F482302

General Info

Members Datasets Scaffolds Average Seq Length
822 608 1644 200

Family's Representative Sequence

Representative Sequence 3300013249|Ga0171463_1011|Ga0171463_10113
Length 244
Sequence MLGVIVSVWKQYVKYPLAYRVIVFPSYVDHRNANKGVPMNVLHIDSGILGDHSVSRRLTAALAAQVKADRPDATLTYRDLAASSLPHLTGAQIMAPADLASVDADLAADVKLGRDMLEEFLAADTIIIGAPMYNFGIPSQLKAWIDRIAVSGKTFRYTENGPEGLAKGKKIIVASTRGGHYSAGPAAVMDHQESYLKTVFGFLGVTDVEFVRAEGLNLSADSKQFAIAEAEKTIAEGNVLRLAS

Samples

Sample ID Description Type Environment
1 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
81 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
82 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
98 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
99 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
103 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
165 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
166 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
167 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
188 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
206 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
210 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
215 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
223 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
282 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
304 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
305 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
316 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
322 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
323 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
326 2506520008 Serratia plymuthica AS12 Isolate Unclassified
327 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
328 2509276019 Ensifer aridi TW10 Isolate Nodule
329 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
330 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
331 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
332 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
333 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
334 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
335 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
336 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
337 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
338 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
339 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
340 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
341 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
342 2516143018 Ensifer sp. BR816 Isolate Nodule
343 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
344 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
345 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
346 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
347 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
348 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
349 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
350 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
351 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
352 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
353 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
354 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
355 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
356 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
357 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
358 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
359 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
360 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
361 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
362 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
363 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
364 2643221557 Ensifer sp. Root558 Isolate Unclassified
365 2643221559 Lysobacter sp. Root559 Isolate Unclassified
366 2643221573 Lysobacter sp. Root604 Isolate Unclassified
367 2643221586 Lysobacter sp. Root667 Isolate Unclassified
368 2643221607 Rhizobium sp. Root73 Isolate Unclassified
369 2643221610 Ensifer sp. Root74 Isolate Unclassified
370 2643221612 Lysobacter sp. Root76 Isolate Unclassified
371 2643221618 Ensifer sp. Root231 Isolate Unclassified
372 2643221626 Ensifer sp. Root31 Isolate Unclassified
373 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
374 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
375 2643221655 Ensifer sp. Root1252 Isolate Unclassified
376 2643221659 Ensifer sp. Root127 Isolate Unclassified
377 2643221668 Ensifer sp. Root423 Isolate Unclassified
378 2643221675 Ensifer sp. Root1298 Isolate Unclassified
379 2643221680 Ensifer sp. Root1312 Isolate Unclassified
380 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
381 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
382 2643221695 Lysobacter sp. Root494 Isolate Unclassified
383 2643221698 Ensifer sp. Root142 Isolate Unclassified
384 2643221712 Ensifer sp. Root258 Isolate Unclassified
385 2643221718 Rhizobium sp. Root268 Isolate Unclassified
386 2643221720 Lysobacter sp. Root916 Isolate Unclassified
387 2643221723 Ensifer sp. Root278 Isolate Unclassified
388 2643221726 Ensifer sp. Root954 Isolate Unclassified
389 2643221727 Lysobacter sp. Root96 Isolate Unclassified
390 2643221728 Lysobacter sp. Root983 Isolate Unclassified
391 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
392 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
393 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
394 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
395 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
396 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
397 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
398 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
399 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
400 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
401 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
402 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
403 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
404 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
405 2818991435 Caulobacter henricii 536 Isolate Unclassified
406 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
407 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
408 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
409 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
410 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
411 2844163670 Ensifer sp. 1H6 Isolate Unclassified
412 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
413 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
414 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
415 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
416 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
417 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
418 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
419 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
420 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
421 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
422 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
423 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
424 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
425 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
426 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
427 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
428 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
429 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
430 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
431 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
432 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
433 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
434 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
435 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
436 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
437 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
438 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
439 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
440 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
441 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
442 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
443 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
444 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
445 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
446 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
447 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
448 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
449 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
450 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
451 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
452 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
453 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
454 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
455 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
456 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
457 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
458 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
459 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
460 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
461 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
462 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
463 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
464 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
465 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
466 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
467 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
468 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
469 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
470 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
471 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
472 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
473 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
474 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
475 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
476 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
477 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
478 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
479 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
480 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
481 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
482 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
483 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
484 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
485 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
486 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
487 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
488 2952252522 Salinicola sp. DM10 Isolate Unclassified
489 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
490 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
491 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
492 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
493 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
494 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
495 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
496 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
497 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
498 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
499 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
500 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
501 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
502 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
503 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
504 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
505 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
506 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
507 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
508 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
509 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
510 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
511 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
512 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
513 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
514 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
515 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
516 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
517 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
518 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
519 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
520 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
521 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
522 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
523 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
524 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
525 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
526 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
527 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
528 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
529 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
530 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
531 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
532 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
533 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
534 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
535 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
536 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
537 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
538 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
539 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
540 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
541 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
542 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
543 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
544 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
545 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
546 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
547 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
548 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
549 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
550 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
551 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
552 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
553 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
554 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
555 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
556 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
557 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
558 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
559 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
560 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
561 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
562 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
563 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
564 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
565 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
566 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
567 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
568 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
569 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
570 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
571 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
572 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
573 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
574 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
575 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
576 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
577 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
578 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
579 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
580 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
581 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
582 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
583 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
584 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
585 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
586 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
587 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
588 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
589 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
590 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
591 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
592 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
593 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
594 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
595 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
596 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
597 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
598 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
599 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
600 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
601 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
602 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
603 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
604 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
605 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
606 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
607 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
608 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.41
Metatranscriptomes 3.04
Isolates 34.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 11.68
Nodule 27.98
Rhizoplane 2.19
Rhizosphere 46.23
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0171463_1011 3300013249 Bacteria 230603
2 JGI24740J21852_10006610 3300001979 Bacteria 4782
3 JGI24739J22299_10000752 3300001989 Bacteria 11806
4 JGI24739J22299_10006754 3300001989 Bacteria 4321
5 JGI24737J22298_10000922 3300001990 Bacteria 10448
6 JGI24737J22298_10005905 3300001990 Bacteria 4214
7 JGI24735J21928_10007930 3300002067 Bacteria 3449
8 JGI24735J21928_10022450 3300002067 Bacteria 1921
9 JGI24738J21930_10024954 3300002075 Bacteria 1229
10 JGI25156J39149_1000221 3300002705 Bacteria 39594
11 JGI25152J39213_1000032 3300002773 Bacteria 96369
12 JGI25150J39212_1000527 3300002774 Bacteria 15593
13 JGI25159J45721_1000002 3300002987 Bacteria 289163
14 JGI25151J46595_10000138 3300003187 Bacteria 96369
15 JGI25151J46595_10028756 3300003187 Bacteria 2210
16 JGI25153J46596_10000102 3300003215 Bacteria 96369
17 JGI25153J46596_10018310 3300003215 Bacteria 2726
18 JGI25153J46596_10032110 3300003215 Bacteria 1756
19 JGI25153J46596_10069973 3300003215 Bacteria 912
20 rootH1_10035110 3300003316 Bacteria 5659
21 rootH2_10002373 3300003320 Bacteria 20932
22 JGI25160J50197_1000008 3300003354 Bacteria 289163
23 JGI25161J50226_1000986 3300003374 Bacteria 10033
24 Ga0006562J51391_1031491 3300003578 Bacteria 9285
25 Ga0006562J51391_1031501 3300003578 Bacteria 1630
26 Ga0006562J51391_1191774 3300003578 Bacteria 6298
27 Ga0006562J51391_1191777 3300003578 Bacteria 1290
28 Ga0055526_1000819 3300003771 Bacteria 23213
29 Ga0055526_1002661 3300003771 Bacteria 11927
30 Ga0055526_1002743 3300003771 Bacteria 11682
31 Ga0055537_1000660 3300003773 Bacteria 18167
32 Ga0055537_1001163 3300003773 Bacteria 11248
33 Ga0055524_1001683 3300003775 Bacteria 12306
34 Ga0055524_1006339 3300003775 Bacteria 5141
35 Ga0055524_1057305 3300003775 Bacteria 833
36 Ga0055536_1001156 3300003781 Bacteria 16517
37 Ga0055536_1004000 3300003781 Bacteria 7699
38 Ga0055534_1000182 3300003784 Bacteria 45916
39 Ga0055534_1001326 3300003784 Bacteria 9924
40 Ga0055528_1000674 3300003790 Bacteria 24747
41 Ga0055528_1000786 3300003790 Bacteria 22080
42 Ga0055528_1025129 3300003790 Bacteria 1761
43 Ga0055530_10003569 3300003791 Bacteria 8746
44 Ga0055531_10002418 3300003794 Bacteria 12508
45 Ga0055531_10009806 3300003794 Bacteria 4854
46 Ga0055531_10012568 3300003794 Bacteria 3972
47 Ga0055531_10016326 3300003794 Bacteria 3209
48 Ga0055531_10023909 3300003794 Bacteria 2273
49 Ga0058692_1000003 3300003856 Bacteria 435295
50 Ga0058692_1000012 3300003856 Bacteria 318930
51 Ga0055543_1000027 3300004625 Bacteria 136033
52 Ga0065165_1000015 3300005262 Bacteria 289201
53 Ga0065165_1000940 3300005262 Bacteria 37166
54 Ga0070658_10355726 3300005327 Bacteria 1254
55 Ga0070690_100156871 3300005330 Bacteria 1556
56 Ga0070670_100511419 3300005331 Bacteria 1069
57 Ga0068869_100688196 3300005334 Bacteria 871
58 Ga0070666_10119919 3300005335 Bacteria 1824
59 Ga0068868_101014093 3300005338 Bacteria 760
60 Ga0070661_100163785 3300005344 Bacteria 1685
61 Ga0070671_100079770 3300005355 Bacteria 2736
62 Ga0070659_100367458 3300005366 Bacteria 1210
63 Ga0070659_101054590 3300005366 Bacteria 715
64 Ga0070714_100012972 3300005435 Bacteria 6665
65 Ga0070708_100412806 3300005445 Bacteria 1273
66 Ga0070663_100002774 3300005455 Bacteria 9930
67 Ga0070678_100170409 3300005456 Bacteria 1773
68 Ga0070662_100697598 3300005457 Bacteria 859
69 Ga0070681_10070591 3300005458 Bacteria 3458
70 Ga0070681_10274162 3300005458 Bacteria 1598
71 Ga0070679_100476043 3300005530 Bacteria 1193
72 Ga0070684_100360347 3300005535 Bacteria 1338
73 Ga0068853_100699817 3300005539 Bacteria 966
74 Ga0070672_100167838 3300005543 Bacteria 1824
75 Ga0070672_100373441 3300005543 Bacteria 1219
76 Ga0068855_100003573 3300005563 Bacteria 19011
77 Ga0068855_100017222 3300005563 Bacteria 8696
78 Ga0068855_100369442 3300005563 Bacteria 1577
79 Ga0070664_100006172 3300005564 Bacteria 9685
80 Ga0070664_100427640 3300005564 Bacteria 1213
81 Ga0068857_100001801 3300005577 Bacteria 17237
82 Ga0068857_100027401 3300005577 Bacteria 5027
83 Ga0068857_100127576 3300005577 Bacteria 2293
84 Ga0068854_100000678 3300005578 Bacteria 20309
85 Ga0068854_100000774 3300005578 Bacteria 18996
86 Ga0068852_100014771 3300005616 Bacteria 6028
87 Ga0068852_100028619 3300005616 Bacteria 4565
88 Ga0068852_100278344 3300005616 Bacteria 1612
89 Ga0068859_100224339 3300005617 Bacteria 1967
90 Ga0068859_100474016 3300005617 Bacteria 1347
91 Ga0068864_100220523 3300005618 Bacteria 1749
92 Ga0068864_100664348 3300005618 Bacteria 1016
93 Ga0068866_10466280 3300005718 Bacteria 829
94 Ga0068851_10002910 3300005834 Bacteria 7561
95 Ga0068851_10006243 3300005834 Bacteria 5438
96 Ga0068863_100011742 3300005841 Bacteria 8471
97 Ga0068858_100044187 3300005842 Bacteria 4131
98 Ga0068858_100136017 3300005842 Bacteria 2306
99 Ga0068860_100614985 3300005843 Bacteria 1093
100 Ga0081539_10025328 3300005985 Bacteria 3824
101 Ga0075364_10435724 3300006051 Bacteria 895
102 Ga0075366_10557191 3300006195 Bacteria 710
103 Ga0075434_100779082 3300006871 Bacteria 973
104 Ga0068865_100730884 3300006881 Bacteria 848
105 Ga0097620_100224339 3300006931 Bacteria 1967
106 Ga0097620_100473971 3300006931 Bacteria 1347
107 Ga0079104_1001945 3300006946 Bacteria 12272
108 Ga0079104_1011685 3300006946 Bacteria 2806
109 Ga0075435_100218055 3300007076 Bacteria 1620
110 Ga0099794_10184493 3300007265 Bacteria 1065
111 Ga0105244_10018528 3300009036 Bacteria 3903
112 Ga0105250_10026630 3300009092 Bacteria 2330
113 Ga0105240_10001284 3300009093 Bacteria 43463
114 Ga0105240_10026572 3300009093 Bacteria 7596
115 Ga0105240_10294107 3300009093 Bacteria 1860
116 Ga0105243_10235343 3300009148 Bacteria 1627
117 Ga0105241_10273760 3300009174 Bacteria 1439
118 Ga0105242_10151602 3300009176 Bacteria 2021
119 Ga0105248_10040915 3300009177 Bacteria 5196
120 Ga0105237_10000079 3300009545 Bacteria 127925
121 Ga0105237_10000701 3300009545 Bacteria 46447
122 Ga0105238_10073961 3300009551 Bacteria 3401
123 Ga0105249_10273629 3300009553 Bacteria 1683
124 Ga0105239_10056632 3300010375 Bacteria 4300
125 Ga0105239_10076582 3300010375 Bacteria 3679
126 Ga0105239_10523854 3300010375 Bacteria 1349
127 Ga0157314_1000037 3300012500 Bacteria 13179
128 Ga0157314_1000390 3300012500 Bacteria 4428
129 Ga0157316_1000174 3300012510 Bacteria 3102
130 Ga0157327_1000422 3300012512 Bacteria 2256
131 Ga0157373_10068296 3300013100 Bacteria 2512
132 Ga0157371_10091945 3300013102 Bacteria 2149
133 Ga0157370_10001576 3300013104 Bacteria 28203
134 Ga0157370_10128117 3300013104 Bacteria 2368
135 Ga0157374_10081857 3300013296 Bacteria 3064
136 Ga0163162_10013446 3300013306 Bacteria 7989
137 Ga0163162_10095314 3300013306 Bacteria 3062
138 Ga0163162_11268249 3300013306 Bacteria 837
139 Ga0157372_10140172 3300013307 Bacteria 2785
140 Ga0157375_10060937 3300013308 Bacteria 3744
141 Ga0157375_10091255 3300013308 Bacteria 3107
142 Ga0182008_10322368 3300014497 Bacteria 813
143 Ga0157379_10914015 3300014968 Bacteria 833
144 Ga0157376_10256861 3300014969 Bacteria 1635
145 Ga0182006_1084360 3300015261 Bacteria 1154
146 Ga0183363_1362 3300015690 Bacteria 4965
147 Ga0163161_10217070 3300017792 Bacteria 1480
148 Ga0163161_10285596 3300017792 Bacteria 1295
149 Ga0163161_10373464 3300017792 Bacteria 1138
150 Ga0206352_10984173 3300020078 Bacteria 1434
151 Ga0214544_1022053 3300021320 Bacteria 3963
152 Ga0214542_1000006 3300021321 Bacteria 345164
153 Ga0214542_1019489 3300021321 Bacteria 5319
154 Ga0214543_1000014 3300021327 Bacteria 324986
155 Ga0214543_1022635 3300021327 Bacteria 4398
156 Ga0213872_10023121 3300021361 Bacteria 2860
157 Ga0224712_10040276 3300022467 Bacteria 1757
158 Ga0228711_1000015 3300022739 Bacteria 126974
159 Ga0228710_1000015 3300022740 Bacteria 133640
160 Ga0209436_105166 3300025208 Bacteria 3052
161 Ga0209674_100157 3300025226 Bacteria 91077
162 Ga0207425_1000078 3300025245 Bacteria 104429
163 Ga0207425_1006994 3300025245 Bacteria 3030
164 Ga0209759_1000363 3300025256 Bacteria 57937
165 Ga0209759_1028209 3300025256 Bacteria 1146
166 Ga0209129_1000157 3300025258 Bacteria 105043
167 Ga0209129_1002581 3300025258 Bacteria 8700
168 Ga0209565_1000168 3300025263 Bacteria 85042
169 Ga0209565_1000202 3300025263 Bacteria 70900
170 Ga0209673_1000007 3300025273 Bacteria 634477
171 Ga0209673_1000087 3300025273 Bacteria 205213
172 Ga0209673_1000759 3300025273 Bacteria 43996
173 Ga0209130_1000007 3300025284 Bacteria 591584
174 Ga0209675_1000039 3300025291 Bacteria 247966
175 Ga0209675_1000453 3300025291 Bacteria 31674
176 Ga0209675_1005313 3300025291 Bacteria 5425
177 Ga0209676_1000011 3300025292 Bacteria 860463
178 Ga0209676_1001917 3300025292 Bacteria 16836
179 Ga0209676_1013007 3300025292 Bacteria 3226
180 Ga0209025_1000054 3300025294 Bacteria 317002
181 Ga0209025_1000303 3300025294 Bacteria 110086
182 Ga0209025_1000361 3300025294 Bacteria 97060
183 Ga0209025_1002031 3300025294 Bacteria 23103
184 Ga0209025_1025420 3300025294 Bacteria 3015
185 Ga0209025_1048955 3300025294 Bacteria 1707
186 Ga0209564_1000203 3300025295 Bacteria 136358
187 Ga0209564_1000296 3300025295 Bacteria 100151
188 Ga0209564_1000759 3300025295 Bacteria 45552
189 Ga0209564_1028231 3300025295 Bacteria 1800
190 Ga0209758_1000062 3300025297 Bacteria 317002
191 Ga0209758_1000315 3300025297 Bacteria 93638
192 Ga0209758_1002680 3300025297 Bacteria 17566
193 Ga0209758_1002818 3300025297 Bacteria 16919
194 Ga0209758_1027147 3300025297 Bacteria 2455
195 Ga0209050_1000251 3300025298 Bacteria 115647
196 Ga0209050_1002665 3300025298 Bacteria 14590
197 Ga0209050_1019538 3300025298 Bacteria 2567
198 Ga0209256_1000415 3300025299 Bacteria 66999
199 Ga0209256_1003048 3300025299 Bacteria 12347
200 Ga0209256_1006077 3300025299 Bacteria 6571
201 Ga0209256_1012181 3300025299 Bacteria 3330
202 Ga0207426_1000064 3300025302 Bacteria 358276
203 Ga0209051_1003625 3300025303 Bacteria 10010
204 Ga0209051_1009318 3300025303 Bacteria 5072
205 Ga0209257_1000014 3300025304 Bacteria 946850
206 Ga0209257_1000080 3300025304 Bacteria 312038
207 Ga0209257_1000170 3300025304 Bacteria 169384
208 Ga0209257_1000430 3300025304 Bacteria 80826
209 Ga0209257_1000817 3300025304 Bacteria 45150
210 Ga0209257_1042247 3300025304 Bacteria 1346
211 Ga0207656_10001594 3300025321 Bacteria 7545
212 Ga0207656_10004205 3300025321 Bacteria 5010
213 Ga0207696_1006475 3300025711 Bacteria 4715
214 Ga0207655_1001054 3300025728 Bacteria 27546
215 Ga0207688_10398758 3300025901 Bacteria 853
216 Ga0207680_10506422 3300025903 Bacteria 860
217 Ga0207647_10000634 3300025904 Bacteria 27396
218 Ga0207647_10004577 3300025904 Bacteria 10246
219 Ga0207685_10256908 3300025905 Bacteria 847
220 Ga0207707_10051481 3300025912 Bacteria 3586
221 Ga0207695_10000401 3300025913 Bacteria 96946
222 Ga0207695_10000541 3300025913 Bacteria 78696
223 Ga0207695_10004041 3300025913 Bacteria 20186
224 Ga0207695_10052537 3300025913 Bacteria 4268
225 Ga0207671_10000009 3300025914 Bacteria 724862
226 Ga0207671_10000050 3300025914 Bacteria 190479
227 Ga0207649_10138984 3300025920 Bacteria 1659
228 Ga0207694_10237921 3300025924 Bacteria 1488
229 Ga0207650_10431580 3300025925 Bacteria 1094
230 Ga0207650_10567289 3300025925 Bacteria 952
231 Ga0207659_10088571 3300025926 Bacteria 2306
232 Ga0207664_11088247 3300025929 Bacteria 715
233 Ga0207644_10010380 3300025931 Bacteria 6138
234 Ga0207644_10268234 3300025931 Bacteria 1367
235 Ga0207690_10947747 3300025932 Bacteria 715
236 Ga0207669_10036237 3300025937 Bacteria 2817
237 Ga0207665_10516838 3300025939 Bacteria 924
238 Ga0207691_10067682 3300025940 Bacteria 3229
239 Ga0207711_10181626 3300025941 Bacteria 1913
240 Ga0207679_10110911 3300025945 Bacteria 2165
241 Ga0207667_10000031 3300025949 Bacteria 323587
242 Ga0207667_10000125 3300025949 Bacteria 118155
243 Ga0207667_10000261 3300025949 Bacteria 73194
244 Ga0207667_10244031 3300025949 Bacteria 1838
245 Ga0207651_10179142 3300025960 Bacteria 1680
246 Ga0207668_10114636 3300025972 Bacteria 2029
247 Ga0207640_10000082 3300025981 Bacteria 74895
248 Ga0207640_10000146 3300025981 Bacteria 51504
249 Ga0207703_10031623 3300026035 Bacteria 4186
250 Ga0207678_10057513 3300026067 Bacteria 3346
251 Ga0207702_10850388 3300026078 Bacteria 903
252 Ga0207641_10077387 3300026088 Bacteria 2878
253 Ga0207641_10424266 3300026088 Bacteria 1281
254 Ga0207648_10013177 3300026089 Bacteria 7704
255 Ga0207676_10101011 3300026095 Bacteria 2391
256 Ga0207676_10299404 3300026095 Bacteria 1468
257 Ga0207674_10000551 3300026116 Bacteria 49136
258 Ga0207674_10004296 3300026116 Bacteria 17186
259 Ga0207674_10145508 3300026116 Bacteria 2328
260 Ga0207698_10001335 3300026142 Bacteria 14394
261 Ga0207698_10019042 3300026142 Bacteria 4690
262 Ga0207698_10248926 3300026142 Bacteria 1625
263 Ga0209281_1000339 3300027111 Bacteria 79862
264 Ga0209281_1001295 3300027111 Bacteria 16021
265 Ga0209371_1000006 3300027312 Bacteria 1055642
266 Ga0209371_1000007 3300027312 Bacteria 1050654
267 Ga0209282_1000054 3300027666 Bacteria 101427
268 Ga0268264_10407356 3300028381 Bacteria 1308
269 Ga0265318_10003237 3300028577 Bacteria 8297
270 Ga0307515_10001636 3300028794 Bacteria 49786
271 Ga0307515_10107545 3300028794 Bacteria 3296
272 Ga0268256_1000007 3300030500 Bacteria 1055326
273 Ga0268256_1000008 3300030500 Bacteria 1050654
274 Ga0307512_10106853 3300030522 Bacteria 1865
275 Ga0314311_1085598 3300030733 Bacteria 1109
276 Ga0316178_1137231 3300030735 Bacteria 1448
277 Ga0316183_1059573 3300030742 Bacteria 6971
278 Ga0316182_1096769 3300030745 Bacteria 1625
279 Ga0265332_10028866 3300031238 Bacteria 2427
280 Ga0265332_10109620 3300031238 Bacteria 1163
281 Ga0265328_10025394 3300031239 Bacteria 2232
282 Ga0265320_10040709 3300031240 Bacteria 2315
283 Ga0265325_10104839 3300031241 Bacteria 1380
284 Ga0265331_10008340 3300031250 Bacteria 5900
285 Ga0265331_10013013 3300031250 Bacteria 4484
286 Ga0307513_10006680 3300031456 Bacteria 15048
287 Ga0307509_10002009 3300031507 Bacteria 33629
288 Ga0307408_100072916 3300031548 Bacteria 2543
289 Ga0307408_100432676 3300031548 Bacteria 1137
290 Ga0307408_101010031 3300031548 Bacteria 767
291 Ga0307408_101185170 3300031548 Bacteria 712
292 Ga0265313_10000507 3300031595 Bacteria 40900
293 Ga0265313_10000855 3300031595 Bacteria 30693
294 Ga0307508_10040330 3300031616 Bacteria 4191
295 Ga0307405_10107988 3300031731 Bacteria 1880
296 Ga0307413_10008456 3300031824 Bacteria 4861
297 Ga0307413_10740951 3300031824 Bacteria 820
298 Ga0307412_10176925 3300031911 Bacteria 1601
299 Ga0315914_1000013 3300031967 Bacteria 133640
300 Ga0307414_10008498 3300032004 Bacteria 5826
301 Ga0307414_10042683 3300032004 Bacteria 3083
302 Ga0307414_10072273 3300032004 Bacteria 2491
303 Ga0307414_10314906 3300032004 Bacteria 1329
304 Ga0307411_10139978 3300032005 Bacteria 1783
305 Ga0307411_10332657 3300032005 Bacteria 1231
306 Ga0307411_10512023 3300032005 Bacteria 1017
307 Ga0307415_100619600 3300032126 Bacteria 966
308 Ga0307507_10409017 3300033179 Bacteria 767
309 Ga0307510_10056070 3300033180 Bacteria 4108
310 Ga0307510_10190918 3300033180 Bacteria 1596
311 Ga0315913_1000097 3300033430 Bacteria 51051
312 Ga0315915_1000001 3300033464 Bacteria 481518
313 Ga0373934_0115865 3300035086 Bacteria 1089
314 Ga0373954_0127432 3300035118 Bacteria 1238
315 Ga0373956_0152733 3300035119 Bacteria 1087
316 Ga0373955_0029130 3300035172 Bacteria 2869
317 Ga0373937_0250448 3300036401 Bacteria 1670
318 Ga0395899_0005603 3300037312 Bacteria 9740
319 Ga0395899_0029844 3300037312 Bacteria 4102
320 Ga0395899_0033855 3300037312 Bacteria 3837
321 Ga0395899_0055243 3300037312 Bacteria 2938
322 Ga0395899_0382442 3300037312 Bacteria 935
323 Ga0395900_0008177 3300037418 Bacteria 10766
324 Ga0395900_0046088 3300037418 Bacteria 4490
325 Ga0395900_0360350 3300037418 Bacteria 1425
326 Ga0395898_0018824 3300037466 Bacteria 7035
327 Ga0395898_0051323 3300037466 Bacteria 4034
328 Ga0395898_0056357 3300037466 Bacteria 3830
329 Ga0395905_0132793 3300037471 Bacteria 2341
330 Ga0395901_0005878 3300038443 Bacteria 12416
331 Ga0395901_0300432 3300038443 Bacteria 1664
332 Ga0237819_00016 3300038705 Bacteria 57788
333 Ga0436365_1882660 3300039437 Bacteria 2569
334 Ga0436360_1249712 3300039438 Bacteria 1953
335 Ga0436361_0007789 3300039447 Bacteria 677
336 Ga0436361_0554014 3300039447 Bacteria 63849
337 Ga0436361_0801329 3300039447 Bacteria 1270
338 Ga0439436_0003109 3300041404 Bacteria 5034
339 Ga0439436_0007456 3300041404 Bacteria 3365
340 Ga0439436_0024629 3300041404 Bacteria 1775
341 Ga0439436_0026519 3300041404 Bacteria 1698
342 Ga0439439_0037901 3300041406 Bacteria 1243
343 Ga0439447_029959 3300041407 Bacteria 1374
344 Ga0439461_0037576 3300041410 Bacteria 1035
345 Ga0439466_0069093 3300041411 Bacteria 1127
346 Ga0439465_0000085 3300041413 Bacteria 20674
347 Ga0439465_0001079 3300041413 Bacteria 8729
348 Ga0439465_0008456 3300041413 Bacteria 3249
349 Ga0439465_0056853 3300041413 Bacteria 1290
350 Ga0451789_0692276 3300041443 Bacteria 1066
351 Ga0451791_0682317 3300041451 Bacteria 1882
352 Ga0451793_1307728 3300041452 Bacteria 1089
353 Ga0451802_0265798 3300041460 Bacteria 1172
354 Ga0451807_2045622 3300041486 Bacteria 2011
355 Ga0451837_0327149 3300041494 Bacteria 1051
356 Ga0451841_1287956 3300041498 Bacteria 1076
357 Ga0451843_0971899 3300041509 Bacteria 1474
358 Ga0451843_1337025 3300041509 Bacteria 880
359 Ga0439433_0033602 3300041999 Bacteria 1179
360 Ga0439445_0001227 3300042004 Bacteria 5543
361 Ga0439445_0052637 3300042004 Bacteria 1102
362 Ga0439432_003800 3300042006 Bacteria 5574
363 Ga0439432_037292 3300042006 Bacteria 1552
364 Ga0439432_080413 3300042006 Bacteria 987
365 Ga0439449_0000553 3300042007 Bacteria 14039
366 Ga0439449_0003112 3300042007 Bacteria 6464
367 Ga0439449_0009113 3300042007 Bacteria 3762
368 Ga0439449_0025712 3300042007 Bacteria 2199
369 Ga0439449_0031339 3300042007 Bacteria 1982
370 Ga0439449_0100272 3300042007 Bacteria 1070
371 Ga0439457_024272 3300042014 Bacteria 1342
372 Ga0450920_016369 3300042122 Bacteria 1413
373 Ga0450918_010043 3300042531 Bacteria 1653
374 Ga0466972_0002873 3300044658 Bacteria 8521
375 Ga0466965_0006935 3300044683 Bacteria 5184
376 Ga0466963_0366045 3300044694 Bacteria 1016
377 Ga0466964_0006875 3300044706 Bacteria 4248
378 Ga0466964_0175917 3300044706 Bacteria 1011
379 Ga0466968_0006143 3300044735 Bacteria 4514
380 Ga0466960_0257232 3300044901 Bacteria 972
381 Ga0495638_0000411 3300046460 Bacteria 52379
382 Ga0495638_0012752 3300046460 Bacteria 5744
383 Ga0495638_0152693 3300046460 Bacteria 1338
384 Ga0495651_0193814 3300046462 Bacteria 1428
385 Ga0495583_0000001 3300046506 Bacteria 811973
386 Ga0495583_0088420 3300046506 Bacteria 1337
387 Ga0495610_0053429 3300046512 Bacteria 1957
388 Ga0495616_0001142 3300046513 Bacteria 18769
389 Ga0495631_0153331 3300046518 Bacteria 989
390 Ga0495632_0002173 3300046519 Bacteria 15138
391 Ga0495632_0006556 3300046519 Bacteria 7460
392 Ga0495643_0002163 3300046522 Bacteria 16117
393 Ga0495643_0340874 3300046522 Bacteria 673
394 Ga0495648_0227243 3300046524 Bacteria 916
395 Ga0495663_0001305 3300046525 Bacteria 7899
396 Ga0495663_0048009 3300046525 Bacteria 1315
397 Ga0495663_0196091 3300046525 Bacteria 703
398 Ga0495652_0095919 3300046529 Bacteria 2416
399 Ga0495621_0038143 3300046539 Bacteria 1675
400 Ga0495597_0173503 3300046542 Bacteria 874
401 Ga0495633_0007146 3300046558 Bacteria 6478
402 Ga0495633_0155586 3300046558 Bacteria 1055
403 Ga0495656_0014644 3300046615 Bacteria 2945
404 Ga0495656_0014718 3300046615 Bacteria 2938
405 Ga0495656_0017587 3300046615 Bacteria 2730
406 Ga0495668_0042550 3300046616 Bacteria 2529
407 Ga0495668_0396350 3300046616 Bacteria 758
408 Ga0495625_0040566 3300046660 Bacteria 3393
409 Ga0495625_0119831 3300046660 Bacteria 1792
410 Ga0495659_0195783 3300046664 Bacteria 827
411 Ga0495588_0045855 3300046674 Bacteria 2242
412 Ga0495649_0000223 3300046694 Bacteria 49772
413 Ga0495660_0006325 3300046810 Bacteria 7021
414 Ga0495660_0061155 3300046810 Bacteria 2021
415 Ga0495636_0000021 3300047318 Bacteria 72964
416 Ga0495636_0008699 3300047318 Bacteria 4002
417 Ga0495636_0070226 3300047318 Bacteria 1493
418 Ga0495636_0093664 3300047318 Bacteria 1307
419 Ga0495672_0000173 3300047320 Bacteria 93630
420 Ga0495687_102345 3300047443 Bacteria 1071
421 Ga0495675_0130004 3300047444 Bacteria 1566
422 Ga0495673_0005478 3300047469 Bacteria 7665
423 Ga0495686_0058598 3300047472 Bacteria 2400
424 Ga0495686_0182915 3300047472 Bacteria 1213
425 Ga0495686_0440005 3300047472 Bacteria 694
426 Ga0495602_0286997 3300048088 Bacteria 1210
427 Ga0496101_0560520 3300048904 Bacteria 903
428 Ga0496105_0275843 3300048908 Bacteria 1357
429 Ga0496106_0324102 3300048909 Bacteria 1237
430 Ga0496108_0342942 3300048911 Bacteria 1303
431 Ga0496108_0606691 3300048911 Bacteria 953
432 Ga0496109_0189585 3300048912 Bacteria 1932
433 Ga0496109_0858648 3300048912 Bacteria 845
434 Ga0496109_1093982 3300048912 Bacteria 734
435 Ga0496110_0553869 3300048913 Bacteria 1045
436 Ga0496113_0084486 3300048916 Bacteria 2437
437 Ga0496114_0080963 3300048917 Bacteria 2743
438 Ga0496115_0000138 3300048918 Bacteria 66964
439 Ga0496116_0024192 3300048919 Bacteria 4498
440 Ga0496117_0012593 3300048920 Bacteria 7441
441 Ga0496117_0154578 3300048920 Bacteria 1352
442 Ga0496118_0005747 3300048921 Bacteria 13953
443 Ga0496118_0091705 3300048921 Bacteria 2088
444 Ga0496121_0007287 3300048924 Bacteria 13384
445 Ga0496121_0148364 3300048924 Bacteria 1729
446 Ga0496122_0006681 3300048925 Bacteria 13137
447 Ga0496122_0299300 3300048925 Bacteria 868
448 Ga0496123_0002214 3300048926 Bacteria 24685
449 Ga0496123_0144246 3300048926 Bacteria 1296
450 Ga0496123_0228430 3300048926 Bacteria 933
451 Ga0496124_0018773 3300048927 Bacteria 6461
452 Ga0496124_0023642 3300048927 Bacteria 5606
453 Ga0496124_0143226 3300048927 Bacteria 1884
454 Ga0496124_0428988 3300048927 Bacteria 908
455 Ga0496125_0000752 3300048928 Bacteria 53483
456 Ga0496125_0000795 3300048928 Bacteria 51440
457 Ga0496125_0006026 3300048928 Bacteria 13260
458 Ga0496125_0088047 3300048928 Bacteria 2342
459 Ga0496126_0000132 3300048929 Bacteria 172325
460 Ga0496126_0002949 3300048929 Bacteria 22105
461 Ga0496126_0026256 3300048929 Bacteria 5587
462 Ga0501306_020338 3300049127 Bacteria 922
463 Ga0501306_055023 3300049127 Bacteria 646
464 Ga0501309_055277 3300049129 Bacteria 630
465 Ga0501310_032951 3300049130 Bacteria 695
466 Ga0501305_034533 3300049161 Bacteria 802
467 Ga0501307_028555 3300049162 Bacteria 763
468 Ga0501307_035106 3300049162 Bacteria 711
469 Ga0501290_049902 3300049513 Bacteria 649
470 Ga0501312_028398 3300049528 Bacteria 867
471 Ga0501315_020532 3300049531 Bacteria 887
472 Ga0501315_051102 3300049531 Bacteria 649
473 Ga0501316_025119 3300049532 Bacteria 773
474 Ga0501316_027639 3300049532 Bacteria 747
475 Ga0501320_032744 3300049536 Bacteria 653
476 Ga0501321_011836 3300049537 Bacteria 979
477 Ga0501321_041788 3300049537 Bacteria 647
478 Ga0501323_013530 3300049539 Bacteria 1010
479 Ga0501324_024766 3300049540 Bacteria 630
480 Ga0501031_0079334 3300049568 Bacteria 2139
481 Ga0501031_0165520 3300049568 Bacteria 1445
482 Ga0501032_0018380 3300049569 Bacteria 4898
483 Ga0501033_0007277 3300049570 Bacteria 8632
484 Ga0501033_0008613 3300049570 Bacteria 7894
485 Ga0501033_0102869 3300049570 Bacteria 2083
486 Ga0501034_0270576 3300049571 Bacteria 1640
487 Ga0501034_0283513 3300049571 Bacteria 1596
488 Ga0501034_0679912 3300049571 Bacteria 929
489 Ga0501036_0100034 3300049572 Bacteria 2452
490 Ga0501037_0091261 3300049573 Bacteria 2203
491 Ga0501038_0059254 3300049574 Bacteria 3280
492 Ga0501038_0070689 3300049574 Bacteria 2962
493 Ga0501046_0176434 3300049580 Bacteria 1600
494 Ga0501046_0314613 3300049580 Bacteria 1141
495 Ga0501047_0004607 3300049581 Bacteria 12970
496 Ga0501047_0012276 3300049581 Bacteria 8107
497 Ga0501047_0102105 3300049581 Bacteria 2747
498 Ga0501069_0147557 3300049585 Bacteria 1350
499 Ga0501070_0153893 3300049586 Bacteria 1897
500 Ga0501071_0003118 3300049587 Bacteria 10292
501 Ga0501073_0002137 3300049589 Bacteria 14793
502 Ga0501073_0050324 3300049589 Bacteria 2920
503 Ga0501074_0057199 3300049590 Bacteria 2809
504 Ga0501223_023579 3300049663 Bacteria 1199
505 Ga0501249_041515 3300049679 Bacteria 1044
506 Ga0501225_0006494 3300049705 Bacteria 3414
507 Ga0501080_0123293 3300049742 Bacteria 2401
508 Ga0501080_0168262 3300049742 Bacteria 2022
509 Ga0501262_010710 3300049759 Bacteria 1151
510 Ga0501035_0078981 3300049822 Bacteria 2906
511 Ga0501035_0105712 3300049822 Bacteria 2468
512 Ga0501035_0124113 3300049822 Bacteria 2255
513 Ga0501035_0157631 3300049822 Bacteria 1966
514 Ga0501035_0414043 3300049822 Bacteria 1119
515 Ga0501044_0005142 3300049823 Bacteria 14593
516 Ga0501044_0085287 3300049823 Bacteria 3191
517 Ga0501044_0095727 3300049823 Bacteria 2992
518 Ga0501044_0151966 3300049823 Bacteria 2297
519 Ga0501044_0389527 3300049823 Bacteria 1307
520 Ga0501044_0600441 3300049823 Bacteria 994
521 nmdc:mga0n895_113061_c1 3300050512 Bacteria 2732
522 nmdc:mga0rr50_86518_c1 3300050513 Unclassified 2431
523 nmdc:mga08x19_165391_c1 3300050514 Bacteria 1504
524 nmdc:mga08x19_382261_c1 3300050514 Bacteria 986
525 Ga0495612_0051054 3300053078 Bacteria 1699
526 Ga0495619_0159951 3300053085 Bacteria 1555
527 Ga0500583_0084864 3300053092 Bacteria 1535
528 Ga0500583_0252094 3300053092 Bacteria 871
529 Ga0500594_0058502 3300053118 Bacteria 1105
530 Ga0500658_0000980 3300053134 Bacteria 11652
531 Ga0500604_0068333 3300053151 Bacteria 1129
532 Ga0500616_0098489 3300053153 Bacteria 1434
533 Ga0500622_0000011 3300053156 Bacteria 386096
534 Ga0500622_0121856 3300053156 Bacteria 1264
535 Ga0500645_035073 3300053730 Bacteria 1495
536 Ga0500609_001029 3300053731 Bacteria 4182
537 Ga0587067_124780 3300059640 Bacteria 622
538 Ga0587111_0056463 3300060346 Bacteria 881
539 2506578410 2506520007 Bacteria 5442880
540 2506583548 2506520008 Bacteria 5443009
541 2509108781 2508501122 Bacteria 6292184
542 2509374239 2509276019 Bacteria 6802256
543 2510307361 2510065057 Bacteria 6649661
544 2511501232 2511231052 Bacteria 6974333
545 2512532659 2512047086 Bacteria 6850303
546 2512972011 2512875026 Bacteria 6861065
547 2513587112 2513237086 Bacteria 7265287
548 2513604680 2513237089 Bacteria 6553624
549 2513616386 2513237091 Bacteria 6900273
550 2513880892 2513237140 Bacteria 7076289
551 2513907427 2513237143 Bacteria 6664116
552 2513987318 2513237156 Bacteria 6402557
553 2514000969 2513237159 Bacteria 6810126
554 2514007334 2513237160 Bacteria 6650282
555 2515608406 2515154107 Bacteria 6795637
556 2516209113 2516143018 Bacteria 6951533
557 2516892515 2516653046 Bacteria 6989037
558 2517569328 2517487022 Bacteria 7227575
559 2524450932 2524023207 Bacteria 6813453
560 2551675549 2551306084 Bacteria 8942552
561 2551689258 2551306085 Bacteria 7347181
562 2551694322 2551306086 Bacteria 6843938
563 2551699721 2551306087 Bacteria 7351905
564 2551712785 2551306089 Bacteria 7162724
565 2551722350 2551306090 Bacteria 7953713
566 2551728634 2551306091 Bacteria 7086830
567 2551734563 2551306092 Bacteria 6992595
568 2551742238 2551306093 Bacteria 7064773
569 2558863265 2558860100 Bacteria 8458965
570 2572254040 2571042365 Bacteria 3289345
571 2585150684 2582581280 Bacteria 5994497
572 2585165842 2582581283 Bacteria 6030556
573 2585198201 2582581293 Bacteria 5907401
574 2585269484 2582581306 Bacteria 6450535
575 2585390946 2582581865 Bacteria 6644329
576 2585393024 2582581866 Bacteria 6859583
577 2600192193 2599185352 Bacteria 7228948
578 2643806961 2643221557 Bacteria 7184309
579 2643815159 2643221559 Bacteria 4424915
580 2643879197 2643221573 Bacteria 4784121
581 2643938046 2643221586 Bacteria 4446529
582 2644048183 2643221607 Bacteria 6314006
583 2644067282 2643221610 Bacteria 7480339
584 2644076895 2643221612 Bacteria 4361984
585 2644108771 2643221618 Bacteria 7717186
586 2644151292 2643221626 Bacteria 8069654
587 2644200681 2643221636 Bacteria 6583769
588 2644206033 2643221637 Bacteria 5345260
589 2644311427 2643221655 Bacteria 7722067
590 2644329685 2643221659 Bacteria 7890716
591 2644378329 2643221668 Bacteria 7306521
592 2644420912 2643221675 Bacteria 7473456
593 2644454436 2643221680 Bacteria 7473610
594 2644485160 2643221686 Bacteria 6310811
595 2644502176 2643221689 Bacteria 6042950
596 2644529220 2643221695 Bacteria 3441323
597 2644546359 2643221698 Bacteria 7756764
598 2644617226 2643221712 Bacteria 7729434
599 2644649680 2643221718 Bacteria 5345506
600 2644660497 2643221720 Bacteria 4694283
601 2644675341 2643221723 Bacteria 7095460
602 2644689774 2643221726 Bacteria 7455827
603 2644695210 2643221727 Bacteria 4415595
604 2644697856 2643221728 Bacteria 4797149
605 2657683049 2657244999 Bacteria 5946535
606 2692316570 2690316117 Bacteria 6800650
607 2792584409 2791355082 Bacteria 5973319
608 2792622463 2791355091 Bacteria 6135441
609 2792628618 2791355092 Bacteria 6248105
610 2792642794 2791355094 Bacteria 7011481
611 2802719341 2802428858 Bacteria 6636079
612 2802723098 2802428859 Bacteria 6667919
613 2802732541 2802428860 Bacteria 6525526
614 2802738460 2802428861 Bacteria 6534206
615 2802745084 2802428862 Bacteria 6633353
616 2802751519 2802428863 Bacteria 6410669
617 2804751562 2802429268 Bacteria 6094027
618 2816517640 2816332141 Bacteria 4436036
619 2819539638 2818991435 Bacteria 5433759
620 2819647013 2818991454 Bacteria 5563326
621 2838076659 2838074704 Bacteria 6785777
622 2842391824 2842391507 Bacteria 4486072
623 2842526107 2842521101 Bacteria 6569494
624 2842758257 2842757796 Bacteria 3981385
625 2844168281 2844163670 Bacteria 7266046
626 2847418362 2847417321 Bacteria 6913799
627 2848993343 2848992105 Bacteria 6810864
628 2850080702 2850079185 Bacteria 6848280
629 2855831585 2855825444 Bacteria 6785811
630 2855840703 2855839649 Bacteria 7135830
631 2855878622 2855872281 Bacteria 6964271
632 2858801231 2858800743 Bacteria 6603254
633 2891377291 2891373044 Bacteria 5202277
634 2895500682 2895498888 Bacteria 5283788
635 2895516448 2895511927 Bacteria 6802080
636 2895523632 2895522137 Bacteria 3284416
637 2895526786 2895525241 Bacteria 3388457
638 2896386853 2896384573 Bacteria 7700774
639 2913301815 2913295892 Bacteria 6333755
640 2915985706 2915980308 Bacteria 6624279
641 2915991763 2915986958 Bacteria 6739310
642 2915995792 2915993759 Bacteria 7016183
643 2916002666 2916000859 Bacteria 6865702
644 2916009852 2916007675 Bacteria 6898660
645 2916018814 2916014648 Bacteria 6946486
646 2916022443 2916021584 Bacteria 6854472
647 2916031833 2916028427 Bacteria 6748433
648 2916040609 2916035215 Bacteria 6755766
649 2916046645 2916041962 Bacteria 6820487
650 2916052701 2916048683 Bacteria 6543552
651 2916055103 2916055098 Bacteria 6758838
652 2916065852 2916061851 Bacteria 6737736
653 2916069539 2916068649 Bacteria 6943657
654 2916078707 2916076590 Bacteria 6596108
655 2920765439 2920760137 Bacteria 7427611
656 2920824069 2920822456 Bacteria 6897201
657 2921205128 2921201388 Bacteria 6926299
658 2921210040 2921208531 Bacteria 6745326
659 2921242289 2921237296 Bacteria 6876710
660 2921248033 2921244191 Bacteria 6568419
661 2921251622 2921250672 Bacteria 6677771
662 2921260817 2921257292 Bacteria 6808382
663 2921263979 2921263974 Bacteria 6864552
664 2921285948 2921282425 Bacteria 6826397
665 2921292118 2921289301 Bacteria 7316391
666 2921299864 2921296804 Bacteria 7176999
667 2924147627 2924144063 Bacteria 6883928
668 2924155035 2924150972 Bacteria 7169444
669 2924165010 2924158325 Bacteria 7188855
670 2924168026 2924165586 Bacteria 7260590
671 2924177087 2924172951 Bacteria 6749356
672 2924184773 2924179722 Bacteria 6843264
673 2924188260 2924186466 Bacteria 6876637
674 2924200324 2924193448 Bacteria 6955718
675 2924206854 2924200457 Bacteria 6757188
676 2924213777 2924207177 Bacteria 6917007
677 2924220295 2924214083 Bacteria 7080103
678 2924224363 2924221636 Bacteria 7113495
679 2924233717 2924228884 Bacteria 6633132
680 2937000844 2936996657 Bacteria 6298727
681 2937009654 2937002841 Bacteria 6934057
682 2937016317 2937009748 Bacteria 6746052
683 2937019560 2937016420 Bacteria 6782579
684 2937028657 2937023124 Bacteria 6815156
685 2937030349 2937029754 Bacteria 6424026
686 2937040752 2937036028 Bacteria 6846469
687 2937045910 2937042894 Bacteria 6741576
688 2937056367 2937049772 Bacteria 6757901
689 2937060829 2937056579 Bacteria 7107896
690 2937069323 2937063883 Bacteria 7199456
691 2937072482 2937071275 Bacteria 6984483
692 2937079383 2937078374 Bacteria 6610289
693 2937088892 2937084907 Bacteria 6618516
694 2937095281 2937091812 Bacteria 6979387
695 2937104516 2937098957 Bacteria 7249374
696 2937109206 2937106411 Bacteria 6947143
697 2937114122 2937113482 Bacteria 6505872
698 2937125788 2937119839 Bacteria 6597547
699 2937129929 2937126314 Bacteria 6771275
700 2939592992 2939589442 Bacteria 4214238
701 2941499982 2941499720 Bacteria 7599444
702 2952253690 2952252522 Bacteria 4171745
703 2957377170 2957375807 Bacteria 6425588
704 2957385751 2957382221 Bacteria 6737050
705 2957388874 2957388812 Bacteria 6778072
706 2957397291 2957395598 Bacteria 6822399
707 2957406480 2957402308 Bacteria 6741770
708 2957413667 2957408893 Bacteria 6558585
709 2957418207 2957415311 Bacteria 6991633
710 2957426016 2957422303 Bacteria 7172205
711 2957431817 2957430029 Bacteria 7022557
712 2957440860 2957437181 Bacteria 6568994
713 2957444735 2957443900 Bacteria 6869977
714 2957453237 2957450854 Bacteria 6765715
715 2957458991 2957457609 Bacteria 6967680
716 2957468155 2957464669 Bacteria 6568877
717 2957475174 2957471148 Bacteria 6797643
718 2957481864 2957478035 Bacteria 6756658
719 2957489219 2957484790 Bacteria 6703082
720 2957491944 2957491536 Bacteria 6695180
721 2957504694 2957498199 Bacteria 7126688
722 2957509094 2957505466 Bacteria 7253085
723 2960587032 2960584000 Bacteria 6864594
724 2960593485 2960591022 Bacteria 6622873
725 2960603588 2960597568 Bacteria 6550735
726 2960604603 2960603979 Bacteria 6898737
727 2960615721 2960610863 Bacteria 6691244
728 2960617958 2960617483 Bacteria 6727748
729 2960628135 2960624210 Bacteria 6875384
730 2960633877 2960631154 Bacteria 6732508
731 2960641082 2960637947 Bacteria 7296468
732 2960651595 2960645483 Bacteria 7211087
733 2960654373 2960652885 Bacteria 7083688
734 2960661422 2960660292 Bacteria 7041660
735 2960673745 2960667422 Bacteria 6763020
736 2960677334 2960674078 Bacteria 6609048
737 2960685072 2960680706 Bacteria 6624464
738 2960691544 2960687367 Bacteria 6535474
739 2960698704 2960693952 Bacteria 6749742
740 2961066285 2961064222 Bacteria 4749990
741 2964611318 2964607997 Bacteria 7101408
742 2964618777 2964615318 Bacteria 6809089
743 2964624434 2964621998 Bacteria 6834995
744 2964632767 2964628898 Bacteria 7083044
745 2964641178 2964636051 Bacteria 7091832
746 2964647025 2964643177 Bacteria 6820887
747 2964652807 2964649959 Bacteria 6675118
748 2964661987 2964656573 Bacteria 7100150
749 2964670751 2964663802 Bacteria 7019362
750 2964676149 2964670856 Bacteria 6851364
751 2964679730 2964678106 Bacteria 6792020
752 2964686252 2964685014 Bacteria 6839111
753 2964692627 2964691889 Bacteria 6802758
754 2964699814 2964698721 Bacteria 6765331
755 2964706936 2964705432 Bacteria 7114648
756 2964717098 2964712639 Bacteria 6695970
757 2964723823 2964719344 Bacteria 7286602
758 2967670389 2967664464 Bacteria 6948836
759 2967672646 2967671571 Bacteria 7021409
760 2967683448 2967678726 Bacteria 7264382
761 2967688597 2967686174 Bacteria 6678622
762 2967694536 2967693043 Bacteria 6804451
763 2967701757 2967699805 Bacteria 6854538
764 2967709854 2967706974 Bacteria 7186053
765 2967718803 2967714385 Bacteria 7000047
766 2967726211 2967721400 Bacteria 7073753
767 2967729690 2967728569 Bacteria 6641507
768 2967738900 2967735183 Bacteria 6827012
769 2967743321 2967742019 Bacteria 6794534
770 2967755348 2967748971 Bacteria 6733771
771 2967761594 2967755722 Bacteria 6814706
772 2967766779 2967762386 Bacteria 6923502
773 2967772585 2967769361 Bacteria 6587838
774 2967779042 2967775926 Bacteria 6738189
775 2970022710 2970019648 Bacteria 7072033
776 2970027872 2970026789 Bacteria 6785236
777 2970036726 2970033650 Bacteria 7118744
778 2970042681 2970040964 Bacteria 6731123
779 2970051755 2970047711 Bacteria 7088379
780 2970058079 2970054988 Bacteria 6611507
781 2970062892 2970061556 Bacteria 7099761
782 2970072156 2970068827 Bacteria 7123112
783 2970079507 2970076120 Bacteria 6697332
784 2970086638 2970082768 Bacteria 6183754
785 2970091778 2970088815 Bacteria 6933825
786 2970098661 2970095765 Bacteria 6936963
787 2970105811 2970102677 Bacteria 6812532
788 2970111936 2970109326 Bacteria 6863976
789 2970120742 2970116247 Bacteria 6501857
790 2970123208 2970122695 Bacteria 6625855
791 2970129774 2970129317 Bacteria 6806560
792 2970139047 2970136068 Bacteria 7207982
793 2970149772 2970143518 Bacteria 6446480
794 2970154203 2970149975 Bacteria 6779706
795 2970160611 2970156795 Bacteria 7168044
796 2970167567 2970164137 Bacteria 6861252
797 2970173611 2970170962 Bacteria 6876229
798 2970178706 2970177841 Bacteria 6768001
799 2970186561 2970184632 Bacteria 7054431
800 2970193272 2970191845 Bacteria 7032787
801 2974308519 2974307012 Bacteria 4172388
802 2977249274 2977247770 Bacteria 4160543
803 2977520541 2977516862 Bacteria 6940108
804 2977530196 2977523885 Bacteria 6960446
805 2977532306 2977530762 Bacteria 6951399
806 2977541407 2977537788 Bacteria 6929320
807 2977550240 2977544691 Bacteria 6875412
808 2977557539 2977551784 Bacteria 7125765
809 2977560822 2977558990 Bacteria 6863948
810 2977569789 2977565890 Bacteria 6901543
811 2977577769 2977572785 Bacteria 6763888
812 2977583903 2977579622 Bacteria 6772100
813 2984516270 2984514374 Bacteria 4172479
814 2989353439 2989349275 Bacteria 6349068
815 2989772386 2989771324 Bacteria 5605128
816 3003932972 3003930520 Bacteria 5667563
817 643825373 643692032 Bacteria 6891900
818 648741534 648276728 Bacteria 6968865
819 8003993202 8003992118 Bacteria 7266902
820 8004000459 8003999396 Bacteria 7063185
821 8049294252 8049293176 Bacteria 6128433
822 8054559179 8054558443 Bacteria 5204801
823 Ga0171463_1011
824 JGI24740J21852_10006610
825 JGI24739J22299_10000752
826 JGI24739J22299_10006754
827 JGI24737J22298_10000922
828 JGI24737J22298_10005905
829 JGI24735J21928_10007930
830 JGI24735J21928_10022450
831 JGI24738J21930_10024954
832 JGI25156J39149_1000221
833 JGI25152J39213_1000032
834 JGI25150J39212_1000527
835 JGI25159J45721_1000002
836 JGI25151J46595_10000138
837 JGI25151J46595_10028756
838 JGI25153J46596_10000102
839 JGI25153J46596_10018310
840 JGI25153J46596_10032110
841 JGI25153J46596_10069973
842 rootH1_10035110
843 rootH2_10002373
844 JGI25160J50197_1000008
845 JGI25161J50226_1000986
846 Ga0006562J51391_1031491
847 Ga0006562J51391_1031501
848 Ga0006562J51391_1191774
849 Ga0006562J51391_1191777
850 Ga0055526_1000819
851 Ga0055526_1002661
852 Ga0055526_1002743
853 Ga0055537_1000660
854 Ga0055537_1001163
855 Ga0055524_1001683
856 Ga0055524_1006339
857 Ga0055524_1057305
858 Ga0055536_1001156
859 Ga0055536_1004000
860 Ga0055534_1000182
861 Ga0055534_1001326
862 Ga0055528_1000674
863 Ga0055528_1000786
864 Ga0055528_1025129
865 Ga0055530_10003569
866 Ga0055531_10002418
867 Ga0055531_10009806
868 Ga0055531_10012568
869 Ga0055531_10016326
870 Ga0055531_10023909
871 Ga0058692_1000003
872 Ga0058692_1000012
873 Ga0055543_1000027
874 Ga0065165_1000015
875 Ga0065165_1000940
876 Ga0070658_10355726
877 Ga0070690_100156871
878 Ga0070670_100511419
879 Ga0068869_100688196
880 Ga0070666_10119919
881 Ga0068868_101014093
882 Ga0070661_100163785
883 Ga0070671_100079770
884 Ga0070659_100367458
885 Ga0070659_101054590
886 Ga0070714_100012972
887 Ga0070708_100412806
888 Ga0070663_100002774
889 Ga0070678_100170409
890 Ga0070662_100697598
891 Ga0070681_10070591
892 Ga0070681_10274162
893 Ga0070679_100476043
894 Ga0070684_100360347
895 Ga0068853_100699817
896 Ga0070672_100167838
897 Ga0070672_100373441
898 Ga0068855_100003573
899 Ga0068855_100017222
900 Ga0068855_100369442
901 Ga0070664_100006172
902 Ga0070664_100427640
903 Ga0068857_100001801
904 Ga0068857_100027401
905 Ga0068857_100127576
906 Ga0068854_100000678
907 Ga0068854_100000774
908 Ga0068852_100014771
909 Ga0068852_100028619
910 Ga0068852_100278344
911 Ga0068859_100224339
912 Ga0068859_100474016
913 Ga0068864_100220523
914 Ga0068864_100664348
915 Ga0068866_10466280
916 Ga0068851_10002910
917 Ga0068851_10006243
918 Ga0068863_100011742
919 Ga0068858_100044187
920 Ga0068858_100136017
921 Ga0068860_100614985
922 Ga0081539_10025328
923 Ga0075364_10435724
924 Ga0075366_10557191
925 Ga0075434_100779082
926 Ga0068865_100730884
927 Ga0097620_100224339
928 Ga0097620_100473971
929 Ga0079104_1001945
930 Ga0079104_1011685
931 Ga0075435_100218055
932 Ga0099794_10184493
933 Ga0105244_10018528
934 Ga0105250_10026630
935 Ga0105240_10001284
936 Ga0105240_10026572
937 Ga0105240_10294107
938 Ga0105243_10235343
939 Ga0105241_10273760
940 Ga0105242_10151602
941 Ga0105248_10040915
942 Ga0105237_10000079
943 Ga0105237_10000701
944 Ga0105238_10073961
945 Ga0105249_10273629
946 Ga0105239_10056632
947 Ga0105239_10076582
948 Ga0105239_10523854
949 Ga0157314_1000037
950 Ga0157314_1000390
951 Ga0157316_1000174
952 Ga0157327_1000422
953 Ga0157373_10068296
954 Ga0157371_10091945
955 Ga0157370_10001576
956 Ga0157370_10128117
957 Ga0157374_10081857
958 Ga0163162_10013446
959 Ga0163162_10095314
960 Ga0163162_11268249
961 Ga0157372_10140172
962 Ga0157375_10060937
963 Ga0157375_10091255
964 Ga0182008_10322368
965 Ga0157379_10914015
966 Ga0157376_10256861
967 Ga0182006_1084360
968 Ga0183363_1362
969 Ga0163161_10217070
970 Ga0163161_10285596
971 Ga0163161_10373464
972 Ga0206352_10984173
973 Ga0214544_1022053
974 Ga0214542_1000006
975 Ga0214542_1019489
976 Ga0214543_1000014
977 Ga0214543_1022635
978 Ga0213872_10023121
979 Ga0224712_10040276
980 Ga0228711_1000015
981 Ga0228710_1000015
982 Ga0209436_105166
983 Ga0209674_100157
984 Ga0207425_1000078
985 Ga0207425_1006994
986 Ga0209759_1000363
987 Ga0209759_1028209
988 Ga0209129_1000157
989 Ga0209129_1002581
990 Ga0209565_1000168
991 Ga0209565_1000202
992 Ga0209673_1000007
993 Ga0209673_1000087
994 Ga0209673_1000759
995 Ga0209130_1000007
996 Ga0209675_1000039
997 Ga0209675_1000453
998 Ga0209675_1005313
999 Ga0209676_1000011
1000 Ga0209676_1001917
1001 Ga0209676_1013007
1002 Ga0209025_1000054
1003 Ga0209025_1000303
1004 Ga0209025_1000361
1005 Ga0209025_1002031
1006 Ga0209025_1025420
1007 Ga0209025_1048955
1008 Ga0209564_1000203
1009 Ga0209564_1000296
1010 Ga0209564_1000759
1011 Ga0209564_1028231
1012 Ga0209758_1000062
1013 Ga0209758_1000315
1014 Ga0209758_1002680
1015 Ga0209758_1002818
1016 Ga0209758_1027147
1017 Ga0209050_1000251
1018 Ga0209050_1002665
1019 Ga0209050_1019538
1020 Ga0209256_1000415
1021 Ga0209256_1003048
1022 Ga0209256_1006077
1023 Ga0209256_1012181
1024 Ga0207426_1000064
1025 Ga0209051_1003625
1026 Ga0209051_1009318
1027 Ga0209257_1000014
1028 Ga0209257_1000080
1029 Ga0209257_1000170
1030 Ga0209257_1000430
1031 Ga0209257_1000817
1032 Ga0209257_1042247
1033 Ga0207656_10001594
1034 Ga0207656_10004205
1035 Ga0207696_1006475
1036 Ga0207655_1001054
1037 Ga0207688_10398758
1038 Ga0207680_10506422
1039 Ga0207647_10000634
1040 Ga0207647_10004577
1041 Ga0207685_10256908
1042 Ga0207707_10051481
1043 Ga0207695_10000401
1044 Ga0207695_10000541
1045 Ga0207695_10004041
1046 Ga0207695_10052537
1047 Ga0207671_10000009
1048 Ga0207671_10000050
1049 Ga0207649_10138984
1050 Ga0207694_10237921
1051 Ga0207650_10431580
1052 Ga0207650_10567289
1053 Ga0207659_10088571
1054 Ga0207664_11088247
1055 Ga0207644_10010380
1056 Ga0207644_10268234
1057 Ga0207690_10947747
1058 Ga0207669_10036237
1059 Ga0207665_10516838
1060 Ga0207691_10067682
1061 Ga0207711_10181626
1062 Ga0207679_10110911
1063 Ga0207667_10000031
1064 Ga0207667_10000125
1065 Ga0207667_10000261
1066 Ga0207667_10244031
1067 Ga0207651_10179142
1068 Ga0207668_10114636
1069 Ga0207640_10000082
1070 Ga0207640_10000146
1071 Ga0207703_10031623
1072 Ga0207678_10057513
1073 Ga0207702_10850388
1074 Ga0207641_10077387
1075 Ga0207641_10424266
1076 Ga0207648_10013177
1077 Ga0207676_10101011
1078 Ga0207676_10299404
1079 Ga0207674_10000551
1080 Ga0207674_10004296
1081 Ga0207674_10145508
1082 Ga0207698_10001335
1083 Ga0207698_10019042
1084 Ga0207698_10248926
1085 Ga0209281_1000339
1086 Ga0209281_1001295
1087 Ga0209371_1000006
1088 Ga0209371_1000007
1089 Ga0209282_1000054
1090 Ga0268264_10407356
1091 Ga0265318_10003237
1092 Ga0307515_10001636
1093 Ga0307515_10107545
1094 Ga0268256_1000007
1095 Ga0268256_1000008
1096 Ga0307512_10106853
1097 Ga0314311_1085598
1098 Ga0316178_1137231
1099 Ga0316183_1059573
1100 Ga0316182_1096769
1101 Ga0265332_10028866
1102 Ga0265332_10109620
1103 Ga0265328_10025394
1104 Ga0265320_10040709
1105 Ga0265325_10104839
1106 Ga0265331_10008340
1107 Ga0265331_10013013
1108 Ga0307513_10006680
1109 Ga0307509_10002009
1110 Ga0307408_100072916
1111 Ga0307408_100432676
1112 Ga0307408_101010031
1113 Ga0307408_101185170
1114 Ga0265313_10000507
1115 Ga0265313_10000855
1116 Ga0307508_10040330
1117 Ga0307405_10107988
1118 Ga0307413_10008456
1119 Ga0307413_10740951
1120 Ga0307412_10176925
1121 Ga0315914_1000013
1122 Ga0307414_10008498
1123 Ga0307414_10042683
1124 Ga0307414_10072273
1125 Ga0307414_10314906
1126 Ga0307411_10139978
1127 Ga0307411_10332657
1128 Ga0307411_10512023
1129 Ga0307415_100619600
1130 Ga0307507_10409017
1131 Ga0307510_10056070
1132 Ga0307510_10190918
1133 Ga0315913_1000097
1134 Ga0315915_1000001
1135 Ga0373934_0115865
1136 Ga0373954_0127432
1137 Ga0373956_0152733
1138 Ga0373955_0029130
1139 Ga0373937_0250448
1140 Ga0395899_0005603
1141 Ga0395899_0029844
1142 Ga0395899_0033855
1143 Ga0395899_0055243
1144 Ga0395899_0382442
1145 Ga0395900_0008177
1146 Ga0395900_0046088
1147 Ga0395900_0360350
1148 Ga0395898_0018824
1149 Ga0395898_0051323
1150 Ga0395898_0056357
1151 Ga0395905_0132793
1152 Ga0395901_0005878
1153 Ga0395901_0300432
1154 Ga0237819_00016
1155 Ga0436365_1882660
1156 Ga0436360_1249712
1157 Ga0436361_0007789
1158 Ga0436361_0554014
1159 Ga0436361_0801329
1160 Ga0439436_0003109
1161 Ga0439436_0007456
1162 Ga0439436_0024629
1163 Ga0439436_0026519
1164 Ga0439439_0037901
1165 Ga0439447_029959
1166 Ga0439461_0037576
1167 Ga0439466_0069093
1168 Ga0439465_0000085
1169 Ga0439465_0001079
1170 Ga0439465_0008456
1171 Ga0439465_0056853
1172 Ga0451789_0692276
1173 Ga0451791_0682317
1174 Ga0451793_1307728
1175 Ga0451802_0265798
1176 Ga0451807_2045622
1177 Ga0451837_0327149
1178 Ga0451841_1287956
1179 Ga0451843_0971899
1180 Ga0451843_1337025
1181 Ga0439433_0033602
1182 Ga0439445_0001227
1183 Ga0439445_0052637
1184 Ga0439432_003800
1185 Ga0439432_037292
1186 Ga0439432_080413
1187 Ga0439449_0000553
1188 Ga0439449_0003112
1189 Ga0439449_0009113
1190 Ga0439449_0025712
1191 Ga0439449_0031339
1192 Ga0439449_0100272
1193 Ga0439457_024272
1194 Ga0450920_016369
1195 Ga0450918_010043
1196 Ga0466972_0002873
1197 Ga0466965_0006935
1198 Ga0466963_0366045
1199 Ga0466964_0006875
1200 Ga0466964_0175917
1201 Ga0466968_0006143
1202 Ga0466960_0257232
1203 Ga0495638_0000411
1204 Ga0495638_0012752
1205 Ga0495638_0152693
1206 Ga0495651_0193814
1207 Ga0495583_0000001
1208 Ga0495583_0088420
1209 Ga0495610_0053429
1210 Ga0495616_0001142
1211 Ga0495631_0153331
1212 Ga0495632_0002173
1213 Ga0495632_0006556
1214 Ga0495643_0002163
1215 Ga0495643_0340874
1216 Ga0495648_0227243
1217 Ga0495663_0001305
1218 Ga0495663_0048009
1219 Ga0495663_0196091
1220 Ga0495652_0095919
1221 Ga0495621_0038143
1222 Ga0495597_0173503
1223 Ga0495633_0007146
1224 Ga0495633_0155586
1225 Ga0495656_0014644
1226 Ga0495656_0014718
1227 Ga0495656_0017587
1228 Ga0495668_0042550
1229 Ga0495668_0396350
1230 Ga0495625_0040566
1231 Ga0495625_0119831
1232 Ga0495659_0195783
1233 Ga0495588_0045855
1234 Ga0495649_0000223
1235 Ga0495660_0006325
1236 Ga0495660_0061155
1237 Ga0495636_0000021
1238 Ga0495636_0008699
1239 Ga0495636_0070226
1240 Ga0495636_0093664
1241 Ga0495672_0000173
1242 Ga0495687_102345
1243 Ga0495675_0130004
1244 Ga0495673_0005478
1245 Ga0495686_0058598
1246 Ga0495686_0182915
1247 Ga0495686_0440005
1248 Ga0495602_0286997
1249 Ga0496101_0560520
1250 Ga0496105_0275843
1251 Ga0496106_0324102
1252 Ga0496108_0342942
1253 Ga0496108_0606691
1254 Ga0496109_0189585
1255 Ga0496109_0858648
1256 Ga0496109_1093982
1257 Ga0496110_0553869
1258 Ga0496113_0084486
1259 Ga0496114_0080963
1260 Ga0496115_0000138
1261 Ga0496116_0024192
1262 Ga0496117_0012593
1263 Ga0496117_0154578
1264 Ga0496118_0005747
1265 Ga0496118_0091705
1266 Ga0496121_0007287
1267 Ga0496121_0148364
1268 Ga0496122_0006681
1269 Ga0496122_0299300
1270 Ga0496123_0002214
1271 Ga0496123_0144246
1272 Ga0496123_0228430
1273 Ga0496124_0018773
1274 Ga0496124_0023642
1275 Ga0496124_0143226
1276 Ga0496124_0428988
1277 Ga0496125_0000752
1278 Ga0496125_0000795
1279 Ga0496125_0006026
1280 Ga0496125_0088047
1281 Ga0496126_0000132
1282 Ga0496126_0002949
1283 Ga0496126_0026256
1284 Ga0501306_020338
1285 Ga0501306_055023
1286 Ga0501309_055277
1287 Ga0501310_032951
1288 Ga0501305_034533
1289 Ga0501307_028555
1290 Ga0501307_035106
1291 Ga0501290_049902
1292 Ga0501312_028398
1293 Ga0501315_020532
1294 Ga0501315_051102
1295 Ga0501316_025119
1296 Ga0501316_027639
1297 Ga0501320_032744
1298 Ga0501321_011836
1299 Ga0501321_041788
1300 Ga0501323_013530
1301 Ga0501324_024766
1302 Ga0501031_0079334
1303 Ga0501031_0165520
1304 Ga0501032_0018380
1305 Ga0501033_0007277
1306 Ga0501033_0008613
1307 Ga0501033_0102869
1308 Ga0501034_0270576
1309 Ga0501034_0283513
1310 Ga0501034_0679912
1311 Ga0501036_0100034
1312 Ga0501037_0091261
1313 Ga0501038_0059254
1314 Ga0501038_0070689
1315 Ga0501046_0176434
1316 Ga0501046_0314613
1317 Ga0501047_0004607
1318 Ga0501047_0012276
1319 Ga0501047_0102105
1320 Ga0501069_0147557
1321 Ga0501070_0153893
1322 Ga0501071_0003118
1323 Ga0501073_0002137
1324 Ga0501073_0050324
1325 Ga0501074_0057199
1326 Ga0501223_023579
1327 Ga0501249_041515
1328 Ga0501225_0006494
1329 Ga0501080_0123293
1330 Ga0501080_0168262
1331 Ga0501262_010710
1332 Ga0501035_0078981
1333 Ga0501035_0105712
1334 Ga0501035_0124113
1335 Ga0501035_0157631
1336 Ga0501035_0414043
1337 Ga0501044_0005142
1338 Ga0501044_0085287
1339 Ga0501044_0095727
1340 Ga0501044_0151966
1341 Ga0501044_0389527
1342 Ga0501044_0600441
1343 nmdc:mga0n895_113061_c1
1344 nmdc:mga0rr50_86518_c1
1345 nmdc:mga08x19_165391_c1
1346 nmdc:mga08x19_382261_c1
1347 Ga0495612_0051054
1348 Ga0495619_0159951
1349 Ga0500583_0084864
1350 Ga0500583_0252094
1351 Ga0500594_0058502
1352 Ga0500658_0000980
1353 Ga0500604_0068333
1354 Ga0500616_0098489
1355 Ga0500622_0000011
1356 Ga0500622_0121856
1357 Ga0500645_035073
1358 Ga0500609_001029
1359 Ga0587067_124780
1360 Ga0587111_0056463
1361 2506578410
1362 2506583548
1363 2509108781
1364 2509374239
1365 2510307361
1366 2511501232
1367 2512532659
1368 2512972011
1369 2513587112
1370 2513604680
1371 2513616386
1372 2513880892
1373 2513907427
1374 2513987318
1375 2514000969
1376 2514007334
1377 2515608406
1378 2516209113
1379 2516892515
1380 2517569328
1381 2524450932
1382 2551675549
1383 2551689258
1384 2551694322
1385 2551699721
1386 2551712785
1387 2551722350
1388 2551728634
1389 2551734563
1390 2551742238
1391 2558863265
1392 2572254040
1393 2585150684
1394 2585165842
1395 2585198201
1396 2585269484
1397 2585390946
1398 2585393024
1399 2600192193
1400 2643806961
1401 2643815159
1402 2643879197
1403 2643938046
1404 2644048183
1405 2644067282
1406 2644076895
1407 2644108771
1408 2644151292
1409 2644200681
1410 2644206033
1411 2644311427
1412 2644329685
1413 2644378329
1414 2644420912
1415 2644454436
1416 2644485160
1417 2644502176
1418 2644529220
1419 2644546359
1420 2644617226
1421 2644649680
1422 2644660497
1423 2644675341
1424 2644689774
1425 2644695210
1426 2644697856
1427 2657683049
1428 2692316570
1429 2792584409
1430 2792622463
1431 2792628618
1432 2792642794
1433 2802719341
1434 2802723098
1435 2802732541
1436 2802738460
1437 2802745084
1438 2802751519
1439 2804751562
1440 2816517640
1441 2819539638
1442 2819647013
1443 2838076659
1444 2842391824
1445 2842526107
1446 2842758257
1447 2844168281
1448 2847418362
1449 2848993343
1450 2850080702
1451 2855831585
1452 2855840703
1453 2855878622
1454 2858801231
1455 2891377291
1456 2895500682
1457 2895516448
1458 2895523632
1459 2895526786
1460 2896386853
1461 2913301815
1462 2915985706
1463 2915991763
1464 2915995792
1465 2916002666
1466 2916009852
1467 2916018814
1468 2916022443
1469 2916031833
1470 2916040609
1471 2916046645
1472 2916052701
1473 2916055103
1474 2916065852
1475 2916069539
1476 2916078707
1477 2920765439
1478 2920824069
1479 2921205128
1480 2921210040
1481 2921242289
1482 2921248033
1483 2921251622
1484 2921260817
1485 2921263979
1486 2921285948
1487 2921292118
1488 2921299864
1489 2924147627
1490 2924155035
1491 2924165010
1492 2924168026
1493 2924177087
1494 2924184773
1495 2924188260
1496 2924200324
1497 2924206854
1498 2924213777
1499 2924220295
1500 2924224363
1501 2924233717
1502 2937000844
1503 2937009654
1504 2937016317
1505 2937019560
1506 2937028657
1507 2937030349
1508 2937040752
1509 2937045910
1510 2937056367
1511 2937060829
1512 2937069323
1513 2937072482
1514 2937079383
1515 2937088892
1516 2937095281
1517 2937104516
1518 2937109206
1519 2937114122
1520 2937125788
1521 2937129929
1522 2939592992
1523 2941499982
1524 2952253690
1525 2957377170
1526 2957385751
1527 2957388874
1528 2957397291
1529 2957406480
1530 2957413667
1531 2957418207
1532 2957426016
1533 2957431817
1534 2957440860
1535 2957444735
1536 2957453237
1537 2957458991
1538 2957468155
1539 2957475174
1540 2957481864
1541 2957489219
1542 2957491944
1543 2957504694
1544 2957509094
1545 2960587032
1546 2960593485
1547 2960603588
1548 2960604603
1549 2960615721
1550 2960617958
1551 2960628135
1552 2960633877
1553 2960641082
1554 2960651595
1555 2960654373
1556 2960661422
1557 2960673745
1558 2960677334
1559 2960685072
1560 2960691544
1561 2960698704
1562 2961066285
1563 2964611318
1564 2964618777
1565 2964624434
1566 2964632767
1567 2964641178
1568 2964647025
1569 2964652807
1570 2964661987
1571 2964670751
1572 2964676149
1573 2964679730
1574 2964686252
1575 2964692627
1576 2964699814
1577 2964706936
1578 2964717098
1579 2964723823
1580 2967670389
1581 2967672646
1582 2967683448
1583 2967688597
1584 2967694536
1585 2967701757
1586 2967709854
1587 2967718803
1588 2967726211
1589 2967729690
1590 2967738900
1591 2967743321
1592 2967755348
1593 2967761594
1594 2967766779
1595 2967772585
1596 2967779042
1597 2970022710
1598 2970027872
1599 2970036726
1600 2970042681
1601 2970051755
1602 2970058079
1603 2970062892
1604 2970072156
1605 2970079507
1606 2970086638
1607 2970091778
1608 2970098661
1609 2970105811
1610 2970111936
1611 2970120742
1612 2970123208
1613 2970129774
1614 2970139047
1615 2970149772
1616 2970154203
1617 2970160611
1618 2970167567
1619 2970173611
1620 2970178706
1621 2970186561
1622 2970193272
1623 2974308519
1624 2977249274
1625 2977520541
1626 2977530196
1627 2977532306
1628 2977541407
1629 2977550240
1630 2977557539
1631 2977560822
1632 2977569789
1633 2977577769
1634 2977583903
1635 2984516270
1636 2989353439
1637 2989772386
1638 3003932972
1639 643825373
1640 648741534
1641 8003993202
1642 8004000459
1643 8049294252
1644 8054559179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

39

237

0.91

PF03358

FMN_red

NADPH-dependent FMN reductase

39

215

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qu0-assembly1.cif.gz_B structure of azoreductase from bacillus sp. a01 0.9123 39 176
1tik-assembly1.cif.gz_A crystal structure of acyl carrier protein phosphodiesterase 0.9045 34 175
6jxn-assembly2.cif.gz_C crystal structure of indigo reductase from bacillus smithii type strain dsm 4216 0.8427 27 176
3w78-assembly2.cif.gz_D crystal structure of azoreductase azrc in complex with nad(p)-inhibitor cibacron blue 0.8335 24 176
3r6w-assembly1.cif.gz_A-2 paazor1 binding to nitrofurazone 0.8064 17 176
ID Description Score Start End Superfamily
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8603 34 176 3.40.50.360
af_Q2G1F2_1_208_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8398 18 176 3.40.50.360
3w77A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7976 18 176 3.40.50.360
3lt5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7962 33 169 3.40.50.360
2hpvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.793 18 169 3.40.50.360
ID Description Score Start End GO Terms
AF-G0A8Z0-F1-model_v4 FMN-dependent NADH-azoreductase (EC 1.7.-.-) 0.9918 101 173 GO:0016491
AF-A0A0H3I3T1-F1-model_v4 FMN-dependent NADH-azoreductase 0.987 50 175
AF-A0A846UKT8-F1-model_v4 FMN-dependent NADH-azoreductase 0.9841 55 174
AF-A0A8B4MR61-F1-model_v4 deleted 0.9754 69 177
AF-A0A435U349-F1-model_v4 FMN-dependent NADH-azoreductase 0.9751 55 176

Map