121007 3300037471 Bacteria 2460
600 Ga0395905_0130924 3300037471 Bacteria 2359
601 Ga0395905_0131969 3300037471 Bacteria 2349
602 Ga0395905_0133874 3300037471 Bacteria 2331
603 Ga0395905_0141893 3300037471 Bacteria 2259
604 Ga0395905_0188908 3300037471 Bacteria 1933
605 Ga0395905_0233950 3300037471 Bacteria 1718
606 Ga0395905_0235648 3300037471 Bacteria 1711
607 Ga0395905_0240529 3300037471 Bacteria 1691
608 Ga0395905_0385604 3300037471 Bacteria 1295
609 Ga0395905_0406618 3300037471 Bacteria 1256
610 Ga0395905_0444862 3300037471 Bacteria 1193
611 Ga0395905_0549238 3300037471 Bacteria 1056
612 Ga0395905_1081499 3300037471 Bacteria 705
613 Ga0395901_0000440 3300038443 Bacteria 48641
614 Ga0395901_0002264 3300038443 Bacteria 19637
615 Ga0395901_0005009 3300038443 Bacteria 13375
616 Ga0395901_0007805 3300038443 Bacteria 10798
617 Ga0395901_0015216 3300038443 Bacteria 7827
618 Ga0395901_0016489 3300038443 Bacteria 7527
619 Ga0395901_0024866 3300038443 Bacteria 6147
620 Ga0395901_0067398 3300038443 Bacteria 3727
621 Ga0395901_0089082 3300038443 Bacteria 3228
622 Ga0395901_0096553 3300038443 Bacteria 3097
623 Ga0395901_0119271 3300038443 Bacteria 2772
624 Ga0395901_0176180 3300038443 Bacteria 2243
625 Ga0395901_0288329 3300038443 Bacteria 1704
626 Ga0395901_0294825 3300038443 Bacteria 1682
627 Ga0395901_0349711 3300038443 Bacteria 1525
628 Ga0436365_0516111 3300039437 Bacteria 956
629 Ga0436365_0591004 3300039437 Bacteria 16573
630 Ga0436365_0789764 3300039437 Bacteria 2228
631 Ga0436365_1801999 3300039437 Bacteria 28927
632 Ga0436362_0385235 3300039453 Bacteria 33119
633 Ga0439438_069322 3300041405 Bacteria 874
634 Ga0451802_2140950 3300041460 Bacteria 964
635 Ga0439448_0007143 3300042005 Bacteria 3228
636 Ga0439448_0032769 3300042005 Bacteria 1655
637 Ga0439455_0005348 3300042012 Bacteria 2603
638 Ga0450920_053062 3300042122 Bacteria 814
639 Ga0450890_005037 3300042127 Bacteria 1708
640 Ga0450905_000429 3300042142 Bacteria 5145
641 Ga0450889_000192 3300042144 Bacteria 6656
642 Ga0439458_0009992 3300042157 Bacteria 2114
643 Ga0439458_0018501 3300042157 Bacteria 1597
644 Ga0439434_0130739 3300042435 Bacteria 823
645 Ga0466969_0044744 3300044656 Bacteria 2200
646 Ga0466972_0097007 3300044658 Bacteria 1396
647 Ga0466965_0095258 3300044683 Bacteria 1518
648 Ga0466966_0017916 3300044684 Bacteria 4676
649 Ga0466966_0029704 3300044684 Bacteria 3554
650 Ga0466966_0391808 3300044684 Bacteria 834
651 Ga0466963_0002507 3300044694 Bacteria 10277
652 Ga0466963_0209017 3300044694 Bacteria 1365
653 Ga0466963_0258016 3300044694 Bacteria 1224
654 Ga0466963_0337192 3300044694 Bacteria 1061
655 Ga0466963_0628365 3300044694 Bacteria 758
656 Ga0466964_0054893 3300044706 Bacteria 1644
657 Ga0466971_0182073 3300044719 Bacteria 988
658 Ga0466970_0003469 3300044765 Bacteria 7681
659 Ga0466970_0178483 3300044765 Bacteria 1178
660 Ga0466957_0021853 3300044842 Bacteria 3772
661 Ga0466957_0033832 3300044842 Bacteria 3066
662 Ga0466957_0058830 3300044842 Bacteria 2354
663 Ga0466957_0066362 3300044842 Bacteria 2224
664 Ga0466957_0897574 3300044842 Bacteria 633
665 Ga0466960_0135974 3300044901 Bacteria 1301
666 Ga0466960_0354915 3300044901 Bacteria 837
667 Ga0466959_0109870 3300045049 Bacteria 1968
668 Ga0466959_0218379 3300045049 Bacteria 1323
669 Ga0466959_0464421 3300045049 Bacteria 857
670 Ga0466958_0000676 3300045836 Bacteria 14782
671 Ga0466958_0050608 3300045836 Bacteria 2515
672 Ga0466958_0259367 3300045836 Bacteria 1112
673 Ga0466967_0002603 3300045976 Bacteria 11343
674 Ga0466967_0004260 3300045976 Bacteria 9609
675 Ga0466967_0019017 3300045976 Bacteria 5513
676 Ga0466967_0091181 3300045976 Bacteria 2769
677 Ga0466967_0220391 3300045976 Bacteria 1802
678 Ga0466967_0240355 3300045976 Bacteria 1727
679 Ga0466967_0487412 3300045976 Bacteria 1208
680 Ga0466967_0594307 3300045976 Bacteria 1092
681 Ga0466967_0824716 3300045976 Bacteria 921
682 Ga0466967_1392654 3300045976 Bacteria 698
683 Ga0495617_006120 3300046452 Bacteria 4239
684 Ga0495582_0266549 3300046473 Bacteria 983
685 Ga0495616_0254005 3300046513 Bacteria 754
686 Ga0495643_0407929 3300046522 Bacteria 598
687 Ga0495663_0014591 3300046525 Bacteria 2203
688 Ga0495663_0015333 3300046525 Bacteria 2158
689 Ga0495642_0341043 3300046528 Bacteria 658
690 Ga0495652_0326049 3300046529 Bacteria 1108
691 Ga0495598_0000288 3300046537 Bacteria 9105
692 Ga0495621_0000258 3300046539 Bacteria 12621
693 Ga0495633_0034072 3300046558 Bacteria 2451
694 Ga0495668_0036982 3300046616 Bacteria 2733
695 Ga0495625_0131550 3300046660 Bacteria 1695
696 Ga0495659_0128080 3300046664 Bacteria 1005
697 Ga0495647_0438268 3300046681 Bacteria 604
698 Ga0495669_0004902 3300046684 Bacteria 5555
699 Ga0495669_0016565 3300046684 Bacteria 3157
700 Ga0495669_0077869 3300046684 Bacteria 1519
701 Ga0495669_0260884 3300046684 Bacteria 832
702 Ga0495670_0000690 3300046691 Bacteria 16043
703 Ga0495687_106026 3300047443 Bacteria 1044
704 Ga0495677_0002083 3300047445 Bacteria 7960
705 Ga0495602_0310362 3300048088 Bacteria 1151
706 Ga0496101_0041762 3300048904 Bacteria 3272
707 Ga0496102_0121289 3300048905 Bacteria 2442
708 Ga0496102_0370806 3300048905 Bacteria 1347
709 Ga0496103_0142207 3300048906 Bacteria 1535
710 Ga0496103_0509593 3300048906 Bacteria 770
711 Ga0496107_0188000 3300048910 Bacteria 1534
712 Ga0496107_0878012 3300048910 Bacteria 654
713 Ga0496108_0029105 3300048911 Bacteria 4572
714 Ga0496109_0006427 3300048912 Bacteria 9898
715 Ga0496109_0179806 3300048912 Bacteria 1986
716 Ga0496109_0996613 3300048912 Bacteria 775
717 Ga0496111_0190768 3300048914 Bacteria 1523
718 Ga0496111_0260005 3300048914 Bacteria 1288
719 Ga0496112_0023006 3300048915 Bacteria 5947
720 Ga0496112_0046192 3300048915 Bacteria 4270
721 Ga0496112_0446365 3300048915 Bacteria 1231
722 Ga0496113_0013267 3300048916 Bacteria 5576
723 Ga0496113_0025913 3300048916 Bacteria 4187
724 Ga0496113_0444333 3300048916 Bacteria 1042
725 Ga0496113_1003976 3300048916 Bacteria 657
726 Ga0496114_0669028 3300048917 Bacteria 912
727 Ga0496117_0034695 3300048920 Bacteria 3798
728 Ga0496118_0019807 3300048921 Bacteria 6000
729 Ga0496126_0061468 3300048929 Bacteria 3374
730 Ga0501306_051874 3300049127 Bacteria 659
731 Ga0501292_000088 3300049515 Bacteria 16990
732 Ga0501294_000241 3300049517 Bacteria 6800
733 Ga0501300_003094 3300049523 Bacteria 2482
734 Ga0501315_014184 3300049531 Bacteria 1007
735 Ga0501033_0071178 3300049570 Bacteria 2555
736 Ga0501034_0076662 3300049571 Bacteria 3350
737 Ga0501047_0025996 3300049581 Bacteria 5629
738 Ga0501067_0022624 3300049583 Bacteria 3478
739 Ga0501067_0136164 3300049583 Bacteria 1368
740 Ga0501068_0371216 3300049584 Bacteria 921
741 Ga0501069_0049843 3300049585 Bacteria 2328
742 Ga0501070_0193460 3300049586 Bacteria 1671
743 Ga0501071_0282657 3300049587 Bacteria 1256
744 Ga0501072_0015507 3300049588 Bacteria 5840
745 Ga0501073_0004494 3300049589 Bacteria 10476
746 Ga0501074_0030693 3300049590 Bacteria 3895
747 Ga0501074_0036865 3300049590 Bacteria 3543
748 Ga0501206_000112 3300049653 Bacteria 8412
749 Ga0501224_000219 3300049664 Bacteria 6508
750 Ga0501227_008045 3300049665 Bacteria 2263
751 Ga0501235_000736 3300049669 Bacteria 6680
752 Ga0501257_050098 3300049686 Bacteria 1040
753 Ga0501259_000816 3300049688 Bacteria 5117
754 Ga0501261_000417 3300049690 Bacteria 5575
755 Ga0501225_0000787 3300049705 Bacteria 9923
756 Ga0501245_003064 3300049708 Bacteria 2256
757 Ga0501080_0034392 3300049742 Bacteria 4731
758 Ga0501080_0369798 3300049742 Bacteria 1293
759 Ga0501279_000074 3300049775 Bacteria 16852
760 Ga0501280_000191 3300049776 Bacteria 15378
761 Ga0501281_00081 3300049777 Bacteria 11133
762 Ga0501282_000381 3300049778 Bacteria 5364
763 Ga0501283_010678 3300049779 Bacteria 1354
764 Ga0501035_0778342 3300049822 Bacteria 766
765 Ga0501044_0536728 3300049823 Bacteria 1068
766 Ga0501044_0947156 3300049823 Bacteria 734
767 nmdc:mga06r32_258210_c1 3300050510 Bacteria 1730
768 nmdc:mga0n895_162161_c1 3300050512 Bacteria 2267
769 Ga0495655_0059720 3300053083 Bacteria 1036
770 Ga0500554_235206 3300053102 Bacteria 607
771 Ga0500595_000405 3300053119 Bacteria 27569
772 Ga0500595_016123 3300053119 Bacteria 2789
773 Ga0500559_0434538 3300053136 Bacteria 608
774 Ga0501084_0074161 3300054114 Bacteria 2849
775 Ga0587084_022667 3300059477 Bacteria 952
776 Ga0501082_0555027 3300060353 Bacteria 1005
777 Ga0466962_0020301 3300061719 Bacteria 3193
778 Ga0466962_0206174 3300061719 Bacteria 961
779 2507509763 2507262055 Bacteria 8048963
780 2508543779 2508501009 Bacteria 7784016
781 2508698433 2508501042 Bacteria 8719808
782 2515630025 2515154112 Bacteria 8294334
783 2793060263 2791355196 Bacteria 7323613
784 2809064865 2808606401 Bacteria 4586670
785 2809080832 2808606404 Bacteria 4652788
786 2809085197 2808606405 Bacteria 4586632
787 2848298250 2848297114 Bacteria 3608511
788 2874595128 2874590934 Bacteria 8299676
789 2874632704 2874628541 Bacteria 8630250
790 2874650989 2874645413 Bacteria 8214782
791 2876775064 2876771140 Bacteria 8287509
792 2876823879 2876818435 Bacteria 8274608
793 2879080507 2879074833 Bacteria 8279565
794 2879149198 2879142872 Bacteria 8267021
795 2880521897 2880518877 Bacteria 5012590
796 2935611378 2935608549 Bacteria 8203142
797 2935648762 2935648319 Bacteria 8801166
798 2935657155 2935656913 Bacteria 8965014
799 2935820855 2935819856 Bacteria 8261050
800 2935850885 2935847175 Bacteria 8228321
801 2935913748 2935908558 Bacteria 8568796
802 2935920262 2935916978 Bacteria 9113783
803 2935930601 2935926038 Bacteria 8601059
804 2935939426 2935934488 Bacteria 8602579
805 2935946375 2935942939 Bacteria 8599779
806 2935955786 2935951376 Bacteria 8602333
807 2935972504 2935967501 Bacteria 8603075
808 2935981665 2935975950 Bacteria 8347125
809 2935991040 2935984226 Bacteria 8302647
810 2936011672 2936011229 Bacteria 8801034
811 2936020267 2936019824 Bacteria 8804134
812 2936028962 2936028420 Bacteria 8965941
813 2936046990 2936046547 Bacteria 8903709
814 2936058130 2936055302 Bacteria 8785755
815 8006930380 8006926726 Bacteria 6749210
816 8016632290 8016630954 Bacteria 9217207
817 8019626842 8019619141 Bacteria 9218857
818 8019644015 8019638758 Bacteria 9062356
819 8019663466 8019659431 Bacteria 8577854
820 8019673080 8019668869 Bacteria 8791617
821 8019683060 8019678201 Bacteria 8863603
822 8019688757 8019687851 Bacteria 8712826
823 Ga0068868_100025177
824 JGI24741J21665_1010075
825 JGI24741J21665_1010189
826 JGI24740J21852_10001392
827 JGI24740J21852_10006828
828 JGI24740J21852_10037057
829 JGI24739J22299_10010528
830 JGI24739J22299_10041361
831 JGI24737J22298_10063939
832 JGI24735J21928_10019234
833 JGI24735J21928_10162953
834 JGI24738J21930_10002194
835 JGI24738J21930_10019404
836 JGI24744J21845_10000034
837 Ga0065715_10244338
838 Ga0065715_10273178
839 Ga0070658_10013640
840 Ga0070658_10020583
841 Ga0070658_10057953
842 Ga0070658_10091541
843 Ga0070658_10173973
844 Ga0070658_10493973
845 Ga0070676_10435944
846 Ga0070676_10446567
847 Ga0070683_100094211
848 Ga0070683_100097247
849 Ga0070683_100177271
850 Ga0070683_100243466
851 Ga0070683_101442549
852 Ga0070690_100012042
853 Ga0070670_100000075
854 Ga0070670_100026404
855 Ga0070670_100037046
856 Ga0070670_100037322
857 Ga0070677_10027811
858 Ga0068869_100150340
859 Ga0068869_100360088
860 Ga0070666_10003597
861 Ga0070666_10068528
862 Ga0070666_10090661
863 Ga0070666_10128663
864 Ga0070680_100103412
865 Ga0070682_100034188
866 Ga0070682_100274812
867 Ga0070682_100822228
868 Ga0068868_100089899
869 Ga0068868_100107056
870 Ga0070660_100002891
871 Ga0070660_100007791
872 Ga0070660_100013592
873 Ga0070660_100015088
874 Ga0070660_100032871
875 Ga0070660_100502673
876 Ga0070661_100000378
877 Ga0070661_100255929
878 Ga0070661_100620340
879 Ga0070692_10028912
880 Ga0070668_100023561
881 Ga0070668_100179313
882 Ga0070668_100381347
883 Ga0070669_100054545
884 Ga0070669_100101961
885 Ga0070669_100160283
886 Ga0070669_100423805
887 Ga0070675_100025299
888 Ga0070675_100060735
889 Ga0070675_100725811
890 Ga0070671_100029750
891 Ga0070671_100060355
892 Ga0070671_100066753
893 Ga0070671_100151152
894 Ga0070671_100182567
895 Ga0070671_100691263
896 Ga0070674_100128556
897 Ga0070674_100319241
898 Ga0070673_100054262
899 Ga0070673_100079951
900 Ga0070673_100195999
901 Ga0070673_100216124
902 Ga0070673_100486337
903 Ga0070673_100497276
904 Ga0070673_101161406
905 Ga0070659_100011523
906 Ga0070659_100127240
907 Ga0070659_100137500
908 Ga0070659_100499768
909 Ga0070659_100519321
910 Ga0070667_100000039
911 Ga0070667_100011640
912 Ga0070667_100068943
913 Ga0070667_100248567
914 Ga0070714_100175931
915 Ga0070714_100525585
916 Ga0070714_100776941
917 Ga0070713_100323140
918 Ga0070694_100007775
919 Ga0070663_100025097
920 Ga0070663_100031065
921 Ga0070663_100067856
922 Ga0070678_100076029
923 Ga0070678_100151644
924 Ga0070678_100158074
925 Ga0070662_100004163
926 Ga0070662_100017760
927 Ga0070662_100037731
928 Ga0070662_100103846
929 Ga0070662_100195622
930 Ga0070662_100251285
931 Ga0070662_100377300
932 Ga0070681_10169060
933 Ga0070681_10513451
934 Ga0070681_10601878
935 Ga0068867_100004535
936 Ga0068867_100006865
937 Ga0070679_100113172
938 Ga0070684_100057452
939 Ga0070684_100095295
940 Ga0070684_100173736
941 Ga0068853_100000371
942 Ga0068853_100003315
943 Ga0068853_100305111
944 Ga0068853_100338138
945 Ga0068853_100547001
946 Ga0070672_100035836
947 Ga0070672_100117164
948 Ga0070672_100425167
949 Ga0070672_100831257
950 Ga0070696_100013365
951 Ga0070696_100110546
952 Ga0070696_101073688
953 Ga0070693_100001061
954 Ga0070693_100033553
955 Ga0070665_100021441
956 Ga0070665_100023728
957 Ga0070665_100025177
958 Ga0070665_100029734
959 Ga0070665_100117624
960 Ga0068855_100001629
961 Ga0068855_100292663
962 Ga0068855_100504310
963 Ga0070664_100002298
964 Ga0070664_100124865
965 Ga0070664_100128418
966 Ga0070664_100130693
967 Ga0068857_100014445
968 Ga0068857_100039350
969 Ga0068857_100055675
970 Ga0068857_100096146
971 Ga0068854_100036953
972 Ga0068854_100145560
973 Ga0068854_100269812
974 Ga0068854_100310613
975 Ga0068854_100358554
976 Ga0068856_100001149
977 Ga0068856_100065317
978 Ga0068856_100223268
979 Ga0068856_100292261
980 Ga0068856_100719533
981 Ga0068856_101201918
982 Ga0068852_100022870
983 Ga0068852_100048453
984 Ga0068852_100058630
985 Ga0068852_100153654
986 Ga0068852_100435191
987 Ga0068859_100084174
988 Ga0068859_101101518
989 Ga0068864_100000016
990 Ga0068864_100005877
991 Ga0068864_100014693
992 Ga0068864_100439607
993 Ga0068864_100536480
994 Ga0068864_101158988
995 Ga0068866_10054825
996 Ga0068866_10113156
997 Ga0068861_101338323
998 Ga0068851_10014198
999 Ga0068851_10018029
1000 Ga0068870_10072422
1001 Ga0068870_10552141
1002 Ga0068863_100000033
1003 Ga0068863_100109342
1004 Ga0068863_100118096
1005 Ga0068863_100119724
1006 Ga0068863_100122714
1007 Ga0068863_100631205
1008 Ga0068858_100036141
1009 Ga0068858_100055697
1010 Ga0068858_100089325
1011 Ga0068858_100205265
1012 Ga0068860_100022352
1013 Ga0068860_100114263
1014 Ga0068860_100205727
1015 Ga0068860_100264367
1016 Ga0068860_100483376
1017 Ga0068860_100748923
1018 Ga0068862_100000040
1019 Ga0068862_100484321
1020 Ga0081539_10015398
1021 Ga0070717_10007362
1022 Ga0070716_100374378
1023 Ga0097621_100162639
1024 Ga0097621_100202842
1025 Ga0068871_100065028
1026 Ga0075434_100355198
1027 Ga0068865_100268959
1028 Ga0075436_100707040
1029 Ga0097620_100084175
1030 Ga0097620_101101476
1031 Ga0079104_1032594
1032 Ga0105251_10004716
1033 Ga0105245_10072535
1034 Ga0105245_11321456
1035 Ga0105245_11417475
1036 Ga0105247_10018821
1037 Ga0114129_11270946
1038 Ga0105243_10069992
1039 Ga0105242_10158169
1040 Ga0105248_10000021
1041 Ga0105248_10001425
1042 Ga0105248_10010652
1043 Ga0105248_10022689
1044 Ga0105248_10043820
1045 Ga0105248_10065969
1046 Ga0105248_10504523
1047 Ga0105238_10456040
1048 Ga0105238_10469713
1049 Ga0105238_10555783
1050 Ga0105249_10001881
1051 Ga0105249_10520247
1052 Ga0105239_10468251
1053 Ga0105246_10161931
1054 Ga0157373_10021771
1055 Ga0157373_10064751
1056 Ga0157373_10406158
1057 Ga0157371_10020175
1058 Ga0157371_10033548
1059 Ga0157371_10089328
1060 Ga0157371_10374672
1061 Ga0157371_10468101
1062 Ga0157371_10698031
1063 Ga0157370_10002611
1064 Ga0157370_10098071
1065 Ga0157370_10100722
1066 Ga0157370_10154252
1067 Ga0157370_10262965
1068 Ga0157370_10486950
1069 Ga0157369_10012264
1070 Ga0157369_10211906
1071 Ga0157369_10545908
1072 Ga0157374_10188509
1073 Ga0157378_10098206
1074 Ga0157378_10511783
1075 Ga0163162_10545435
1076 Ga0163162_10592138
1077 Ga0157375_10524144
1078 Ga0163163_10002656
1079 Ga0163163_10064459
1080 Ga0157380_11337360
1081 Ga0157377_10112415
1082 Ga0157377_10134202
1083 Ga0157379_10051816
1084 Ga0157379_10060038
1085 Ga0157379_10562570
1086 Ga0157379_10769217
1087 Ga0183363_1006
1088 Ga0213873_10000021
1089 Ga0213876_10000050
1090 Ga0213876_10005218
1091 Ga0213876_10015842
1092 Ga0209026_1013989
1093 Ga0209675_1024192
1094 Ga0209676_1004347
1095 Ga0209050_1031105
1096 Ga0207697_10120618
1097 Ga0207697_10149067
1098 Ga0207656_10005222
1099 Ga0207656_10021936
1100 Ga0207656_10155001
1101 Ga0207713_1070882
1102 Ga0207682_10007605
1103 Ga0207682_10049275
1104 Ga0207710_10004955
1105 Ga0207688_10462528
1106 Ga0207680_10004230
1107 Ga0207680_10006079
1108 Ga0207680_10034048
1109 Ga0207680_10077641
1110 Ga0207647_10002583
1111 Ga0207647_10007170
1112 Ga0207647_10009661
1113 Ga0207647_10108367
1114 Ga0207647_10154111
1115 Ga0207645_10007046
1116 Ga0207645_10075152
1117 Ga0207645_10367224
1118 Ga0207643_10052301
1119 Ga0207643_10206399
1120 Ga0207705_10000002
1121 Ga0207705_10000484
1122 Ga0207705_10001745
1123 Ga0207705_10001825
1124 Ga0207705_10003572
1125 Ga0207705_10012492
1126 Ga0207705_10026379
1127 Ga0207705_10038076
1128 Ga0207705_10049071
1129 Ga0207705_10062137
1130 Ga0207705_10950109
1131 Ga0207707_10049693
1132 Ga0207707_10328138
1133 Ga0207707_10447734
1134 Ga0207707_10912621
1135 Ga0207695_10031682
1136 Ga0207660_10112179
1137 Ga0207660_10129339
1138 Ga0207662_10016667
1139 Ga0207662_10178877
1140 Ga0207657_10000223
1141 Ga0207657_10001247
1142 Ga0207657_10007500
1143 Ga0207657_10010881
1144 Ga0207657_10035997
1145 Ga0207657_10109681
1146 Ga0207657_10216014
1147 Ga0207657_10243090
1148 Ga0207649_10000659
1149 Ga0207649_10010463
1150 Ga0207649_10065124
1151 Ga0207649_10186581
1152 Ga0207649_10272597
1153 Ga0207652_10065349
1154 Ga0207681_10149198
1155 Ga0207681_10218785
1156 Ga0207681_10227030
1157 Ga0207694_10018876
1158 Ga0207694_10049198
1159 Ga0207694_10353041
1160 Ga0207694_10353483
1161 Ga0207694_10363345
1162 Ga0207694_10856658
1163 Ga0207650_10000069
1164 Ga0207650_10024733
1165 Ga0207650_10037959
1166 Ga0207650_10480781
1167 Ga0207659_10169367
1168 Ga0207687_10360079
1169 Ga0207687_10374109
1170 Ga0207700_10007574
1171 Ga0207664_10118545
1172 Ga0207664_10426069
1173 Ga0207644_10002343
1174 Ga0207644_10012564
1175 Ga0207644_10270886
1176 Ga0207644_10580671
1177 Ga0207690_10000528
1178 Ga0207690_10004734
1179 Ga0207690_10020755
1180 Ga0207690_10061840
1181 Ga0207690_10124323
1182 Ga0207690_10185781
1183 Ga0207690_10346062
1184 Ga0207690_10423859
1185 Ga0207706_10000616
1186 Ga0207706_10029984
1187 Ga0207706_10040732
1188 Ga0207706_10145127
1189 Ga0207706_10226977
1190 Ga0207709_10023662
1191 Ga0207709_10180387
1192 Ga0207669_10173791
1193 Ga0207669_10317751
1194 Ga0207704_10039542
1195 Ga0207704_10279339
1196 Ga0207704_10375805
1197 Ga0207704_10618799
1198 Ga0207665_10027914
1199 Ga0207691_10040981
1200 Ga0207691_10095473
1201 Ga0207691_10140643
1202 Ga0207711_10000025
1203 Ga0207711_10002648
1204 Ga0207711_10004929
1205 Ga0207711_10009023
1206 Ga0207711_10014312
1207 Ga0207711_10017709
1208 Ga0207711_10572788
1209 Ga0207689_10022353
1210 Ga0207689_10170390
1211 Ga0207689_10410168
1212 Ga0207661_10016172
1213 Ga0207661_10171262
1214 Ga0207661_10787368
1215 Ga0207679_10000479
1216 Ga0207679_10163688
1217 Ga0207679_10187253
1218 Ga0207679_10368414
1219 Ga0207679_10627920
1220 Ga0207679_10652008
1221 Ga0207667_10010498
1222 Ga0207667_10059037
1223 Ga0207667_10272095
1224 Ga0207651_10003835
1225 Ga0207651_10030265
1226 Ga0207651_10057545
1227 Ga0207651_10065446
1228 Ga0207712_10000723
1229 Ga0207712_10005054
1230 Ga0207668_10000062
1231 Ga0207668_10188385
1232 Ga0207668_10418953
1233 Ga0207640_10049362
1234 Ga0207640_10054766
1235 Ga0207640_10072842
1236 Ga0207640_10111900
1237 Ga0207640_10426957
1238 Ga0207640_10581031
1239 Ga0207658_10005476
1240 Ga0207658_10010246
1241 Ga0207658_10158701
1242 Ga0207658_10343760
1243 Ga0207677_10002162
1244 Ga0207703_10005190
1245 Ga0207703_10019493
1246 Ga0207703_10028602
1247 Ga0207703_10125792
1248 Ga0207639_10000546
1249 Ga0207639_10001294
1250 Ga0207639_10033955
1251 Ga0207639_10303397
1252 Ga0207639_10396244
1253 Ga0207639_10568869
1254 Ga0207678_10008075
1255 Ga0207678_10013749
1256 Ga0207678_10028891
1257 Ga0207678_10054170
1258 Ga0207678_10225761
1259 Ga0207702_10012978
1260 Ga0207702_10020714
1261 Ga0207702_10047612
1262 Ga0207702_10141558
1263 Ga0207702_10324438
1264 Ga0207702_10754755
1265 Ga0207641_10000002
1266 Ga0207641_10020933
1267 Ga0207641_10042964
1268 Ga0207641_10067620
1269 Ga0207641_10209119
1270 Ga0207648_10008052
1271 Ga0207648_10009676
1272 Ga0207648_10012702
1273 Ga0207676_10000044
1274 Ga0207676_10010620
1275 Ga0207676_10022848
1276 Ga0207676_10247685
1277 Ga0207674_10048053
1278 Ga0207674_10149917
1279 Ga0207675_100301257
1280 Ga0207675_100353123
1281 Ga0207675_101236096
1282 Ga0207683_10007887
1283 Ga0207683_10034570
1284 Ga0207683_10039250
1285 Ga0207683_10108426
1286 Ga0207683_11038906
1287 Ga0207698_10012178
1288 Ga0209967_1008386
1289 Ga0209974_10034981
1290 Ga0209974_10195648
1291 Ga0268266_10000733
1292 Ga0268266_10027292
1293 Ga0268266_10053791
1294 Ga0268266_10118901
1295 Ga0268266_10158155
1296 Ga0268265_10000003
1297 Ga0268265_10009247
1298 Ga0268264_10045694
1299 Ga0268264_10205367
1300 Ga0268264_10229824
1301 Ga0268264_10539944
1302 Ga0268264_10602394
1303 Ga0265338_10084073
1304 Ga0265338_10098220
1305 Ga0316180_1083564
1306 Ga0307509_10592510
1307 Ga0307408_100044067
1308 Ga0265313_10016941
1309 Ga0307508_10004384
1310 Ga0307405_10088296
1311 Ga0307405_10109637
1312 Ga0307413_10169219
1313 Ga0307413_10320839
1314 Ga0307413_10878938
1315 Ga0307410_10036572
1316 Ga0307410_10064289
1317 Ga0307410_10104548
1318 Ga0307410_10477646
1319 Ga0307410_10690448
1320 Ga0307406_10012911
1321 Ga0307406_10088249
1322 Ga0307406_10169327
1323 Ga0307406_10285417
1324 Ga0307407_10034803
1325 Ga0307409_100010580
1326 Ga0307409_100039888
1327 Ga0307409_100119335
1328 Ga0307409_100361320
1329 Ga0307409_100600802
1330 Ga0307409_100672773
1331 Ga0307409_101084433
1332 Ga0307416_100022017
1333 Ga0307414_10014366
1334 Ga0307414_10027901
1335 Ga0307414_10052296
1336 Ga0307414_10060390
1337 Ga0307414_11005772
1338 Ga0307411_10011344
1339 Ga0307411_10029834
1340 Ga0307411_10038989
1341 Ga0307411_10050369
1342 Ga0307411_10052077
1343 Ga0307411_10372842
1344 Ga0307415_100005316
1345 Ga0307415_100039321
1346 Ga0307415_100052250
1347 Ga0307415_100693019
1348 Ga0307415_101574756
1349 Ga0373949_0021042
1350 Ga0373952_0063600
1351 Ga0373932_0025680
1352 Ga0373936_0054026
1353 Ga0373941_0178523
1354 Ga0373954_0047929
1355 Ga0373943_0024258
1356 Ga0373946_0016952
1357 Ga0373961_0013736
1358 Ga0373962_0132032
1359 Ga0373931_0004862
1360 Ga0373931_0303033
1361 Ga0373935_0035783
1362 Ga0373935_0657379
1363 Ga0373927_0095889
1364 Ga0373933_0054385
1365 Ga0373933_0144089
1366 Ga0373937_0004874
1367 Ga0373937_0536967
1368 Ga0373937_0593682
1369 Ga0395899_0000973
1370 Ga0395899_0003333
1371 Ga0395899_0004515
1372 Ga0395899_0007993
1373 Ga0395899_0018580
1374 Ga0395899_0032872
1375 Ga0395899_0034409
1376 Ga0395899_0065531
1377 Ga0395899_0198723
1378 Ga0395899_0264762
1379 Ga0395899_0287023
1380 Ga0395899_0417332
1381 Ga0395899_0614466
1382 Ga0395900_0000221
1383 Ga0395900_0000777
1384 Ga0395900_0001512
1385 Ga0395900_0016898
1386 Ga0395900_0019486
1387 Ga0395900_0032553
1388 Ga0395900_0037027
1389 Ga0395900_0052767
1390 Ga0395900_0063383
1391 Ga0395900_0073832
1392 Ga0395900_0077937
1393 Ga0395900_0194556
1394 Ga0395900_0205610
1395 Ga0395900_0206850
1396 Ga0395900_0376050
1397 Ga0395900_0393339
1398 Ga0395900_0508537
1399 Ga0395900_0545717
1400 Ga0395900_0849529
1401 Ga0395898_0000053
1402 Ga0395898_0004457
1403 Ga0395898_0015175
1404 Ga0395898_0024657
1405 Ga0395898_0101641
1406 Ga0395898_0122083
1407 Ga0395898_0158880
1408 Ga0395898_0302953
1409 Ga0395898_0881500
1410 Ga0395905_0000031
1411 Ga0395905_0001351
1412 Ga0395905_0006929
1413 Ga0395905_0011337
1414 Ga0395905_0018068
1415 Ga0395905_0021621
1416 Ga0395905_0040916
1417 Ga0395905_0082765
1418 Ga0395905_0083769
1419 Ga0395905_0094768
1420 Ga0395905_0101879
1421 Ga0395905_0121007
1422 Ga0395905_0130924
1423 Ga0395905_0131969
1424 Ga0395905_0133874
1425 Ga0395905_0141893
1426 Ga0395905_0188908
1427 Ga0395905_0233950
1428 Ga0395905_0235648
1429 Ga0395905_0240529
1430 Ga0395905_0385604
1431 Ga0395905_0406618
1432 Ga0395905_0444862
1433 Ga0395905_0549238
1434 Ga0395905_1081499
1435 Ga0395901_0000440
1436 Ga0395901_0002264
1437 Ga0395901_0005009
1438 Ga0395901_0007805
1439 Ga0395901_0015216
1440 Ga0395901_0016489
1441 Ga0395901_0024866
1442 Ga0395901_0067398
1443 Ga0395901_0089082
1444 Ga0395901_0096553
1445 Ga0395901_0119271
1446 Ga0395901_0176180
1447 Ga0395901_0288329
1448 Ga0395901_0294825
1449 Ga0395901_0349711
1450 Ga0436365_0516111
1451 Ga0436365_0591004
1452 Ga0436365_0789764
1453 Ga0436365_1801999
1454 Ga0436362_0385235
1455 Ga0439438_069322
1456 Ga0451802_2140950
1457 Ga0439448_0007143
1458 Ga0439448_0032769
1459 Ga0439455_0005348
1460 Ga0450920_053062
1461 Ga0450890_005037
1462 Ga0450905_000429
1463 Ga0450889_000192
1464 Ga0439458_0009992
1465 Ga0439458_0018501
1466 Ga0439434_0130739
1467 Ga0466969_0044744
1468 Ga0466972_0097007
1469 Ga0466965_0095258
1470 Ga0466966_0017916
1471 Ga0466966_0029704
1472 Ga0466966_0391808
1473 Ga0466963_0002507
1474 Ga0466963_0209017
1475 Ga0466963_0258016
1476 Ga0466963_0337192
1477 Ga0466963_0628365
1478 Ga0466964_0054893
1479 Ga0466971_0182073
1480 Ga0466970_0003469
1481 Ga0466970_0178483
1482 Ga0466957_0021853
1483 Ga0466957_0033832
1484 Ga0466957_0058830
1485 Ga0466957_0066362
1486 Ga0466957_0897574
1487 Ga0466960_0135974
1488 Ga0466960_0354915
1489 Ga0466959_0109870
1490 Ga0466959_0218379
1491 Ga0466959_0464421
1492 Ga0466958_0000676
1493 Ga0466958_0050608
1494 Ga0466958_0259367
1495 Ga0466967_0002603
1496 Ga0466967_0004260
1497 Ga0466967_0019017
1498 Ga0466967_0091181
1499 Ga0466967_0220391
1500 Ga0466967_0240355
1501 Ga0466967_0487412
1502 Ga0466967_0594307
1503 Ga0466967_0824716
1504 Ga0466967_1392654
1505 Ga0495617_006120
1506 Ga0495582_0266549
1507 Ga0495616_0254005
1508 Ga0495643_0407929
1509 Ga0495663_0014591
1510 Ga0495663_0015333
1511 Ga0495642_0341043
1512 Ga0495652_0326049
1513 Ga0495598_0000288
1514 Ga0495621_0000258
1515 Ga0495633_0034072
1516 Ga0495668_0036982
1517 Ga0495625_0131550
1518 Ga0495659_0128080
1519 Ga0495647_0438268
1520 Ga0495669_0004902
1521 Ga0495669_0016565
1522 Ga0495669_0077869
1523 Ga0495669_0260884
1524 Ga0495670_0000690
1525 Ga0495687_106026
1526 Ga0495677_0002083
1527 Ga0495602_0310362
1528 Ga0496101_0041762
1529 Ga0496102_0121289
1530 Ga0496102_0370806
1531 Ga0496103_0142207
1532 Ga0496103_0509593
1533 Ga0496107_0188000
1534 Ga0496107_0878012
1535 Ga0496108_0029105
1536 Ga0496109_0006427
1537 Ga0496109_0179806
1538 Ga0496109_0996613
1539 Ga0496111_0190768
1540 Ga0496111_0260005
1541 Ga0496112_0023006
1542 Ga0496112_0046192
1543 Ga0496112_0446365
1544 Ga0496113_0013267
1545 Ga0496113_0025913
1546 Ga0496113_0444333
1547 Ga0496113_1003976
1548 Ga0496114_0669028
1549 Ga0496117_0034695
1550 Ga0496118_0019807
1551 Ga0496126_0061468
1552 Ga0501306_051874
1553 Ga0501292_000088
1554 Ga0501294_000241
1555 Ga0501300_003094
1556 Ga0501315_014184
1557 Ga0501033_0071178
1558 Ga0501034_0076662
1559 Ga0501047_0025996
1560 Ga0501067_0022624
1561 Ga0501067_0136164
1562 Ga0501068_0371216
1563 Ga0501069_0049843
1564 Ga0501070_0193460
1565 Ga0501071_0282657
1566 Ga0501072_0015507
1567 Ga0501073_0004494
1568 Ga0501074_0030693
1569 Ga0501074_0036865
1570 Ga0501206_000112
1571 Ga0501224_000219
1572 Ga0501227_008045
1573 Ga0501235_000736
1574 Ga0501257_050098
1575 Ga0501259_000816
1576 Ga0501261_000417
1577 Ga0501225_0000787
1578 Ga0501245_003064
1579 Ga0501080_0034392
1580 Ga0501080_0369798
1581 Ga0501279_000074
1582 Ga0501280_000191
1583 Ga0501281_00081
1584 Ga0501282_000381
1585 Ga0501283_010678
1586 Ga0501035_0778342
1587 Ga0501044_0536728
1588 Ga0501044_0947156
1589 nmdc:mga06r32_258210_c1
1590 nmdc:mga0n895_162161_c1
1591 Ga0495655_0059720
1592 Ga0500554_235206
1593 Ga0500595_000405
1594 Ga0500595_016123
1595 Ga0500559_0434538
1596 Ga0501084_0074161
1597 Ga0587084_022667
1598 Ga0501082_0555027
1599 Ga0466962_0020301
1600 Ga0466962_0206174
1601 2507509763
1602 2508543779
1603 2508698433
1604 2515630025
1605 2793060263
1606 2809064865
1607 2809080832
1608 2809085197
1609 2848298250
1610 2874595128
1611 2874632704
1612 2874650989
1613 2876775064
1614 2876823879
1615 2879080507
1616 2879149198
1617 2880521897
1618 2935611378
1619 2935648762
1620 2935657155
1621 2935820855
1622 2935850885
1623 2935913748
1624 2935920262
1625 2935930601
1626 2935939426
1627 2935946375
1628 2935955786
1629 2935972504
1630 2935981665
1631 2935991040
1632 2936011672
1633 2936020267
1634 2936028962
1635 2936046990
1636 2936058130
1637 8006930380
1638 8016632290
1639 8019626842
1640 8019644015
1641 8019663466
1642 8019673080
1643 8019683060
1644 8019688757

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

39

160

0.92

Map