F482293

General Info

Members Datasets Scaffolds Average Seq Length
822 540 618 216

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100204049|Ga0070665_1002040493
Length 248
Sequence LTDLFENVGDTRPSREAMAEGATLLRGFARPFEAELLPALRAIIKQSPFRHLITPGGHRMSVAMTNSGSVGWVSDSTGYRYDAVDPDTGQNWPAMPPVLRKLAANAAEDAGYRGFAPEACLINRYVPGAKLSLHQDKDELDFAAPIVSVSLGLPATFLFGGLKRADKTARYRLEHGDVVVWGGPSRLFYHGVAPLAEGEHAVMRGSGSTSHSARCGDLSEISPSFRGDAKHRTRNLEIPGSVLRTAPE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
22 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
23 2643221626 Ensifer sp. Root31 Isolate Unclassified
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
26 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
27 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
28 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
29 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
53 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
54 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
55 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
56 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
57 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
58 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
59 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
60 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
61 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
62 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
63 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
64 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
65 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
66 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
67 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
68 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
69 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
70 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
71 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
72 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
73 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
74 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
75 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
76 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
77 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
78 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
79 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
80 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
81 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
82 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
83 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
84 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
85 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
86 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
87 2904699407
88 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
89 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
90 2906610324
91 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
92 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
93 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
94 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
95 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
96 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
97 2922368715
98 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
99 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
100 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
101 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
102 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
103 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
104 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
105 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
106 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
107 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
108 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
109 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
110 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
111 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
112 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
113 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
114 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
115 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
116 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
117 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
118 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
119 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
120 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
121 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
122 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
123 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
124 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
125 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
126 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
127 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
128 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
129 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
130 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
131 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
132 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
133 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
134 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
135 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
136 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
137 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
138 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
139 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
140 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
141 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
142 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
143 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
144 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
145 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
146 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
147 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
148 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
149 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
150 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
151 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
152 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
153 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
154 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
155 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
156 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
157 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
158 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
159 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
160 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
161 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
162 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
163 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
164 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
165 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
166 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
167 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
168 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
169 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
170 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
171 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
172 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
173 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
174 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
175 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
176 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
177 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
178 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
179 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
180 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
181 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
182 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
183 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
184 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
185 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
186 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
187 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
188 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
189 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
190 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
191 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
192 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
193 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
194 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
195 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
196 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
197 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
198 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
199 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
200 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
201 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
202 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
203 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
204 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
205 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
206 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
207 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
208 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
209 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
210 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
211 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
212 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
213 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
214 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
215 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
216 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
217 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
218 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
219 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
220 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
221 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
222 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
223 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
224 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
225 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
226 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
227 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
228 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
229 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
231 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
232 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
233 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
234 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
235 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
236 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
237 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
238 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
239 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
240 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
241 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
242 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
243 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
244 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
245 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
246 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
247 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
248 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
249 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
250 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
251 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
252 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
253 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
254 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
255 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
256 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
257 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
258 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
259 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
260 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
261 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
262 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
263 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
264 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
265 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
266 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
267 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
271 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
275 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
277 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
311 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
312 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
313 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
314 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
318 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
319 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
321 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
322 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
323 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
324 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
325 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
326 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
327 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
328 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
329 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
330 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
331 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
332 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
333 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
334 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
335 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
338 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
339 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
340 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
341 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
342 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
343 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
344 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
345 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
346 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
347 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
348 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
349 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
350 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
351 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
352 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
353 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
354 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
355 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
356 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
357 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
358 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
359 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
360 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
361 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
362 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
363 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
364 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
365 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
366 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
367 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
368 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
372 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
373 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
378 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
379 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
380 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
381 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
382 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
383 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
384 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
385 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
386 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
387 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
388 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
389 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
390 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
391 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
392 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
393 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
394 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
395 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
396 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
397 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
398 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
399 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
400 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
401 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
402 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
403 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
404 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
405 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
406 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
407 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
408 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
409 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
410 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
411 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
412 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
413 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
414 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
415 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
416 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
417 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
418 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
419 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
422 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
423 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
434 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
435 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
438 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
439 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
440 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
441 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
442 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
443 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
444 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
445 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
446 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
447 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
448 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
449 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
450 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
459 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
460 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
469 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
470 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
471 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
472 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
473 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
474 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
475 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
479 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
480 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
481 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
482 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
483 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
484 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
485 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
486 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
487 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
488 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
489 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
490 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
491 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
492 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
493 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
494 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
495 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
496 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
497 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
498 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
499 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
500 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
501 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
502 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
503 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
504 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
507 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
508 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
509 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
510 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
511 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
512 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
513 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
514 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
515 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
516 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
517 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
518 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
519 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
520 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
521 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
522 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
523 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
524 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
525 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
526 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
527 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
528 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
529 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
530 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
531 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
532 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
533 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
534 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
535 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
536 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
537 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
538 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
539 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
540 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.34
Metatranscriptomes 0.12
Isolates 24.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.75
Nodule 19.83
Rhizoplane 5.47
Rhizosphere 49.39
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1005870 3300003214 Bacteria 2273
2 JGI25153J46596_10003908 3300003215 Bacteria 8174
3 JGI25153J46596_10005616 3300003215 Bacteria 6556
4 JGI25153J46596_10008403 3300003215 Bacteria 4937
5 JGI25153J46596_10008855 3300003215 Bacteria 4753
6 JGI25153J46596_10024455 3300003215 Bacteria 2178
7 JGI25160J50197_1003595 3300003354 Bacteria 6881
8 Ga0055536_1000637 3300003781 Bacteria 23872
9 Ga0055531_10009410 3300003794 Bacteria 4993
10 Ga0055543_1003833 3300004625 Bacteria 4269
11 Ga0065165_1002074 3300005262 Bacteria 18412
12 Ga0065165_1002220 3300005262 Bacteria 17337
13 Ga0065165_1016415 3300005262 Bacteria 2774
14 Ga0065165_1050349 3300005262 Bacteria 1186
15 Ga0070658_10406513 3300005327 Bacteria 1170
16 Ga0070670_100234998 3300005331 Bacteria 1595
17 Ga0068869_100196545 3300005334 Bacteria 1589
18 Ga0068869_100506261 3300005334 Bacteria 1009
19 Ga0070682_100299317 3300005337 Bacteria 1180
20 Ga0068868_100098903 3300005338 Bacteria 2359
21 Ga0070660_100190841 3300005339 Bacteria 1659
22 Ga0070660_100764218 3300005339 Bacteria 812
23 Ga0070661_100178364 3300005344 Bacteria 1615
24 Ga0070675_101028222 3300005354 Bacteria 757
25 Ga0070671_100175412 3300005355 Bacteria 1813
26 Ga0070671_100712972 3300005355 Bacteria 871
27 Ga0070674_100012062 3300005356 Bacteria 5294
28 Ga0070659_100179814 3300005366 Bacteria 1735
29 Ga0070667_100361078 3300005367 Bacteria 1316
30 Ga0070709_10185716 3300005434 Bacteria 1463
31 Ga0070713_100012830 3300005436 Bacteria 6162
32 Ga0070710_10045935 3300005437 Bacteria 2430
33 Ga0070711_100068830 3300005439 Bacteria 2488
34 Ga0070663_100011972 3300005455 Bacteria 5471
35 Ga0070663_100032808 3300005455 Bacteria 3583
36 Ga0070663_100070882 3300005455 Bacteria 2535
37 Ga0070663_100071943 3300005455 Bacteria 2518
38 Ga0070663_100155556 3300005455 Bacteria 1756
39 Ga0070663_100485313 3300005455 Bacteria 1024
40 Ga0070678_100193823 3300005456 Bacteria 1672
41 Ga0070662_100582836 3300005457 Bacteria 940
42 Ga0068867_100171073 3300005459 Bacteria 1721
43 Ga0068867_100426294 3300005459 Bacteria 1125
44 Ga0070698_100231832 3300005471 Bacteria 1779
45 Ga0070684_100210755 3300005535 Bacteria 1771
46 Ga0068853_100170200 3300005539 Bacteria 1970
47 Ga0068853_100488017 3300005539 Bacteria 1162
48 Ga0070693_100143917 3300005547 Bacteria 1503
49 Ga0070665_100049587 3300005548 Bacteria 4212
50 Ga0070665_100061335 3300005548 Bacteria 3769
51 Ga0070665_100161421 3300005548 Bacteria 2243
52 Ga0070665_100204049 3300005548 Bacteria 1977
53 Ga0070665_100258288 3300005548 Bacteria 1743
54 Ga0070665_100286459 3300005548 Bacteria 1649
55 Ga0070665_101101699 3300005548 Bacteria 806
56 Ga0070664_100067766 3300005564 Bacteria 3050
57 Ga0070664_100297849 3300005564 Bacteria 1457
58 Ga0070664_100969003 3300005564 Bacteria 799
59 Ga0068854_100088228 3300005578 Bacteria 2303
60 Ga0068854_100319859 3300005578 Bacteria 1261
61 Ga0068852_100068945 3300005616 Bacteria 3097
62 Ga0068852_100215323 3300005616 Bacteria 1824
63 Ga0068859_100266622 3300005617 Bacteria 1804
64 Ga0068859_100964496 3300005617 Bacteria 936
65 Ga0068864_100050579 3300005618 Bacteria 3577
66 Ga0068864_100765040 3300005618 Bacteria 947
67 Ga0068866_10368545 3300005718 Bacteria 918
68 Ga0068861_100050178 3300005719 Bacteria 3163
69 Ga0068861_100205641 3300005719 Bacteria 1655
70 Ga0068863_101011788 3300005841 Bacteria 834
71 Ga0068858_100287010 3300005842 Bacteria 1568
72 Ga0068860_100463816 3300005843 Bacteria 1261
73 Ga0068862_100141684 3300005844 Bacteria 2134
74 Ga0068862_100702929 3300005844 Bacteria 979
75 Ga0081538_10085946 3300005981 Bacteria 1649
76 Ga0081540_1005624 3300005983 Bacteria 9335
77 Ga0081540_1010058 3300005983 Bacteria 6440
78 Ga0081539_10005109 3300005985 Bacteria 13741
79 Ga0081539_10062093 3300005985 Bacteria 2044
80 Ga0075365_10008428 3300006038 Bacteria 5852
81 Ga0075365_10049319 3300006038 Bacteria 2774
82 Ga0075365_10080808 3300006038 Bacteria 2201
83 Ga0075365_10472984 3300006038 Bacteria 885
84 Ga0075368_10038840 3300006042 Bacteria 1864
85 Ga0075363_100006965 3300006048 Bacteria 5170
86 Ga0075363_100022057 3300006048 Bacteria 3215
87 Ga0075364_10062032 3300006051 Bacteria 2453
88 Ga0075364_10167528 3300006051 Bacteria 1484
89 Ga0075364_10403018 3300006051 Bacteria 933
90 Ga0070712_100024328 3300006175 Bacteria 4012
91 Ga0070712_100166275 3300006175 Bacteria 1708
92 Ga0075362_10005241 3300006177 Bacteria 4729
93 Ga0075367_10029890 3300006178 Bacteria 3120
94 Ga0075367_10066920 3300006178 Bacteria 2154
95 Ga0075369_10006201 3300006186 Bacteria 4515
96 Ga0075369_10021391 3300006186 Bacteria 2658
97 Ga0075366_10079661 3300006195 Bacteria 1956
98 Ga0075370_10014516 3300006353 Bacteria 4204
99 Ga0075370_10216421 3300006353 Bacteria 1131
100 Ga0068871_100383927 3300006358 Bacteria 1248
101 Ga0075428_100756624 3300006844 Bacteria 1034
102 Ga0075436_100050664 3300006914 Bacteria 2866
103 Ga0097620_100266601 3300006931 Bacteria 1804
104 Ga0097620_100964535 3300006931 Bacteria 936
105 Ga0099825_1017324 3300006941 Bacteria 5917
106 Ga0099824_1007408 3300006942 Bacteria 14551
107 Ga0099824_1028243 3300006942 Bacteria 2575
108 Ga0099822_1018218 3300006943 Bacteria 7346
109 Ga0075435_100089843 3300007076 Unclassified 2533
110 Ga0105251_10143078 3300009011 Bacteria 1082
111 Ga0105244_10001018 3300009036 Bacteria 23466
112 Ga0105244_10001348 3300009036 Bacteria 20005
113 Ga0105244_10009572 3300009036 Bacteria 5943
114 Ga0105250_10000038 3300009092 Bacteria 141225
115 Ga0105240_10055828 3300009093 Bacteria 4944
116 Ga0105240_10118535 3300009093 Bacteria 3190
117 Ga0105245_10033125 3300009098 Bacteria 4577
118 Ga0105245_10058514 3300009098 Bacteria 3469
119 Ga0105247_10257372 3300009101 Bacteria 1195
120 Ga0114129_10687533 3300009147 Bacteria 1316
121 Ga0105243_10018993 3300009148 Bacteria 5211
122 Ga0105243_10347936 3300009148 Bacteria 1360
123 Ga0105243_11290085 3300009148 Bacteria 747
124 Ga0105241_10021246 3300009174 Bacteria 4797
125 Ga0105241_10079612 3300009174 Bacteria 2563
126 Ga0105241_10199857 3300009174 Bacteria 1669
127 Ga0105242_10178625 3300009176 Bacteria 1871
128 Ga0105242_10800662 3300009176 Bacteria 933
129 Ga0105248_10097999 3300009177 Bacteria 3303
130 Ga0105248_10412780 3300009177 Bacteria 1520
131 Ga0105237_10023096 3300009545 Bacteria 6377
132 Ga0105237_10077928 3300009545 Bacteria 3304
133 Ga0105237_10286710 3300009545 Bacteria 1649
134 Ga0105238_10752349 3300009551 Bacteria 988
135 Ga0105238_10839675 3300009551 Bacteria 935
136 Ga0105249_10820958 3300009553 Bacteria 994
137 Ga0105249_10964151 3300009553 Bacteria 921
138 Ga0105239_10078938 3300010375 Bacteria 3622
139 Ga0105239_10128506 3300010375 Bacteria 2817
140 Ga0105239_10680129 3300010375 Bacteria 1176
141 Ga0105246_10041641 3300011119 Bacteria 3106
142 Ga0105246_10197976 3300011119 Bacteria 1560
143 Ga0157373_10005013 3300013100 Bacteria 9945
144 Ga0157374_10774110 3300013296 Bacteria 975
145 Ga0157374_11000872 3300013296 Bacteria 855
146 Ga0157378_11142950 3300013297 Bacteria 817
147 Ga0163162_10147448 3300013306 Bacteria 2470
148 Ga0163162_10564682 3300013306 Bacteria 1265
149 Ga0163162_11520961 3300013306 Bacteria 763
150 Ga0157375_10177401 3300013308 Bacteria 2281
151 Ga0157375_10178304 3300013308 Bacteria 2276
152 Ga0157375_10342330 3300013308 Bacteria 1661
153 Ga0157375_10629743 3300013308 Bacteria 1230
154 Ga0157375_11110265 3300013308 Bacteria 926
155 Ga0163163_10421184 3300014325 Bacteria 1394
156 Ga0163163_11111012 3300014325 Bacteria 853
157 Ga0157380_10225614 3300014326 Bacteria 1679
158 Ga0157380_10686591 3300014326 Bacteria 1027
159 Ga0182008_10155284 3300014497 Bacteria 1149
160 Ga0157377_10557712 3300014745 Bacteria 810
161 Ga0157379_10383885 3300014968 Bacteria 1289
162 Ga0157379_10836777 3300014968 Bacteria 870
163 Ga0157376_10260555 3300014969 Bacteria 1624
164 Ga0182006_1165676 3300015261 Bacteria 743
165 Ga0163161_10104209 3300017792 Bacteria 2114
166 Ga0214544_1001813 3300021320 Bacteria 44864
167 Ga0214544_1032892 3300021320 Bacteria 1575
168 Ga0214542_1001236 3300021321 Bacteria 51849
169 Ga0214542_1035084 3300021321 Bacteria 1575
170 Ga0214545_1000924 3300021324 Bacteria 51830
171 Ga0214545_1023872 3300021324 Bacteria 3911
172 Ga0214543_1003531 3300021327 Bacteria 30263
173 Ga0214543_1025126 3300021327 Bacteria 3507
174 Ga0209563_110159 3300025230 Bacteria 1387
175 Ga0209677_109130 3300025253 Bacteria 1819
176 Ga0209148_1000180 3300025254 Bacteria 124830
177 Ga0209233_1001441 3300025261 Bacteria 9387
178 Ga0209233_1006461 3300025261 Bacteria 3776
179 Ga0209455_1015254 3300025272 Bacteria 1697
180 Ga0209673_1026975 3300025273 Bacteria 1876
181 Ga0209564_1018234 3300025295 Bacteria 2687
182 Ga0209564_1049802 3300025295 Bacteria 1032
183 Ga0209758_1000011 3300025297 Bacteria 1049685
184 Ga0209758_1000133 3300025297 Bacteria 182442
185 Ga0209758_1001210 3300025297 Bacteria 32486
186 Ga0209758_1004569 3300025297 Bacteria 11413
187 Ga0209758_1008544 3300025297 Bacteria 6599
188 Ga0209758_1063625 3300025297 Bacteria 1200
189 Ga0209256_1005155 3300025299 Bacteria 7715
190 Ga0207426_1000572 3300025302 Bacteria 49561
191 Ga0207426_1001763 3300025302 Bacteria 16381
192 Ga0207426_1006362 3300025302 Bacteria 5153
193 Ga0207426_1015149 3300025302 Bacteria 2804
194 Ga0209257_1019864 3300025304 Bacteria 2510
195 Ga0209257_1026162 3300025304 Bacteria 1974
196 Ga0207696_1000123 3300025711 Bacteria 141297
197 Ga0207655_1003326 3300025728 Bacteria 12045
198 Ga0207655_1004644 3300025728 Bacteria 9644
199 Ga0207713_1000097 3300025735 Bacteria 144844
200 Ga0207692_10033660 3300025898 Bacteria 2475
201 Ga0207688_10013784 3300025901 Bacteria 4393
202 Ga0207647_10051282 3300025904 Bacteria 2551
203 Ga0207699_10075205 3300025906 Bacteria 2077
204 Ga0207705_10110005 3300025909 Bacteria 2035
205 Ga0207654_10159141 3300025911 Bacteria 1457
206 Ga0207654_10381095 3300025911 Bacteria 977
207 Ga0207695_10000008 3300025913 Bacteria 1058268
208 Ga0207671_10005294 3300025914 Bacteria 11960
209 Ga0207693_10006974 3300025915 Bacteria 9332
210 Ga0207693_10109971 3300025915 Bacteria 2161
211 Ga0207663_10084448 3300025916 Bacteria 2088
212 Ga0207650_10250033 3300025925 Bacteria 1435
213 Ga0207687_10032388 3300025927 Bacteria 3540
214 Ga0207687_10156507 3300025927 Bacteria 1744
215 Ga0207700_10009160 3300025928 Bacteria 6168
216 Ga0207664_10237969 3300025929 Bacteria 1584
217 Ga0207706_10034381 3300025933 Bacteria 4510
218 Ga0207686_10301308 3300025934 Bacteria 1190
219 Ga0207670_10731302 3300025936 Bacteria 821
220 Ga0207679_10024233 3300025945 Bacteria 4160
221 Ga0207667_10727079 3300025949 Bacteria 993
222 Ga0207668_10680854 3300025972 Bacteria 902
223 Ga0207668_11015886 3300025972 Bacteria 741
224 Ga0207640_10354130 3300025981 Bacteria 1180
225 Ga0207640_10528801 3300025981 Bacteria 987
226 Ga0207703_10296197 3300026035 Bacteria 1474
227 Ga0207639_10525052 3300026041 Bacteria 1084
228 Ga0207678_10043423 3300026067 Bacteria 3890
229 Ga0207678_10044113 3300026067 Bacteria 3858
230 Ga0207678_10079290 3300026067 Bacteria 2812
231 Ga0207678_10300827 3300026067 Bacteria 1379
232 Ga0207708_10663429 3300026075 Bacteria 889
233 Ga0207648_10451297 3300026089 Bacteria 1171
234 Ga0207648_11082103 3300026089 Bacteria 752
235 Ga0207675_100114402 3300026118 Bacteria 2548
236 Ga0207675_100528013 3300026118 Bacteria 1177
237 Ga0207675_100765425 3300026118 Bacteria 977
238 Ga0207683_10301298 3300026121 Bacteria 1467
239 Ga0207698_10042595 3300026142 Bacteria 3394
240 Ga0207698_10045951 3300026142 Bacteria 3293
241 Ga0209389_1000115 3300027296 Bacteria 71798
242 Ga0209589_1000014 3300027357 Bacteria 227996
243 Ga0209589_1000033 3300027357 Bacteria 140561
244 Ga0209489_100014 3300027361 Bacteria 227996
245 Ga0209489_100040 3300027361 Bacteria 164986
246 Ga0209700_100007 3300027363 Bacteria 454608
247 Ga0209700_100024 3300027363 Bacteria 227996
248 Ga0268266_10008590 3300028379 Bacteria 9072
249 Ga0268266_10104619 3300028379 Bacteria 2499
250 Ga0268266_10190655 3300028379 Bacteria 1871
251 Ga0268266_10727798 3300028379 Bacteria 957
252 Ga0268265_10682560 3300028380 Bacteria 990
253 Ga0268264_10328040 3300028381 Bacteria 1449
254 Ga0268264_10525038 3300028381 Bacteria 1158
255 Ga0268264_10814503 3300028381 Bacteria 933
256 Ga0307515_10374161 3300028794 Bacteria 1060
257 Ga0265338_10000092 3300028800 Bacteria 168538
258 Ga0265771_1008501 3300031010 Bacteria 721
259 Ga0307509_10263602 3300031507 Bacteria 1496
260 Ga0265314_10091444 3300031711 Bacteria 1980
261 Ga0265342_10030224 3300031712 Bacteria 3358
262 Ga0307405_10438346 3300031731 Bacteria 1033
263 Ga0307518_10382183 3300031838 Bacteria 798
264 Ga0307409_100446883 3300031995 Bacteria 1247
265 Ga0307414_10971651 3300032004 Bacteria 781
266 Ga0307411_10201149 3300032005 Bacteria 1530
267 Ga0307415_100329890 3300032126 Bacteria 1276
268 Ga0307510_10211658 3300033180 Bacteria 1460
269 Ga0315911_1000002 3300033442 Bacteria 926833
270 Ga0373923_0178964 3300035111 Bacteria 974
271 Ga0373936_0098359 3300035113 Bacteria 1233
272 Ga0373954_0044880 3300035118 Bacteria 2064
273 Ga0373931_0009359 3300035691 Bacteria 4683
274 Ga0373935_0016273 3300035692 Bacteria 4502
275 Ga0373937_0013710 3300036401 Bacteria 7142
276 Ga0395899_0075033 3300037312 Bacteria 2470
277 Ga0395900_0001029 3300037418 Bacteria 35765
278 Ga0395898_0002778 3300037466 Bacteria 20117
279 Ga0395898_0022553 3300037466 Bacteria 6376
280 Ga0395905_0055862 3300037471 Bacteria 3695
281 Ga0395905_0270498 3300037471 Bacteria 1585
282 Ga0395901_0078512 3300038443 Bacteria 3447
283 Ga0436365_1099947 3300039437 Bacteria 1647
284 Ga0436365_1926447 3300039437 Bacteria 1017
285 Ga0451839_1113772 3300041496 Bacteria 1157
286 Ga0450911_001673 3300042115 Bacteria 4903
287 Ga0450904_000630 3300042139 Bacteria 6432
288 Ga0466972_0000172 3300044658 Bacteria 50564
289 Ga0466972_0067429 3300044658 Bacteria 1709
290 Ga0466982_0032239 3300044672 Bacteria 3116
291 Ga0466965_0045998 3300044683 Bacteria 2159
292 Ga0466965_0340339 3300044683 Bacteria 820
293 Ga0466966_0000128 3300044684 Bacteria 48511
294 Ga0466961_0000236 3300044693 Bacteria 37237
295 Ga0466963_0238974 3300044694 Bacteria 1273
296 Ga0466964_0173024 3300044706 Bacteria 1018
297 Ga0466971_0088968 3300044719 Bacteria 1413
298 Ga0466971_0092090 3300044719 Bacteria 1389
299 Ga0466968_0270933 3300044735 Bacteria 810
300 Ga0466970_0195280 3300044765 Bacteria 1125
301 Ga0466970_0272050 3300044765 Bacteria 952
302 Ga0466959_0001099 3300045049 Bacteria 16214
303 Ga0466959_0051531 3300045049 Bacteria 3018
304 Ga0466959_0076070 3300045049 Bacteria 2425
305 Ga0466959_0135683 3300045049 Bacteria 1742
306 Ga0495617_010330 3300046452 Bacteria 3197
307 Ga0495617_086006 3300046452 Bacteria 1028
308 Ga0495603_0015187 3300046455 Bacteria 4659
309 Ga0495590_0023678 3300046457 Bacteria 2167
310 Ga0495591_000248 3300046458 Bacteria 52176
311 Ga0495591_000548 3300046458 Bacteria 28794
312 Ga0495591_006848 3300046458 Bacteria 4952
313 Ga0495629_0122018 3300046459 Bacteria 1815
314 Ga0495629_0360963 3300046459 Bacteria 990
315 Ga0495650_0000183 3300046471 Bacteria 137025
316 Ga0495650_0003354 3300046471 Bacteria 11752
317 Ga0495605_0000337 3300046474 Bacteria 46872
318 Ga0495605_0005910 3300046474 Bacteria 7075
319 Ga0495605_0009653 3300046474 Bacteria 5422
320 Ga0495605_0041536 3300046474 Bacteria 2291
321 Ga0495605_0168115 3300046474 Bacteria 970
322 Ga0495639_0258153 3300046475 Bacteria 863
323 Ga0495639_0378340 3300046475 Bacteria 713
324 Ga0495584_0004905 3300046491 Bacteria 7141
325 Ga0495585_0006785 3300046492 Bacteria 7067
326 Ga0495596_0039623 3300046500 Bacteria 1861
327 Ga0495607_0000318 3300046501 Bacteria 50045
328 Ga0495607_0003679 3300046501 Bacteria 11634
329 Ga0495607_0059472 3300046501 Bacteria 2180
330 Ga0495607_0114443 3300046501 Bacteria 1425
331 Ga0495607_0207443 3300046501 Bacteria 966
332 Ga0495583_0000089 3300046506 Bacteria 163349
333 Ga0495583_0004882 3300046506 Bacteria 9356
334 Ga0495583_0004893 3300046506 Bacteria 9328
335 Ga0495583_0005641 3300046506 Bacteria 8429
336 Ga0495583_0009598 3300046506 Bacteria 5763
337 Ga0495583_0077822 3300046506 Bacteria 1446
338 Ga0495606_0000013 3300046507 Bacteria 292850
339 Ga0495606_0000455 3300046507 Bacteria 67087
340 Ga0495606_0009478 3300046507 Bacteria 8231
341 Ga0495606_0078923 3300046507 Bacteria 2052
342 Ga0495606_0083527 3300046507 Bacteria 1980
343 Ga0495606_0088537 3300046507 Bacteria 1909
344 Ga0495606_0103575 3300046507 Bacteria 1728
345 Ga0495606_0218844 3300046507 Bacteria 1074
346 Ga0495608_0029892 3300046511 Bacteria 3692
347 Ga0495610_0012937 3300046512 Bacteria 4987
348 Ga0495610_0027518 3300046512 Bacteria 3020
349 Ga0495610_0111679 3300046512 Bacteria 1210
350 Ga0495616_0052715 3300046513 Bacteria 2024
351 Ga0495620_0001393 3300046515 Bacteria 14512
352 Ga0495620_0011651 3300046515 Bacteria 4577
353 Ga0495620_0119477 3300046515 Bacteria 1039
354 Ga0495628_0039638 3300046516 Bacteria 3767
355 Ga0495630_0391582 3300046517 Bacteria 1064
356 Ga0495631_0000824 3300046518 Bacteria 19819
357 Ga0495631_0002927 3300046518 Bacteria 9454
358 Ga0495632_0000219 3300046519 Bacteria 58093
359 Ga0495632_0001788 3300046519 Bacteria 17343
360 Ga0495632_0015872 3300046519 Bacteria 4206
361 Ga0495632_0020391 3300046519 Bacteria 3590
362 Ga0495632_0023959 3300046519 Bacteria 3250
363 Ga0495632_0124613 3300046519 Bacteria 1202
364 Ga0495632_0287359 3300046519 Bacteria 731
365 Ga0495637_0000027 3300046520 Bacteria 146241
366 Ga0495637_0000673 3300046520 Bacteria 23781
367 Ga0495637_0006068 3300046520 Bacteria 6102
368 Ga0495643_0007804 3300046522 Bacteria 6846
369 Ga0495643_0009713 3300046522 Bacteria 5951
370 Ga0495644_0001060 3300046523 Bacteria 11446
371 Ga0495644_0099967 3300046523 Bacteria 1097
372 Ga0495648_0002940 3300046524 Bacteria 15290
373 Ga0495648_0003624 3300046524 Bacteria 13521
374 Ga0495648_0059019 3300046524 Bacteria 2291
375 Ga0495648_0153083 3300046524 Bacteria 1201
376 Ga0495652_0323138 3300046529 Bacteria 1114
377 Ga0495654_0019656 3300046530 Bacteria 3531
378 Ga0495654_0042784 3300046530 Bacteria 2247
379 Ga0495654_0096041 3300046530 Bacteria 1370
380 Ga0495587_0018206 3300046536 Bacteria 4357
381 Ga0495609_0000027 3300046538 Bacteria 234661
382 Ga0495609_0000037 3300046538 Bacteria 185912
383 Ga0495609_0051699 3300046538 Bacteria 1829
384 Ga0495609_0104549 3300046538 Bacteria 1225
385 Ga0495597_0067803 3300046542 Bacteria 1543
386 Ga0495645_0013557 3300046543 Bacteria 5768
387 Ga0495622_0236519 3300046557 Bacteria 806
388 Ga0495633_0244013 3300046558 Bacteria 820
389 Ga0495633_0277069 3300046558 Bacteria 763
390 Ga0495667_0212907 3300046559 Bacteria 1235
391 Ga0495656_0009149 3300046615 Bacteria 3558
392 Ga0495656_0093640 3300046615 Bacteria 1378
393 Ga0495656_0226960 3300046615 Bacteria 936
394 Ga0495668_0013418 3300046616 Bacteria 4832
395 Ga0495668_0018052 3300046616 Bacteria 4083
396 Ga0495668_0049246 3300046616 Bacteria 2336
397 Ga0495668_0135775 3300046616 Bacteria 1346
398 Ga0495668_0254597 3300046616 Bacteria 961
399 Ga0495634_0024426 3300046642 Bacteria 4241
400 Ga0495611_0000972 3300046648 Bacteria 15280
401 Ga0495611_0008461 3300046648 Bacteria 4355
402 Ga0495611_0121127 3300046648 Bacteria 1220
403 Ga0495625_0000071 3300046660 Bacteria 166966
404 Ga0495625_0044250 3300046660 Bacteria 3224
405 Ga0495625_0172294 3300046660 Bacteria 1444
406 Ga0495635_0015088 3300046663 Bacteria 5404
407 Ga0495635_0064359 3300046663 Bacteria 2517
408 Ga0495659_0099877 3300046664 Bacteria 1123
409 Ga0495661_0000080 3300046665 Bacteria 117162
410 Ga0495661_0000141 3300046665 Bacteria 84404
411 Ga0495661_0016010 3300046665 Bacteria 4984
412 Ga0495588_0002049 3300046674 Bacteria 8621
413 Ga0495657_0016639 3300046675 Bacteria 5354
414 Ga0495657_0019591 3300046675 Bacteria 4879
415 Ga0495623_0027993 3300046679 Bacteria 3628
416 Ga0495646_0029384 3300046680 Bacteria 3436
417 Ga0495669_0053184 3300046684 Bacteria 1821
418 Ga0495669_0185735 3300046684 Bacteria 991
419 Ga0495613_0030248 3300046689 Bacteria 4022
420 Ga0495613_0528655 3300046689 Bacteria 791
421 Ga0495624_0024480 3300046690 Bacteria 3972
422 Ga0495671_0002922 3300046692 Bacteria 10655
423 Ga0495671_0066801 3300046692 Bacteria 1769
424 Ga0495671_0135709 3300046692 Bacteria 1199
425 Ga0495589_0047680 3300046794 Bacteria 2122
426 Ga0495600_0059110 3300046809 Bacteria 2504
427 Ga0495600_0222613 3300046809 Bacteria 1207
428 Ga0495660_0017453 3300046810 Bacteria 4132
429 Ga0495660_0208738 3300046810 Bacteria 928
430 Ga0495604_0041025 3300047317 Bacteria 3631
431 Ga0495604_0076598 3300047317 Bacteria 2515
432 Ga0495672_0019556 3300047320 Bacteria 4464
433 Ga0495672_0072477 3300047320 Bacteria 1945
434 Ga0495676_0000003 3300047321 Bacteria 318463
435 Ga0495676_0028303 3300047321 Bacteria 4787
436 Ga0495680_0001711 3300047322 Bacteria 23324
437 Ga0495683_0011659 3300047323 Bacteria 4625
438 Ga0495679_000145 3300047446 Bacteria 64494
439 Ga0495673_0000650 3300047469 Bacteria 34106
440 Ga0495673_0006629 3300047469 Bacteria 6786
441 Ga0495673_0006757 3300047469 Bacteria 6703
442 Ga0495673_0041835 3300047469 Bacteria 2060
443 Ga0495673_0047853 3300047469 Bacteria 1888
444 Ga0495673_0048307 3300047469 Bacteria 1876
445 Ga0495673_0139030 3300047469 Bacteria 948
446 Ga0495681_0002926 3300047470 Bacteria 12070
447 Ga0495686_0048258 3300047472 Bacteria 2685
448 Ga0495686_0057021 3300047472 Bacteria 2439
449 Ga0495686_0191723 3300047472 Bacteria 1178
450 Ga0495686_0287561 3300047472 Bacteria 912
451 Ga0495602_0003274 3300048088 Bacteria 16731
452 Ga0495602_0009113 3300048088 Bacteria 10332
453 Ga0495626_0000010 3300048091 Bacteria 270265
454 Ga0496100_0171465 3300048903 Bacteria 1563
455 Ga0496100_0395299 3300048903 Bacteria 1052
456 Ga0496101_0207065 3300048904 Bacteria 1518
457 Ga0496101_0321800 3300048904 Bacteria 1213
458 Ga0496101_0642038 3300048904 Bacteria 839
459 Ga0496101_0821783 3300048904 Bacteria 733
460 Ga0496102_0166209 3300048905 Bacteria 2076
461 Ga0496102_0211670 3300048905 Bacteria 1827
462 Ga0496102_0242612 3300048905 Bacteria 1699
463 Ga0496102_0697222 3300048905 Bacteria 938
464 Ga0496103_0402072 3300048906 Bacteria 880
465 Ga0496104_0005822 3300048907 Bacteria 10797
466 Ga0496104_0011101 3300048907 Bacteria 8061
467 Ga0496104_0070856 3300048907 Bacteria 3315
468 Ga0496105_0003099 3300048908 Bacteria 12229
469 Ga0496105_0054260 3300048908 Bacteria 3309
470 Ga0496105_0253171 3300048908 Bacteria 1426
471 Ga0496106_0086321 3300048909 Bacteria 2417
472 Ga0496106_0138711 3300048909 Bacteria 1911
473 Ga0496106_0185592 3300048909 Bacteria 1652
474 Ga0496106_0270426 3300048909 Bacteria 1361
475 Ga0496106_0604710 3300048909 Bacteria 878
476 Ga0496107_0146565 3300048910 Bacteria 1746
477 Ga0496107_0165272 3300048910 Bacteria 1641
478 Ga0496108_0250980 3300048911 Bacteria 1539
479 Ga0496109_0248413 3300048912 Bacteria 1675
480 Ga0496109_0269180 3300048912 Bacteria 1605
481 Ga0496109_0308487 3300048912 Bacteria 1493
482 Ga0496110_0441495 3300048913 Bacteria 1186
483 Ga0496111_0297372 3300048914 Bacteria 1197
484 Ga0496112_0019263 3300048915 Bacteria 6437
485 Ga0496112_0326907 3300048915 Bacteria 1477
486 Ga0496112_0642602 3300048915 Bacteria 991
487 Ga0496112_0740408 3300048915 Bacteria 910
488 Ga0496113_0043185 3300048916 Bacteria 3335
489 Ga0496113_0166803 3300048916 Bacteria 1743
490 Ga0496113_0280913 3300048916 Bacteria 1331
491 Ga0496113_0419413 3300048916 Bacteria 1075
492 Ga0496114_0336037 3300048917 Bacteria 1335
493 Ga0496114_0405980 3300048917 Bacteria 1206
494 Ga0496114_0690482 3300048917 Bacteria 896
495 Ga0496115_0086717 3300048918 Bacteria 2554
496 Ga0496115_0128957 3300048918 Bacteria 2084
497 Ga0496116_0018009 3300048919 Bacteria 5461
498 Ga0496117_0227648 3300048920 Bacteria 1033
499 Ga0496118_0057282 3300048921 Bacteria 2922
500 Ga0496118_0080360 3300048921 Bacteria 2295
501 Ga0496118_0155780 3300048921 Bacteria 1421
502 Ga0496119_0034548 3300048922 Bacteria 3326
503 Ga0496120_0016795 3300048923 Bacteria 4770
504 Ga0496120_0034937 3300048923 Bacteria 3007
505 Ga0496121_0004242 3300048924 Bacteria 19493
506 Ga0496121_0008031 3300048924 Bacteria 12580
507 Ga0496121_0110562 3300048924 Bacteria 2097
508 Ga0496121_0125842 3300048924 Bacteria 1927
509 Ga0496121_0127740 3300048924 Bacteria 1908
510 Ga0496121_0179749 3300048924 Bacteria 1528
511 Ga0496121_0250341 3300048924 Bacteria 1229
512 Ga0496121_0435321 3300048924 Bacteria 849
513 Ga0496122_0013833 3300048925 Bacteria 7858
514 Ga0496122_0306040 3300048925 Bacteria 854
515 Ga0496123_0034164 3300048926 Bacteria 3647
516 Ga0496124_0002063 3300048927 Bacteria 27250
517 Ga0496125_0000040 3300048928 Bacteria 314478
518 Ga0496125_0084146 3300048928 Bacteria 2417
519 Ga0496125_0090688 3300048928 Bacteria 2293
520 Ga0496125_0286362 3300048928 Bacteria 1017
521 Ga0496126_0026298 3300048929 Bacteria 5582
522 Ga0496126_0029864 3300048929 Bacteria 5174
523 Ga0496126_0096800 3300048929 Bacteria 2587
524 Ga0496126_0156430 3300048929 Bacteria 1950
525 Ga0496126_0181908 3300048929 Bacteria 1785
526 Ga0496126_0196249 3300048929 Bacteria 1707
527 Ga0496126_0389651 3300048929 Bacteria 1132
528 Ga0495678_000072 3300049459 Bacteria 128270
529 Ga0495678_004739 3300049459 Bacteria 7757
530 Ga0495678_005790 3300049459 Bacteria 6711
531 Ga0495682_0000125 3300049460 Bacteria 67122
532 Ga0495682_0045902 3300049460 Bacteria 1596
533 Ga0501032_0165536 3300049569 Bacteria 1451
534 Ga0501032_0224511 3300049569 Bacteria 1222
535 Ga0501033_0240924 3300049570 Bacteria 1283
536 Ga0501033_0347509 3300049570 Bacteria 1039
537 Ga0501034_0062087 3300049571 Bacteria 3752
538 Ga0501038_0257320 3300049574 Bacteria 1381
539 Ga0501043_0189980 3300049579 Bacteria 1598
540 Ga0501046_0315241 3300049580 Bacteria 1140
541 Ga0501047_0012334 3300049581 Bacteria 8090
542 Ga0501067_0332997 3300049583 Bacteria 846
543 Ga0501069_0294975 3300049585 Bacteria 950
544 Ga0501069_0385451 3300049585 Bacteria 828
545 Ga0501069_0427071 3300049585 Bacteria 786
546 Ga0501070_0183353 3300049586 Bacteria 1722
547 Ga0501070_0255850 3300049586 Bacteria 1432
548 Ga0501074_0030384 3300049590 Bacteria 3915
549 Ga0501080_0013729 3300049742 Bacteria 7457
550 Ga0501035_0284353 3300049822 Bacteria 1397
551 Ga0501044_0016521 3300049823 Bacteria 7921
552 Ga0501044_0037527 3300049823 Bacteria 5064
553 nmdc:mga03n38_213128_c1 3300050490 Bacteria 1005
554 nmdc:mga00v17_53228_c2 3300050491 Bacteria 2035
555 nmdc:mga00v17_541840_c1 3300050491 Bacteria 753
556 nmdc:mga0yw44_104866_c1 3300050492 Bacteria 1805
557 nmdc:mga0yw44_3463_c1 3300050492 Bacteria 7008
558 nmdc:mga0yw44_69758_c1 3300050492 Bacteria 2178
559 nmdc:mga06z11_185196_c1 3300050494 Bacteria 1203
560 nmdc:mga06z11_22778_c1 3300050494 Bacteria 2931
561 nmdc:mga06z11_372733_c1 3300050494 Bacteria 857
562 nmdc:mga06z11_42173_c1 3300050494 Bacteria 2287
563 nmdc:mga04h51_10509_c1 3300050495 Bacteria 2544
564 nmdc:mga04h51_143972_c1 3300050495 Bacteria 906
565 nmdc:mga04h51_221485_c1 3300050495 Bacteria 750
566 nmdc:mga07m45_17167_c1 3300050496 Bacteria 3882
567 nmdc:mga07m45_174947_c1 3300050496 Bacteria 1248
568 nmdc:mga07m45_203658_c1 3300050496 Bacteria 1151
569 nmdc:mga07m45_476071_c1 3300050496 Bacteria 724
570 nmdc:mga07m45_745_c1 3300050496 Bacteria 13914
571 nmdc:mga0qj67_321054_c1 3300050509 Bacteria 1253
572 nmdc:mga08y16_166574_c1 3300050511 Bacteria 2289
573 nmdc:mga0n895_364856_c1 3300050512 Bacteria 1462
574 nmdc:mga0rr50_372613_c1 3300050513 Bacteria 1203
575 nmdc:mga08x19_100096_c1 3300050514 Bacteria 1922
576 nmdc:mga0sz30_137066_c1 3300050516 Bacteria 1080
577 nmdc:mga0sz30_4355_c1 3300050516 Bacteria 5112
578 nmdc:mga0sz30_81848_c1 3300050516 Bacteria 1398
579 Ga0495619_0133043 3300053085 Bacteria 1710
580 Ga0500578_0204759 3300053086 Bacteria 1206
581 Ga0500643_000456 3300053087 Bacteria 30270
582 Ga0500643_013502 3300053087 Bacteria 2881
583 Ga0500646_0076963 3300053090 Bacteria 1011
584 Ga0500647_0097491 3300053091 Bacteria 1405
585 Ga0500583_0315902 3300053092 Bacteria 762
586 Ga0500651_0206179 3300053093 Bacteria 1158
587 Ga0500566_0001762 3300053094 Bacteria 12726
588 Ga0500566_0137301 3300053094 Bacteria 1301
589 Ga0500640_153193 3300053095 Bacteria 877
590 Ga0500641_0008111 3300053096 Bacteria 3741
591 Ga0500641_0009742 3300053096 Bacteria 3458
592 Ga0500650_0060856 3300053098 Bacteria 1763
593 Ga0500555_024001 3300053103 Bacteria 1748
594 Ga0500555_040214 3300053103 Bacteria 1304
595 Ga0500557_000003 3300053105 Bacteria 228429
596 Ga0500569_051039 3300053109 Bacteria 1248
597 Ga0500595_010552 3300053119 Bacteria 3664
598 Ga0500595_012731 3300053119 Bacteria 3242
599 Ga0500642_0000252 3300053130 Bacteria 20158
600 Ga0500642_0254996 3300053130 Bacteria 804
601 Ga0500559_0067679 3300053136 Bacteria 1604
602 Ga0500568_0079948 3300053139 Bacteria 1242
603 Ga0500577_0011877 3300053142 Bacteria 2614
604 Ga0500577_0073065 3300053142 Bacteria 1349
605 Ga0500577_0082092 3300053142 Bacteria 1287
606 Ga0500586_115204 3300053145 Bacteria 938
607 Ga0500588_0065868 3300053146 Bacteria 1174
608 Ga0500590_073751 3300053148 Bacteria 1691
609 Ga0500590_104886 3300053148 Bacteria 1351
610 Ga0500619_137777 3300053154 Bacteria 831
611 Ga0500622_0025979 3300053156 Bacteria 3092
612 Ga0500636_0000365 3300053177 Bacteria 24884
613 Ga0500636_0188136 3300053177 Bacteria 1102
614 Ga0500625_024839 3300053729 Bacteria 2832
615 Ga0500645_044982 3300053730 Bacteria 1298
616 Ga0500645_050295 3300053730 Bacteria 1217
617 Ga0500601_000203 3300053737 Bacteria 12048
618 Ga0501082_0469461 3300060353 Bacteria 1100

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006943 Ga0099822_1018218 Ga0099822_10182184 193
2 3300005339 Ga0070660_100764218 Ga0070660_1007642181 199
3 3300005434 Ga0070709_10185716 Ga0070709_101857162 199
4 3300005471 Ga0070698_100231832 Ga0070698_1002318322 199
5 3300005535 Ga0070684_100210755 Ga0070684_1002107552 199
6 3300005718 Ga0068866_10368545 Ga0068866_103685451 199
7 3300005983 Ga0081540_1005624 Ga0081540_10056242 199
8 3300005985 Ga0081539_10062093 Ga0081539_100620932 199
9 3300006942 Ga0099824_1007408 Ga0099824_100740812 199
10 3300027357 Ga0209589_1000014 Ga0209589_1000014172 199
11 3300027361 Ga0209489_100014 Ga0209489_100014172 199
12 3300027363 Ga0209700_100024 Ga0209700_100024172 199
13 3300005331 Ga0070670_100234998 Ga0070670_1002349981 206
14 3300005334 Ga0068869_100196545 Ga0068869_1001965451 206
15 3300005338 Ga0068868_100098903 Ga0068868_1000989032 206
16 3300005456 Ga0070678_100193823 Ga0070678_1001938232 206
17 3300005459 Ga0068867_100171073 Ga0068867_1001710732 206
18 3300005564 Ga0070664_100067766 Ga0070664_1000677662 206
19 3300005578 Ga0068854_100088228 Ga0068854_1000882283 206
20 3300005618 Ga0068864_100050579 Ga0068864_1000505792 206
21 3300005719 Ga0068861_100050178 Ga0068861_1000501784 206
22 3300005981 Ga0081538_10085946 Ga0081538_100859461 206
23 3300005983 Ga0081540_1010058 Ga0081540_10100584 206
24 3300006038 Ga0075365_10049319 Ga0075365_100493194 206
25 3300025927 Ga0207687_10032388 Ga0207687_100323884 206
26 3300025933 Ga0207706_10034381 Ga0207706_100343815 206
27 3300031711 Ga0265314_10091444 Ga0265314_100914442 206
28 3300048917 Ga0496114_0690482 Ga0496114_0690482_16_636 206
29 3300006914 Ga0075436_100050664 Ga0075436_1000506644 209
30 3300007076 Ga0075435_100089843 Ga0075435_1000898434 209
31 3300046558 Ga0495633_0277069 Ga0495633_0277069_76_705 209
32 3300046794 Ga0495589_0047680 Ga0495589_0047680_190_819 209
33 3300050513 nmdc:mga0rr50_372613_c1 nmdc:mga0rr50_372613_c1_473_1105 209
34 3300050514 nmdc:mga08x19_100096_c1 nmdc:mga08x19_100096_c1_52_684 209
35 3300005455 Ga0070663_100011972 Ga0070663_1000119722 211
36 3300005548 Ga0070665_100061335 Ga0070665_1000613354 211
37 3300005564 Ga0070664_100297849 Ga0070664_1002978492 211
38 3300005985 Ga0081539_10005109 Ga0081539_100051098 211
39 3300006048 Ga0075363_100006965 Ga0075363_1000069656 211
40 3300006051 Ga0075364_10062032 Ga0075364_100620323 211
41 3300006177 Ga0075362_10005241 Ga0075362_100052413 211
42 3300006178 Ga0075367_10029890 Ga0075367_100298904 211
43 3300006178 Ga0075367_10066920 Ga0075367_100669202 211
44 3300006186 Ga0075369_10006201 Ga0075369_100062011 211
45 3300006353 Ga0075370_10014516 Ga0075370_100145164 211
46 3300025945 Ga0207679_10024233 Ga0207679_100242333 211
47 3300026067 Ga0207678_10044113 Ga0207678_100441132 211
48 3300026089 Ga0207648_11082103 Ga0207648_110821031 211
49 3300028379 Ga0268266_10008590 Ga0268266_100085906 211
50 3300039437 Ga0436365_1926447 Ga0436365_1926447_39_677 211
51 3300048905 Ga0496102_0166209 Ga0496102_0166209_733_1386 211
52 3300048907 Ga0496104_0070856 Ga0496104_0070856_252_905 211
53 3300048909 Ga0496106_0086321 Ga0496106_0086321_363_1016 211
54 3300049571 Ga0501034_0062087 Ga0501034_0062087_2472_3107 211
55 3300050491 nmdc:mga00v17_53228_c2 nmdc:mga00v17_53228_c2_877_1530 211
56 3300050492 nmdc:mga0yw44_69758_c1 nmdc:mga0yw44_69758_c1_588_1223 211
57 3300050494 nmdc:mga06z11_22778_c1 nmdc:mga06z11_22778_c1_1884_2537 211
58 3300050494 nmdc:mga06z11_42173_c1 nmdc:mga06z11_42173_c1_1346_1981 211
59 3300050495 nmdc:mga04h51_143972_c1 nmdc:mga04h51_143972_c1_180_815 211
60 3300050496 nmdc:mga07m45_17167_c1 nmdc:mga07m45_17167_c1_3171_3806 211
61 3300050496 nmdc:mga07m45_203658_c1 nmdc:mga07m45_203658_c1_324_959 211
62 3300050496 nmdc:mga07m45_745_c1 nmdc:mga07m45_745_c1_11604_12257 211
63 3300050516 nmdc:mga0sz30_4355_c1 nmdc:mga0sz30_4355_c1_4300_4935 211
64 3300053096 Ga0500641_0008111 Ga0500641_0008111_34_672 211
65 iso_pu_bacteria 2643221626 2644146026 211
66 iso_pu_bacteria 8016548790 8016555017 211
67 3300009147 Ga0114129_10687533 Ga0114129_106875332 212
68 3300050509 nmdc:mga0qj67_321054_c1 nmdc:mga0qj67_321054_c1_46_687 212
69 iso_pu_bacteria 2507262055 2507507677 212
70 iso_pu_bacteria 2508501042 2508692659 212
71 iso_pu_bacteria 2515154112 2515626065 212
72 iso_pu_bacteria 2874590934 2874598787 212
73 iso_pu_bacteria 2874645413 2874652243 212
74 iso_pu_bacteria 2876771140 2876778826 212
75 iso_pu_bacteria 2876818435 2876824279 212
76 iso_pu_bacteria 2879074833 2879082619 212
77 iso_pu_bacteria 2879083081 2879086610 212
78 iso_pu_bacteria 2879127579 2879131536 212
79 iso_pu_bacteria 2879142872 2879147982 212
80 iso_pu_bacteria 2935608549 2935609814 212
81 iso_pu_bacteria 2935648319 2935652157 212
82 iso_pu_bacteria 2935656913 2935659870 212
83 iso_pu_bacteria 2935819856 2935822975 212
84 iso_pu_bacteria 2935847175 2935848557 212
85 iso_pu_bacteria 2935975950 2935980226 212
86 iso_pu_bacteria 2935984226 2935987015 212
87 iso_pu_bacteria 2936011229 2936014286 212
88 iso_pu_bacteria 2936019824 2936023874 212
89 iso_pu_bacteria 2936028420 2936031517 212
90 iso_pu_bacteria 2936046547 2936049392 212
91 iso_pu_bacteria 2936055302 2936062142 212
92 iso_pu_bacteria 8016630954 8016639195 212
93 iso_pu_bacteria 8019619141 8019619799 212
94 iso_pu_bacteria 8019629233 8019633316 212
95 iso_pu_bacteria 8019638758 8019646584 212
96 iso_pu_bacteria 8019659431 8019661190 212
97 iso_pu_bacteria 8019668869 8019670741 212
98 iso_pu_bacteria 8019678201 8019685489 212
99 3300009011 Ga0105251_10143078 Ga0105251_101430782 213
100 3300009098 Ga0105245_10058514 Ga0105245_100585142 213
101 3300009101 Ga0105247_10257372 Ga0105247_102573722 213
102 3300009148 Ga0105243_11290085 Ga0105243_112900851 213
103 3300013308 Ga0157375_10177401 Ga0157375_101774013 213
104 3300013308 Ga0157375_10629743 Ga0157375_106297432 213
105 3300014325 Ga0163163_10421184 Ga0163163_104211841 213
106 3300014745 Ga0157377_10557712 Ga0157377_105577122 213
107 3300014968 Ga0157379_10836777 Ga0157379_108367771 213
108 3300044684 Ga0466966_0000128 Ga0466966_0000128_16196_16837 213
109 3300044693 Ga0466961_0000236 Ga0466961_0000236_22524_23165 213
110 3300044706 Ga0466964_0173024 Ga0466964_0173024_212_853 213
111 3300044735 Ga0466968_0270933 Ga0466968_0270933_139_780 213
112 3300045049 Ga0466959_0001099 Ga0466959_0001099_10509_11150 213
113 3300046455 Ga0495603_0015187 Ga0495603_0015187_3960_4601 213
114 3300046459 Ga0495629_0360963 Ga0495629_0360963_139_780 213
115 3300046519 Ga0495632_0124613 Ga0495632_0124613_148_789 213
116 3300046519 Ga0495632_0287359 Ga0495632_0287359_58_699 213
117 3300046538 Ga0495609_0051699 Ga0495609_0051699_581_1222 213
118 3300046557 Ga0495622_0236519 Ga0495622_0236519_104_745 213
119 3300046616 Ga0495668_0049246 Ga0495668_0049246_164_805 213
120 3300046616 Ga0495668_0254597 Ga0495668_0254597_195_836 213
121 3300046660 Ga0495625_0044250 Ga0495625_0044250_446_1087 213
122 3300046664 Ga0495659_0099877 Ga0495659_0099877_227_868 213
123 3300046684 Ga0495669_0185735 Ga0495669_0185735_205_846 213
124 3300046810 Ga0495660_0208738 Ga0495660_0208738_97_738 213
125 3300047472 Ga0495686_0057021 Ga0495686_0057021_839_1480 213
126 3300048904 Ga0496101_0821783 Ga0496101_0821783_13_654 213
127 3300048909 Ga0496106_0604710 Ga0496106_0604710_112_753 213
128 3300048928 Ga0496125_0286362 Ga0496125_0286362_341_982 213
129 3300048929 Ga0496126_0029864 Ga0496126_0029864_4128_4769 213
130 3300050492 nmdc:mga0yw44_104866_c1 nmdc:mga0yw44_104866_c1_154_795 213
131 3300050494 nmdc:mga06z11_372733_c1 nmdc:mga06z11_372733_c1_35_676 213
132 3300050495 nmdc:mga04h51_221485_c1 nmdc:mga04h51_221485_c1_98_739 213
133 3300050496 nmdc:mga07m45_476071_c1 nmdc:mga07m45_476071_c1_47_688 213
134 3300050511 nmdc:mga08y16_166574_c1 nmdc:mga08y16_166574_c1_1369_2010 213
135 3300050512 nmdc:mga0n895_364856_c1 nmdc:mga0n895_364856_c1_71_712 213
136 3300050516 nmdc:mga0sz30_137066_c1 nmdc:mga0sz30_137066_c1_13_654 213
137 3300053086 Ga0500578_0204759 Ga0500578_0204759_384_1025 213
138 3300053087 Ga0500643_013502 Ga0500643_013502_1963_2607 213
139 3300053090 Ga0500646_0076963 Ga0500646_0076963_282_923 213
140 3300053093 Ga0500651_0206179 Ga0500651_0206179_385_1026 213
141 3300053094 Ga0500566_0137301 Ga0500566_0137301_191_832 213
142 3300053095 Ga0500640_153193 Ga0500640_153193_16_657 213
143 3300053103 Ga0500555_040214 Ga0500555_040214_187_828 213
144 3300053109 Ga0500569_051039 Ga0500569_051039_231_872 213
145 3300053142 Ga0500577_0082092 Ga0500577_0082092_292_933 213
146 3300053145 Ga0500586_115204 Ga0500586_115204_210_854 213
147 3300053148 Ga0500590_073751 Ga0500590_073751_948_1589 213
148 3300053148 Ga0500590_104886 Ga0500590_104886_320_961 213
149 3300053154 Ga0500619_137777 Ga0500619_137777_119_760 213
150 3300053177 Ga0500636_0000365 Ga0500636_0000365_5640_6281 213
151 3300053730 Ga0500645_050295 Ga0500645_050295_330_971 213
152 3300053737 Ga0500601_000203 Ga0500601_000203_2680_3321 213
153 iso_pu_bacteria 2508501009 2508541792 213
154 iso_pu_bacteria 2511231028 2511400928 213
155 iso_pu_bacteria 2513237092 2513621880 213
156 iso_pu_bacteria 2513237094 2513642973 213
157 iso_pu_bacteria 2513237095 2513647501 213
158 iso_pu_bacteria 2513237096 2513654076 213
159 iso_pu_bacteria 2513237102 2513704273 213
160 iso_pu_bacteria 2513237137 2513856828 213
161 iso_pu_bacteria 2513237145 2513918416 213
162 iso_pu_bacteria 2513237161 2514009445 213
163 iso_pu_bacteria 2517093001 2517104145 213
164 iso_pu_bacteria 2517572143 2517891350 213
165 iso_pu_bacteria 2528768022 2528848994 213
166 iso_pu_bacteria 2617270741 2617372715 213
167 iso_pu_bacteria 2667528175 2671118870 213
168 iso_pu_bacteria 2728368998 2728750063 213
169 iso_pu_bacteria 2791355196 2793065221 213
170 iso_pu_bacteria 2791355197 2793066718 213
171 iso_pu_bacteria 2824600985 2824606551 213
172 iso_pu_bacteria 2824609381 2824613032 213
173 iso_pu_bacteria 2824617872 2824620397 213
174 iso_pu_bacteria 2824626560 2824628555 213
175 iso_pu_bacteria 2824635225 2824639093 213
176 iso_pu_bacteria 2824644064 2824647318 213
177 iso_pu_bacteria 2824653114 2824658525 213
178 iso_pu_bacteria 2824661429 2824666474 213
179 iso_pu_bacteria 2824679649 2824685668 213
180 iso_pu_bacteria 2824704595 2824710244 213
181 iso_pu_bacteria 2824723954 2824732448 213
182 iso_pu_bacteria 2824732956 2824735846 213
183 iso_pu_bacteria 2824746037 2824750093 213
184 iso_pu_bacteria 2824753945 2824755968 213
185 iso_pu_bacteria 2824763712 2824767506 213
186 iso_pu_bacteria 2838122688 2838130494 213
187 iso_pu_bacteria 2841949485 2841953463 213
188 iso_pu_bacteria 2841966195 2841972060 213
189 iso_pu_bacteria 2841974524 2841978192 213
190 iso_pu_bacteria 2841983080 2841991007 213
191 iso_pu_bacteria 2844315083 2844320008 213
192 iso_pu_bacteria 2849076700 2849078412 213
193 iso_pu_bacteria 2857509624 2857512784 213
194 iso_pu_bacteria 2874604998 2874607394 213
195 iso_pu_bacteria 2874612657 2874614587 213
196 iso_pu_bacteria 2874620515 2874628065 213
197 iso_pu_bacteria 2874628541 2874635020 213
198 iso_pu_bacteria 2879099564 2879107119 213
199 iso_pu_bacteria 2881364244 2881371474 213
200 iso_pu_bacteria 2881665667 2881666563 213
201 iso_pu_bacteria 2885366525 2885369957 213
202 iso_pu_bacteria 2885374607 2885374996 213
203 iso_pu_bacteria 2885409591 2885410277 213
204 iso_pu_bacteria 2888378607 2888385438 213
205 iso_pu_bacteria 2888388044 2888392795 213
206 iso_pu_bacteria 2889033259 2889038030 213
207 iso_pu_bacteria 2903727486 2903730317 213
208 iso_pu_bacteria 2903748898 2903755311 213
209 iso_pu_bacteria 2904666416 2904674317 213
210 iso_pu_bacteria 2904690495 2904691219 213
211 iso_pu_bacteria 2904711408 2904711987 213
212 iso_pu_bacteria 2906602504 2906604748 213
213 iso_pu_bacteria 2906610324 2906616536 213
214 iso_pu_bacteria 2906635258 2906635309 213
215 iso_pu_bacteria 2906643746 2906643929 213
216 iso_pu_bacteria 2906660503 2906666854 213
217 iso_pu_bacteria 2908739725 2908741704 213
218 iso_pu_bacteria 2908756301 2908759140 213
219 iso_pu_bacteria 2908775508 2908781158 213
220 iso_pu_bacteria 2922368715 2922372421 213
221 iso_pu_bacteria 2922386360 2922387364 213
222 iso_pu_bacteria 2922393267 2922397085 213
223 iso_pu_bacteria 2929615660 2929621010 213
224 iso_pu_bacteria 2929624759 2929626159 213
225 iso_pu_bacteria 2932784394 2932784961 213
226 iso_pu_bacteria 2932801729 2932805689 213
227 iso_pu_bacteria 2932809354 2932809994 213
228 iso_pu_bacteria 2932818245 2932818263 213
229 iso_pu_bacteria 2932828146 2932828798 213
230 iso_pu_bacteria 2933577622 2933583120 213
231 iso_pu_bacteria 2935616580 2935619782 213
232 iso_pu_bacteria 2935630451 2935634040 213
233 iso_pu_bacteria 2935638405 2935638763 213
234 iso_pu_bacteria 2935665750 2935666386 213
235 iso_pu_bacteria 2935675223 2935676567 213
236 iso_pu_bacteria 2935684952 2935690761 213
237 iso_pu_bacteria 2935694250 2935694648 213
238 iso_pu_bacteria 2935703347 2935703769 213
239 iso_pu_bacteria 2935713505 2935718142 213
240 iso_pu_bacteria 2935722832 2935727877 213
241 iso_pu_bacteria 2935732158 2935736581 213
242 iso_pu_bacteria 2935741537 2935745960 213
243 iso_pu_bacteria 2935750917 2935756341 213
244 iso_pu_bacteria 2935760218 2935760554 213
245 iso_pu_bacteria 2935769743 2935777542 213
246 iso_pu_bacteria 2935777560 2935784327 213
247 iso_pu_bacteria 2935785616 2935793536 213
248 iso_pu_bacteria 2935793552 2935801531 213
249 iso_pu_bacteria 2935801545 2935801906 213
250 iso_pu_bacteria 2935810662 2935810676 213
251 iso_pu_bacteria 2935827899 2935828257 213
252 iso_pu_bacteria 2935837841 2935842461 213
253 iso_pu_bacteria 2935855204 2935857903 213
254 iso_pu_bacteria 2935864058 2935868755 213
255 iso_pu_bacteria 2935873716 2935874170 213
256 iso_pu_bacteria 2935883170 2935883941 213
257 iso_pu_bacteria 2935908558 2935909635 213
258 iso_pu_bacteria 2935916978 2935917360 213
259 iso_pu_bacteria 2935926038 2935927116 213
260 iso_pu_bacteria 2935934488 2935937040 213
261 iso_pu_bacteria 2935942939 2935944657 213
262 iso_pu_bacteria 2935951376 2935953094 213
263 iso_pu_bacteria 2935959822 2935966596 213
264 iso_pu_bacteria 2935967501 2935969934 213
265 iso_pu_bacteria 2935992306 2935992905 213
266 iso_pu_bacteria 2936002035 2936002818 213
267 iso_pu_bacteria 2936037263 2936037904 213
268 iso_pu_bacteria 2940556831 2940561684 213
269 iso_pu_bacteria 2941507105 2941510657 213
270 iso_pu_bacteria 2941515067 2941518041 213
271 iso_pu_bacteria 2941523033 2941527088 213
272 iso_pu_bacteria 2941531003 2941531193 213
273 iso_pu_bacteria 2941538514 2941542510 213
274 iso_pu_bacteria 3005474847 3005481237 213
275 iso_pu_bacteria 3005483717 3005484808 213
276 iso_pu_bacteria 3005506211 3005508446 213
277 iso_pu_bacteria 3005587118 3005588051 213
278 iso_pu_bacteria 3005710791 3005715794 213
279 iso_pu_bacteria 3005718088 3005723149 213
280 iso_pu_bacteria 3007718800 3007722534 213
281 iso_pu_bacteria 8006933436 8006939472 213
282 iso_pu_bacteria 8006973647 8006979222 213
283 iso_pu_bacteria 8016511872 8016520675 213
284 iso_pu_bacteria 8016522445 8016528701 213
285 iso_pu_bacteria 8016530956 8016533880 213
286 iso_pu_bacteria 8016539877 8016547103 213
287 iso_pu_bacteria 8016557553 8016563387 213
288 iso_pu_bacteria 8016566248 8016572218 213
289 iso_pu_bacteria 8016595262 8016601137 213
290 iso_pu_bacteria 8016603502 8016609311 213
291 iso_pu_bacteria 8016613128 8016615593 213
292 iso_pu_bacteria 8016622563 8016625627 213
293 iso_pu_bacteria 8017057580 8017064907 213
294 iso_pu_bacteria 8019530166 8019533651 213
295 iso_pu_bacteria 8019547302 8019552706 213
296 iso_pu_bacteria 8019555841 8019565350 213
297 iso_pu_bacteria 8019565922 8019575450 213
298 iso_pu_bacteria 8019576017 8019584283 213
299 iso_pu_bacteria 8019586578 8019592051 213
300 iso_pu_bacteria 8019597564 8019599232 213
301 iso_pu_bacteria 8019608314 8019609126 213
302 iso_pu_bacteria 8019648815 8019649354 213
303 iso_pu_bacteria 8055742211 8055745127 213
304 iso_pu_bacteria 8056673599 8056681093 213
305 iso_pu_bacteria 8056689827 8056693076 213
306 iso_pu_bacteria 8056967851 8056975085 213
307 3300009036 Ga0105244_10001348 Ga0105244_100013488 214
308 3300005436 Ga0070713_100012830 Ga0070713_1000128302 215
309 3300005578 Ga0068854_100319859 Ga0068854_1003198592 215
310 3300011119 Ga0105246_10041641 Ga0105246_100416412 215
311 3300013100 Ga0157373_10005013 Ga0157373_100050134 215
312 3300013306 Ga0163162_11520961 Ga0163162_115209611 215
313 3300015261 Ga0182006_1165676 Ga0182006_11656761 215
314 3300025728 Ga0207655_1003326 Ga0207655_10033262 215
315 3300025906 Ga0207699_10075205 Ga0207699_100752052 215
316 3300025928 Ga0207700_10009160 Ga0207700_100091602 215
317 3300025929 Ga0207664_10237969 Ga0207664_102379691 215
318 3300035111 Ga0373923_0178964 Ga0373923_0178964_183_830 215
319 3300035113 Ga0373936_0098359 Ga0373936_0098359_479_1126 215
320 3300035118 Ga0373954_0044880 Ga0373954_0044880_900_1547 215
321 3300035692 Ga0373935_0016273 Ga0373935_0016273_2550_3197 215
322 3300036401 Ga0373937_0013710 Ga0373937_0013710_5302_5949 215
323 3300039437 Ga0436365_1099947 Ga0436365_1099947_805_1455 215
324 3300044672 Ga0466982_0032239 Ga0466982_0032239_2268_2936 215
325 3300044694 Ga0466963_0238974 Ga0466963_0238974_266_934 215
326 3300046457 Ga0495590_0023678 Ga0495590_0023678_763_1443 215
327 3300046458 Ga0495591_000248 Ga0495591_000248_11198_11875 215
328 3300046458 Ga0495591_000548 Ga0495591_000548_14392_15072 215
329 3300046458 Ga0495591_006848 Ga0495591_006848_1924_2604 215
330 3300046471 Ga0495650_0000183 Ga0495650_0000183_38904_39584 215
331 3300046471 Ga0495650_0003354 Ga0495650_0003354_3740_4420 215
332 3300046474 Ga0495605_0000337 Ga0495605_0000337_20820_21500 215
333 3300046474 Ga0495605_0005910 Ga0495605_0005910_3628_4308 215
334 3300046474 Ga0495605_0009653 Ga0495605_0009653_3359_4039 215
335 3300046474 Ga0495605_0168115 Ga0495605_0168115_184_864 215
336 3300046491 Ga0495584_0004905 Ga0495584_0004905_3694_4374 215
337 3300046492 Ga0495585_0006785 Ga0495585_0006785_1931_2611 215
338 3300046501 Ga0495607_0000318 Ga0495607_0000318_6835_7497 215
339 3300046501 Ga0495607_0003679 Ga0495607_0003679_5752_6432 215
340 3300046501 Ga0495607_0059472 Ga0495607_0059472_1068_1748 215
341 3300046501 Ga0495607_0114443 Ga0495607_0114443_441_1121 215
342 3300046501 Ga0495607_0207443 Ga0495607_0207443_102_782 215
343 3300046506 Ga0495583_0000089 Ga0495583_0000089_112916_113596 215
344 3300046506 Ga0495583_0004882 Ga0495583_0004882_1788_2468 215
345 3300046506 Ga0495583_0004893 Ga0495583_0004893_3814_4494 215
346 3300046506 Ga0495583_0005641 Ga0495583_0005641_2293_2973 215
347 3300046506 Ga0495583_0009598 Ga0495583_0009598_3325_4005 215
348 3300046507 Ga0495606_0000013 Ga0495606_0000013_239129_239809 215
349 3300046507 Ga0495606_0000455 Ga0495606_0000455_5462_6142 215
350 3300046507 Ga0495606_0009478 Ga0495606_0009478_2198_2878 215
351 3300046512 Ga0495610_0012937 Ga0495610_0012937_1268_1948 215
352 3300046512 Ga0495610_0027518 Ga0495610_0027518_2155_2835 215
353 3300046513 Ga0495616_0052715 Ga0495616_0052715_742_1422 215
354 3300046515 Ga0495620_0001393 Ga0495620_0001393_2528_3208 215
355 3300046515 Ga0495620_0011651 Ga0495620_0011651_1946_2626 215
356 3300046518 Ga0495631_0002927 Ga0495631_0002927_7953_8633 215
357 3300046519 Ga0495632_0000219 Ga0495632_0000219_48575_49255 215
358 3300046519 Ga0495632_0001788 Ga0495632_0001788_8843_9523 215
359 3300046519 Ga0495632_0020391 Ga0495632_0020391_1725_2387 215
360 3300046519 Ga0495632_0023959 Ga0495632_0023959_1901_2581 215
361 3300046520 Ga0495637_0000027 Ga0495637_0000027_9276_9956 215
362 3300046520 Ga0495637_0000673 Ga0495637_0000673_3824_4504 215
363 3300046520 Ga0495637_0006068 Ga0495637_0006068_2268_2948 215
364 3300046522 Ga0495643_0007804 Ga0495643_0007804_742_1422 215
365 3300046522 Ga0495643_0009713 Ga0495643_0009713_3225_3905 215
366 3300046523 Ga0495644_0001060 Ga0495644_0001060_606_1286 215
367 3300046524 Ga0495648_0002940 Ga0495648_0002940_4819_5499 215
368 3300046524 Ga0495648_0003624 Ga0495648_0003624_7348_8028 215
369 3300046530 Ga0495654_0019656 Ga0495654_0019656_2029_2709 215
370 3300046530 Ga0495654_0042784 Ga0495654_0042784_517_1197 215
371 3300046538 Ga0495609_0000027 Ga0495609_0000027_94262_94942 215
372 3300046538 Ga0495609_0000037 Ga0495609_0000037_24364_25044 215
373 3300046558 Ga0495633_0244013 Ga0495633_0244013_50_730 215
374 3300046616 Ga0495668_0013418 Ga0495668_0013418_1069_1749 215
375 3300046616 Ga0495668_0135775 Ga0495668_0135775_49_729 215
376 3300046648 Ga0495611_0000972 Ga0495611_0000972_12973_13653 215
377 3300046648 Ga0495611_0008461 Ga0495611_0008461_2679_3359 215
378 3300046660 Ga0495625_0000071 Ga0495625_0000071_66533_67213 215
379 3300046665 Ga0495661_0000080 Ga0495661_0000080_95152_95832 215
380 3300046665 Ga0495661_0000141 Ga0495661_0000141_34477_35157 215
381 3300046665 Ga0495661_0016010 Ga0495661_0016010_2222_2902 215
382 3300046692 Ga0495671_0002922 Ga0495671_0002922_6098_6778 215
383 3300046692 Ga0495671_0066801 Ga0495671_0066801_27_707 215
384 3300046692 Ga0495671_0135709 Ga0495671_0135709_495_1175 215
385 3300046810 Ga0495660_0017453 Ga0495660_0017453_364_1044 215
386 3300047320 Ga0495672_0019556 Ga0495672_0019556_23_703 215
387 3300047320 Ga0495672_0072477 Ga0495672_0072477_146_826 215
388 3300047321 Ga0495676_0000003 Ga0495676_0000003_138986_139666 215
389 3300047323 Ga0495683_0011659 Ga0495683_0011659_213_890 215
390 3300047446 Ga0495679_000145 Ga0495679_000145_549_1226 215
391 3300047469 Ga0495673_0000650 Ga0495673_0000650_17036_17716 215
392 3300047469 Ga0495673_0006629 Ga0495673_0006629_542_1222 215
393 3300047469 Ga0495673_0006757 Ga0495673_0006757_3658_4338 215
394 3300047469 Ga0495673_0047853 Ga0495673_0047853_307_987 215
395 3300047469 Ga0495673_0048307 Ga0495673_0048307_1062_1742 215
396 3300047470 Ga0495681_0002926 Ga0495681_0002926_7602_8282 215
397 3300047472 Ga0495686_0048258 Ga0495686_0048258_1369_2049 215
398 3300048091 Ga0495626_0000010 Ga0495626_0000010_107471_108151 215
399 3300048904 Ga0496101_0642038 Ga0496101_0642038_91_741 215
400 3300049459 Ga0495678_000072 Ga0495678_000072_40840_41520 215
401 3300049459 Ga0495678_004739 Ga0495678_004739_3420_4100 215
402 3300049459 Ga0495678_005790 Ga0495678_005790_5491_6171 215
403 3300049460 Ga0495682_0000125 Ga0495682_0000125_45365_46045 215
404 3300049569 Ga0501032_0224511 Ga0501032_0224511_47_697 215
405 3300049570 Ga0501033_0240924 Ga0501033_0240924_310_960 215
406 3300049580 Ga0501046_0315241 Ga0501046_0315241_366_1016 215
407 3300049581 Ga0501047_0012334 Ga0501047_0012334_3926_4576 215
408 3300049586 Ga0501070_0183353 Ga0501070_0183353_132_782 215
409 3300049586 Ga0501070_0255850 Ga0501070_0255850_529_1179 215
410 3300049590 Ga0501074_0030384 Ga0501074_0030384_280_930 215
411 3300049742 Ga0501080_0013729 Ga0501080_0013729_3293_3943 215
412 3300049823 Ga0501044_0016521 Ga0501044_0016521_6668_7318 215
413 iso_pu_bacteria 2599185155 2599328951 215
414 iso_pu_bacteria 2738541271 2738691292 215
415 iso_pu_bacteria 2738543016 2739267067 215
416 3300003214 JGI25165J46597_1005870 JGI25165J46597_10058702 216
417 3300003215 JGI25153J46596_10003908 JGI25153J46596_100039085 216
418 3300003215 JGI25153J46596_10005616 JGI25153J46596_100056165 216
419 3300003215 JGI25153J46596_10008403 JGI25153J46596_100084034 216
420 3300003215 JGI25153J46596_10008855 JGI25153J46596_100088553 216
421 3300003215 JGI25153J46596_10024455 JGI25153J46596_100244551 216
422 3300003354 JGI25160J50197_1003595 JGI25160J50197_10035953 216
423 3300003781 Ga0055536_1000637 Ga0055536_100063715 216
424 3300003794 Ga0055531_10009410 Ga0055531_100094102 216
425 3300004625 Ga0055543_1003833 Ga0055543_10038333 216
426 3300005262 Ga0065165_1002074 Ga0065165_10020744 216
427 3300005262 Ga0065165_1002220 Ga0065165_100222013 216
428 3300005262 Ga0065165_1016415 Ga0065165_10164152 216
429 3300005262 Ga0065165_1050349 Ga0065165_10503492 216
430 3300005327 Ga0070658_10406513 Ga0070658_104065132 216
431 3300005334 Ga0068869_100506261 Ga0068869_1005062612 216
432 3300005337 Ga0070682_100299317 Ga0070682_1002993172 216
433 3300005339 Ga0070660_100190841 Ga0070660_1001908412 216
434 3300005344 Ga0070661_100178364 Ga0070661_1001783642 216
435 3300005354 Ga0070675_101028222 Ga0070675_1010282221 216
436 3300005355 Ga0070671_100175412 Ga0070671_1001754122 216
437 3300005355 Ga0070671_100712972 Ga0070671_1007129721 216
438 3300005356 Ga0070674_100012062 Ga0070674_1000120627 216
439 3300005366 Ga0070659_100179814 Ga0070659_1001798142 216
440 3300005367 Ga0070667_100361078 Ga0070667_1003610782 216
441 3300005437 Ga0070710_10045935 Ga0070710_100459352 216
442 3300005439 Ga0070711_100068830 Ga0070711_1000688303 216
443 3300005455 Ga0070663_100032808 Ga0070663_1000328084 216
444 3300005455 Ga0070663_100070882 Ga0070663_1000708822 216
445 3300005455 Ga0070663_100071943 Ga0070663_1000719431 216
446 3300005455 Ga0070663_100155556 Ga0070663_1001555563 216
447 3300005455 Ga0070663_100485313 Ga0070663_1004853132 216
448 3300005457 Ga0070662_100582836 Ga0070662_1005828362 216
449 3300005459 Ga0068867_100426294 Ga0068867_1004262941 216
450 3300005539 Ga0068853_100170200 Ga0068853_1001702002 216
451 3300005539 Ga0068853_100488017 Ga0068853_1004880172 216
452 3300005547 Ga0070693_100143917 Ga0070693_1001439172 216
453 3300005548 Ga0070665_100049587 Ga0070665_1000495872 216
454 3300005548 Ga0070665_100161421 Ga0070665_1001614211 216
455 3300005548 Ga0070665_100204049 Ga0070665_1002040493 216
456 3300005548 Ga0070665_100258288 Ga0070665_1002582881 216
457 3300005548 Ga0070665_100286459 Ga0070665_1002864592 216
458 3300005548 Ga0070665_101101699 Ga0070665_1011016991 216
459 3300005564 Ga0070664_100969003 Ga0070664_1009690031 216
460 3300005616 Ga0068852_100068945 Ga0068852_1000689453 216
461 3300005616 Ga0068852_100215323 Ga0068852_1002153232 216
462 3300005617 Ga0068859_100266622 Ga0068859_1002666221 216
463 3300005617 Ga0068859_100964496 Ga0068859_1009644962 216
464 3300005618 Ga0068864_100765040 Ga0068864_1007650402 216
465 3300005719 Ga0068861_100205641 Ga0068861_1002056412 216
466 3300005841 Ga0068863_101011788 Ga0068863_1010117881 216
467 3300005842 Ga0068858_100287010 Ga0068858_1002870102 216
468 3300005843 Ga0068860_100463816 Ga0068860_1004638162 216
469 3300005844 Ga0068862_100141684 Ga0068862_1001416841 216
470 3300005844 Ga0068862_100702929 Ga0068862_1007029291 216
471 3300006038 Ga0075365_10008428 Ga0075365_100084283 216
472 3300006038 Ga0075365_10080808 Ga0075365_100808082 216
473 3300006038 Ga0075365_10472984 Ga0075365_104729842 216
474 3300006042 Ga0075368_10038840 Ga0075368_100388402 216
475 3300006048 Ga0075363_100022057 Ga0075363_1000220574 216
476 3300006051 Ga0075364_10167528 Ga0075364_101675282 216
477 3300006051 Ga0075364_10403018 Ga0075364_104030181 216
478 3300006175 Ga0070712_100024328 Ga0070712_1000243281 216
479 3300006175 Ga0070712_100166275 Ga0070712_1001662752 216
480 3300006186 Ga0075369_10021391 Ga0075369_100213912 216
481 3300006195 Ga0075366_10079661 Ga0075366_100796612 216
482 3300006353 Ga0075370_10216421 Ga0075370_102164212 216
483 3300006358 Ga0068871_100383927 Ga0068871_1003839272 216
484 3300006844 Ga0075428_100756624 Ga0075428_1007566241 216
485 3300006931 Ga0097620_100266601 Ga0097620_1002666011 216
486 3300006931 Ga0097620_100964535 Ga0097620_1009645352 216
487 3300006941 Ga0099825_1017324 Ga0099825_10173245 216
488 3300006942 Ga0099824_1028243 Ga0099824_10282432 216
489 3300009036 Ga0105244_10001018 Ga0105244_1000101815 216
490 3300009036 Ga0105244_10009572 Ga0105244_100095727 216
491 3300009092 Ga0105250_10000038 Ga0105250_10000038116 216
492 3300009093 Ga0105240_10055828 Ga0105240_100558284 216
493 3300009093 Ga0105240_10118535 Ga0105240_101185353 216
494 3300009098 Ga0105245_10033125 Ga0105245_100331254 216
495 3300009148 Ga0105243_10018993 Ga0105243_100189934 216
496 3300009148 Ga0105243_10347936 Ga0105243_103479362 216
497 3300009174 Ga0105241_10021246 Ga0105241_100212462 216
498 3300009174 Ga0105241_10079612 Ga0105241_100796122 216
499 3300009174 Ga0105241_10199857 Ga0105241_101998572 216
500 3300009176 Ga0105242_10178625 Ga0105242_101786252 216
501 3300009176 Ga0105242_10800662 Ga0105242_108006622 216
502 3300009177 Ga0105248_10097999 Ga0105248_100979991 216
503 3300009177 Ga0105248_10412780 Ga0105248_104127803 216
504 3300009545 Ga0105237_10023096 Ga0105237_100230965 216
505 3300009545 Ga0105237_10077928 Ga0105237_100779284 216
506 3300009545 Ga0105237_10286710 Ga0105237_102867102 216
507 3300009551 Ga0105238_10752349 Ga0105238_107523492 216
508 3300009551 Ga0105238_10839675 Ga0105238_108396751 216
509 3300009553 Ga0105249_10820958 Ga0105249_108209582 216
510 3300009553 Ga0105249_10964151 Ga0105249_109641511 216
511 3300010375 Ga0105239_10078938 Ga0105239_100789382 216
512 3300010375 Ga0105239_10128506 Ga0105239_101285062 216
513 3300010375 Ga0105239_10680129 Ga0105239_106801291 216
514 3300011119 Ga0105246_10197976 Ga0105246_101979761 216
515 3300013296 Ga0157374_10774110 Ga0157374_107741101 216
516 3300013296 Ga0157374_11000872 Ga0157374_110008721 216
517 3300013297 Ga0157378_11142950 Ga0157378_111429501 216
518 3300013306 Ga0163162_10147448 Ga0163162_101474484 216
519 3300013306 Ga0163162_10564682 Ga0163162_105646822 216
520 3300013308 Ga0157375_10178304 Ga0157375_101783043 216
521 3300013308 Ga0157375_10342330 Ga0157375_103423302 216
522 3300013308 Ga0157375_11110265 Ga0157375_111102652 216
523 3300014325 Ga0163163_11111012 Ga0163163_111110122 216
524 3300014326 Ga0157380_10225614 Ga0157380_102256142 216
525 3300014326 Ga0157380_10686591 Ga0157380_106865912 216
526 3300014497 Ga0182008_10155284 Ga0182008_101552841 216
527 3300014968 Ga0157379_10383885 Ga0157379_103838851 216
528 3300014969 Ga0157376_10260555 Ga0157376_102605552 216
529 3300017792 Ga0163161_10104209 Ga0163161_101042092 216
530 3300021320 Ga0214544_1001813 Ga0214544_100181323 216
531 3300021320 Ga0214544_1032892 Ga0214544_10328921 216
532 3300021321 Ga0214542_1001236 Ga0214542_100123616 216
533 3300021321 Ga0214542_1035084 Ga0214542_10350841 216
534 3300021324 Ga0214545_1000924 Ga0214545_100092429 216
535 3300021324 Ga0214545_1023872 Ga0214545_10238722 216
536 3300021327 Ga0214543_1003531 Ga0214543_100353115 216
537 3300021327 Ga0214543_1025126 Ga0214543_10251264 216
538 3300025230 Ga0209563_110159 Ga0209563_1101592 216
539 3300025253 Ga0209677_109130 Ga0209677_1091302 216
540 3300025254 Ga0209148_1000180 Ga0209148_100018099 216
541 3300025261 Ga0209233_1001441 Ga0209233_10014418 216
542 3300025261 Ga0209233_1006461 Ga0209233_10064613 216
543 3300025272 Ga0209455_1015254 Ga0209455_10152542 216
544 3300025273 Ga0209673_1026975 Ga0209673_10269753 216
545 3300025295 Ga0209564_1018234 Ga0209564_10182342 216
546 3300025295 Ga0209564_1049802 Ga0209564_10498021 216
547 3300025297 Ga0209758_1000011 Ga0209758_1000011305 216
548 3300025297 Ga0209758_1000133 Ga0209758_100013348 216
549 3300025297 Ga0209758_1001210 Ga0209758_100121021 216
550 3300025297 Ga0209758_1004569 Ga0209758_100456912 216
551 3300025297 Ga0209758_1008544 Ga0209758_10085445 216
552 3300025297 Ga0209758_1063625 Ga0209758_10636252 216
553 3300025299 Ga0209256_1005155 Ga0209256_10051555 216
554 3300025302 Ga0207426_1000572 Ga0207426_100057225 216
555 3300025302 Ga0207426_1001763 Ga0207426_10017634 216
556 3300025302 Ga0207426_1006362 Ga0207426_10063626 216
557 3300025302 Ga0207426_1015149 Ga0207426_10151493 216
558 3300025304 Ga0209257_1019864 Ga0209257_10198642 216
559 3300025304 Ga0209257_1026162 Ga0209257_10261623 216
560 3300025711 Ga0207696_1000123 Ga0207696_100012318 216
561 3300025728 Ga0207655_1004644 Ga0207655_10046443 216
562 3300025735 Ga0207713_1000097 Ga0207713_1000097116 216
563 3300025898 Ga0207692_10033660 Ga0207692_100336602 216
564 3300025901 Ga0207688_10013784 Ga0207688_100137842 216
565 3300025904 Ga0207647_10051282 Ga0207647_100512823 216
566 3300025909 Ga0207705_10110005 Ga0207705_101100051 216
567 3300025911 Ga0207654_10159141 Ga0207654_101591412 216
568 3300025911 Ga0207654_10381095 Ga0207654_103810952 216
569 3300025913 Ga0207695_10000008 Ga0207695_10000008791 216
570 3300025914 Ga0207671_10005294 Ga0207671_100052948 216
571 3300025915 Ga0207693_10006974 Ga0207693_100069749 216
572 3300025915 Ga0207693_10109971 Ga0207693_101099712 216
573 3300025916 Ga0207663_10084448 Ga0207663_100844482 216
574 3300025925 Ga0207650_10250033 Ga0207650_102500332 216
575 3300025927 Ga0207687_10156507 Ga0207687_101565072 216
576 3300025934 Ga0207686_10301308 Ga0207686_103013082 216
577 3300025936 Ga0207670_10731302 Ga0207670_107313021 216
578 3300025949 Ga0207667_10727079 Ga0207667_107270791 216
579 3300025972 Ga0207668_10680854 Ga0207668_106808542 216
580 3300025972 Ga0207668_11015886 Ga0207668_110158861 216
581 3300025981 Ga0207640_10354130 Ga0207640_103541302 216
582 3300025981 Ga0207640_10528801 Ga0207640_105288011 216
583 3300026035 Ga0207703_10296197 Ga0207703_102961972 216
584 3300026041 Ga0207639_10525052 Ga0207639_105250522 216
585 3300026067 Ga0207678_10043423 Ga0207678_100434231 216
586 3300026067 Ga0207678_10079290 Ga0207678_100792902 216
587 3300026067 Ga0207678_10300827 Ga0207678_103008272 216
588 3300026075 Ga0207708_10663429 Ga0207708_106634292 216
589 3300026089 Ga0207648_10451297 Ga0207648_104512972 216
590 3300026118 Ga0207675_100114402 Ga0207675_1001144022 216
591 3300026118 Ga0207675_100528013 Ga0207675_1005280132 216
592 3300026118 Ga0207675_100765425 Ga0207675_1007654251 216
593 3300026121 Ga0207683_10301298 Ga0207683_103012982 216
594 3300026142 Ga0207698_10042595 Ga0207698_100425952 216
595 3300026142 Ga0207698_10045951 Ga0207698_100459514 216
596 3300027296 Ga0209389_1000115 Ga0209389_100011526 216
597 3300027357 Ga0209589_1000033 Ga0209589_100003326 216
598 3300027361 Ga0209489_100040 Ga0209489_100040124 216
599 3300027363 Ga0209700_100007 Ga0209700_100007259 216
600 3300028379 Ga0268266_10104619 Ga0268266_101046192 216
601 3300028379 Ga0268266_10190655 Ga0268266_101906551 216
602 3300028379 Ga0268266_10727798 Ga0268266_107277982 216
603 3300028380 Ga0268265_10682560 Ga0268265_106825602 216
604 3300028381 Ga0268264_10328040 Ga0268264_103280402 216
605 3300028381 Ga0268264_10525038 Ga0268264_105250382 216
606 3300028381 Ga0268264_10814503 Ga0268264_108145031 216
607 3300028794 Ga0307515_10374161 Ga0307515_103741611 216
608 3300028800 Ga0265338_10000092 Ga0265338_10000092106 216
609 3300031010 Ga0265771_1008501 Ga0265771_10085011 216
610 3300031507 Ga0307509_10263602 Ga0307509_102636022 216
611 3300031712 Ga0265342_10030224 Ga0265342_100302243 216
612 3300031731 Ga0307405_10438346 Ga0307405_104383461 216
613 3300031838 Ga0307518_10382183 Ga0307518_103821831 216
614 3300031995 Ga0307409_100446883 Ga0307409_1004468832 216
615 3300032004 Ga0307414_10971651 Ga0307414_109716511 216
616 3300032005 Ga0307411_10201149 Ga0307411_102011492 216
617 3300032126 Ga0307415_100329890 Ga0307415_1003298902 216
618 3300033180 Ga0307510_10211658 Ga0307510_102116582 216
619 3300033442 Ga0315911_1000002 Ga0315911_1000002147 216
620 3300035691 Ga0373931_0009359 Ga0373931_0009359_1939_2592 216
621 3300037312 Ga0395899_0075033 Ga0395899_0075033_776_1429 216
622 3300037418 Ga0395900_0001029 Ga0395900_0001029_18351_19004 216
623 3300037466 Ga0395898_0002778 Ga0395898_0002778_8134_8787 216
624 3300037466 Ga0395898_0022553 Ga0395898_0022553_3691_4344 216
625 3300037471 Ga0395905_0055862 Ga0395905_0055862_2791_3444 216
626 3300037471 Ga0395905_0270498 Ga0395905_0270498_510_1163 216
627 3300038443 Ga0395901_0078512 Ga0395901_0078512_1345_1998 216
628 3300041496 Ga0451839_1113772 Ga0451839_1113772_205_855 216
629 3300042115 Ga0450911_001673 Ga0450911_001673_4128_4793 216
630 3300042139 Ga0450904_000630 Ga0450904_000630_5732_6412 216
631 3300044658 Ga0466972_0000172 Ga0466972_0000172_49606_50259 216
632 3300044658 Ga0466972_0067429 Ga0466972_0067429_679_1332 216
633 3300044683 Ga0466965_0045998 Ga0466965_0045998_1419_2072 216
634 3300044683 Ga0466965_0340339 Ga0466965_0340339_67_720 216
635 3300044719 Ga0466971_0088968 Ga0466971_0088968_75_728 216
636 3300044719 Ga0466971_0092090 Ga0466971_0092090_25_678 216
637 3300044765 Ga0466970_0195280 Ga0466970_0195280_201_854 216
638 3300044765 Ga0466970_0272050 Ga0466970_0272050_241_894 216
639 3300045049 Ga0466959_0051531 Ga0466959_0051531_900_1553 216
640 3300045049 Ga0466959_0076070 Ga0466959_0076070_1656_2333 216
641 3300045049 Ga0466959_0135683 Ga0466959_0135683_830_1483 216
642 3300046452 Ga0495617_010330 Ga0495617_010330_1152_1805 216
643 3300046452 Ga0495617_086006 Ga0495617_086006_325_987 216
644 3300046459 Ga0495629_0122018 Ga0495629_0122018_894_1547 216
645 3300046474 Ga0495605_0041536 Ga0495605_0041536_689_1342 216
646 3300046475 Ga0495639_0258153 Ga0495639_0258153_59_712 216
647 3300046475 Ga0495639_0378340 Ga0495639_0378340_24_677 216
648 3300046500 Ga0495596_0039623 Ga0495596_0039623_211_864 216
649 3300046506 Ga0495583_0077822 Ga0495583_0077822_64_717 216
650 3300046507 Ga0495606_0078923 Ga0495606_0078923_908_1561 216
651 3300046507 Ga0495606_0083527 Ga0495606_0083527_1061_1711 216
652 3300046507 Ga0495606_0088537 Ga0495606_0088537_1020_1673 216
653 3300046507 Ga0495606_0103575 Ga0495606_0103575_506_1159 216
654 3300046507 Ga0495606_0218844 Ga0495606_0218844_17_667 216
655 3300046511 Ga0495608_0029892 Ga0495608_0029892_2741_3394 216
656 3300046512 Ga0495610_0111679 Ga0495610_0111679_463_1116 216
657 3300046515 Ga0495620_0119477 Ga0495620_0119477_60_713 216
658 3300046516 Ga0495628_0039638 Ga0495628_0039638_2653_3306 216
659 3300046517 Ga0495630_0391582 Ga0495630_0391582_304_957 216
660 3300046518 Ga0495631_0000824 Ga0495631_0000824_8014_8679 216
661 3300046519 Ga0495632_0015872 Ga0495632_0015872_2552_3205 216
662 3300046523 Ga0495644_0099967 Ga0495644_0099967_359_1012 216
663 3300046524 Ga0495648_0059019 Ga0495648_0059019_791_1444 216
664 3300046524 Ga0495648_0153083 Ga0495648_0153083_136_789 216
665 3300046529 Ga0495652_0323138 Ga0495652_0323138_438_1091 216
666 3300046530 Ga0495654_0096041 Ga0495654_0096041_91_744 216
667 3300046536 Ga0495587_0018206 Ga0495587_0018206_933_1586 216
668 3300046538 Ga0495609_0104549 Ga0495609_0104549_493_1146 216
669 3300046542 Ga0495597_0067803 Ga0495597_0067803_446_1099 216
670 3300046543 Ga0495645_0013557 Ga0495645_0013557_4477_5130 216
671 3300046559 Ga0495667_0212907 Ga0495667_0212907_454_1107 216
672 3300046615 Ga0495656_0009149 Ga0495656_0009149_1677_2342 216
673 3300046615 Ga0495656_0093640 Ga0495656_0093640_696_1349 216
674 3300046615 Ga0495656_0226960 Ga0495656_0226960_238_891 216
675 3300046616 Ga0495668_0018052 Ga0495668_0018052_1011_1664 216
676 3300046642 Ga0495634_0024426 Ga0495634_0024426_963_1616 216
677 3300046648 Ga0495611_0121127 Ga0495611_0121127_219_872 216
678 3300046660 Ga0495625_0172294 Ga0495625_0172294_745_1410 216
679 3300046663 Ga0495635_0015088 Ga0495635_0015088_2030_2683 216
680 3300046663 Ga0495635_0064359 Ga0495635_0064359_655_1308 216
681 3300046674 Ga0495588_0002049 Ga0495588_0002049_4002_4655 216
682 3300046675 Ga0495657_0016639 Ga0495657_0016639_2995_3648 216
683 3300046675 Ga0495657_0019591 Ga0495657_0019591_3103_3756 216
684 3300046679 Ga0495623_0027993 Ga0495623_0027993_2454_3107 216
685 3300046680 Ga0495646_0029384 Ga0495646_0029384_1441_2094 216
686 3300046684 Ga0495669_0053184 Ga0495669_0053184_1048_1713 216
687 3300046689 Ga0495613_0030248 Ga0495613_0030248_2467_3120 216
688 3300046689 Ga0495613_0528655 Ga0495613_0528655_98_760 216
689 3300046690 Ga0495624_0024480 Ga0495624_0024480_1054_1707 216
690 3300046809 Ga0495600_0059110 Ga0495600_0059110_514_1167 216
691 3300046809 Ga0495600_0222613 Ga0495600_0222613_85_738 216
692 3300047317 Ga0495604_0041025 Ga0495604_0041025_1180_1833 216
693 3300047317 Ga0495604_0076598 Ga0495604_0076598_1382_2035 216
694 3300047321 Ga0495676_0028303 Ga0495676_0028303_2179_2832 216
695 3300047322 Ga0495680_0001711 Ga0495680_0001711_6121_6774 216
696 3300047469 Ga0495673_0041835 Ga0495673_0041835_676_1329 216
697 3300047469 Ga0495673_0139030 Ga0495673_0139030_175_828 216
698 3300047472 Ga0495686_0191723 Ga0495686_0191723_220_873 216
699 3300047472 Ga0495686_0287561 Ga0495686_0287561_163_816 216
700 3300048088 Ga0495602_0003274 Ga0495602_0003274_1326_1979 216
701 3300048088 Ga0495602_0009113 Ga0495602_0009113_8742_9395 216
702 3300048903 Ga0496100_0171465 Ga0496100_0171465_654_1307 216
703 3300048903 Ga0496100_0395299 Ga0496100_0395299_306_959 216
704 3300048904 Ga0496101_0207065 Ga0496101_0207065_356_1009 216
705 3300048904 Ga0496101_0321800 Ga0496101_0321800_115_768 216
706 3300048905 Ga0496102_0211670 Ga0496102_0211670_1119_1772 216
707 3300048905 Ga0496102_0242612 Ga0496102_0242612_449_1102 216
708 3300048905 Ga0496102_0697222 Ga0496102_0697222_214_897 216
709 3300048906 Ga0496103_0402072 Ga0496103_0402072_133_798 216
710 3300048907 Ga0496104_0005822 Ga0496104_0005822_1253_1906 216
711 3300048907 Ga0496104_0011101 Ga0496104_0011101_3623_4276 216
712 3300048908 Ga0496105_0003099 Ga0496105_0003099_9844_10497 216
713 3300048908 Ga0496105_0054260 Ga0496105_0054260_131_784 216
714 3300048908 Ga0496105_0253171 Ga0496105_0253171_669_1322 216
715 3300048909 Ga0496106_0138711 Ga0496106_0138711_1003_1656 216
716 3300048909 Ga0496106_0185592 Ga0496106_0185592_79_732 216
717 3300048909 Ga0496106_0270426 Ga0496106_0270426_596_1249 216
718 3300048910 Ga0496107_0146565 Ga0496107_0146565_460_1113 216
719 3300048910 Ga0496107_0165272 Ga0496107_0165272_36_689 216
720 3300048911 Ga0496108_0250980 Ga0496108_0250980_115_768 216
721 3300048912 Ga0496109_0248413 Ga0496109_0248413_162_815 216
722 3300048912 Ga0496109_0269180 Ga0496109_0269180_307_960 216
723 3300048912 Ga0496109_0308487 Ga0496109_0308487_313_966 216
724 3300048913 Ga0496110_0441495 Ga0496110_0441495_119_772 216
725 3300048914 Ga0496111_0297372 Ga0496111_0297372_310_963 216
726 3300048915 Ga0496112_0019263 Ga0496112_0019263_4320_4973 216
727 3300048915 Ga0496112_0326907 Ga0496112_0326907_690_1343 216
728 3300048915 Ga0496112_0642602 Ga0496112_0642602_54_707 216
729 3300048915 Ga0496112_0740408 Ga0496112_0740408_13_666 216
730 3300048916 Ga0496113_0043185 Ga0496113_0043185_1730_2383 216
731 3300048916 Ga0496113_0166803 Ga0496113_0166803_576_1229 216
732 3300048916 Ga0496113_0280913 Ga0496113_0280913_460_1113 216
733 3300048916 Ga0496113_0419413 Ga0496113_0419413_94_747 216
734 3300048917 Ga0496114_0336037 Ga0496114_0336037_376_1029 216
735 3300048917 Ga0496114_0405980 Ga0496114_0405980_379_1032 216
736 3300048918 Ga0496115_0086717 Ga0496115_0086717_1010_1672 216
737 3300048918 Ga0496115_0128957 Ga0496115_0128957_1248_1901 216
738 3300048919 Ga0496116_0018009 Ga0496116_0018009_3324_3977 216
739 3300048920 Ga0496117_0227648 Ga0496117_0227648_294_959 216
740 3300048921 Ga0496118_0057282 Ga0496118_0057282_122_805 216
741 3300048921 Ga0496118_0080360 Ga0496118_0080360_1421_2074 216
742 3300048921 Ga0496118_0155780 Ga0496118_0155780_26_679 216
743 3300048922 Ga0496119_0034548 Ga0496119_0034548_762_1415 216
744 3300048923 Ga0496120_0016795 Ga0496120_0016795_2903_3556 216
745 3300048923 Ga0496120_0034937 Ga0496120_0034937_2259_2912 216
746 3300048924 Ga0496121_0004242 Ga0496121_0004242_7605_8288 216
747 3300048924 Ga0496121_0008031 Ga0496121_0008031_8885_9538 216
748 3300048924 Ga0496121_0110562 Ga0496121_0110562_324_977 216
749 3300048924 Ga0496121_0125842 Ga0496121_0125842_550_1203 216
750 3300048924 Ga0496121_0127740 Ga0496121_0127740_1056_1709 216
751 3300048924 Ga0496121_0179749 Ga0496121_0179749_120_773 216
752 3300048924 Ga0496121_0250341 Ga0496121_0250341_366_1025 216
753 3300048924 Ga0496121_0435321 Ga0496121_0435321_69_722 216
754 3300048925 Ga0496122_0013833 Ga0496122_0013833_5043_5726 216
755 3300048925 Ga0496122_0306040 Ga0496122_0306040_117_770 216
756 3300048926 Ga0496123_0034164 Ga0496123_0034164_1400_2083 216
757 3300048927 Ga0496124_0002063 Ga0496124_0002063_15312_15995 216
758 3300048928 Ga0496125_0000040 Ga0496125_0000040_11496_12146 216
759 3300048928 Ga0496125_0084146 Ga0496125_0084146_948_1601 216
760 3300048928 Ga0496125_0090688 Ga0496125_0090688_156_809 216
761 3300048929 Ga0496126_0026298 Ga0496126_0026298_967_1620 216
762 3300048929 Ga0496126_0096800 Ga0496126_0096800_1241_1894 216
763 3300048929 Ga0496126_0156430 Ga0496126_0156430_359_1012 216
764 3300048929 Ga0496126_0181908 Ga0496126_0181908_121_771 216
765 3300048929 Ga0496126_0196249 Ga0496126_0196249_117_770 216
766 3300048929 Ga0496126_0389651 Ga0496126_0389651_100_753 216
767 3300049460 Ga0495682_0045902 Ga0495682_0045902_60_713 216
768 3300049569 Ga0501032_0165536 Ga0501032_0165536_224_877 216
769 3300049570 Ga0501033_0347509 Ga0501033_0347509_70_723 216
770 3300049574 Ga0501038_0257320 Ga0501038_0257320_171_824 216
771 3300049579 Ga0501043_0189980 Ga0501043_0189980_392_1045 216
772 3300049583 Ga0501067_0332997 Ga0501067_0332997_65_730 216
773 3300049585 Ga0501069_0294975 Ga0501069_0294975_95_760 216
774 3300049585 Ga0501069_0385451 Ga0501069_0385451_72_725 216
775 3300049585 Ga0501069_0427071 Ga0501069_0427071_38_727 216
776 3300049822 Ga0501035_0284353 Ga0501035_0284353_519_1172 216
777 3300049823 Ga0501044_0037527 Ga0501044_0037527_1608_2261 216
778 3300050490 nmdc:mga03n38_213128_c1 nmdc:mga03n38_213128_c1_164_817 216
779 3300050491 nmdc:mga00v17_541840_c1 nmdc:mga00v17_541840_c1_47_700 216
780 3300050492 nmdc:mga0yw44_3463_c1 nmdc:mga0yw44_3463_c1_5376_6029 216
781 3300050494 nmdc:mga06z11_185196_c1 nmdc:mga06z11_185196_c1_118_771 216
782 3300050495 nmdc:mga04h51_10509_c1 nmdc:mga04h51_10509_c1_56_709 216
783 3300050496 nmdc:mga07m45_174947_c1 nmdc:mga07m45_174947_c1_122_775 216
784 3300050516 nmdc:mga0sz30_81848_c1 nmdc:mga0sz30_81848_c1_333_986 216
785 3300053085 Ga0495619_0133043 Ga0495619_0133043_297_950 216
786 3300053087 Ga0500643_000456 Ga0500643_000456_11742_12395 216
787 3300053091 Ga0500647_0097491 Ga0500647_0097491_437_1090 216
788 3300053092 Ga0500583_0315902 Ga0500583_0315902_55_708 216
789 3300053094 Ga0500566_0001762 Ga0500566_0001762_8872_9525 216
790 3300053096 Ga0500641_0009742 Ga0500641_0009742_1091_1744 216
791 3300053098 Ga0500650_0060856 Ga0500650_0060856_461_1114 216
792 3300053103 Ga0500555_024001 Ga0500555_024001_983_1636 216
793 3300053105 Ga0500557_000003 Ga0500557_000003_15717_16370 216
794 3300053119 Ga0500595_010552 Ga0500595_010552_863_1516 216
795 3300053119 Ga0500595_012731 Ga0500595_012731_2084_2737 216
796 3300053130 Ga0500642_0000252 Ga0500642_0000252_10724_11377 216
797 3300053130 Ga0500642_0254996 Ga0500642_0254996_19_672 216
798 3300053136 Ga0500559_0067679 Ga0500559_0067679_733_1386 216
799 3300053139 Ga0500568_0079948 Ga0500568_0079948_100_753 216
800 3300053142 Ga0500577_0011877 Ga0500577_0011877_20_673 216
801 3300053142 Ga0500577_0073065 Ga0500577_0073065_61_711 216
802 3300053146 Ga0500588_0065868 Ga0500588_0065868_389_1042 216
803 3300053156 Ga0500622_0025979 Ga0500622_0025979_2035_2688 216
804 3300053177 Ga0500636_0188136 Ga0500636_0188136_198_851 216
805 3300053729 Ga0500625_024839 Ga0500625_024839_809_1462 216
806 3300053730 Ga0500645_044982 Ga0500645_044982_513_1166 216
807 3300060353 Ga0501082_0469461 Ga0501082_0469461_47_700 216
808 iso_pu_bacteria 2513237139 2513878508 216
809 iso_pu_bacteria 2617270735 2617346785 216
810 iso_pu_bacteria 2643221589 2643954258 216
811 iso_pu_bacteria 2643221602 2644023067 216
812 iso_pu_bacteria 2802429603 2805919068 216
813 iso_pu_bacteria 2808606445 2809214706 216
814 iso_pu_bacteria 2824671348 2824674134 216
815 iso_pu_bacteria 2824687955 2824691975 216
816 iso_pu_bacteria 2824696289 2824701129 216
817 iso_pu_bacteria 2824773399 2824775139 216
818 iso_pu_bacteria 2841941048 2841949288 216
819 iso_pu_bacteria 2847939898 2847947727 216
820 iso_pu_bacteria 2888419890 2888425568 216
821 iso_pu_bacteria 2904699407 2904701304 216
822 iso_pu_bacteria 8006984368 8006984414 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

21

216

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bkz-assembly1.cif.gz_A x-ray structure of e coli alkb crosslinked to dsdna in the active site 0.9817 17 215
4zhn-assembly1.cif.gz_A crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9812 18 215
4nii-assembly1.cif.gz_A crystal structure of alkb d135i mutant protein with cofactors bound to dsdna containing m6a/a 0.9805 16 214
2fdf-assembly1.cif.gz_A crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.98 18 216
3o1p-assembly1.cif.gz_A iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase 0.9783 16 215
ID Description Score Start End Superfamily
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9805 16 214 2.60.120.590
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9565 16 214 2.60.120.590
af_C6TKW1_99_311_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8858 16 214 2.60.120.590
af_A0A1Q0YC58_8_168_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8848 88 215 2.60.120.590
af_Q13686_178_346_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8817 95 215 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A386HVK5-F1-model_v4 AlkB 0.9994 146 214 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-W1YKM2-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9934 144 214 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-A0A537FMV5-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9912 15 121 GO:0051213
AF-A0A537DLG2-F1-model_v4 DNA oxidative demethylase AlkB (EC 1.14.11.33) 0.9904 15 216 GO:0005737
GO:0006281
GO:0008168
GO:0008198
GO:0032259
GO:0035513
GO:0035515
GO:0035516
AF-A0A0H3ATV7-F1-model_v4 Alkylated DNA repair protein AlkB 0.9898 18 216 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516

Feature Viewer

pLDDT pTM Quality
92.93 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map