F482293
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 822 | 540 | 618 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100204049|Ga0070665_1002040493 |
| Length | 248 |
| Sequence | LTDLFENVGDTRPSREAMAEGATLLRGFARPFEAELLPALRAIIKQSPFRHLITPGGHRMSVAMTNSGSVGWVSDSTGYRYDAVDPDTGQNWPAMPPVLRKLAANAAEDAGYRGFAPEACLINRYVPGAKLSLHQDKDELDFAAPIVSVSLGLPATFLFGGLKRADKTARYRLEHGDVVVWGGPSRLFYHGVAPLAEGEHAVMRGSGSTSHSARCGDLSEISPSFRGDAKHRTRNLEIPGSVLRTAPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 18 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 22 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 23 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 24 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 25 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 26 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 27 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 28 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 29 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 32 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 33 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 34 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 35 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 36 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 37 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 38 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 39 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 40 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 41 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 42 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 43 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 44 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 45 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 46 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 47 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 48 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 49 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 50 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 51 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 52 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 53 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 54 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 55 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 56 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 57 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 58 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 59 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 60 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 61 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 62 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 63 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 64 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 65 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 66 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 67 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 68 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 69 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 70 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 71 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 72 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 73 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 74 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 75 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 76 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 77 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 78 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 79 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 80 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 81 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 82 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 83 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 84 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 85 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 86 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 87 | 2904699407 | |||
| 88 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 89 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 90 | 2906610324 | |||
| 91 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 92 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 93 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 94 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 95 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 96 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 97 | 2922368715 | |||
| 98 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 99 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 100 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 101 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 102 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 103 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 104 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 105 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 106 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 107 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 108 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 109 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 110 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 111 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 112 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 113 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 114 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 115 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 116 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 117 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 118 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 119 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 120 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 121 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 122 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 123 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 124 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 125 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 126 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 127 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 128 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 129 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 130 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 131 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 132 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 133 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 134 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 135 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 136 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 137 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 138 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 139 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 140 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 141 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 142 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 143 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 144 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 145 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 146 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 147 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 148 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 149 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 150 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 151 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 152 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 153 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 154 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 155 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 156 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 157 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 158 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 159 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 160 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 161 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 162 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 163 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 164 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 165 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 166 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 167 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 168 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 169 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 170 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 171 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 172 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 173 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 174 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 175 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 176 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 177 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 180 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 181 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 182 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 191 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 197 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 199 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 200 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 204 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 205 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 206 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 207 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 208 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 209 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 210 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 211 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 212 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 213 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 214 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 215 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 216 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 217 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 218 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 219 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 220 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 221 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 222 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 223 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 224 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 225 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 226 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 227 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 228 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 229 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 231 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 232 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 233 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 234 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 258 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 262 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 264 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 265 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 266 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 267 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 273 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 311 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 312 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 313 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 314 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 318 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 319 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 321 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 322 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 323 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 324 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 325 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 326 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 327 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 328 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 329 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 330 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 331 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 332 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 333 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 334 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 335 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 336 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 338 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 339 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 340 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 341 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 342 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 343 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 344 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 345 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 346 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 347 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 348 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 349 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 350 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 351 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 352 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 353 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 354 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 355 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 356 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 357 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 425 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 426 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 427 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 428 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 429 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 430 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 433 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 434 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 435 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 436 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 437 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 438 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 439 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 440 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 441 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 442 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 443 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 444 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 445 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 446 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 447 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 448 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 449 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 466 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 470 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 480 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 481 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 482 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 483 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 484 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 486 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 489 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 490 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 491 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 492 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 494 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 496 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 500 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 501 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 503 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 505 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 507 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 508 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 509 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 510 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 511 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 512 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 513 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 514 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 515 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 516 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 517 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 518 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 519 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 520 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 521 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 522 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 523 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 524 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 525 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 526 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 527 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 528 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 529 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 530 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 531 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 532 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 533 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 534 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 535 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 536 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 537 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 538 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 539 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 540 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.34 |
| Metatranscriptomes | 0.12 |
| Isolates | 24.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.75 |
| Nodule | 19.83 |
| Rhizoplane | 5.47 |
| Rhizosphere | 49.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1005870 | 3300003214 | Bacteria | 2273 |
| 2 | JGI25153J46596_10003908 | 3300003215 | Bacteria | 8174 |
| 3 | JGI25153J46596_10005616 | 3300003215 | Bacteria | 6556 |
| 4 | JGI25153J46596_10008403 | 3300003215 | Bacteria | 4937 |
| 5 | JGI25153J46596_10008855 | 3300003215 | Bacteria | 4753 |
| 6 | JGI25153J46596_10024455 | 3300003215 | Bacteria | 2178 |
| 7 | JGI25160J50197_1003595 | 3300003354 | Bacteria | 6881 |
| 8 | Ga0055536_1000637 | 3300003781 | Bacteria | 23872 |
| 9 | Ga0055531_10009410 | 3300003794 | Bacteria | 4993 |
| 10 | Ga0055543_1003833 | 3300004625 | Bacteria | 4269 |
| 11 | Ga0065165_1002074 | 3300005262 | Bacteria | 18412 |
| 12 | Ga0065165_1002220 | 3300005262 | Bacteria | 17337 |
| 13 | Ga0065165_1016415 | 3300005262 | Bacteria | 2774 |
| 14 | Ga0065165_1050349 | 3300005262 | Bacteria | 1186 |
| 15 | Ga0070658_10406513 | 3300005327 | Bacteria | 1170 |
| 16 | Ga0070670_100234998 | 3300005331 | Bacteria | 1595 |
| 17 | Ga0068869_100196545 | 3300005334 | Bacteria | 1589 |
| 18 | Ga0068869_100506261 | 3300005334 | Bacteria | 1009 |
| 19 | Ga0070682_100299317 | 3300005337 | Bacteria | 1180 |
| 20 | Ga0068868_100098903 | 3300005338 | Bacteria | 2359 |
| 21 | Ga0070660_100190841 | 3300005339 | Bacteria | 1659 |
| 22 | Ga0070660_100764218 | 3300005339 | Bacteria | 812 |
| 23 | Ga0070661_100178364 | 3300005344 | Bacteria | 1615 |
| 24 | Ga0070675_101028222 | 3300005354 | Bacteria | 757 |
| 25 | Ga0070671_100175412 | 3300005355 | Bacteria | 1813 |
| 26 | Ga0070671_100712972 | 3300005355 | Bacteria | 871 |
| 27 | Ga0070674_100012062 | 3300005356 | Bacteria | 5294 |
| 28 | Ga0070659_100179814 | 3300005366 | Bacteria | 1735 |
| 29 | Ga0070667_100361078 | 3300005367 | Bacteria | 1316 |
| 30 | Ga0070709_10185716 | 3300005434 | Bacteria | 1463 |
| 31 | Ga0070713_100012830 | 3300005436 | Bacteria | 6162 |
| 32 | Ga0070710_10045935 | 3300005437 | Bacteria | 2430 |
| 33 | Ga0070711_100068830 | 3300005439 | Bacteria | 2488 |
| 34 | Ga0070663_100011972 | 3300005455 | Bacteria | 5471 |
| 35 | Ga0070663_100032808 | 3300005455 | Bacteria | 3583 |
| 36 | Ga0070663_100070882 | 3300005455 | Bacteria | 2535 |
| 37 | Ga0070663_100071943 | 3300005455 | Bacteria | 2518 |
| 38 | Ga0070663_100155556 | 3300005455 | Bacteria | 1756 |
| 39 | Ga0070663_100485313 | 3300005455 | Bacteria | 1024 |
| 40 | Ga0070678_100193823 | 3300005456 | Bacteria | 1672 |
| 41 | Ga0070662_100582836 | 3300005457 | Bacteria | 940 |
| 42 | Ga0068867_100171073 | 3300005459 | Bacteria | 1721 |
| 43 | Ga0068867_100426294 | 3300005459 | Bacteria | 1125 |
| 44 | Ga0070698_100231832 | 3300005471 | Bacteria | 1779 |
| 45 | Ga0070684_100210755 | 3300005535 | Bacteria | 1771 |
| 46 | Ga0068853_100170200 | 3300005539 | Bacteria | 1970 |
| 47 | Ga0068853_100488017 | 3300005539 | Bacteria | 1162 |
| 48 | Ga0070693_100143917 | 3300005547 | Bacteria | 1503 |
| 49 | Ga0070665_100049587 | 3300005548 | Bacteria | 4212 |
| 50 | Ga0070665_100061335 | 3300005548 | Bacteria | 3769 |
| 51 | Ga0070665_100161421 | 3300005548 | Bacteria | 2243 |
| 52 | Ga0070665_100204049 | 3300005548 | Bacteria | 1977 |
| 53 | Ga0070665_100258288 | 3300005548 | Bacteria | 1743 |
| 54 | Ga0070665_100286459 | 3300005548 | Bacteria | 1649 |
| 55 | Ga0070665_101101699 | 3300005548 | Bacteria | 806 |
| 56 | Ga0070664_100067766 | 3300005564 | Bacteria | 3050 |
| 57 | Ga0070664_100297849 | 3300005564 | Bacteria | 1457 |
| 58 | Ga0070664_100969003 | 3300005564 | Bacteria | 799 |
| 59 | Ga0068854_100088228 | 3300005578 | Bacteria | 2303 |
| 60 | Ga0068854_100319859 | 3300005578 | Bacteria | 1261 |
| 61 | Ga0068852_100068945 | 3300005616 | Bacteria | 3097 |
| 62 | Ga0068852_100215323 | 3300005616 | Bacteria | 1824 |
| 63 | Ga0068859_100266622 | 3300005617 | Bacteria | 1804 |
| 64 | Ga0068859_100964496 | 3300005617 | Bacteria | 936 |
| 65 | Ga0068864_100050579 | 3300005618 | Bacteria | 3577 |
| 66 | Ga0068864_100765040 | 3300005618 | Bacteria | 947 |
| 67 | Ga0068866_10368545 | 3300005718 | Bacteria | 918 |
| 68 | Ga0068861_100050178 | 3300005719 | Bacteria | 3163 |
| 69 | Ga0068861_100205641 | 3300005719 | Bacteria | 1655 |
| 70 | Ga0068863_101011788 | 3300005841 | Bacteria | 834 |
| 71 | Ga0068858_100287010 | 3300005842 | Bacteria | 1568 |
| 72 | Ga0068860_100463816 | 3300005843 | Bacteria | 1261 |
| 73 | Ga0068862_100141684 | 3300005844 | Bacteria | 2134 |
| 74 | Ga0068862_100702929 | 3300005844 | Bacteria | 979 |
| 75 | Ga0081538_10085946 | 3300005981 | Bacteria | 1649 |
| 76 | Ga0081540_1005624 | 3300005983 | Bacteria | 9335 |
| 77 | Ga0081540_1010058 | 3300005983 | Bacteria | 6440 |
| 78 | Ga0081539_10005109 | 3300005985 | Bacteria | 13741 |
| 79 | Ga0081539_10062093 | 3300005985 | Bacteria | 2044 |
| 80 | Ga0075365_10008428 | 3300006038 | Bacteria | 5852 |
| 81 | Ga0075365_10049319 | 3300006038 | Bacteria | 2774 |
| 82 | Ga0075365_10080808 | 3300006038 | Bacteria | 2201 |
| 83 | Ga0075365_10472984 | 3300006038 | Bacteria | 885 |
| 84 | Ga0075368_10038840 | 3300006042 | Bacteria | 1864 |
| 85 | Ga0075363_100006965 | 3300006048 | Bacteria | 5170 |
| 86 | Ga0075363_100022057 | 3300006048 | Bacteria | 3215 |
| 87 | Ga0075364_10062032 | 3300006051 | Bacteria | 2453 |
| 88 | Ga0075364_10167528 | 3300006051 | Bacteria | 1484 |
| 89 | Ga0075364_10403018 | 3300006051 | Bacteria | 933 |
| 90 | Ga0070712_100024328 | 3300006175 | Bacteria | 4012 |
| 91 | Ga0070712_100166275 | 3300006175 | Bacteria | 1708 |
| 92 | Ga0075362_10005241 | 3300006177 | Bacteria | 4729 |
| 93 | Ga0075367_10029890 | 3300006178 | Bacteria | 3120 |
| 94 | Ga0075367_10066920 | 3300006178 | Bacteria | 2154 |
| 95 | Ga0075369_10006201 | 3300006186 | Bacteria | 4515 |
| 96 | Ga0075369_10021391 | 3300006186 | Bacteria | 2658 |
| 97 | Ga0075366_10079661 | 3300006195 | Bacteria | 1956 |
| 98 | Ga0075370_10014516 | 3300006353 | Bacteria | 4204 |
| 99 | Ga0075370_10216421 | 3300006353 | Bacteria | 1131 |
| 100 | Ga0068871_100383927 | 3300006358 | Bacteria | 1248 |
| 101 | Ga0075428_100756624 | 3300006844 | Bacteria | 1034 |
| 102 | Ga0075436_100050664 | 3300006914 | Bacteria | 2866 |
| 103 | Ga0097620_100266601 | 3300006931 | Bacteria | 1804 |
| 104 | Ga0097620_100964535 | 3300006931 | Bacteria | 936 |
| 105 | Ga0099825_1017324 | 3300006941 | Bacteria | 5917 |
| 106 | Ga0099824_1007408 | 3300006942 | Bacteria | 14551 |
| 107 | Ga0099824_1028243 | 3300006942 | Bacteria | 2575 |
| 108 | Ga0099822_1018218 | 3300006943 | Bacteria | 7346 |
| 109 | Ga0075435_100089843 | 3300007076 | Unclassified | 2533 |
| 110 | Ga0105251_10143078 | 3300009011 | Bacteria | 1082 |
| 111 | Ga0105244_10001018 | 3300009036 | Bacteria | 23466 |
| 112 | Ga0105244_10001348 | 3300009036 | Bacteria | 20005 |
| 113 | Ga0105244_10009572 | 3300009036 | Bacteria | 5943 |
| 114 | Ga0105250_10000038 | 3300009092 | Bacteria | 141225 |
| 115 | Ga0105240_10055828 | 3300009093 | Bacteria | 4944 |
| 116 | Ga0105240_10118535 | 3300009093 | Bacteria | 3190 |
| 117 | Ga0105245_10033125 | 3300009098 | Bacteria | 4577 |
| 118 | Ga0105245_10058514 | 3300009098 | Bacteria | 3469 |
| 119 | Ga0105247_10257372 | 3300009101 | Bacteria | 1195 |
| 120 | Ga0114129_10687533 | 3300009147 | Bacteria | 1316 |
| 121 | Ga0105243_10018993 | 3300009148 | Bacteria | 5211 |
| 122 | Ga0105243_10347936 | 3300009148 | Bacteria | 1360 |
| 123 | Ga0105243_11290085 | 3300009148 | Bacteria | 747 |
| 124 | Ga0105241_10021246 | 3300009174 | Bacteria | 4797 |
| 125 | Ga0105241_10079612 | 3300009174 | Bacteria | 2563 |
| 126 | Ga0105241_10199857 | 3300009174 | Bacteria | 1669 |
| 127 | Ga0105242_10178625 | 3300009176 | Bacteria | 1871 |
| 128 | Ga0105242_10800662 | 3300009176 | Bacteria | 933 |
| 129 | Ga0105248_10097999 | 3300009177 | Bacteria | 3303 |
| 130 | Ga0105248_10412780 | 3300009177 | Bacteria | 1520 |
| 131 | Ga0105237_10023096 | 3300009545 | Bacteria | 6377 |
| 132 | Ga0105237_10077928 | 3300009545 | Bacteria | 3304 |
| 133 | Ga0105237_10286710 | 3300009545 | Bacteria | 1649 |
| 134 | Ga0105238_10752349 | 3300009551 | Bacteria | 988 |
| 135 | Ga0105238_10839675 | 3300009551 | Bacteria | 935 |
| 136 | Ga0105249_10820958 | 3300009553 | Bacteria | 994 |
| 137 | Ga0105249_10964151 | 3300009553 | Bacteria | 921 |
| 138 | Ga0105239_10078938 | 3300010375 | Bacteria | 3622 |
| 139 | Ga0105239_10128506 | 3300010375 | Bacteria | 2817 |
| 140 | Ga0105239_10680129 | 3300010375 | Bacteria | 1176 |
| 141 | Ga0105246_10041641 | 3300011119 | Bacteria | 3106 |
| 142 | Ga0105246_10197976 | 3300011119 | Bacteria | 1560 |
| 143 | Ga0157373_10005013 | 3300013100 | Bacteria | 9945 |
| 144 | Ga0157374_10774110 | 3300013296 | Bacteria | 975 |
| 145 | Ga0157374_11000872 | 3300013296 | Bacteria | 855 |
| 146 | Ga0157378_11142950 | 3300013297 | Bacteria | 817 |
| 147 | Ga0163162_10147448 | 3300013306 | Bacteria | 2470 |
| 148 | Ga0163162_10564682 | 3300013306 | Bacteria | 1265 |
| 149 | Ga0163162_11520961 | 3300013306 | Bacteria | 763 |
| 150 | Ga0157375_10177401 | 3300013308 | Bacteria | 2281 |
| 151 | Ga0157375_10178304 | 3300013308 | Bacteria | 2276 |
| 152 | Ga0157375_10342330 | 3300013308 | Bacteria | 1661 |
| 153 | Ga0157375_10629743 | 3300013308 | Bacteria | 1230 |
| 154 | Ga0157375_11110265 | 3300013308 | Bacteria | 926 |
| 155 | Ga0163163_10421184 | 3300014325 | Bacteria | 1394 |
| 156 | Ga0163163_11111012 | 3300014325 | Bacteria | 853 |
| 157 | Ga0157380_10225614 | 3300014326 | Bacteria | 1679 |
| 158 | Ga0157380_10686591 | 3300014326 | Bacteria | 1027 |
| 159 | Ga0182008_10155284 | 3300014497 | Bacteria | 1149 |
| 160 | Ga0157377_10557712 | 3300014745 | Bacteria | 810 |
| 161 | Ga0157379_10383885 | 3300014968 | Bacteria | 1289 |
| 162 | Ga0157379_10836777 | 3300014968 | Bacteria | 870 |
| 163 | Ga0157376_10260555 | 3300014969 | Bacteria | 1624 |
| 164 | Ga0182006_1165676 | 3300015261 | Bacteria | 743 |
| 165 | Ga0163161_10104209 | 3300017792 | Bacteria | 2114 |
| 166 | Ga0214544_1001813 | 3300021320 | Bacteria | 44864 |
| 167 | Ga0214544_1032892 | 3300021320 | Bacteria | 1575 |
| 168 | Ga0214542_1001236 | 3300021321 | Bacteria | 51849 |
| 169 | Ga0214542_1035084 | 3300021321 | Bacteria | 1575 |
| 170 | Ga0214545_1000924 | 3300021324 | Bacteria | 51830 |
| 171 | Ga0214545_1023872 | 3300021324 | Bacteria | 3911 |
| 172 | Ga0214543_1003531 | 3300021327 | Bacteria | 30263 |
| 173 | Ga0214543_1025126 | 3300021327 | Bacteria | 3507 |
| 174 | Ga0209563_110159 | 3300025230 | Bacteria | 1387 |
| 175 | Ga0209677_109130 | 3300025253 | Bacteria | 1819 |
| 176 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 177 | Ga0209233_1001441 | 3300025261 | Bacteria | 9387 |
| 178 | Ga0209233_1006461 | 3300025261 | Bacteria | 3776 |
| 179 | Ga0209455_1015254 | 3300025272 | Bacteria | 1697 |
| 180 | Ga0209673_1026975 | 3300025273 | Bacteria | 1876 |
| 181 | Ga0209564_1018234 | 3300025295 | Bacteria | 2687 |
| 182 | Ga0209564_1049802 | 3300025295 | Bacteria | 1032 |
| 183 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 184 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 185 | Ga0209758_1001210 | 3300025297 | Bacteria | 32486 |
| 186 | Ga0209758_1004569 | 3300025297 | Bacteria | 11413 |
| 187 | Ga0209758_1008544 | 3300025297 | Bacteria | 6599 |
| 188 | Ga0209758_1063625 | 3300025297 | Bacteria | 1200 |
| 189 | Ga0209256_1005155 | 3300025299 | Bacteria | 7715 |
| 190 | Ga0207426_1000572 | 3300025302 | Bacteria | 49561 |
| 191 | Ga0207426_1001763 | 3300025302 | Bacteria | 16381 |
| 192 | Ga0207426_1006362 | 3300025302 | Bacteria | 5153 |
| 193 | Ga0207426_1015149 | 3300025302 | Bacteria | 2804 |
| 194 | Ga0209257_1019864 | 3300025304 | Bacteria | 2510 |
| 195 | Ga0209257_1026162 | 3300025304 | Bacteria | 1974 |
| 196 | Ga0207696_1000123 | 3300025711 | Bacteria | 141297 |
| 197 | Ga0207655_1003326 | 3300025728 | Bacteria | 12045 |
| 198 | Ga0207655_1004644 | 3300025728 | Bacteria | 9644 |
| 199 | Ga0207713_1000097 | 3300025735 | Bacteria | 144844 |
| 200 | Ga0207692_10033660 | 3300025898 | Bacteria | 2475 |
| 201 | Ga0207688_10013784 | 3300025901 | Bacteria | 4393 |
| 202 | Ga0207647_10051282 | 3300025904 | Bacteria | 2551 |
| 203 | Ga0207699_10075205 | 3300025906 | Bacteria | 2077 |
| 204 | Ga0207705_10110005 | 3300025909 | Bacteria | 2035 |
| 205 | Ga0207654_10159141 | 3300025911 | Bacteria | 1457 |
| 206 | Ga0207654_10381095 | 3300025911 | Bacteria | 977 |
| 207 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 208 | Ga0207671_10005294 | 3300025914 | Bacteria | 11960 |
| 209 | Ga0207693_10006974 | 3300025915 | Bacteria | 9332 |
| 210 | Ga0207693_10109971 | 3300025915 | Bacteria | 2161 |
| 211 | Ga0207663_10084448 | 3300025916 | Bacteria | 2088 |
| 212 | Ga0207650_10250033 | 3300025925 | Bacteria | 1435 |
| 213 | Ga0207687_10032388 | 3300025927 | Bacteria | 3540 |
| 214 | Ga0207687_10156507 | 3300025927 | Bacteria | 1744 |
| 215 | Ga0207700_10009160 | 3300025928 | Bacteria | 6168 |
| 216 | Ga0207664_10237969 | 3300025929 | Bacteria | 1584 |
| 217 | Ga0207706_10034381 | 3300025933 | Bacteria | 4510 |
| 218 | Ga0207686_10301308 | 3300025934 | Bacteria | 1190 |
| 219 | Ga0207670_10731302 | 3300025936 | Bacteria | 821 |
| 220 | Ga0207679_10024233 | 3300025945 | Bacteria | 4160 |
| 221 | Ga0207667_10727079 | 3300025949 | Bacteria | 993 |
| 222 | Ga0207668_10680854 | 3300025972 | Bacteria | 902 |
| 223 | Ga0207668_11015886 | 3300025972 | Bacteria | 741 |
| 224 | Ga0207640_10354130 | 3300025981 | Bacteria | 1180 |
| 225 | Ga0207640_10528801 | 3300025981 | Bacteria | 987 |
| 226 | Ga0207703_10296197 | 3300026035 | Bacteria | 1474 |
| 227 | Ga0207639_10525052 | 3300026041 | Bacteria | 1084 |
| 228 | Ga0207678_10043423 | 3300026067 | Bacteria | 3890 |
| 229 | Ga0207678_10044113 | 3300026067 | Bacteria | 3858 |
| 230 | Ga0207678_10079290 | 3300026067 | Bacteria | 2812 |
| 231 | Ga0207678_10300827 | 3300026067 | Bacteria | 1379 |
| 232 | Ga0207708_10663429 | 3300026075 | Bacteria | 889 |
| 233 | Ga0207648_10451297 | 3300026089 | Bacteria | 1171 |
| 234 | Ga0207648_11082103 | 3300026089 | Bacteria | 752 |
| 235 | Ga0207675_100114402 | 3300026118 | Bacteria | 2548 |
| 236 | Ga0207675_100528013 | 3300026118 | Bacteria | 1177 |
| 237 | Ga0207675_100765425 | 3300026118 | Bacteria | 977 |
| 238 | Ga0207683_10301298 | 3300026121 | Bacteria | 1467 |
| 239 | Ga0207698_10042595 | 3300026142 | Bacteria | 3394 |
| 240 | Ga0207698_10045951 | 3300026142 | Bacteria | 3293 |
| 241 | Ga0209389_1000115 | 3300027296 | Bacteria | 71798 |
| 242 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 243 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 244 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 245 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 246 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 247 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 248 | Ga0268266_10008590 | 3300028379 | Bacteria | 9072 |
| 249 | Ga0268266_10104619 | 3300028379 | Bacteria | 2499 |
| 250 | Ga0268266_10190655 | 3300028379 | Bacteria | 1871 |
| 251 | Ga0268266_10727798 | 3300028379 | Bacteria | 957 |
| 252 | Ga0268265_10682560 | 3300028380 | Bacteria | 990 |
| 253 | Ga0268264_10328040 | 3300028381 | Bacteria | 1449 |
| 254 | Ga0268264_10525038 | 3300028381 | Bacteria | 1158 |
| 255 | Ga0268264_10814503 | 3300028381 | Bacteria | 933 |
| 256 | Ga0307515_10374161 | 3300028794 | Bacteria | 1060 |
| 257 | Ga0265338_10000092 | 3300028800 | Bacteria | 168538 |
| 258 | Ga0265771_1008501 | 3300031010 | Bacteria | 721 |
| 259 | Ga0307509_10263602 | 3300031507 | Bacteria | 1496 |
| 260 | Ga0265314_10091444 | 3300031711 | Bacteria | 1980 |
| 261 | Ga0265342_10030224 | 3300031712 | Bacteria | 3358 |
| 262 | Ga0307405_10438346 | 3300031731 | Bacteria | 1033 |
| 263 | Ga0307518_10382183 | 3300031838 | Bacteria | 798 |
| 264 | Ga0307409_100446883 | 3300031995 | Bacteria | 1247 |
| 265 | Ga0307414_10971651 | 3300032004 | Bacteria | 781 |
| 266 | Ga0307411_10201149 | 3300032005 | Bacteria | 1530 |
| 267 | Ga0307415_100329890 | 3300032126 | Bacteria | 1276 |
| 268 | Ga0307510_10211658 | 3300033180 | Bacteria | 1460 |
| 269 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 270 | Ga0373923_0178964 | 3300035111 | Bacteria | 974 |
| 271 | Ga0373936_0098359 | 3300035113 | Bacteria | 1233 |
| 272 | Ga0373954_0044880 | 3300035118 | Bacteria | 2064 |
| 273 | Ga0373931_0009359 | 3300035691 | Bacteria | 4683 |
| 274 | Ga0373935_0016273 | 3300035692 | Bacteria | 4502 |
| 275 | Ga0373937_0013710 | 3300036401 | Bacteria | 7142 |
| 276 | Ga0395899_0075033 | 3300037312 | Bacteria | 2470 |
| 277 | Ga0395900_0001029 | 3300037418 | Bacteria | 35765 |
| 278 | Ga0395898_0002778 | 3300037466 | Bacteria | 20117 |
| 279 | Ga0395898_0022553 | 3300037466 | Bacteria | 6376 |
| 280 | Ga0395905_0055862 | 3300037471 | Bacteria | 3695 |
| 281 | Ga0395905_0270498 | 3300037471 | Bacteria | 1585 |
| 282 | Ga0395901_0078512 | 3300038443 | Bacteria | 3447 |
| 283 | Ga0436365_1099947 | 3300039437 | Bacteria | 1647 |
| 284 | Ga0436365_1926447 | 3300039437 | Bacteria | 1017 |
| 285 | Ga0451839_1113772 | 3300041496 | Bacteria | 1157 |
| 286 | Ga0450911_001673 | 3300042115 | Bacteria | 4903 |
| 287 | Ga0450904_000630 | 3300042139 | Bacteria | 6432 |
| 288 | Ga0466972_0000172 | 3300044658 | Bacteria | 50564 |
| 289 | Ga0466972_0067429 | 3300044658 | Bacteria | 1709 |
| 290 | Ga0466982_0032239 | 3300044672 | Bacteria | 3116 |
| 291 | Ga0466965_0045998 | 3300044683 | Bacteria | 2159 |
| 292 | Ga0466965_0340339 | 3300044683 | Bacteria | 820 |
| 293 | Ga0466966_0000128 | 3300044684 | Bacteria | 48511 |
| 294 | Ga0466961_0000236 | 3300044693 | Bacteria | 37237 |
| 295 | Ga0466963_0238974 | 3300044694 | Bacteria | 1273 |
| 296 | Ga0466964_0173024 | 3300044706 | Bacteria | 1018 |
| 297 | Ga0466971_0088968 | 3300044719 | Bacteria | 1413 |
| 298 | Ga0466971_0092090 | 3300044719 | Bacteria | 1389 |
| 299 | Ga0466968_0270933 | 3300044735 | Bacteria | 810 |
| 300 | Ga0466970_0195280 | 3300044765 | Bacteria | 1125 |
| 301 | Ga0466970_0272050 | 3300044765 | Bacteria | 952 |
| 302 | Ga0466959_0001099 | 3300045049 | Bacteria | 16214 |
| 303 | Ga0466959_0051531 | 3300045049 | Bacteria | 3018 |
| 304 | Ga0466959_0076070 | 3300045049 | Bacteria | 2425 |
| 305 | Ga0466959_0135683 | 3300045049 | Bacteria | 1742 |
| 306 | Ga0495617_010330 | 3300046452 | Bacteria | 3197 |
| 307 | Ga0495617_086006 | 3300046452 | Bacteria | 1028 |
| 308 | Ga0495603_0015187 | 3300046455 | Bacteria | 4659 |
| 309 | Ga0495590_0023678 | 3300046457 | Bacteria | 2167 |
| 310 | Ga0495591_000248 | 3300046458 | Bacteria | 52176 |
| 311 | Ga0495591_000548 | 3300046458 | Bacteria | 28794 |
| 312 | Ga0495591_006848 | 3300046458 | Bacteria | 4952 |
| 313 | Ga0495629_0122018 | 3300046459 | Bacteria | 1815 |
| 314 | Ga0495629_0360963 | 3300046459 | Bacteria | 990 |
| 315 | Ga0495650_0000183 | 3300046471 | Bacteria | 137025 |
| 316 | Ga0495650_0003354 | 3300046471 | Bacteria | 11752 |
| 317 | Ga0495605_0000337 | 3300046474 | Bacteria | 46872 |
| 318 | Ga0495605_0005910 | 3300046474 | Bacteria | 7075 |
| 319 | Ga0495605_0009653 | 3300046474 | Bacteria | 5422 |
| 320 | Ga0495605_0041536 | 3300046474 | Bacteria | 2291 |
| 321 | Ga0495605_0168115 | 3300046474 | Bacteria | 970 |
| 322 | Ga0495639_0258153 | 3300046475 | Bacteria | 863 |
| 323 | Ga0495639_0378340 | 3300046475 | Bacteria | 713 |
| 324 | Ga0495584_0004905 | 3300046491 | Bacteria | 7141 |
| 325 | Ga0495585_0006785 | 3300046492 | Bacteria | 7067 |
| 326 | Ga0495596_0039623 | 3300046500 | Bacteria | 1861 |
| 327 | Ga0495607_0000318 | 3300046501 | Bacteria | 50045 |
| 328 | Ga0495607_0003679 | 3300046501 | Bacteria | 11634 |
| 329 | Ga0495607_0059472 | 3300046501 | Bacteria | 2180 |
| 330 | Ga0495607_0114443 | 3300046501 | Bacteria | 1425 |
| 331 | Ga0495607_0207443 | 3300046501 | Bacteria | 966 |
| 332 | Ga0495583_0000089 | 3300046506 | Bacteria | 163349 |
| 333 | Ga0495583_0004882 | 3300046506 | Bacteria | 9356 |
| 334 | Ga0495583_0004893 | 3300046506 | Bacteria | 9328 |
| 335 | Ga0495583_0005641 | 3300046506 | Bacteria | 8429 |
| 336 | Ga0495583_0009598 | 3300046506 | Bacteria | 5763 |
| 337 | Ga0495583_0077822 | 3300046506 | Bacteria | 1446 |
| 338 | Ga0495606_0000013 | 3300046507 | Bacteria | 292850 |
| 339 | Ga0495606_0000455 | 3300046507 | Bacteria | 67087 |
| 340 | Ga0495606_0009478 | 3300046507 | Bacteria | 8231 |
| 341 | Ga0495606_0078923 | 3300046507 | Bacteria | 2052 |
| 342 | Ga0495606_0083527 | 3300046507 | Bacteria | 1980 |
| 343 | Ga0495606_0088537 | 3300046507 | Bacteria | 1909 |
| 344 | Ga0495606_0103575 | 3300046507 | Bacteria | 1728 |
| 345 | Ga0495606_0218844 | 3300046507 | Bacteria | 1074 |
| 346 | Ga0495608_0029892 | 3300046511 | Bacteria | 3692 |
| 347 | Ga0495610_0012937 | 3300046512 | Bacteria | 4987 |
| 348 | Ga0495610_0027518 | 3300046512 | Bacteria | 3020 |
| 349 | Ga0495610_0111679 | 3300046512 | Bacteria | 1210 |
| 350 | Ga0495616_0052715 | 3300046513 | Bacteria | 2024 |
| 351 | Ga0495620_0001393 | 3300046515 | Bacteria | 14512 |
| 352 | Ga0495620_0011651 | 3300046515 | Bacteria | 4577 |
| 353 | Ga0495620_0119477 | 3300046515 | Bacteria | 1039 |
| 354 | Ga0495628_0039638 | 3300046516 | Bacteria | 3767 |
| 355 | Ga0495630_0391582 | 3300046517 | Bacteria | 1064 |
| 356 | Ga0495631_0000824 | 3300046518 | Bacteria | 19819 |
| 357 | Ga0495631_0002927 | 3300046518 | Bacteria | 9454 |
| 358 | Ga0495632_0000219 | 3300046519 | Bacteria | 58093 |
| 359 | Ga0495632_0001788 | 3300046519 | Bacteria | 17343 |
| 360 | Ga0495632_0015872 | 3300046519 | Bacteria | 4206 |
| 361 | Ga0495632_0020391 | 3300046519 | Bacteria | 3590 |
| 362 | Ga0495632_0023959 | 3300046519 | Bacteria | 3250 |
| 363 | Ga0495632_0124613 | 3300046519 | Bacteria | 1202 |
| 364 | Ga0495632_0287359 | 3300046519 | Bacteria | 731 |
| 365 | Ga0495637_0000027 | 3300046520 | Bacteria | 146241 |
| 366 | Ga0495637_0000673 | 3300046520 | Bacteria | 23781 |
| 367 | Ga0495637_0006068 | 3300046520 | Bacteria | 6102 |
| 368 | Ga0495643_0007804 | 3300046522 | Bacteria | 6846 |
| 369 | Ga0495643_0009713 | 3300046522 | Bacteria | 5951 |
| 370 | Ga0495644_0001060 | 3300046523 | Bacteria | 11446 |
| 371 | Ga0495644_0099967 | 3300046523 | Bacteria | 1097 |
| 372 | Ga0495648_0002940 | 3300046524 | Bacteria | 15290 |
| 373 | Ga0495648_0003624 | 3300046524 | Bacteria | 13521 |
| 374 | Ga0495648_0059019 | 3300046524 | Bacteria | 2291 |
| 375 | Ga0495648_0153083 | 3300046524 | Bacteria | 1201 |
| 376 | Ga0495652_0323138 | 3300046529 | Bacteria | 1114 |
| 377 | Ga0495654_0019656 | 3300046530 | Bacteria | 3531 |
| 378 | Ga0495654_0042784 | 3300046530 | Bacteria | 2247 |
| 379 | Ga0495654_0096041 | 3300046530 | Bacteria | 1370 |
| 380 | Ga0495587_0018206 | 3300046536 | Bacteria | 4357 |
| 381 | Ga0495609_0000027 | 3300046538 | Bacteria | 234661 |
| 382 | Ga0495609_0000037 | 3300046538 | Bacteria | 185912 |
| 383 | Ga0495609_0051699 | 3300046538 | Bacteria | 1829 |
| 384 | Ga0495609_0104549 | 3300046538 | Bacteria | 1225 |
| 385 | Ga0495597_0067803 | 3300046542 | Bacteria | 1543 |
| 386 | Ga0495645_0013557 | 3300046543 | Bacteria | 5768 |
| 387 | Ga0495622_0236519 | 3300046557 | Bacteria | 806 |
| 388 | Ga0495633_0244013 | 3300046558 | Bacteria | 820 |
| 389 | Ga0495633_0277069 | 3300046558 | Bacteria | 763 |
| 390 | Ga0495667_0212907 | 3300046559 | Bacteria | 1235 |
| 391 | Ga0495656_0009149 | 3300046615 | Bacteria | 3558 |
| 392 | Ga0495656_0093640 | 3300046615 | Bacteria | 1378 |
| 393 | Ga0495656_0226960 | 3300046615 | Bacteria | 936 |
| 394 | Ga0495668_0013418 | 3300046616 | Bacteria | 4832 |
| 395 | Ga0495668_0018052 | 3300046616 | Bacteria | 4083 |
| 396 | Ga0495668_0049246 | 3300046616 | Bacteria | 2336 |
| 397 | Ga0495668_0135775 | 3300046616 | Bacteria | 1346 |
| 398 | Ga0495668_0254597 | 3300046616 | Bacteria | 961 |
| 399 | Ga0495634_0024426 | 3300046642 | Bacteria | 4241 |
| 400 | Ga0495611_0000972 | 3300046648 | Bacteria | 15280 |
| 401 | Ga0495611_0008461 | 3300046648 | Bacteria | 4355 |
| 402 | Ga0495611_0121127 | 3300046648 | Bacteria | 1220 |
| 403 | Ga0495625_0000071 | 3300046660 | Bacteria | 166966 |
| 404 | Ga0495625_0044250 | 3300046660 | Bacteria | 3224 |
| 405 | Ga0495625_0172294 | 3300046660 | Bacteria | 1444 |
| 406 | Ga0495635_0015088 | 3300046663 | Bacteria | 5404 |
| 407 | Ga0495635_0064359 | 3300046663 | Bacteria | 2517 |
| 408 | Ga0495659_0099877 | 3300046664 | Bacteria | 1123 |
| 409 | Ga0495661_0000080 | 3300046665 | Bacteria | 117162 |
| 410 | Ga0495661_0000141 | 3300046665 | Bacteria | 84404 |
| 411 | Ga0495661_0016010 | 3300046665 | Bacteria | 4984 |
| 412 | Ga0495588_0002049 | 3300046674 | Bacteria | 8621 |
| 413 | Ga0495657_0016639 | 3300046675 | Bacteria | 5354 |
| 414 | Ga0495657_0019591 | 3300046675 | Bacteria | 4879 |
| 415 | Ga0495623_0027993 | 3300046679 | Bacteria | 3628 |
| 416 | Ga0495646_0029384 | 3300046680 | Bacteria | 3436 |
| 417 | Ga0495669_0053184 | 3300046684 | Bacteria | 1821 |
| 418 | Ga0495669_0185735 | 3300046684 | Bacteria | 991 |
| 419 | Ga0495613_0030248 | 3300046689 | Bacteria | 4022 |
| 420 | Ga0495613_0528655 | 3300046689 | Bacteria | 791 |
| 421 | Ga0495624_0024480 | 3300046690 | Bacteria | 3972 |
| 422 | Ga0495671_0002922 | 3300046692 | Bacteria | 10655 |
| 423 | Ga0495671_0066801 | 3300046692 | Bacteria | 1769 |
| 424 | Ga0495671_0135709 | 3300046692 | Bacteria | 1199 |
| 425 | Ga0495589_0047680 | 3300046794 | Bacteria | 2122 |
| 426 | Ga0495600_0059110 | 3300046809 | Bacteria | 2504 |
| 427 | Ga0495600_0222613 | 3300046809 | Bacteria | 1207 |
| 428 | Ga0495660_0017453 | 3300046810 | Bacteria | 4132 |
| 429 | Ga0495660_0208738 | 3300046810 | Bacteria | 928 |
| 430 | Ga0495604_0041025 | 3300047317 | Bacteria | 3631 |
| 431 | Ga0495604_0076598 | 3300047317 | Bacteria | 2515 |
| 432 | Ga0495672_0019556 | 3300047320 | Bacteria | 4464 |
| 433 | Ga0495672_0072477 | 3300047320 | Bacteria | 1945 |
| 434 | Ga0495676_0000003 | 3300047321 | Bacteria | 318463 |
| 435 | Ga0495676_0028303 | 3300047321 | Bacteria | 4787 |
| 436 | Ga0495680_0001711 | 3300047322 | Bacteria | 23324 |
| 437 | Ga0495683_0011659 | 3300047323 | Bacteria | 4625 |
| 438 | Ga0495679_000145 | 3300047446 | Bacteria | 64494 |
| 439 | Ga0495673_0000650 | 3300047469 | Bacteria | 34106 |
| 440 | Ga0495673_0006629 | 3300047469 | Bacteria | 6786 |
| 441 | Ga0495673_0006757 | 3300047469 | Bacteria | 6703 |
| 442 | Ga0495673_0041835 | 3300047469 | Bacteria | 2060 |
| 443 | Ga0495673_0047853 | 3300047469 | Bacteria | 1888 |
| 444 | Ga0495673_0048307 | 3300047469 | Bacteria | 1876 |
| 445 | Ga0495673_0139030 | 3300047469 | Bacteria | 948 |
| 446 | Ga0495681_0002926 | 3300047470 | Bacteria | 12070 |
| 447 | Ga0495686_0048258 | 3300047472 | Bacteria | 2685 |
| 448 | Ga0495686_0057021 | 3300047472 | Bacteria | 2439 |
| 449 | Ga0495686_0191723 | 3300047472 | Bacteria | 1178 |
| 450 | Ga0495686_0287561 | 3300047472 | Bacteria | 912 |
| 451 | Ga0495602_0003274 | 3300048088 | Bacteria | 16731 |
| 452 | Ga0495602_0009113 | 3300048088 | Bacteria | 10332 |
| 453 | Ga0495626_0000010 | 3300048091 | Bacteria | 270265 |
| 454 | Ga0496100_0171465 | 3300048903 | Bacteria | 1563 |
| 455 | Ga0496100_0395299 | 3300048903 | Bacteria | 1052 |
| 456 | Ga0496101_0207065 | 3300048904 | Bacteria | 1518 |
| 457 | Ga0496101_0321800 | 3300048904 | Bacteria | 1213 |
| 458 | Ga0496101_0642038 | 3300048904 | Bacteria | 839 |
| 459 | Ga0496101_0821783 | 3300048904 | Bacteria | 733 |
| 460 | Ga0496102_0166209 | 3300048905 | Bacteria | 2076 |
| 461 | Ga0496102_0211670 | 3300048905 | Bacteria | 1827 |
| 462 | Ga0496102_0242612 | 3300048905 | Bacteria | 1699 |
| 463 | Ga0496102_0697222 | 3300048905 | Bacteria | 938 |
| 464 | Ga0496103_0402072 | 3300048906 | Bacteria | 880 |
| 465 | Ga0496104_0005822 | 3300048907 | Bacteria | 10797 |
| 466 | Ga0496104_0011101 | 3300048907 | Bacteria | 8061 |
| 467 | Ga0496104_0070856 | 3300048907 | Bacteria | 3315 |
| 468 | Ga0496105_0003099 | 3300048908 | Bacteria | 12229 |
| 469 | Ga0496105_0054260 | 3300048908 | Bacteria | 3309 |
| 470 | Ga0496105_0253171 | 3300048908 | Bacteria | 1426 |
| 471 | Ga0496106_0086321 | 3300048909 | Bacteria | 2417 |
| 472 | Ga0496106_0138711 | 3300048909 | Bacteria | 1911 |
| 473 | Ga0496106_0185592 | 3300048909 | Bacteria | 1652 |
| 474 | Ga0496106_0270426 | 3300048909 | Bacteria | 1361 |
| 475 | Ga0496106_0604710 | 3300048909 | Bacteria | 878 |
| 476 | Ga0496107_0146565 | 3300048910 | Bacteria | 1746 |
| 477 | Ga0496107_0165272 | 3300048910 | Bacteria | 1641 |
| 478 | Ga0496108_0250980 | 3300048911 | Bacteria | 1539 |
| 479 | Ga0496109_0248413 | 3300048912 | Bacteria | 1675 |
| 480 | Ga0496109_0269180 | 3300048912 | Bacteria | 1605 |
| 481 | Ga0496109_0308487 | 3300048912 | Bacteria | 1493 |
| 482 | Ga0496110_0441495 | 3300048913 | Bacteria | 1186 |
| 483 | Ga0496111_0297372 | 3300048914 | Bacteria | 1197 |
| 484 | Ga0496112_0019263 | 3300048915 | Bacteria | 6437 |
| 485 | Ga0496112_0326907 | 3300048915 | Bacteria | 1477 |
| 486 | Ga0496112_0642602 | 3300048915 | Bacteria | 991 |
| 487 | Ga0496112_0740408 | 3300048915 | Bacteria | 910 |
| 488 | Ga0496113_0043185 | 3300048916 | Bacteria | 3335 |
| 489 | Ga0496113_0166803 | 3300048916 | Bacteria | 1743 |
| 490 | Ga0496113_0280913 | 3300048916 | Bacteria | 1331 |
| 491 | Ga0496113_0419413 | 3300048916 | Bacteria | 1075 |
| 492 | Ga0496114_0336037 | 3300048917 | Bacteria | 1335 |
| 493 | Ga0496114_0405980 | 3300048917 | Bacteria | 1206 |
| 494 | Ga0496114_0690482 | 3300048917 | Bacteria | 896 |
| 495 | Ga0496115_0086717 | 3300048918 | Bacteria | 2554 |
| 496 | Ga0496115_0128957 | 3300048918 | Bacteria | 2084 |
| 497 | Ga0496116_0018009 | 3300048919 | Bacteria | 5461 |
| 498 | Ga0496117_0227648 | 3300048920 | Bacteria | 1033 |
| 499 | Ga0496118_0057282 | 3300048921 | Bacteria | 2922 |
| 500 | Ga0496118_0080360 | 3300048921 | Bacteria | 2295 |
| 501 | Ga0496118_0155780 | 3300048921 | Bacteria | 1421 |
| 502 | Ga0496119_0034548 | 3300048922 | Bacteria | 3326 |
| 503 | Ga0496120_0016795 | 3300048923 | Bacteria | 4770 |
| 504 | Ga0496120_0034937 | 3300048923 | Bacteria | 3007 |
| 505 | Ga0496121_0004242 | 3300048924 | Bacteria | 19493 |
| 506 | Ga0496121_0008031 | 3300048924 | Bacteria | 12580 |
| 507 | Ga0496121_0110562 | 3300048924 | Bacteria | 2097 |
| 508 | Ga0496121_0125842 | 3300048924 | Bacteria | 1927 |
| 509 | Ga0496121_0127740 | 3300048924 | Bacteria | 1908 |
| 510 | Ga0496121_0179749 | 3300048924 | Bacteria | 1528 |
| 511 | Ga0496121_0250341 | 3300048924 | Bacteria | 1229 |
| 512 | Ga0496121_0435321 | 3300048924 | Bacteria | 849 |
| 513 | Ga0496122_0013833 | 3300048925 | Bacteria | 7858 |
| 514 | Ga0496122_0306040 | 3300048925 | Bacteria | 854 |
| 515 | Ga0496123_0034164 | 3300048926 | Bacteria | 3647 |
| 516 | Ga0496124_0002063 | 3300048927 | Bacteria | 27250 |
| 517 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 518 | Ga0496125_0084146 | 3300048928 | Bacteria | 2417 |
| 519 | Ga0496125_0090688 | 3300048928 | Bacteria | 2293 |
| 520 | Ga0496125_0286362 | 3300048928 | Bacteria | 1017 |
| 521 | Ga0496126_0026298 | 3300048929 | Bacteria | 5582 |
| 522 | Ga0496126_0029864 | 3300048929 | Bacteria | 5174 |
| 523 | Ga0496126_0096800 | 3300048929 | Bacteria | 2587 |
| 524 | Ga0496126_0156430 | 3300048929 | Bacteria | 1950 |
| 525 | Ga0496126_0181908 | 3300048929 | Bacteria | 1785 |
| 526 | Ga0496126_0196249 | 3300048929 | Bacteria | 1707 |
| 527 | Ga0496126_0389651 | 3300048929 | Bacteria | 1132 |
| 528 | Ga0495678_000072 | 3300049459 | Bacteria | 128270 |
| 529 | Ga0495678_004739 | 3300049459 | Bacteria | 7757 |
| 530 | Ga0495678_005790 | 3300049459 | Bacteria | 6711 |
| 531 | Ga0495682_0000125 | 3300049460 | Bacteria | 67122 |
| 532 | Ga0495682_0045902 | 3300049460 | Bacteria | 1596 |
| 533 | Ga0501032_0165536 | 3300049569 | Bacteria | 1451 |
| 534 | Ga0501032_0224511 | 3300049569 | Bacteria | 1222 |
| 535 | Ga0501033_0240924 | 3300049570 | Bacteria | 1283 |
| 536 | Ga0501033_0347509 | 3300049570 | Bacteria | 1039 |
| 537 | Ga0501034_0062087 | 3300049571 | Bacteria | 3752 |
| 538 | Ga0501038_0257320 | 3300049574 | Bacteria | 1381 |
| 539 | Ga0501043_0189980 | 3300049579 | Bacteria | 1598 |
| 540 | Ga0501046_0315241 | 3300049580 | Bacteria | 1140 |
| 541 | Ga0501047_0012334 | 3300049581 | Bacteria | 8090 |
| 542 | Ga0501067_0332997 | 3300049583 | Bacteria | 846 |
| 543 | Ga0501069_0294975 | 3300049585 | Bacteria | 950 |
| 544 | Ga0501069_0385451 | 3300049585 | Bacteria | 828 |
| 545 | Ga0501069_0427071 | 3300049585 | Bacteria | 786 |
| 546 | Ga0501070_0183353 | 3300049586 | Bacteria | 1722 |
| 547 | Ga0501070_0255850 | 3300049586 | Bacteria | 1432 |
| 548 | Ga0501074_0030384 | 3300049590 | Bacteria | 3915 |
| 549 | Ga0501080_0013729 | 3300049742 | Bacteria | 7457 |
| 550 | Ga0501035_0284353 | 3300049822 | Bacteria | 1397 |
| 551 | Ga0501044_0016521 | 3300049823 | Bacteria | 7921 |
| 552 | Ga0501044_0037527 | 3300049823 | Bacteria | 5064 |
| 553 | nmdc:mga03n38_213128_c1 | 3300050490 | Bacteria | 1005 |
| 554 | nmdc:mga00v17_53228_c2 | 3300050491 | Bacteria | 2035 |
| 555 | nmdc:mga00v17_541840_c1 | 3300050491 | Bacteria | 753 |
| 556 | nmdc:mga0yw44_104866_c1 | 3300050492 | Bacteria | 1805 |
| 557 | nmdc:mga0yw44_3463_c1 | 3300050492 | Bacteria | 7008 |
| 558 | nmdc:mga0yw44_69758_c1 | 3300050492 | Bacteria | 2178 |
| 559 | nmdc:mga06z11_185196_c1 | 3300050494 | Bacteria | 1203 |
| 560 | nmdc:mga06z11_22778_c1 | 3300050494 | Bacteria | 2931 |
| 561 | nmdc:mga06z11_372733_c1 | 3300050494 | Bacteria | 857 |
| 562 | nmdc:mga06z11_42173_c1 | 3300050494 | Bacteria | 2287 |
| 563 | nmdc:mga04h51_10509_c1 | 3300050495 | Bacteria | 2544 |
| 564 | nmdc:mga04h51_143972_c1 | 3300050495 | Bacteria | 906 |
| 565 | nmdc:mga04h51_221485_c1 | 3300050495 | Bacteria | 750 |
| 566 | nmdc:mga07m45_17167_c1 | 3300050496 | Bacteria | 3882 |
| 567 | nmdc:mga07m45_174947_c1 | 3300050496 | Bacteria | 1248 |
| 568 | nmdc:mga07m45_203658_c1 | 3300050496 | Bacteria | 1151 |
| 569 | nmdc:mga07m45_476071_c1 | 3300050496 | Bacteria | 724 |
| 570 | nmdc:mga07m45_745_c1 | 3300050496 | Bacteria | 13914 |
| 571 | nmdc:mga0qj67_321054_c1 | 3300050509 | Bacteria | 1253 |
| 572 | nmdc:mga08y16_166574_c1 | 3300050511 | Bacteria | 2289 |
| 573 | nmdc:mga0n895_364856_c1 | 3300050512 | Bacteria | 1462 |
| 574 | nmdc:mga0rr50_372613_c1 | 3300050513 | Bacteria | 1203 |
| 575 | nmdc:mga08x19_100096_c1 | 3300050514 | Bacteria | 1922 |
| 576 | nmdc:mga0sz30_137066_c1 | 3300050516 | Bacteria | 1080 |
| 577 | nmdc:mga0sz30_4355_c1 | 3300050516 | Bacteria | 5112 |
| 578 | nmdc:mga0sz30_81848_c1 | 3300050516 | Bacteria | 1398 |
| 579 | Ga0495619_0133043 | 3300053085 | Bacteria | 1710 |
| 580 | Ga0500578_0204759 | 3300053086 | Bacteria | 1206 |
| 581 | Ga0500643_000456 | 3300053087 | Bacteria | 30270 |
| 582 | Ga0500643_013502 | 3300053087 | Bacteria | 2881 |
| 583 | Ga0500646_0076963 | 3300053090 | Bacteria | 1011 |
| 584 | Ga0500647_0097491 | 3300053091 | Bacteria | 1405 |
| 585 | Ga0500583_0315902 | 3300053092 | Bacteria | 762 |
| 586 | Ga0500651_0206179 | 3300053093 | Bacteria | 1158 |
| 587 | Ga0500566_0001762 | 3300053094 | Bacteria | 12726 |
| 588 | Ga0500566_0137301 | 3300053094 | Bacteria | 1301 |
| 589 | Ga0500640_153193 | 3300053095 | Bacteria | 877 |
| 590 | Ga0500641_0008111 | 3300053096 | Bacteria | 3741 |
| 591 | Ga0500641_0009742 | 3300053096 | Bacteria | 3458 |
| 592 | Ga0500650_0060856 | 3300053098 | Bacteria | 1763 |
| 593 | Ga0500555_024001 | 3300053103 | Bacteria | 1748 |
| 594 | Ga0500555_040214 | 3300053103 | Bacteria | 1304 |
| 595 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 596 | Ga0500569_051039 | 3300053109 | Bacteria | 1248 |
| 597 | Ga0500595_010552 | 3300053119 | Bacteria | 3664 |
| 598 | Ga0500595_012731 | 3300053119 | Bacteria | 3242 |
| 599 | Ga0500642_0000252 | 3300053130 | Bacteria | 20158 |
| 600 | Ga0500642_0254996 | 3300053130 | Bacteria | 804 |
| 601 | Ga0500559_0067679 | 3300053136 | Bacteria | 1604 |
| 602 | Ga0500568_0079948 | 3300053139 | Bacteria | 1242 |
| 603 | Ga0500577_0011877 | 3300053142 | Bacteria | 2614 |
| 604 | Ga0500577_0073065 | 3300053142 | Bacteria | 1349 |
| 605 | Ga0500577_0082092 | 3300053142 | Bacteria | 1287 |
| 606 | Ga0500586_115204 | 3300053145 | Bacteria | 938 |
| 607 | Ga0500588_0065868 | 3300053146 | Bacteria | 1174 |
| 608 | Ga0500590_073751 | 3300053148 | Bacteria | 1691 |
| 609 | Ga0500590_104886 | 3300053148 | Bacteria | 1351 |
| 610 | Ga0500619_137777 | 3300053154 | Bacteria | 831 |
| 611 | Ga0500622_0025979 | 3300053156 | Bacteria | 3092 |
| 612 | Ga0500636_0000365 | 3300053177 | Bacteria | 24884 |
| 613 | Ga0500636_0188136 | 3300053177 | Bacteria | 1102 |
| 614 | Ga0500625_024839 | 3300053729 | Bacteria | 2832 |
| 615 | Ga0500645_044982 | 3300053730 | Bacteria | 1298 |
| 616 | Ga0500645_050295 | 3300053730 | Bacteria | 1217 |
| 617 | Ga0500601_000203 | 3300053737 | Bacteria | 12048 |
| 618 | Ga0501082_0469461 | 3300060353 | Bacteria | 1100 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006943 | Ga0099822_1018218 | Ga0099822_10182184 | 193 |
| 2 | 3300005339 | Ga0070660_100764218 | Ga0070660_1007642181 | 199 |
| 3 | 3300005434 | Ga0070709_10185716 | Ga0070709_101857162 | 199 |
| 4 | 3300005471 | Ga0070698_100231832 | Ga0070698_1002318322 | 199 |
| 5 | 3300005535 | Ga0070684_100210755 | Ga0070684_1002107552 | 199 |
| 6 | 3300005718 | Ga0068866_10368545 | Ga0068866_103685451 | 199 |
| 7 | 3300005983 | Ga0081540_1005624 | Ga0081540_10056242 | 199 |
| 8 | 3300005985 | Ga0081539_10062093 | Ga0081539_100620932 | 199 |
| 9 | 3300006942 | Ga0099824_1007408 | Ga0099824_100740812 | 199 |
| 10 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014172 | 199 |
| 11 | 3300027361 | Ga0209489_100014 | Ga0209489_100014172 | 199 |
| 12 | 3300027363 | Ga0209700_100024 | Ga0209700_100024172 | 199 |
| 13 | 3300005331 | Ga0070670_100234998 | Ga0070670_1002349981 | 206 |
| 14 | 3300005334 | Ga0068869_100196545 | Ga0068869_1001965451 | 206 |
| 15 | 3300005338 | Ga0068868_100098903 | Ga0068868_1000989032 | 206 |
| 16 | 3300005456 | Ga0070678_100193823 | Ga0070678_1001938232 | 206 |
| 17 | 3300005459 | Ga0068867_100171073 | Ga0068867_1001710732 | 206 |
| 18 | 3300005564 | Ga0070664_100067766 | Ga0070664_1000677662 | 206 |
| 19 | 3300005578 | Ga0068854_100088228 | Ga0068854_1000882283 | 206 |
| 20 | 3300005618 | Ga0068864_100050579 | Ga0068864_1000505792 | 206 |
| 21 | 3300005719 | Ga0068861_100050178 | Ga0068861_1000501784 | 206 |
| 22 | 3300005981 | Ga0081538_10085946 | Ga0081538_100859461 | 206 |
| 23 | 3300005983 | Ga0081540_1010058 | Ga0081540_10100584 | 206 |
| 24 | 3300006038 | Ga0075365_10049319 | Ga0075365_100493194 | 206 |
| 25 | 3300025927 | Ga0207687_10032388 | Ga0207687_100323884 | 206 |
| 26 | 3300025933 | Ga0207706_10034381 | Ga0207706_100343815 | 206 |
| 27 | 3300031711 | Ga0265314_10091444 | Ga0265314_100914442 | 206 |
| 28 | 3300048917 | Ga0496114_0690482 | Ga0496114_0690482_16_636 | 206 |
| 29 | 3300006914 | Ga0075436_100050664 | Ga0075436_1000506644 | 209 |
| 30 | 3300007076 | Ga0075435_100089843 | Ga0075435_1000898434 | 209 |
| 31 | 3300046558 | Ga0495633_0277069 | Ga0495633_0277069_76_705 | 209 |
| 32 | 3300046794 | Ga0495589_0047680 | Ga0495589_0047680_190_819 | 209 |
| 33 | 3300050513 | nmdc:mga0rr50_372613_c1 | nmdc:mga0rr50_372613_c1_473_1105 | 209 |
| 34 | 3300050514 | nmdc:mga08x19_100096_c1 | nmdc:mga08x19_100096_c1_52_684 | 209 |
| 35 | 3300005455 | Ga0070663_100011972 | Ga0070663_1000119722 | 211 |
| 36 | 3300005548 | Ga0070665_100061335 | Ga0070665_1000613354 | 211 |
| 37 | 3300005564 | Ga0070664_100297849 | Ga0070664_1002978492 | 211 |
| 38 | 3300005985 | Ga0081539_10005109 | Ga0081539_100051098 | 211 |
| 39 | 3300006048 | Ga0075363_100006965 | Ga0075363_1000069656 | 211 |
| 40 | 3300006051 | Ga0075364_10062032 | Ga0075364_100620323 | 211 |
| 41 | 3300006177 | Ga0075362_10005241 | Ga0075362_100052413 | 211 |
| 42 | 3300006178 | Ga0075367_10029890 | Ga0075367_100298904 | 211 |
| 43 | 3300006178 | Ga0075367_10066920 | Ga0075367_100669202 | 211 |
| 44 | 3300006186 | Ga0075369_10006201 | Ga0075369_100062011 | 211 |
| 45 | 3300006353 | Ga0075370_10014516 | Ga0075370_100145164 | 211 |
| 46 | 3300025945 | Ga0207679_10024233 | Ga0207679_100242333 | 211 |
| 47 | 3300026067 | Ga0207678_10044113 | Ga0207678_100441132 | 211 |
| 48 | 3300026089 | Ga0207648_11082103 | Ga0207648_110821031 | 211 |
| 49 | 3300028379 | Ga0268266_10008590 | Ga0268266_100085906 | 211 |
| 50 | 3300039437 | Ga0436365_1926447 | Ga0436365_1926447_39_677 | 211 |
| 51 | 3300048905 | Ga0496102_0166209 | Ga0496102_0166209_733_1386 | 211 |
| 52 | 3300048907 | Ga0496104_0070856 | Ga0496104_0070856_252_905 | 211 |
| 53 | 3300048909 | Ga0496106_0086321 | Ga0496106_0086321_363_1016 | 211 |
| 54 | 3300049571 | Ga0501034_0062087 | Ga0501034_0062087_2472_3107 | 211 |
| 55 | 3300050491 | nmdc:mga00v17_53228_c2 | nmdc:mga00v17_53228_c2_877_1530 | 211 |
| 56 | 3300050492 | nmdc:mga0yw44_69758_c1 | nmdc:mga0yw44_69758_c1_588_1223 | 211 |
| 57 | 3300050494 | nmdc:mga06z11_22778_c1 | nmdc:mga06z11_22778_c1_1884_2537 | 211 |
| 58 | 3300050494 | nmdc:mga06z11_42173_c1 | nmdc:mga06z11_42173_c1_1346_1981 | 211 |
| 59 | 3300050495 | nmdc:mga04h51_143972_c1 | nmdc:mga04h51_143972_c1_180_815 | 211 |
| 60 | 3300050496 | nmdc:mga07m45_17167_c1 | nmdc:mga07m45_17167_c1_3171_3806 | 211 |
| 61 | 3300050496 | nmdc:mga07m45_203658_c1 | nmdc:mga07m45_203658_c1_324_959 | 211 |
| 62 | 3300050496 | nmdc:mga07m45_745_c1 | nmdc:mga07m45_745_c1_11604_12257 | 211 |
| 63 | 3300050516 | nmdc:mga0sz30_4355_c1 | nmdc:mga0sz30_4355_c1_4300_4935 | 211 |
| 64 | 3300053096 | Ga0500641_0008111 | Ga0500641_0008111_34_672 | 211 |
| 65 | iso_pu_bacteria | 2643221626 | 2644146026 | 211 |
| 66 | iso_pu_bacteria | 8016548790 | 8016555017 | 211 |
| 67 | 3300009147 | Ga0114129_10687533 | Ga0114129_106875332 | 212 |
| 68 | 3300050509 | nmdc:mga0qj67_321054_c1 | nmdc:mga0qj67_321054_c1_46_687 | 212 |
| 69 | iso_pu_bacteria | 2507262055 | 2507507677 | 212 |
| 70 | iso_pu_bacteria | 2508501042 | 2508692659 | 212 |
| 71 | iso_pu_bacteria | 2515154112 | 2515626065 | 212 |
| 72 | iso_pu_bacteria | 2874590934 | 2874598787 | 212 |
| 73 | iso_pu_bacteria | 2874645413 | 2874652243 | 212 |
| 74 | iso_pu_bacteria | 2876771140 | 2876778826 | 212 |
| 75 | iso_pu_bacteria | 2876818435 | 2876824279 | 212 |
| 76 | iso_pu_bacteria | 2879074833 | 2879082619 | 212 |
| 77 | iso_pu_bacteria | 2879083081 | 2879086610 | 212 |
| 78 | iso_pu_bacteria | 2879127579 | 2879131536 | 212 |
| 79 | iso_pu_bacteria | 2879142872 | 2879147982 | 212 |
| 80 | iso_pu_bacteria | 2935608549 | 2935609814 | 212 |
| 81 | iso_pu_bacteria | 2935648319 | 2935652157 | 212 |
| 82 | iso_pu_bacteria | 2935656913 | 2935659870 | 212 |
| 83 | iso_pu_bacteria | 2935819856 | 2935822975 | 212 |
| 84 | iso_pu_bacteria | 2935847175 | 2935848557 | 212 |
| 85 | iso_pu_bacteria | 2935975950 | 2935980226 | 212 |
| 86 | iso_pu_bacteria | 2935984226 | 2935987015 | 212 |
| 87 | iso_pu_bacteria | 2936011229 | 2936014286 | 212 |
| 88 | iso_pu_bacteria | 2936019824 | 2936023874 | 212 |
| 89 | iso_pu_bacteria | 2936028420 | 2936031517 | 212 |
| 90 | iso_pu_bacteria | 2936046547 | 2936049392 | 212 |
| 91 | iso_pu_bacteria | 2936055302 | 2936062142 | 212 |
| 92 | iso_pu_bacteria | 8016630954 | 8016639195 | 212 |
| 93 | iso_pu_bacteria | 8019619141 | 8019619799 | 212 |
| 94 | iso_pu_bacteria | 8019629233 | 8019633316 | 212 |
| 95 | iso_pu_bacteria | 8019638758 | 8019646584 | 212 |
| 96 | iso_pu_bacteria | 8019659431 | 8019661190 | 212 |
| 97 | iso_pu_bacteria | 8019668869 | 8019670741 | 212 |
| 98 | iso_pu_bacteria | 8019678201 | 8019685489 | 212 |
| 99 | 3300009011 | Ga0105251_10143078 | Ga0105251_101430782 | 213 |
| 100 | 3300009098 | Ga0105245_10058514 | Ga0105245_100585142 | 213 |
| 101 | 3300009101 | Ga0105247_10257372 | Ga0105247_102573722 | 213 |
| 102 | 3300009148 | Ga0105243_11290085 | Ga0105243_112900851 | 213 |
| 103 | 3300013308 | Ga0157375_10177401 | Ga0157375_101774013 | 213 |
| 104 | 3300013308 | Ga0157375_10629743 | Ga0157375_106297432 | 213 |
| 105 | 3300014325 | Ga0163163_10421184 | Ga0163163_104211841 | 213 |
| 106 | 3300014745 | Ga0157377_10557712 | Ga0157377_105577122 | 213 |
| 107 | 3300014968 | Ga0157379_10836777 | Ga0157379_108367771 | 213 |
| 108 | 3300044684 | Ga0466966_0000128 | Ga0466966_0000128_16196_16837 | 213 |
| 109 | 3300044693 | Ga0466961_0000236 | Ga0466961_0000236_22524_23165 | 213 |
| 110 | 3300044706 | Ga0466964_0173024 | Ga0466964_0173024_212_853 | 213 |
| 111 | 3300044735 | Ga0466968_0270933 | Ga0466968_0270933_139_780 | 213 |
| 112 | 3300045049 | Ga0466959_0001099 | Ga0466959_0001099_10509_11150 | 213 |
| 113 | 3300046455 | Ga0495603_0015187 | Ga0495603_0015187_3960_4601 | 213 |
| 114 | 3300046459 | Ga0495629_0360963 | Ga0495629_0360963_139_780 | 213 |
| 115 | 3300046519 | Ga0495632_0124613 | Ga0495632_0124613_148_789 | 213 |
| 116 | 3300046519 | Ga0495632_0287359 | Ga0495632_0287359_58_699 | 213 |
| 117 | 3300046538 | Ga0495609_0051699 | Ga0495609_0051699_581_1222 | 213 |
| 118 | 3300046557 | Ga0495622_0236519 | Ga0495622_0236519_104_745 | 213 |
| 119 | 3300046616 | Ga0495668_0049246 | Ga0495668_0049246_164_805 | 213 |
| 120 | 3300046616 | Ga0495668_0254597 | Ga0495668_0254597_195_836 | 213 |
| 121 | 3300046660 | Ga0495625_0044250 | Ga0495625_0044250_446_1087 | 213 |
| 122 | 3300046664 | Ga0495659_0099877 | Ga0495659_0099877_227_868 | 213 |
| 123 | 3300046684 | Ga0495669_0185735 | Ga0495669_0185735_205_846 | 213 |
| 124 | 3300046810 | Ga0495660_0208738 | Ga0495660_0208738_97_738 | 213 |
| 125 | 3300047472 | Ga0495686_0057021 | Ga0495686_0057021_839_1480 | 213 |
| 126 | 3300048904 | Ga0496101_0821783 | Ga0496101_0821783_13_654 | 213 |
| 127 | 3300048909 | Ga0496106_0604710 | Ga0496106_0604710_112_753 | 213 |
| 128 | 3300048928 | Ga0496125_0286362 | Ga0496125_0286362_341_982 | 213 |
| 129 | 3300048929 | Ga0496126_0029864 | Ga0496126_0029864_4128_4769 | 213 |
| 130 | 3300050492 | nmdc:mga0yw44_104866_c1 | nmdc:mga0yw44_104866_c1_154_795 | 213 |
| 131 | 3300050494 | nmdc:mga06z11_372733_c1 | nmdc:mga06z11_372733_c1_35_676 | 213 |
| 132 | 3300050495 | nmdc:mga04h51_221485_c1 | nmdc:mga04h51_221485_c1_98_739 | 213 |
| 133 | 3300050496 | nmdc:mga07m45_476071_c1 | nmdc:mga07m45_476071_c1_47_688 | 213 |
| 134 | 3300050511 | nmdc:mga08y16_166574_c1 | nmdc:mga08y16_166574_c1_1369_2010 | 213 |
| 135 | 3300050512 | nmdc:mga0n895_364856_c1 | nmdc:mga0n895_364856_c1_71_712 | 213 |
| 136 | 3300050516 | nmdc:mga0sz30_137066_c1 | nmdc:mga0sz30_137066_c1_13_654 | 213 |
| 137 | 3300053086 | Ga0500578_0204759 | Ga0500578_0204759_384_1025 | 213 |
| 138 | 3300053087 | Ga0500643_013502 | Ga0500643_013502_1963_2607 | 213 |
| 139 | 3300053090 | Ga0500646_0076963 | Ga0500646_0076963_282_923 | 213 |
| 140 | 3300053093 | Ga0500651_0206179 | Ga0500651_0206179_385_1026 | 213 |
| 141 | 3300053094 | Ga0500566_0137301 | Ga0500566_0137301_191_832 | 213 |
| 142 | 3300053095 | Ga0500640_153193 | Ga0500640_153193_16_657 | 213 |
| 143 | 3300053103 | Ga0500555_040214 | Ga0500555_040214_187_828 | 213 |
| 144 | 3300053109 | Ga0500569_051039 | Ga0500569_051039_231_872 | 213 |
| 145 | 3300053142 | Ga0500577_0082092 | Ga0500577_0082092_292_933 | 213 |
| 146 | 3300053145 | Ga0500586_115204 | Ga0500586_115204_210_854 | 213 |
| 147 | 3300053148 | Ga0500590_073751 | Ga0500590_073751_948_1589 | 213 |
| 148 | 3300053148 | Ga0500590_104886 | Ga0500590_104886_320_961 | 213 |
| 149 | 3300053154 | Ga0500619_137777 | Ga0500619_137777_119_760 | 213 |
| 150 | 3300053177 | Ga0500636_0000365 | Ga0500636_0000365_5640_6281 | 213 |
| 151 | 3300053730 | Ga0500645_050295 | Ga0500645_050295_330_971 | 213 |
| 152 | 3300053737 | Ga0500601_000203 | Ga0500601_000203_2680_3321 | 213 |
| 153 | iso_pu_bacteria | 2508501009 | 2508541792 | 213 |
| 154 | iso_pu_bacteria | 2511231028 | 2511400928 | 213 |
| 155 | iso_pu_bacteria | 2513237092 | 2513621880 | 213 |
| 156 | iso_pu_bacteria | 2513237094 | 2513642973 | 213 |
| 157 | iso_pu_bacteria | 2513237095 | 2513647501 | 213 |
| 158 | iso_pu_bacteria | 2513237096 | 2513654076 | 213 |
| 159 | iso_pu_bacteria | 2513237102 | 2513704273 | 213 |
| 160 | iso_pu_bacteria | 2513237137 | 2513856828 | 213 |
| 161 | iso_pu_bacteria | 2513237145 | 2513918416 | 213 |
| 162 | iso_pu_bacteria | 2513237161 | 2514009445 | 213 |
| 163 | iso_pu_bacteria | 2517093001 | 2517104145 | 213 |
| 164 | iso_pu_bacteria | 2517572143 | 2517891350 | 213 |
| 165 | iso_pu_bacteria | 2528768022 | 2528848994 | 213 |
| 166 | iso_pu_bacteria | 2617270741 | 2617372715 | 213 |
| 167 | iso_pu_bacteria | 2667528175 | 2671118870 | 213 |
| 168 | iso_pu_bacteria | 2728368998 | 2728750063 | 213 |
| 169 | iso_pu_bacteria | 2791355196 | 2793065221 | 213 |
| 170 | iso_pu_bacteria | 2791355197 | 2793066718 | 213 |
| 171 | iso_pu_bacteria | 2824600985 | 2824606551 | 213 |
| 172 | iso_pu_bacteria | 2824609381 | 2824613032 | 213 |
| 173 | iso_pu_bacteria | 2824617872 | 2824620397 | 213 |
| 174 | iso_pu_bacteria | 2824626560 | 2824628555 | 213 |
| 175 | iso_pu_bacteria | 2824635225 | 2824639093 | 213 |
| 176 | iso_pu_bacteria | 2824644064 | 2824647318 | 213 |
| 177 | iso_pu_bacteria | 2824653114 | 2824658525 | 213 |
| 178 | iso_pu_bacteria | 2824661429 | 2824666474 | 213 |
| 179 | iso_pu_bacteria | 2824679649 | 2824685668 | 213 |
| 180 | iso_pu_bacteria | 2824704595 | 2824710244 | 213 |
| 181 | iso_pu_bacteria | 2824723954 | 2824732448 | 213 |
| 182 | iso_pu_bacteria | 2824732956 | 2824735846 | 213 |
| 183 | iso_pu_bacteria | 2824746037 | 2824750093 | 213 |
| 184 | iso_pu_bacteria | 2824753945 | 2824755968 | 213 |
| 185 | iso_pu_bacteria | 2824763712 | 2824767506 | 213 |
| 186 | iso_pu_bacteria | 2838122688 | 2838130494 | 213 |
| 187 | iso_pu_bacteria | 2841949485 | 2841953463 | 213 |
| 188 | iso_pu_bacteria | 2841966195 | 2841972060 | 213 |
| 189 | iso_pu_bacteria | 2841974524 | 2841978192 | 213 |
| 190 | iso_pu_bacteria | 2841983080 | 2841991007 | 213 |
| 191 | iso_pu_bacteria | 2844315083 | 2844320008 | 213 |
| 192 | iso_pu_bacteria | 2849076700 | 2849078412 | 213 |
| 193 | iso_pu_bacteria | 2857509624 | 2857512784 | 213 |
| 194 | iso_pu_bacteria | 2874604998 | 2874607394 | 213 |
| 195 | iso_pu_bacteria | 2874612657 | 2874614587 | 213 |
| 196 | iso_pu_bacteria | 2874620515 | 2874628065 | 213 |
| 197 | iso_pu_bacteria | 2874628541 | 2874635020 | 213 |
| 198 | iso_pu_bacteria | 2879099564 | 2879107119 | 213 |
| 199 | iso_pu_bacteria | 2881364244 | 2881371474 | 213 |
| 200 | iso_pu_bacteria | 2881665667 | 2881666563 | 213 |
| 201 | iso_pu_bacteria | 2885366525 | 2885369957 | 213 |
| 202 | iso_pu_bacteria | 2885374607 | 2885374996 | 213 |
| 203 | iso_pu_bacteria | 2885409591 | 2885410277 | 213 |
| 204 | iso_pu_bacteria | 2888378607 | 2888385438 | 213 |
| 205 | iso_pu_bacteria | 2888388044 | 2888392795 | 213 |
| 206 | iso_pu_bacteria | 2889033259 | 2889038030 | 213 |
| 207 | iso_pu_bacteria | 2903727486 | 2903730317 | 213 |
| 208 | iso_pu_bacteria | 2903748898 | 2903755311 | 213 |
| 209 | iso_pu_bacteria | 2904666416 | 2904674317 | 213 |
| 210 | iso_pu_bacteria | 2904690495 | 2904691219 | 213 |
| 211 | iso_pu_bacteria | 2904711408 | 2904711987 | 213 |
| 212 | iso_pu_bacteria | 2906602504 | 2906604748 | 213 |
| 213 | iso_pu_bacteria | 2906610324 | 2906616536 | 213 |
| 214 | iso_pu_bacteria | 2906635258 | 2906635309 | 213 |
| 215 | iso_pu_bacteria | 2906643746 | 2906643929 | 213 |
| 216 | iso_pu_bacteria | 2906660503 | 2906666854 | 213 |
| 217 | iso_pu_bacteria | 2908739725 | 2908741704 | 213 |
| 218 | iso_pu_bacteria | 2908756301 | 2908759140 | 213 |
| 219 | iso_pu_bacteria | 2908775508 | 2908781158 | 213 |
| 220 | iso_pu_bacteria | 2922368715 | 2922372421 | 213 |
| 221 | iso_pu_bacteria | 2922386360 | 2922387364 | 213 |
| 222 | iso_pu_bacteria | 2922393267 | 2922397085 | 213 |
| 223 | iso_pu_bacteria | 2929615660 | 2929621010 | 213 |
| 224 | iso_pu_bacteria | 2929624759 | 2929626159 | 213 |
| 225 | iso_pu_bacteria | 2932784394 | 2932784961 | 213 |
| 226 | iso_pu_bacteria | 2932801729 | 2932805689 | 213 |
| 227 | iso_pu_bacteria | 2932809354 | 2932809994 | 213 |
| 228 | iso_pu_bacteria | 2932818245 | 2932818263 | 213 |
| 229 | iso_pu_bacteria | 2932828146 | 2932828798 | 213 |
| 230 | iso_pu_bacteria | 2933577622 | 2933583120 | 213 |
| 231 | iso_pu_bacteria | 2935616580 | 2935619782 | 213 |
| 232 | iso_pu_bacteria | 2935630451 | 2935634040 | 213 |
| 233 | iso_pu_bacteria | 2935638405 | 2935638763 | 213 |
| 234 | iso_pu_bacteria | 2935665750 | 2935666386 | 213 |
| 235 | iso_pu_bacteria | 2935675223 | 2935676567 | 213 |
| 236 | iso_pu_bacteria | 2935684952 | 2935690761 | 213 |
| 237 | iso_pu_bacteria | 2935694250 | 2935694648 | 213 |
| 238 | iso_pu_bacteria | 2935703347 | 2935703769 | 213 |
| 239 | iso_pu_bacteria | 2935713505 | 2935718142 | 213 |
| 240 | iso_pu_bacteria | 2935722832 | 2935727877 | 213 |
| 241 | iso_pu_bacteria | 2935732158 | 2935736581 | 213 |
| 242 | iso_pu_bacteria | 2935741537 | 2935745960 | 213 |
| 243 | iso_pu_bacteria | 2935750917 | 2935756341 | 213 |
| 244 | iso_pu_bacteria | 2935760218 | 2935760554 | 213 |
| 245 | iso_pu_bacteria | 2935769743 | 2935777542 | 213 |
| 246 | iso_pu_bacteria | 2935777560 | 2935784327 | 213 |
| 247 | iso_pu_bacteria | 2935785616 | 2935793536 | 213 |
| 248 | iso_pu_bacteria | 2935793552 | 2935801531 | 213 |
| 249 | iso_pu_bacteria | 2935801545 | 2935801906 | 213 |
| 250 | iso_pu_bacteria | 2935810662 | 2935810676 | 213 |
| 251 | iso_pu_bacteria | 2935827899 | 2935828257 | 213 |
| 252 | iso_pu_bacteria | 2935837841 | 2935842461 | 213 |
| 253 | iso_pu_bacteria | 2935855204 | 2935857903 | 213 |
| 254 | iso_pu_bacteria | 2935864058 | 2935868755 | 213 |
| 255 | iso_pu_bacteria | 2935873716 | 2935874170 | 213 |
| 256 | iso_pu_bacteria | 2935883170 | 2935883941 | 213 |
| 257 | iso_pu_bacteria | 2935908558 | 2935909635 | 213 |
| 258 | iso_pu_bacteria | 2935916978 | 2935917360 | 213 |
| 259 | iso_pu_bacteria | 2935926038 | 2935927116 | 213 |
| 260 | iso_pu_bacteria | 2935934488 | 2935937040 | 213 |
| 261 | iso_pu_bacteria | 2935942939 | 2935944657 | 213 |
| 262 | iso_pu_bacteria | 2935951376 | 2935953094 | 213 |
| 263 | iso_pu_bacteria | 2935959822 | 2935966596 | 213 |
| 264 | iso_pu_bacteria | 2935967501 | 2935969934 | 213 |
| 265 | iso_pu_bacteria | 2935992306 | 2935992905 | 213 |
| 266 | iso_pu_bacteria | 2936002035 | 2936002818 | 213 |
| 267 | iso_pu_bacteria | 2936037263 | 2936037904 | 213 |
| 268 | iso_pu_bacteria | 2940556831 | 2940561684 | 213 |
| 269 | iso_pu_bacteria | 2941507105 | 2941510657 | 213 |
| 270 | iso_pu_bacteria | 2941515067 | 2941518041 | 213 |
| 271 | iso_pu_bacteria | 2941523033 | 2941527088 | 213 |
| 272 | iso_pu_bacteria | 2941531003 | 2941531193 | 213 |
| 273 | iso_pu_bacteria | 2941538514 | 2941542510 | 213 |
| 274 | iso_pu_bacteria | 3005474847 | 3005481237 | 213 |
| 275 | iso_pu_bacteria | 3005483717 | 3005484808 | 213 |
| 276 | iso_pu_bacteria | 3005506211 | 3005508446 | 213 |
| 277 | iso_pu_bacteria | 3005587118 | 3005588051 | 213 |
| 278 | iso_pu_bacteria | 3005710791 | 3005715794 | 213 |
| 279 | iso_pu_bacteria | 3005718088 | 3005723149 | 213 |
| 280 | iso_pu_bacteria | 3007718800 | 3007722534 | 213 |
| 281 | iso_pu_bacteria | 8006933436 | 8006939472 | 213 |
| 282 | iso_pu_bacteria | 8006973647 | 8006979222 | 213 |
| 283 | iso_pu_bacteria | 8016511872 | 8016520675 | 213 |
| 284 | iso_pu_bacteria | 8016522445 | 8016528701 | 213 |
| 285 | iso_pu_bacteria | 8016530956 | 8016533880 | 213 |
| 286 | iso_pu_bacteria | 8016539877 | 8016547103 | 213 |
| 287 | iso_pu_bacteria | 8016557553 | 8016563387 | 213 |
| 288 | iso_pu_bacteria | 8016566248 | 8016572218 | 213 |
| 289 | iso_pu_bacteria | 8016595262 | 8016601137 | 213 |
| 290 | iso_pu_bacteria | 8016603502 | 8016609311 | 213 |
| 291 | iso_pu_bacteria | 8016613128 | 8016615593 | 213 |
| 292 | iso_pu_bacteria | 8016622563 | 8016625627 | 213 |
| 293 | iso_pu_bacteria | 8017057580 | 8017064907 | 213 |
| 294 | iso_pu_bacteria | 8019530166 | 8019533651 | 213 |
| 295 | iso_pu_bacteria | 8019547302 | 8019552706 | 213 |
| 296 | iso_pu_bacteria | 8019555841 | 8019565350 | 213 |
| 297 | iso_pu_bacteria | 8019565922 | 8019575450 | 213 |
| 298 | iso_pu_bacteria | 8019576017 | 8019584283 | 213 |
| 299 | iso_pu_bacteria | 8019586578 | 8019592051 | 213 |
| 300 | iso_pu_bacteria | 8019597564 | 8019599232 | 213 |
| 301 | iso_pu_bacteria | 8019608314 | 8019609126 | 213 |
| 302 | iso_pu_bacteria | 8019648815 | 8019649354 | 213 |
| 303 | iso_pu_bacteria | 8055742211 | 8055745127 | 213 |
| 304 | iso_pu_bacteria | 8056673599 | 8056681093 | 213 |
| 305 | iso_pu_bacteria | 8056689827 | 8056693076 | 213 |
| 306 | iso_pu_bacteria | 8056967851 | 8056975085 | 213 |
| 307 | 3300009036 | Ga0105244_10001348 | Ga0105244_100013488 | 214 |
| 308 | 3300005436 | Ga0070713_100012830 | Ga0070713_1000128302 | 215 |
| 309 | 3300005578 | Ga0068854_100319859 | Ga0068854_1003198592 | 215 |
| 310 | 3300011119 | Ga0105246_10041641 | Ga0105246_100416412 | 215 |
| 311 | 3300013100 | Ga0157373_10005013 | Ga0157373_100050134 | 215 |
| 312 | 3300013306 | Ga0163162_11520961 | Ga0163162_115209611 | 215 |
| 313 | 3300015261 | Ga0182006_1165676 | Ga0182006_11656761 | 215 |
| 314 | 3300025728 | Ga0207655_1003326 | Ga0207655_10033262 | 215 |
| 315 | 3300025906 | Ga0207699_10075205 | Ga0207699_100752052 | 215 |
| 316 | 3300025928 | Ga0207700_10009160 | Ga0207700_100091602 | 215 |
| 317 | 3300025929 | Ga0207664_10237969 | Ga0207664_102379691 | 215 |
| 318 | 3300035111 | Ga0373923_0178964 | Ga0373923_0178964_183_830 | 215 |
| 319 | 3300035113 | Ga0373936_0098359 | Ga0373936_0098359_479_1126 | 215 |
| 320 | 3300035118 | Ga0373954_0044880 | Ga0373954_0044880_900_1547 | 215 |
| 321 | 3300035692 | Ga0373935_0016273 | Ga0373935_0016273_2550_3197 | 215 |
| 322 | 3300036401 | Ga0373937_0013710 | Ga0373937_0013710_5302_5949 | 215 |
| 323 | 3300039437 | Ga0436365_1099947 | Ga0436365_1099947_805_1455 | 215 |
| 324 | 3300044672 | Ga0466982_0032239 | Ga0466982_0032239_2268_2936 | 215 |
| 325 | 3300044694 | Ga0466963_0238974 | Ga0466963_0238974_266_934 | 215 |
| 326 | 3300046457 | Ga0495590_0023678 | Ga0495590_0023678_763_1443 | 215 |
| 327 | 3300046458 | Ga0495591_000248 | Ga0495591_000248_11198_11875 | 215 |
| 328 | 3300046458 | Ga0495591_000548 | Ga0495591_000548_14392_15072 | 215 |
| 329 | 3300046458 | Ga0495591_006848 | Ga0495591_006848_1924_2604 | 215 |
| 330 | 3300046471 | Ga0495650_0000183 | Ga0495650_0000183_38904_39584 | 215 |
| 331 | 3300046471 | Ga0495650_0003354 | Ga0495650_0003354_3740_4420 | 215 |
| 332 | 3300046474 | Ga0495605_0000337 | Ga0495605_0000337_20820_21500 | 215 |
| 333 | 3300046474 | Ga0495605_0005910 | Ga0495605_0005910_3628_4308 | 215 |
| 334 | 3300046474 | Ga0495605_0009653 | Ga0495605_0009653_3359_4039 | 215 |
| 335 | 3300046474 | Ga0495605_0168115 | Ga0495605_0168115_184_864 | 215 |
| 336 | 3300046491 | Ga0495584_0004905 | Ga0495584_0004905_3694_4374 | 215 |
| 337 | 3300046492 | Ga0495585_0006785 | Ga0495585_0006785_1931_2611 | 215 |
| 338 | 3300046501 | Ga0495607_0000318 | Ga0495607_0000318_6835_7497 | 215 |
| 339 | 3300046501 | Ga0495607_0003679 | Ga0495607_0003679_5752_6432 | 215 |
| 340 | 3300046501 | Ga0495607_0059472 | Ga0495607_0059472_1068_1748 | 215 |
| 341 | 3300046501 | Ga0495607_0114443 | Ga0495607_0114443_441_1121 | 215 |
| 342 | 3300046501 | Ga0495607_0207443 | Ga0495607_0207443_102_782 | 215 |
| 343 | 3300046506 | Ga0495583_0000089 | Ga0495583_0000089_112916_113596 | 215 |
| 344 | 3300046506 | Ga0495583_0004882 | Ga0495583_0004882_1788_2468 | 215 |
| 345 | 3300046506 | Ga0495583_0004893 | Ga0495583_0004893_3814_4494 | 215 |
| 346 | 3300046506 | Ga0495583_0005641 | Ga0495583_0005641_2293_2973 | 215 |
| 347 | 3300046506 | Ga0495583_0009598 | Ga0495583_0009598_3325_4005 | 215 |
| 348 | 3300046507 | Ga0495606_0000013 | Ga0495606_0000013_239129_239809 | 215 |
| 349 | 3300046507 | Ga0495606_0000455 | Ga0495606_0000455_5462_6142 | 215 |
| 350 | 3300046507 | Ga0495606_0009478 | Ga0495606_0009478_2198_2878 | 215 |
| 351 | 3300046512 | Ga0495610_0012937 | Ga0495610_0012937_1268_1948 | 215 |
| 352 | 3300046512 | Ga0495610_0027518 | Ga0495610_0027518_2155_2835 | 215 |
| 353 | 3300046513 | Ga0495616_0052715 | Ga0495616_0052715_742_1422 | 215 |
| 354 | 3300046515 | Ga0495620_0001393 | Ga0495620_0001393_2528_3208 | 215 |
| 355 | 3300046515 | Ga0495620_0011651 | Ga0495620_0011651_1946_2626 | 215 |
| 356 | 3300046518 | Ga0495631_0002927 | Ga0495631_0002927_7953_8633 | 215 |
| 357 | 3300046519 | Ga0495632_0000219 | Ga0495632_0000219_48575_49255 | 215 |
| 358 | 3300046519 | Ga0495632_0001788 | Ga0495632_0001788_8843_9523 | 215 |
| 359 | 3300046519 | Ga0495632_0020391 | Ga0495632_0020391_1725_2387 | 215 |
| 360 | 3300046519 | Ga0495632_0023959 | Ga0495632_0023959_1901_2581 | 215 |
| 361 | 3300046520 | Ga0495637_0000027 | Ga0495637_0000027_9276_9956 | 215 |
| 362 | 3300046520 | Ga0495637_0000673 | Ga0495637_0000673_3824_4504 | 215 |
| 363 | 3300046520 | Ga0495637_0006068 | Ga0495637_0006068_2268_2948 | 215 |
| 364 | 3300046522 | Ga0495643_0007804 | Ga0495643_0007804_742_1422 | 215 |
| 365 | 3300046522 | Ga0495643_0009713 | Ga0495643_0009713_3225_3905 | 215 |
| 366 | 3300046523 | Ga0495644_0001060 | Ga0495644_0001060_606_1286 | 215 |
| 367 | 3300046524 | Ga0495648_0002940 | Ga0495648_0002940_4819_5499 | 215 |
| 368 | 3300046524 | Ga0495648_0003624 | Ga0495648_0003624_7348_8028 | 215 |
| 369 | 3300046530 | Ga0495654_0019656 | Ga0495654_0019656_2029_2709 | 215 |
| 370 | 3300046530 | Ga0495654_0042784 | Ga0495654_0042784_517_1197 | 215 |
| 371 | 3300046538 | Ga0495609_0000027 | Ga0495609_0000027_94262_94942 | 215 |
| 372 | 3300046538 | Ga0495609_0000037 | Ga0495609_0000037_24364_25044 | 215 |
| 373 | 3300046558 | Ga0495633_0244013 | Ga0495633_0244013_50_730 | 215 |
| 374 | 3300046616 | Ga0495668_0013418 | Ga0495668_0013418_1069_1749 | 215 |
| 375 | 3300046616 | Ga0495668_0135775 | Ga0495668_0135775_49_729 | 215 |
| 376 | 3300046648 | Ga0495611_0000972 | Ga0495611_0000972_12973_13653 | 215 |
| 377 | 3300046648 | Ga0495611_0008461 | Ga0495611_0008461_2679_3359 | 215 |
| 378 | 3300046660 | Ga0495625_0000071 | Ga0495625_0000071_66533_67213 | 215 |
| 379 | 3300046665 | Ga0495661_0000080 | Ga0495661_0000080_95152_95832 | 215 |
| 380 | 3300046665 | Ga0495661_0000141 | Ga0495661_0000141_34477_35157 | 215 |
| 381 | 3300046665 | Ga0495661_0016010 | Ga0495661_0016010_2222_2902 | 215 |
| 382 | 3300046692 | Ga0495671_0002922 | Ga0495671_0002922_6098_6778 | 215 |
| 383 | 3300046692 | Ga0495671_0066801 | Ga0495671_0066801_27_707 | 215 |
| 384 | 3300046692 | Ga0495671_0135709 | Ga0495671_0135709_495_1175 | 215 |
| 385 | 3300046810 | Ga0495660_0017453 | Ga0495660_0017453_364_1044 | 215 |
| 386 | 3300047320 | Ga0495672_0019556 | Ga0495672_0019556_23_703 | 215 |
| 387 | 3300047320 | Ga0495672_0072477 | Ga0495672_0072477_146_826 | 215 |
| 388 | 3300047321 | Ga0495676_0000003 | Ga0495676_0000003_138986_139666 | 215 |
| 389 | 3300047323 | Ga0495683_0011659 | Ga0495683_0011659_213_890 | 215 |
| 390 | 3300047446 | Ga0495679_000145 | Ga0495679_000145_549_1226 | 215 |
| 391 | 3300047469 | Ga0495673_0000650 | Ga0495673_0000650_17036_17716 | 215 |
| 392 | 3300047469 | Ga0495673_0006629 | Ga0495673_0006629_542_1222 | 215 |
| 393 | 3300047469 | Ga0495673_0006757 | Ga0495673_0006757_3658_4338 | 215 |
| 394 | 3300047469 | Ga0495673_0047853 | Ga0495673_0047853_307_987 | 215 |
| 395 | 3300047469 | Ga0495673_0048307 | Ga0495673_0048307_1062_1742 | 215 |
| 396 | 3300047470 | Ga0495681_0002926 | Ga0495681_0002926_7602_8282 | 215 |
| 397 | 3300047472 | Ga0495686_0048258 | Ga0495686_0048258_1369_2049 | 215 |
| 398 | 3300048091 | Ga0495626_0000010 | Ga0495626_0000010_107471_108151 | 215 |
| 399 | 3300048904 | Ga0496101_0642038 | Ga0496101_0642038_91_741 | 215 |
| 400 | 3300049459 | Ga0495678_000072 | Ga0495678_000072_40840_41520 | 215 |
| 401 | 3300049459 | Ga0495678_004739 | Ga0495678_004739_3420_4100 | 215 |
| 402 | 3300049459 | Ga0495678_005790 | Ga0495678_005790_5491_6171 | 215 |
| 403 | 3300049460 | Ga0495682_0000125 | Ga0495682_0000125_45365_46045 | 215 |
| 404 | 3300049569 | Ga0501032_0224511 | Ga0501032_0224511_47_697 | 215 |
| 405 | 3300049570 | Ga0501033_0240924 | Ga0501033_0240924_310_960 | 215 |
| 406 | 3300049580 | Ga0501046_0315241 | Ga0501046_0315241_366_1016 | 215 |
| 407 | 3300049581 | Ga0501047_0012334 | Ga0501047_0012334_3926_4576 | 215 |
| 408 | 3300049586 | Ga0501070_0183353 | Ga0501070_0183353_132_782 | 215 |
| 409 | 3300049586 | Ga0501070_0255850 | Ga0501070_0255850_529_1179 | 215 |
| 410 | 3300049590 | Ga0501074_0030384 | Ga0501074_0030384_280_930 | 215 |
| 411 | 3300049742 | Ga0501080_0013729 | Ga0501080_0013729_3293_3943 | 215 |
| 412 | 3300049823 | Ga0501044_0016521 | Ga0501044_0016521_6668_7318 | 215 |
| 413 | iso_pu_bacteria | 2599185155 | 2599328951 | 215 |
| 414 | iso_pu_bacteria | 2738541271 | 2738691292 | 215 |
| 415 | iso_pu_bacteria | 2738543016 | 2739267067 | 215 |
| 416 | 3300003214 | JGI25165J46597_1005870 | JGI25165J46597_10058702 | 216 |
| 417 | 3300003215 | JGI25153J46596_10003908 | JGI25153J46596_100039085 | 216 |
| 418 | 3300003215 | JGI25153J46596_10005616 | JGI25153J46596_100056165 | 216 |
| 419 | 3300003215 | JGI25153J46596_10008403 | JGI25153J46596_100084034 | 216 |
| 420 | 3300003215 | JGI25153J46596_10008855 | JGI25153J46596_100088553 | 216 |
| 421 | 3300003215 | JGI25153J46596_10024455 | JGI25153J46596_100244551 | 216 |
| 422 | 3300003354 | JGI25160J50197_1003595 | JGI25160J50197_10035953 | 216 |
| 423 | 3300003781 | Ga0055536_1000637 | Ga0055536_100063715 | 216 |
| 424 | 3300003794 | Ga0055531_10009410 | Ga0055531_100094102 | 216 |
| 425 | 3300004625 | Ga0055543_1003833 | Ga0055543_10038333 | 216 |
| 426 | 3300005262 | Ga0065165_1002074 | Ga0065165_10020744 | 216 |
| 427 | 3300005262 | Ga0065165_1002220 | Ga0065165_100222013 | 216 |
| 428 | 3300005262 | Ga0065165_1016415 | Ga0065165_10164152 | 216 |
| 429 | 3300005262 | Ga0065165_1050349 | Ga0065165_10503492 | 216 |
| 430 | 3300005327 | Ga0070658_10406513 | Ga0070658_104065132 | 216 |
| 431 | 3300005334 | Ga0068869_100506261 | Ga0068869_1005062612 | 216 |
| 432 | 3300005337 | Ga0070682_100299317 | Ga0070682_1002993172 | 216 |
| 433 | 3300005339 | Ga0070660_100190841 | Ga0070660_1001908412 | 216 |
| 434 | 3300005344 | Ga0070661_100178364 | Ga0070661_1001783642 | 216 |
| 435 | 3300005354 | Ga0070675_101028222 | Ga0070675_1010282221 | 216 |
| 436 | 3300005355 | Ga0070671_100175412 | Ga0070671_1001754122 | 216 |
| 437 | 3300005355 | Ga0070671_100712972 | Ga0070671_1007129721 | 216 |
| 438 | 3300005356 | Ga0070674_100012062 | Ga0070674_1000120627 | 216 |
| 439 | 3300005366 | Ga0070659_100179814 | Ga0070659_1001798142 | 216 |
| 440 | 3300005367 | Ga0070667_100361078 | Ga0070667_1003610782 | 216 |
| 441 | 3300005437 | Ga0070710_10045935 | Ga0070710_100459352 | 216 |
| 442 | 3300005439 | Ga0070711_100068830 | Ga0070711_1000688303 | 216 |
| 443 | 3300005455 | Ga0070663_100032808 | Ga0070663_1000328084 | 216 |
| 444 | 3300005455 | Ga0070663_100070882 | Ga0070663_1000708822 | 216 |
| 445 | 3300005455 | Ga0070663_100071943 | Ga0070663_1000719431 | 216 |
| 446 | 3300005455 | Ga0070663_100155556 | Ga0070663_1001555563 | 216 |
| 447 | 3300005455 | Ga0070663_100485313 | Ga0070663_1004853132 | 216 |
| 448 | 3300005457 | Ga0070662_100582836 | Ga0070662_1005828362 | 216 |
| 449 | 3300005459 | Ga0068867_100426294 | Ga0068867_1004262941 | 216 |
| 450 | 3300005539 | Ga0068853_100170200 | Ga0068853_1001702002 | 216 |
| 451 | 3300005539 | Ga0068853_100488017 | Ga0068853_1004880172 | 216 |
| 452 | 3300005547 | Ga0070693_100143917 | Ga0070693_1001439172 | 216 |
| 453 | 3300005548 | Ga0070665_100049587 | Ga0070665_1000495872 | 216 |
| 454 | 3300005548 | Ga0070665_100161421 | Ga0070665_1001614211 | 216 |
| 455 | 3300005548 | Ga0070665_100204049 | Ga0070665_1002040493 | 216 |
| 456 | 3300005548 | Ga0070665_100258288 | Ga0070665_1002582881 | 216 |
| 457 | 3300005548 | Ga0070665_100286459 | Ga0070665_1002864592 | 216 |
| 458 | 3300005548 | Ga0070665_101101699 | Ga0070665_1011016991 | 216 |
| 459 | 3300005564 | Ga0070664_100969003 | Ga0070664_1009690031 | 216 |
| 460 | 3300005616 | Ga0068852_100068945 | Ga0068852_1000689453 | 216 |
| 461 | 3300005616 | Ga0068852_100215323 | Ga0068852_1002153232 | 216 |
| 462 | 3300005617 | Ga0068859_100266622 | Ga0068859_1002666221 | 216 |
| 463 | 3300005617 | Ga0068859_100964496 | Ga0068859_1009644962 | 216 |
| 464 | 3300005618 | Ga0068864_100765040 | Ga0068864_1007650402 | 216 |
| 465 | 3300005719 | Ga0068861_100205641 | Ga0068861_1002056412 | 216 |
| 466 | 3300005841 | Ga0068863_101011788 | Ga0068863_1010117881 | 216 |
| 467 | 3300005842 | Ga0068858_100287010 | Ga0068858_1002870102 | 216 |
| 468 | 3300005843 | Ga0068860_100463816 | Ga0068860_1004638162 | 216 |
| 469 | 3300005844 | Ga0068862_100141684 | Ga0068862_1001416841 | 216 |
| 470 | 3300005844 | Ga0068862_100702929 | Ga0068862_1007029291 | 216 |
| 471 | 3300006038 | Ga0075365_10008428 | Ga0075365_100084283 | 216 |
| 472 | 3300006038 | Ga0075365_10080808 | Ga0075365_100808082 | 216 |
| 473 | 3300006038 | Ga0075365_10472984 | Ga0075365_104729842 | 216 |
| 474 | 3300006042 | Ga0075368_10038840 | Ga0075368_100388402 | 216 |
| 475 | 3300006048 | Ga0075363_100022057 | Ga0075363_1000220574 | 216 |
| 476 | 3300006051 | Ga0075364_10167528 | Ga0075364_101675282 | 216 |
| 477 | 3300006051 | Ga0075364_10403018 | Ga0075364_104030181 | 216 |
| 478 | 3300006175 | Ga0070712_100024328 | Ga0070712_1000243281 | 216 |
| 479 | 3300006175 | Ga0070712_100166275 | Ga0070712_1001662752 | 216 |
| 480 | 3300006186 | Ga0075369_10021391 | Ga0075369_100213912 | 216 |
| 481 | 3300006195 | Ga0075366_10079661 | Ga0075366_100796612 | 216 |
| 482 | 3300006353 | Ga0075370_10216421 | Ga0075370_102164212 | 216 |
| 483 | 3300006358 | Ga0068871_100383927 | Ga0068871_1003839272 | 216 |
| 484 | 3300006844 | Ga0075428_100756624 | Ga0075428_1007566241 | 216 |
| 485 | 3300006931 | Ga0097620_100266601 | Ga0097620_1002666011 | 216 |
| 486 | 3300006931 | Ga0097620_100964535 | Ga0097620_1009645352 | 216 |
| 487 | 3300006941 | Ga0099825_1017324 | Ga0099825_10173245 | 216 |
| 488 | 3300006942 | Ga0099824_1028243 | Ga0099824_10282432 | 216 |
| 489 | 3300009036 | Ga0105244_10001018 | Ga0105244_1000101815 | 216 |
| 490 | 3300009036 | Ga0105244_10009572 | Ga0105244_100095727 | 216 |
| 491 | 3300009092 | Ga0105250_10000038 | Ga0105250_10000038116 | 216 |
| 492 | 3300009093 | Ga0105240_10055828 | Ga0105240_100558284 | 216 |
| 493 | 3300009093 | Ga0105240_10118535 | Ga0105240_101185353 | 216 |
| 494 | 3300009098 | Ga0105245_10033125 | Ga0105245_100331254 | 216 |
| 495 | 3300009148 | Ga0105243_10018993 | Ga0105243_100189934 | 216 |
| 496 | 3300009148 | Ga0105243_10347936 | Ga0105243_103479362 | 216 |
| 497 | 3300009174 | Ga0105241_10021246 | Ga0105241_100212462 | 216 |
| 498 | 3300009174 | Ga0105241_10079612 | Ga0105241_100796122 | 216 |
| 499 | 3300009174 | Ga0105241_10199857 | Ga0105241_101998572 | 216 |
| 500 | 3300009176 | Ga0105242_10178625 | Ga0105242_101786252 | 216 |
| 501 | 3300009176 | Ga0105242_10800662 | Ga0105242_108006622 | 216 |
| 502 | 3300009177 | Ga0105248_10097999 | Ga0105248_100979991 | 216 |
| 503 | 3300009177 | Ga0105248_10412780 | Ga0105248_104127803 | 216 |
| 504 | 3300009545 | Ga0105237_10023096 | Ga0105237_100230965 | 216 |
| 505 | 3300009545 | Ga0105237_10077928 | Ga0105237_100779284 | 216 |
| 506 | 3300009545 | Ga0105237_10286710 | Ga0105237_102867102 | 216 |
| 507 | 3300009551 | Ga0105238_10752349 | Ga0105238_107523492 | 216 |
| 508 | 3300009551 | Ga0105238_10839675 | Ga0105238_108396751 | 216 |
| 509 | 3300009553 | Ga0105249_10820958 | Ga0105249_108209582 | 216 |
| 510 | 3300009553 | Ga0105249_10964151 | Ga0105249_109641511 | 216 |
| 511 | 3300010375 | Ga0105239_10078938 | Ga0105239_100789382 | 216 |
| 512 | 3300010375 | Ga0105239_10128506 | Ga0105239_101285062 | 216 |
| 513 | 3300010375 | Ga0105239_10680129 | Ga0105239_106801291 | 216 |
| 514 | 3300011119 | Ga0105246_10197976 | Ga0105246_101979761 | 216 |
| 515 | 3300013296 | Ga0157374_10774110 | Ga0157374_107741101 | 216 |
| 516 | 3300013296 | Ga0157374_11000872 | Ga0157374_110008721 | 216 |
| 517 | 3300013297 | Ga0157378_11142950 | Ga0157378_111429501 | 216 |
| 518 | 3300013306 | Ga0163162_10147448 | Ga0163162_101474484 | 216 |
| 519 | 3300013306 | Ga0163162_10564682 | Ga0163162_105646822 | 216 |
| 520 | 3300013308 | Ga0157375_10178304 | Ga0157375_101783043 | 216 |
| 521 | 3300013308 | Ga0157375_10342330 | Ga0157375_103423302 | 216 |
| 522 | 3300013308 | Ga0157375_11110265 | Ga0157375_111102652 | 216 |
| 523 | 3300014325 | Ga0163163_11111012 | Ga0163163_111110122 | 216 |
| 524 | 3300014326 | Ga0157380_10225614 | Ga0157380_102256142 | 216 |
| 525 | 3300014326 | Ga0157380_10686591 | Ga0157380_106865912 | 216 |
| 526 | 3300014497 | Ga0182008_10155284 | Ga0182008_101552841 | 216 |
| 527 | 3300014968 | Ga0157379_10383885 | Ga0157379_103838851 | 216 |
| 528 | 3300014969 | Ga0157376_10260555 | Ga0157376_102605552 | 216 |
| 529 | 3300017792 | Ga0163161_10104209 | Ga0163161_101042092 | 216 |
| 530 | 3300021320 | Ga0214544_1001813 | Ga0214544_100181323 | 216 |
| 531 | 3300021320 | Ga0214544_1032892 | Ga0214544_10328921 | 216 |
| 532 | 3300021321 | Ga0214542_1001236 | Ga0214542_100123616 | 216 |
| 533 | 3300021321 | Ga0214542_1035084 | Ga0214542_10350841 | 216 |
| 534 | 3300021324 | Ga0214545_1000924 | Ga0214545_100092429 | 216 |
| 535 | 3300021324 | Ga0214545_1023872 | Ga0214545_10238722 | 216 |
| 536 | 3300021327 | Ga0214543_1003531 | Ga0214543_100353115 | 216 |
| 537 | 3300021327 | Ga0214543_1025126 | Ga0214543_10251264 | 216 |
| 538 | 3300025230 | Ga0209563_110159 | Ga0209563_1101592 | 216 |
| 539 | 3300025253 | Ga0209677_109130 | Ga0209677_1091302 | 216 |
| 540 | 3300025254 | Ga0209148_1000180 | Ga0209148_100018099 | 216 |
| 541 | 3300025261 | Ga0209233_1001441 | Ga0209233_10014418 | 216 |
| 542 | 3300025261 | Ga0209233_1006461 | Ga0209233_10064613 | 216 |
| 543 | 3300025272 | Ga0209455_1015254 | Ga0209455_10152542 | 216 |
| 544 | 3300025273 | Ga0209673_1026975 | Ga0209673_10269753 | 216 |
| 545 | 3300025295 | Ga0209564_1018234 | Ga0209564_10182342 | 216 |
| 546 | 3300025295 | Ga0209564_1049802 | Ga0209564_10498021 | 216 |
| 547 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011305 | 216 |
| 548 | 3300025297 | Ga0209758_1000133 | Ga0209758_100013348 | 216 |
| 549 | 3300025297 | Ga0209758_1001210 | Ga0209758_100121021 | 216 |
| 550 | 3300025297 | Ga0209758_1004569 | Ga0209758_100456912 | 216 |
| 551 | 3300025297 | Ga0209758_1008544 | Ga0209758_10085445 | 216 |
| 552 | 3300025297 | Ga0209758_1063625 | Ga0209758_10636252 | 216 |
| 553 | 3300025299 | Ga0209256_1005155 | Ga0209256_10051555 | 216 |
| 554 | 3300025302 | Ga0207426_1000572 | Ga0207426_100057225 | 216 |
| 555 | 3300025302 | Ga0207426_1001763 | Ga0207426_10017634 | 216 |
| 556 | 3300025302 | Ga0207426_1006362 | Ga0207426_10063626 | 216 |
| 557 | 3300025302 | Ga0207426_1015149 | Ga0207426_10151493 | 216 |
| 558 | 3300025304 | Ga0209257_1019864 | Ga0209257_10198642 | 216 |
| 559 | 3300025304 | Ga0209257_1026162 | Ga0209257_10261623 | 216 |
| 560 | 3300025711 | Ga0207696_1000123 | Ga0207696_100012318 | 216 |
| 561 | 3300025728 | Ga0207655_1004644 | Ga0207655_10046443 | 216 |
| 562 | 3300025735 | Ga0207713_1000097 | Ga0207713_1000097116 | 216 |
| 563 | 3300025898 | Ga0207692_10033660 | Ga0207692_100336602 | 216 |
| 564 | 3300025901 | Ga0207688_10013784 | Ga0207688_100137842 | 216 |
| 565 | 3300025904 | Ga0207647_10051282 | Ga0207647_100512823 | 216 |
| 566 | 3300025909 | Ga0207705_10110005 | Ga0207705_101100051 | 216 |
| 567 | 3300025911 | Ga0207654_10159141 | Ga0207654_101591412 | 216 |
| 568 | 3300025911 | Ga0207654_10381095 | Ga0207654_103810952 | 216 |
| 569 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008791 | 216 |
| 570 | 3300025914 | Ga0207671_10005294 | Ga0207671_100052948 | 216 |
| 571 | 3300025915 | Ga0207693_10006974 | Ga0207693_100069749 | 216 |
| 572 | 3300025915 | Ga0207693_10109971 | Ga0207693_101099712 | 216 |
| 573 | 3300025916 | Ga0207663_10084448 | Ga0207663_100844482 | 216 |
| 574 | 3300025925 | Ga0207650_10250033 | Ga0207650_102500332 | 216 |
| 575 | 3300025927 | Ga0207687_10156507 | Ga0207687_101565072 | 216 |
| 576 | 3300025934 | Ga0207686_10301308 | Ga0207686_103013082 | 216 |
| 577 | 3300025936 | Ga0207670_10731302 | Ga0207670_107313021 | 216 |
| 578 | 3300025949 | Ga0207667_10727079 | Ga0207667_107270791 | 216 |
| 579 | 3300025972 | Ga0207668_10680854 | Ga0207668_106808542 | 216 |
| 580 | 3300025972 | Ga0207668_11015886 | Ga0207668_110158861 | 216 |
| 581 | 3300025981 | Ga0207640_10354130 | Ga0207640_103541302 | 216 |
| 582 | 3300025981 | Ga0207640_10528801 | Ga0207640_105288011 | 216 |
| 583 | 3300026035 | Ga0207703_10296197 | Ga0207703_102961972 | 216 |
| 584 | 3300026041 | Ga0207639_10525052 | Ga0207639_105250522 | 216 |
| 585 | 3300026067 | Ga0207678_10043423 | Ga0207678_100434231 | 216 |
| 586 | 3300026067 | Ga0207678_10079290 | Ga0207678_100792902 | 216 |
| 587 | 3300026067 | Ga0207678_10300827 | Ga0207678_103008272 | 216 |
| 588 | 3300026075 | Ga0207708_10663429 | Ga0207708_106634292 | 216 |
| 589 | 3300026089 | Ga0207648_10451297 | Ga0207648_104512972 | 216 |
| 590 | 3300026118 | Ga0207675_100114402 | Ga0207675_1001144022 | 216 |
| 591 | 3300026118 | Ga0207675_100528013 | Ga0207675_1005280132 | 216 |
| 592 | 3300026118 | Ga0207675_100765425 | Ga0207675_1007654251 | 216 |
| 593 | 3300026121 | Ga0207683_10301298 | Ga0207683_103012982 | 216 |
| 594 | 3300026142 | Ga0207698_10042595 | Ga0207698_100425952 | 216 |
| 595 | 3300026142 | Ga0207698_10045951 | Ga0207698_100459514 | 216 |
| 596 | 3300027296 | Ga0209389_1000115 | Ga0209389_100011526 | 216 |
| 597 | 3300027357 | Ga0209589_1000033 | Ga0209589_100003326 | 216 |
| 598 | 3300027361 | Ga0209489_100040 | Ga0209489_100040124 | 216 |
| 599 | 3300027363 | Ga0209700_100007 | Ga0209700_100007259 | 216 |
| 600 | 3300028379 | Ga0268266_10104619 | Ga0268266_101046192 | 216 |
| 601 | 3300028379 | Ga0268266_10190655 | Ga0268266_101906551 | 216 |
| 602 | 3300028379 | Ga0268266_10727798 | Ga0268266_107277982 | 216 |
| 603 | 3300028380 | Ga0268265_10682560 | Ga0268265_106825602 | 216 |
| 604 | 3300028381 | Ga0268264_10328040 | Ga0268264_103280402 | 216 |
| 605 | 3300028381 | Ga0268264_10525038 | Ga0268264_105250382 | 216 |
| 606 | 3300028381 | Ga0268264_10814503 | Ga0268264_108145031 | 216 |
| 607 | 3300028794 | Ga0307515_10374161 | Ga0307515_103741611 | 216 |
| 608 | 3300028800 | Ga0265338_10000092 | Ga0265338_10000092106 | 216 |
| 609 | 3300031010 | Ga0265771_1008501 | Ga0265771_10085011 | 216 |
| 610 | 3300031507 | Ga0307509_10263602 | Ga0307509_102636022 | 216 |
| 611 | 3300031712 | Ga0265342_10030224 | Ga0265342_100302243 | 216 |
| 612 | 3300031731 | Ga0307405_10438346 | Ga0307405_104383461 | 216 |
| 613 | 3300031838 | Ga0307518_10382183 | Ga0307518_103821831 | 216 |
| 614 | 3300031995 | Ga0307409_100446883 | Ga0307409_1004468832 | 216 |
| 615 | 3300032004 | Ga0307414_10971651 | Ga0307414_109716511 | 216 |
| 616 | 3300032005 | Ga0307411_10201149 | Ga0307411_102011492 | 216 |
| 617 | 3300032126 | Ga0307415_100329890 | Ga0307415_1003298902 | 216 |
| 618 | 3300033180 | Ga0307510_10211658 | Ga0307510_102116582 | 216 |
| 619 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002147 | 216 |
| 620 | 3300035691 | Ga0373931_0009359 | Ga0373931_0009359_1939_2592 | 216 |
| 621 | 3300037312 | Ga0395899_0075033 | Ga0395899_0075033_776_1429 | 216 |
| 622 | 3300037418 | Ga0395900_0001029 | Ga0395900_0001029_18351_19004 | 216 |
| 623 | 3300037466 | Ga0395898_0002778 | Ga0395898_0002778_8134_8787 | 216 |
| 624 | 3300037466 | Ga0395898_0022553 | Ga0395898_0022553_3691_4344 | 216 |
| 625 | 3300037471 | Ga0395905_0055862 | Ga0395905_0055862_2791_3444 | 216 |
| 626 | 3300037471 | Ga0395905_0270498 | Ga0395905_0270498_510_1163 | 216 |
| 627 | 3300038443 | Ga0395901_0078512 | Ga0395901_0078512_1345_1998 | 216 |
| 628 | 3300041496 | Ga0451839_1113772 | Ga0451839_1113772_205_855 | 216 |
| 629 | 3300042115 | Ga0450911_001673 | Ga0450911_001673_4128_4793 | 216 |
| 630 | 3300042139 | Ga0450904_000630 | Ga0450904_000630_5732_6412 | 216 |
| 631 | 3300044658 | Ga0466972_0000172 | Ga0466972_0000172_49606_50259 | 216 |
| 632 | 3300044658 | Ga0466972_0067429 | Ga0466972_0067429_679_1332 | 216 |
| 633 | 3300044683 | Ga0466965_0045998 | Ga0466965_0045998_1419_2072 | 216 |
| 634 | 3300044683 | Ga0466965_0340339 | Ga0466965_0340339_67_720 | 216 |
| 635 | 3300044719 | Ga0466971_0088968 | Ga0466971_0088968_75_728 | 216 |
| 636 | 3300044719 | Ga0466971_0092090 | Ga0466971_0092090_25_678 | 216 |
| 637 | 3300044765 | Ga0466970_0195280 | Ga0466970_0195280_201_854 | 216 |
| 638 | 3300044765 | Ga0466970_0272050 | Ga0466970_0272050_241_894 | 216 |
| 639 | 3300045049 | Ga0466959_0051531 | Ga0466959_0051531_900_1553 | 216 |
| 640 | 3300045049 | Ga0466959_0076070 | Ga0466959_0076070_1656_2333 | 216 |
| 641 | 3300045049 | Ga0466959_0135683 | Ga0466959_0135683_830_1483 | 216 |
| 642 | 3300046452 | Ga0495617_010330 | Ga0495617_010330_1152_1805 | 216 |
| 643 | 3300046452 | Ga0495617_086006 | Ga0495617_086006_325_987 | 216 |
| 644 | 3300046459 | Ga0495629_0122018 | Ga0495629_0122018_894_1547 | 216 |
| 645 | 3300046474 | Ga0495605_0041536 | Ga0495605_0041536_689_1342 | 216 |
| 646 | 3300046475 | Ga0495639_0258153 | Ga0495639_0258153_59_712 | 216 |
| 647 | 3300046475 | Ga0495639_0378340 | Ga0495639_0378340_24_677 | 216 |
| 648 | 3300046500 | Ga0495596_0039623 | Ga0495596_0039623_211_864 | 216 |
| 649 | 3300046506 | Ga0495583_0077822 | Ga0495583_0077822_64_717 | 216 |
| 650 | 3300046507 | Ga0495606_0078923 | Ga0495606_0078923_908_1561 | 216 |
| 651 | 3300046507 | Ga0495606_0083527 | Ga0495606_0083527_1061_1711 | 216 |
| 652 | 3300046507 | Ga0495606_0088537 | Ga0495606_0088537_1020_1673 | 216 |
| 653 | 3300046507 | Ga0495606_0103575 | Ga0495606_0103575_506_1159 | 216 |
| 654 | 3300046507 | Ga0495606_0218844 | Ga0495606_0218844_17_667 | 216 |
| 655 | 3300046511 | Ga0495608_0029892 | Ga0495608_0029892_2741_3394 | 216 |
| 656 | 3300046512 | Ga0495610_0111679 | Ga0495610_0111679_463_1116 | 216 |
| 657 | 3300046515 | Ga0495620_0119477 | Ga0495620_0119477_60_713 | 216 |
| 658 | 3300046516 | Ga0495628_0039638 | Ga0495628_0039638_2653_3306 | 216 |
| 659 | 3300046517 | Ga0495630_0391582 | Ga0495630_0391582_304_957 | 216 |
| 660 | 3300046518 | Ga0495631_0000824 | Ga0495631_0000824_8014_8679 | 216 |
| 661 | 3300046519 | Ga0495632_0015872 | Ga0495632_0015872_2552_3205 | 216 |
| 662 | 3300046523 | Ga0495644_0099967 | Ga0495644_0099967_359_1012 | 216 |
| 663 | 3300046524 | Ga0495648_0059019 | Ga0495648_0059019_791_1444 | 216 |
| 664 | 3300046524 | Ga0495648_0153083 | Ga0495648_0153083_136_789 | 216 |
| 665 | 3300046529 | Ga0495652_0323138 | Ga0495652_0323138_438_1091 | 216 |
| 666 | 3300046530 | Ga0495654_0096041 | Ga0495654_0096041_91_744 | 216 |
| 667 | 3300046536 | Ga0495587_0018206 | Ga0495587_0018206_933_1586 | 216 |
| 668 | 3300046538 | Ga0495609_0104549 | Ga0495609_0104549_493_1146 | 216 |
| 669 | 3300046542 | Ga0495597_0067803 | Ga0495597_0067803_446_1099 | 216 |
| 670 | 3300046543 | Ga0495645_0013557 | Ga0495645_0013557_4477_5130 | 216 |
| 671 | 3300046559 | Ga0495667_0212907 | Ga0495667_0212907_454_1107 | 216 |
| 672 | 3300046615 | Ga0495656_0009149 | Ga0495656_0009149_1677_2342 | 216 |
| 673 | 3300046615 | Ga0495656_0093640 | Ga0495656_0093640_696_1349 | 216 |
| 674 | 3300046615 | Ga0495656_0226960 | Ga0495656_0226960_238_891 | 216 |
| 675 | 3300046616 | Ga0495668_0018052 | Ga0495668_0018052_1011_1664 | 216 |
| 676 | 3300046642 | Ga0495634_0024426 | Ga0495634_0024426_963_1616 | 216 |
| 677 | 3300046648 | Ga0495611_0121127 | Ga0495611_0121127_219_872 | 216 |
| 678 | 3300046660 | Ga0495625_0172294 | Ga0495625_0172294_745_1410 | 216 |
| 679 | 3300046663 | Ga0495635_0015088 | Ga0495635_0015088_2030_2683 | 216 |
| 680 | 3300046663 | Ga0495635_0064359 | Ga0495635_0064359_655_1308 | 216 |
| 681 | 3300046674 | Ga0495588_0002049 | Ga0495588_0002049_4002_4655 | 216 |
| 682 | 3300046675 | Ga0495657_0016639 | Ga0495657_0016639_2995_3648 | 216 |
| 683 | 3300046675 | Ga0495657_0019591 | Ga0495657_0019591_3103_3756 | 216 |
| 684 | 3300046679 | Ga0495623_0027993 | Ga0495623_0027993_2454_3107 | 216 |
| 685 | 3300046680 | Ga0495646_0029384 | Ga0495646_0029384_1441_2094 | 216 |
| 686 | 3300046684 | Ga0495669_0053184 | Ga0495669_0053184_1048_1713 | 216 |
| 687 | 3300046689 | Ga0495613_0030248 | Ga0495613_0030248_2467_3120 | 216 |
| 688 | 3300046689 | Ga0495613_0528655 | Ga0495613_0528655_98_760 | 216 |
| 689 | 3300046690 | Ga0495624_0024480 | Ga0495624_0024480_1054_1707 | 216 |
| 690 | 3300046809 | Ga0495600_0059110 | Ga0495600_0059110_514_1167 | 216 |
| 691 | 3300046809 | Ga0495600_0222613 | Ga0495600_0222613_85_738 | 216 |
| 692 | 3300047317 | Ga0495604_0041025 | Ga0495604_0041025_1180_1833 | 216 |
| 693 | 3300047317 | Ga0495604_0076598 | Ga0495604_0076598_1382_2035 | 216 |
| 694 | 3300047321 | Ga0495676_0028303 | Ga0495676_0028303_2179_2832 | 216 |
| 695 | 3300047322 | Ga0495680_0001711 | Ga0495680_0001711_6121_6774 | 216 |
| 696 | 3300047469 | Ga0495673_0041835 | Ga0495673_0041835_676_1329 | 216 |
| 697 | 3300047469 | Ga0495673_0139030 | Ga0495673_0139030_175_828 | 216 |
| 698 | 3300047472 | Ga0495686_0191723 | Ga0495686_0191723_220_873 | 216 |
| 699 | 3300047472 | Ga0495686_0287561 | Ga0495686_0287561_163_816 | 216 |
| 700 | 3300048088 | Ga0495602_0003274 | Ga0495602_0003274_1326_1979 | 216 |
| 701 | 3300048088 | Ga0495602_0009113 | Ga0495602_0009113_8742_9395 | 216 |
| 702 | 3300048903 | Ga0496100_0171465 | Ga0496100_0171465_654_1307 | 216 |
| 703 | 3300048903 | Ga0496100_0395299 | Ga0496100_0395299_306_959 | 216 |
| 704 | 3300048904 | Ga0496101_0207065 | Ga0496101_0207065_356_1009 | 216 |
| 705 | 3300048904 | Ga0496101_0321800 | Ga0496101_0321800_115_768 | 216 |
| 706 | 3300048905 | Ga0496102_0211670 | Ga0496102_0211670_1119_1772 | 216 |
| 707 | 3300048905 | Ga0496102_0242612 | Ga0496102_0242612_449_1102 | 216 |
| 708 | 3300048905 | Ga0496102_0697222 | Ga0496102_0697222_214_897 | 216 |
| 709 | 3300048906 | Ga0496103_0402072 | Ga0496103_0402072_133_798 | 216 |
| 710 | 3300048907 | Ga0496104_0005822 | Ga0496104_0005822_1253_1906 | 216 |
| 711 | 3300048907 | Ga0496104_0011101 | Ga0496104_0011101_3623_4276 | 216 |
| 712 | 3300048908 | Ga0496105_0003099 | Ga0496105_0003099_9844_10497 | 216 |
| 713 | 3300048908 | Ga0496105_0054260 | Ga0496105_0054260_131_784 | 216 |
| 714 | 3300048908 | Ga0496105_0253171 | Ga0496105_0253171_669_1322 | 216 |
| 715 | 3300048909 | Ga0496106_0138711 | Ga0496106_0138711_1003_1656 | 216 |
| 716 | 3300048909 | Ga0496106_0185592 | Ga0496106_0185592_79_732 | 216 |
| 717 | 3300048909 | Ga0496106_0270426 | Ga0496106_0270426_596_1249 | 216 |
| 718 | 3300048910 | Ga0496107_0146565 | Ga0496107_0146565_460_1113 | 216 |
| 719 | 3300048910 | Ga0496107_0165272 | Ga0496107_0165272_36_689 | 216 |
| 720 | 3300048911 | Ga0496108_0250980 | Ga0496108_0250980_115_768 | 216 |
| 721 | 3300048912 | Ga0496109_0248413 | Ga0496109_0248413_162_815 | 216 |
| 722 | 3300048912 | Ga0496109_0269180 | Ga0496109_0269180_307_960 | 216 |
| 723 | 3300048912 | Ga0496109_0308487 | Ga0496109_0308487_313_966 | 216 |
| 724 | 3300048913 | Ga0496110_0441495 | Ga0496110_0441495_119_772 | 216 |
| 725 | 3300048914 | Ga0496111_0297372 | Ga0496111_0297372_310_963 | 216 |
| 726 | 3300048915 | Ga0496112_0019263 | Ga0496112_0019263_4320_4973 | 216 |
| 727 | 3300048915 | Ga0496112_0326907 | Ga0496112_0326907_690_1343 | 216 |
| 728 | 3300048915 | Ga0496112_0642602 | Ga0496112_0642602_54_707 | 216 |
| 729 | 3300048915 | Ga0496112_0740408 | Ga0496112_0740408_13_666 | 216 |
| 730 | 3300048916 | Ga0496113_0043185 | Ga0496113_0043185_1730_2383 | 216 |
| 731 | 3300048916 | Ga0496113_0166803 | Ga0496113_0166803_576_1229 | 216 |
| 732 | 3300048916 | Ga0496113_0280913 | Ga0496113_0280913_460_1113 | 216 |
| 733 | 3300048916 | Ga0496113_0419413 | Ga0496113_0419413_94_747 | 216 |
| 734 | 3300048917 | Ga0496114_0336037 | Ga0496114_0336037_376_1029 | 216 |
| 735 | 3300048917 | Ga0496114_0405980 | Ga0496114_0405980_379_1032 | 216 |
| 736 | 3300048918 | Ga0496115_0086717 | Ga0496115_0086717_1010_1672 | 216 |
| 737 | 3300048918 | Ga0496115_0128957 | Ga0496115_0128957_1248_1901 | 216 |
| 738 | 3300048919 | Ga0496116_0018009 | Ga0496116_0018009_3324_3977 | 216 |
| 739 | 3300048920 | Ga0496117_0227648 | Ga0496117_0227648_294_959 | 216 |
| 740 | 3300048921 | Ga0496118_0057282 | Ga0496118_0057282_122_805 | 216 |
| 741 | 3300048921 | Ga0496118_0080360 | Ga0496118_0080360_1421_2074 | 216 |
| 742 | 3300048921 | Ga0496118_0155780 | Ga0496118_0155780_26_679 | 216 |
| 743 | 3300048922 | Ga0496119_0034548 | Ga0496119_0034548_762_1415 | 216 |
| 744 | 3300048923 | Ga0496120_0016795 | Ga0496120_0016795_2903_3556 | 216 |
| 745 | 3300048923 | Ga0496120_0034937 | Ga0496120_0034937_2259_2912 | 216 |
| 746 | 3300048924 | Ga0496121_0004242 | Ga0496121_0004242_7605_8288 | 216 |
| 747 | 3300048924 | Ga0496121_0008031 | Ga0496121_0008031_8885_9538 | 216 |
| 748 | 3300048924 | Ga0496121_0110562 | Ga0496121_0110562_324_977 | 216 |
| 749 | 3300048924 | Ga0496121_0125842 | Ga0496121_0125842_550_1203 | 216 |
| 750 | 3300048924 | Ga0496121_0127740 | Ga0496121_0127740_1056_1709 | 216 |
| 751 | 3300048924 | Ga0496121_0179749 | Ga0496121_0179749_120_773 | 216 |
| 752 | 3300048924 | Ga0496121_0250341 | Ga0496121_0250341_366_1025 | 216 |
| 753 | 3300048924 | Ga0496121_0435321 | Ga0496121_0435321_69_722 | 216 |
| 754 | 3300048925 | Ga0496122_0013833 | Ga0496122_0013833_5043_5726 | 216 |
| 755 | 3300048925 | Ga0496122_0306040 | Ga0496122_0306040_117_770 | 216 |
| 756 | 3300048926 | Ga0496123_0034164 | Ga0496123_0034164_1400_2083 | 216 |
| 757 | 3300048927 | Ga0496124_0002063 | Ga0496124_0002063_15312_15995 | 216 |
| 758 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_11496_12146 | 216 |
| 759 | 3300048928 | Ga0496125_0084146 | Ga0496125_0084146_948_1601 | 216 |
| 760 | 3300048928 | Ga0496125_0090688 | Ga0496125_0090688_156_809 | 216 |
| 761 | 3300048929 | Ga0496126_0026298 | Ga0496126_0026298_967_1620 | 216 |
| 762 | 3300048929 | Ga0496126_0096800 | Ga0496126_0096800_1241_1894 | 216 |
| 763 | 3300048929 | Ga0496126_0156430 | Ga0496126_0156430_359_1012 | 216 |
| 764 | 3300048929 | Ga0496126_0181908 | Ga0496126_0181908_121_771 | 216 |
| 765 | 3300048929 | Ga0496126_0196249 | Ga0496126_0196249_117_770 | 216 |
| 766 | 3300048929 | Ga0496126_0389651 | Ga0496126_0389651_100_753 | 216 |
| 767 | 3300049460 | Ga0495682_0045902 | Ga0495682_0045902_60_713 | 216 |
| 768 | 3300049569 | Ga0501032_0165536 | Ga0501032_0165536_224_877 | 216 |
| 769 | 3300049570 | Ga0501033_0347509 | Ga0501033_0347509_70_723 | 216 |
| 770 | 3300049574 | Ga0501038_0257320 | Ga0501038_0257320_171_824 | 216 |
| 771 | 3300049579 | Ga0501043_0189980 | Ga0501043_0189980_392_1045 | 216 |
| 772 | 3300049583 | Ga0501067_0332997 | Ga0501067_0332997_65_730 | 216 |
| 773 | 3300049585 | Ga0501069_0294975 | Ga0501069_0294975_95_760 | 216 |
| 774 | 3300049585 | Ga0501069_0385451 | Ga0501069_0385451_72_725 | 216 |
| 775 | 3300049585 | Ga0501069_0427071 | Ga0501069_0427071_38_727 | 216 |
| 776 | 3300049822 | Ga0501035_0284353 | Ga0501035_0284353_519_1172 | 216 |
| 777 | 3300049823 | Ga0501044_0037527 | Ga0501044_0037527_1608_2261 | 216 |
| 778 | 3300050490 | nmdc:mga03n38_213128_c1 | nmdc:mga03n38_213128_c1_164_817 | 216 |
| 779 | 3300050491 | nmdc:mga00v17_541840_c1 | nmdc:mga00v17_541840_c1_47_700 | 216 |
| 780 | 3300050492 | nmdc:mga0yw44_3463_c1 | nmdc:mga0yw44_3463_c1_5376_6029 | 216 |
| 781 | 3300050494 | nmdc:mga06z11_185196_c1 | nmdc:mga06z11_185196_c1_118_771 | 216 |
| 782 | 3300050495 | nmdc:mga04h51_10509_c1 | nmdc:mga04h51_10509_c1_56_709 | 216 |
| 783 | 3300050496 | nmdc:mga07m45_174947_c1 | nmdc:mga07m45_174947_c1_122_775 | 216 |
| 784 | 3300050516 | nmdc:mga0sz30_81848_c1 | nmdc:mga0sz30_81848_c1_333_986 | 216 |
| 785 | 3300053085 | Ga0495619_0133043 | Ga0495619_0133043_297_950 | 216 |
| 786 | 3300053087 | Ga0500643_000456 | Ga0500643_000456_11742_12395 | 216 |
| 787 | 3300053091 | Ga0500647_0097491 | Ga0500647_0097491_437_1090 | 216 |
| 788 | 3300053092 | Ga0500583_0315902 | Ga0500583_0315902_55_708 | 216 |
| 789 | 3300053094 | Ga0500566_0001762 | Ga0500566_0001762_8872_9525 | 216 |
| 790 | 3300053096 | Ga0500641_0009742 | Ga0500641_0009742_1091_1744 | 216 |
| 791 | 3300053098 | Ga0500650_0060856 | Ga0500650_0060856_461_1114 | 216 |
| 792 | 3300053103 | Ga0500555_024001 | Ga0500555_024001_983_1636 | 216 |
| 793 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_15717_16370 | 216 |
| 794 | 3300053119 | Ga0500595_010552 | Ga0500595_010552_863_1516 | 216 |
| 795 | 3300053119 | Ga0500595_012731 | Ga0500595_012731_2084_2737 | 216 |
| 796 | 3300053130 | Ga0500642_0000252 | Ga0500642_0000252_10724_11377 | 216 |
| 797 | 3300053130 | Ga0500642_0254996 | Ga0500642_0254996_19_672 | 216 |
| 798 | 3300053136 | Ga0500559_0067679 | Ga0500559_0067679_733_1386 | 216 |
| 799 | 3300053139 | Ga0500568_0079948 | Ga0500568_0079948_100_753 | 216 |
| 800 | 3300053142 | Ga0500577_0011877 | Ga0500577_0011877_20_673 | 216 |
| 801 | 3300053142 | Ga0500577_0073065 | Ga0500577_0073065_61_711 | 216 |
| 802 | 3300053146 | Ga0500588_0065868 | Ga0500588_0065868_389_1042 | 216 |
| 803 | 3300053156 | Ga0500622_0025979 | Ga0500622_0025979_2035_2688 | 216 |
| 804 | 3300053177 | Ga0500636_0188136 | Ga0500636_0188136_198_851 | 216 |
| 805 | 3300053729 | Ga0500625_024839 | Ga0500625_024839_809_1462 | 216 |
| 806 | 3300053730 | Ga0500645_044982 | Ga0500645_044982_513_1166 | 216 |
| 807 | 3300060353 | Ga0501082_0469461 | Ga0501082_0469461_47_700 | 216 |
| 808 | iso_pu_bacteria | 2513237139 | 2513878508 | 216 |
| 809 | iso_pu_bacteria | 2617270735 | 2617346785 | 216 |
| 810 | iso_pu_bacteria | 2643221589 | 2643954258 | 216 |
| 811 | iso_pu_bacteria | 2643221602 | 2644023067 | 216 |
| 812 | iso_pu_bacteria | 2802429603 | 2805919068 | 216 |
| 813 | iso_pu_bacteria | 2808606445 | 2809214706 | 216 |
| 814 | iso_pu_bacteria | 2824671348 | 2824674134 | 216 |
| 815 | iso_pu_bacteria | 2824687955 | 2824691975 | 216 |
| 816 | iso_pu_bacteria | 2824696289 | 2824701129 | 216 |
| 817 | iso_pu_bacteria | 2824773399 | 2824775139 | 216 |
| 818 | iso_pu_bacteria | 2841941048 | 2841949288 | 216 |
| 819 | iso_pu_bacteria | 2847939898 | 2847947727 | 216 |
| 820 | iso_pu_bacteria | 2888419890 | 2888425568 | 216 |
| 821 | iso_pu_bacteria | 2904699407 | 2904701304 | 216 |
| 822 | iso_pu_bacteria | 8006984368 | 8006984414 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bkz-assembly1.cif.gz_A | x-ray structure of e coli alkb crosslinked to dsdna in the active site | 0.9817 | 17 | 215 |
| 4zhn-assembly1.cif.gz_A | crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t | 0.9812 | 18 | 215 |
| 4nii-assembly1.cif.gz_A | crystal structure of alkb d135i mutant protein with cofactors bound to dsdna containing m6a/a | 0.9805 | 16 | 214 |
| 2fdf-assembly1.cif.gz_A | crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t | 0.98 | 18 | 216 |
| 3o1p-assembly1.cif.gz_A | iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase | 0.9783 | 16 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4niiA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9805 | 16 | 214 | 2.60.120.590 |
| 4niiA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9565 | 16 | 214 | 2.60.120.590 |
| af_C6TKW1_99_311_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8858 | 16 | 214 | 2.60.120.590 |
| af_A0A1Q0YC58_8_168_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8848 | 88 | 215 | 2.60.120.590 |
| af_Q13686_178_346_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8817 | 95 | 215 | 2.60.120.590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A386HVK5-F1-model_v4 | AlkB | 0.9994 | 146 | 214 |
GO:0005737
GO:0006281 GO:0008198 GO:0035513 GO:0035515 GO:0035516 |
| AF-W1YKM2-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.9934 | 144 | 214 |
GO:0005737
GO:0006281 GO:0008198 GO:0035513 GO:0035515 GO:0035516 |
| AF-A0A537FMV5-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.9912 | 15 | 121 |
GO:0051213
|
| AF-A0A537DLG2-F1-model_v4 | DNA oxidative demethylase AlkB (EC 1.14.11.33) | 0.9904 | 15 | 216 |
GO:0005737
GO:0006281 GO:0008168 GO:0008198 GO:0032259 GO:0035513 GO:0035515 GO:0035516 |
| AF-A0A0H3ATV7-F1-model_v4 | Alkylated DNA repair protein AlkB | 0.9898 | 18 | 216 |
GO:0005737
GO:0006281 GO:0008198 GO:0035513 GO:0035515 GO:0035516 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar