F482341

General Info

Members Datasets Scaffolds Average Seq Length
823 336 808 605

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10048738|Ga0207695_100487383
Length 683
Sequence MEQRRGFHLTKCTDIFEKCNRLHLLLIFLVRLPAESGPRREEMWVAAVAEEFWKTGRPERTTVYLYRLLTGNMARSKTPAATEPLTWKQRLNALRNLPRFFRLVWQTSPGIMLANILLRITRSAIPVIILYVGKLIIDEVILLAKTGGKGDLHYIWELVALEFGLALISDGMARAVSLMDSLLGDKFSNFTSVRIMAHAARLDLDQFEDSTFYDKLERARQQTNGRTVLLSQVLGQVQDLISMGFLAAGLMAFNPWLILLLLVAVVPAFLGESYFNDRSYALTRSQTTERRELDYLRFLGASDETAKEVKLFGLSGFLIDRFSLLAEKFYRDGRKLAIKRSAWGTFFALLGSAGYYSAYVVIIFRAIHGSLSIGDLAFLAGSFRQLRSLLEGILTRFTSVSQGAIYLQDLFEFFEIEPRIKPVAHPRPFXXPVKEGFVFEDVGFRYLHSERWANRHLNFTLKAGERLALVGENGAGKTTLIKLLTRLYDPTEGRILLDGVDLREYDPDDLRRNIGVIFQDYLRYQMTMAQNIAVGNIGHKEDRALIETAAQQSLADTVVEKLPGRYDQKLGRWFGQGVDLSGGEWQKIALARAYIRDAQLLILDEPTAALDARAEYEVFQRFSELTQGRTAVLISHRFSTVRMADRILVLDKGQLLEIGSHEELLARNGRYAELFHLQARGYR

Samples

Sample ID Description Type Environment
1 2738541284 Pedobacter sp. YR016 Isolate Unclassified
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
5 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
6 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
9 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
12 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
13 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
14 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
15 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
16 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
126 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
308 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
325 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
326 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
327 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
328 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
332 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.36
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 0
Rhizoplane 1.82
Rhizosphere 89.79
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000166 3300000546 Bacteria 10816
2 LJNas_1000968 3300000546 Bacteria 4581
3 JGI24737J22298_10007369 3300001990 Bacteria 3717
4 JGI25162J39368_1000141 3300002737 Bacteria 77973
5 JGI25162J39368_1000852 3300002737 Bacteria 20132
6 JGI25164J39214_1000617 3300002772 Bacteria 15116
7 JGI25165J46597_1000157 3300003214 Bacteria 108987
8 rootH2_10000327 3300003320 Bacteria 51947
9 rootH2_10006617 3300003320 Bacteria 52484
10 rootH2_10108130 3300003320 Bacteria 7338
11 rootL2_10093656 3300003322 Bacteria 5225
12 rootH1_10126443 3300003323 Unclassified 2992
13 rootH1_10139100 3300003323 Bacteria 4355
14 Ga0065714_10066555 3300005288 Bacteria 6653
15 Ga0065704_10071014 3300005289 Bacteria 13752
16 Ga0065704_10076291 3300005289 Bacteria 5181
17 Ga0065707_10103932 3300005295 Bacteria 2722
18 Ga0070658_10000008 3300005327 Bacteria 319912
19 Ga0070658_10000074 3300005327 Bacteria 95827
20 Ga0070658_10000230 3300005327 Bacteria 49640
21 Ga0070658_10002294 3300005327 Bacteria 16046
22 Ga0070658_10034259 3300005327 Bacteria 4086
23 Ga0070658_10110586 3300005327 Unclassified 2276
24 Ga0070676_10001002 3300005328 Bacteria 14031
25 Ga0070683_100129003 3300005329 Bacteria 2392
26 Ga0070677_10004081 3300005333 Bacteria 4739
27 Ga0068869_100000733 3300005334 Bacteria 18626
28 Ga0068869_100022814 3300005334 Unclassified 4317
29 Ga0068869_100076046 3300005334 Bacteria 2495
30 Ga0070666_10000165 3300005335 Bacteria 45323
31 Ga0070666_10001005 3300005335 Bacteria 17249
32 Ga0070666_10024138 3300005335 Unclassified 3959
33 Ga0070680_100005084 3300005336 Bacteria 9924
34 Ga0070680_100016335 3300005336 Bacteria 5842
35 Ga0070682_100007190 3300005337 Bacteria 6272
36 Ga0068868_100002352 3300005338 Bacteria 13087
37 Ga0068868_100005239 3300005338 Bacteria 9103
38 Ga0068868_100008266 3300005338 Bacteria 7451
39 Ga0070660_100000870 3300005339 Bacteria 20145
40 Ga0070691_10002535 3300005341 Bacteria 8137
41 Ga0070691_10009231 3300005341 Bacteria 4508
42 Ga0070661_100062757 3300005344 Unclassified 2728
43 Ga0070661_100107872 3300005344 Bacteria 2077
44 Ga0070668_100009328 3300005347 Bacteria 7280
45 Ga0070675_100048866 3300005354 Bacteria 3470
46 Ga0070675_100056061 3300005354 Bacteria 3246
47 Ga0070671_100038052 3300005355 Bacteria 3993
48 Ga0070674_100053400 3300005356 Bacteria 2790
49 Ga0070673_100000096 3300005364 Bacteria 39184
50 Ga0070673_100030771 3300005364 Bacteria 4022
51 Ga0070688_100009314 3300005365 Bacteria 5365
52 Ga0070659_100004697 3300005366 Bacteria 9753
53 Ga0070659_100123379 3300005366 Bacteria 2100
54 Ga0070667_100002462 3300005367 Bacteria 16163
55 Ga0070709_10005054 3300005434 Bacteria 7132
56 Ga0070709_10028343 3300005434 Bacteria 3338
57 Ga0070709_10076770 3300005434 Bacteria 2170
58 Ga0070714_100001471 3300005435 Bacteria 17162
59 Ga0070713_100001335 3300005436 Bacteria 15771
60 Ga0070713_100038053 3300005436 Bacteria 3894
61 Ga0070713_100045224 3300005436 Bacteria 3606
62 Ga0070710_10001260 3300005437 Bacteria 12035
63 Ga0070710_10012873 3300005437 Bacteria 4169
64 Ga0070710_10016203 3300005437 Bacteria 3788
65 Ga0070711_100001977 3300005439 Bacteria 11516
66 Ga0070711_100021677 3300005439 Bacteria 4157
67 Ga0070708_100000141 3300005445 Bacteria 49530
68 Ga0070708_100004536 3300005445 Bacteria 10933
69 Ga0070708_100030444 3300005445 Bacteria 4665
70 Ga0070663_100000586 3300005455 Bacteria 19455
71 Ga0070678_100030075 3300005456 Bacteria 3728
72 Ga0070678_100031688 3300005456 Bacteria 3651
73 Ga0070662_100000020 3300005457 Bacteria 99425
74 Ga0070662_100008816 3300005457 Bacteria 6575
75 Ga0070662_100018002 3300005457 Bacteria 4772
76 Ga0070662_100099864 3300005457 Bacteria 2195
77 Ga0070681_10000293 3300005458 Bacteria 40403
78 Ga0070681_10006018 3300005458 Bacteria 11754
79 Ga0070681_10008225 3300005458 Bacteria 10206
80 Ga0070681_10105955 3300005458 Unclassified 2753
81 Ga0068867_100012223 3300005459 Bacteria 6068
82 Ga0068867_100106407 3300005459 Unclassified 2149
83 Ga0070685_10018240 3300005466 Bacteria 3771
84 Ga0070685_10019301 3300005466 Bacteria 3676
85 Ga0070706_100002149 3300005467 Bacteria 20081
86 Ga0070707_100004191 3300005468 Bacteria 13515
87 Ga0070698_100004301 3300005471 Bacteria 15665
88 Ga0070699_100000132 3300005518 Bacteria 69186
89 Ga0070679_100018669 3300005530 Bacteria 6732
90 Ga0070679_100031281 3300005530 Bacteria 5257
91 Ga0070679_100036612 3300005530 Bacteria 4870
92 Ga0070679_100045509 3300005530 Unclassified 4373
93 Ga0070679_100126134 3300005530 Unclassified 2542
94 Ga0070684_100067299 3300005535 Bacteria 3146
95 Ga0070684_100073890 3300005535 Bacteria 3005
96 Ga0070684_100096428 3300005535 Bacteria 2636
97 Ga0070697_100000261 3300005536 Bacteria 42660
98 Ga0070697_100001102 3300005536 Bacteria 20411
99 Ga0068853_100004755 3300005539 Bacteria 10557
100 Ga0068853_100069644 3300005539 Unclassified 3061
101 Ga0068853_100100389 3300005539 Unclassified 2558
102 Ga0070672_100000033 3300005543 Bacteria 61516
103 Ga0070686_100094564 3300005544 Bacteria 2006
104 Ga0070665_100000041 3300005548 Bacteria 297849
105 Ga0070665_100001161 3300005548 Bacteria 32366
106 Ga0070665_100001625 3300005548 Bacteria 25892
107 Ga0070665_100032975 3300005548 Bacteria 5211
108 Ga0068855_100000026 3300005563 Bacteria 175140
109 Ga0068855_100000275 3300005563 Bacteria 63345
110 Ga0068855_100000500 3300005563 Bacteria 48457
111 Ga0068855_100001157 3300005563 Bacteria 32696
112 Ga0068855_100005062 3300005563 Bacteria 16079
113 Ga0068855_100014026 3300005563 Bacteria 9659
114 Ga0068855_100024706 3300005563 Bacteria 7188
115 Ga0068855_100047039 3300005563 Bacteria 5098
116 Ga0068855_100065776 3300005563 Bacteria 4227
117 Ga0068855_100068978 3300005563 Bacteria 4115
118 Ga0068855_100075546 3300005563 Bacteria 3912
119 Ga0068855_100096081 3300005563 Bacteria 3415
120 Ga0068855_100099240 3300005563 Bacteria 3354
121 Ga0068855_100104433 3300005563 Unclassified 3259
122 Ga0070664_100000583 3300005564 Bacteria 27797
123 Ga0070664_100034117 3300005564 Unclassified 4268
124 Ga0068857_100001802 3300005577 Bacteria 17235
125 Ga0068857_100005388 3300005577 Bacteria 10908
126 Ga0068857_100015189 3300005577 Bacteria 6719
127 Ga0068857_100040949 3300005577 Bacteria 4107
128 Ga0068854_100009116 3300005578 Bacteria 6398
129 Ga0068854_100095595 3300005578 Unclassified 2218
130 Ga0068856_100001116 3300005614 Bacteria 28358
131 Ga0068856_100004130 3300005614 Bacteria 14509
132 Ga0068856_100004768 3300005614 Bacteria 13445
133 Ga0068856_100018770 3300005614 Bacteria 6706
134 Ga0068856_100041934 3300005614 Bacteria 4500
135 Ga0068856_100058747 3300005614 Bacteria 3798
136 Ga0068856_100059504 3300005614 Bacteria 3773
137 Ga0068856_100091069 3300005614 Bacteria 3034
138 Ga0068856_100105561 3300005614 Bacteria 2811
139 Ga0068856_100179104 3300005614 Unclassified 2132
140 Ga0068852_100000649 3300005616 Bacteria 22756
141 Ga0068852_100010317 3300005616 Bacteria 6975
142 Ga0068852_100022599 3300005616 Bacteria 5046
143 Ga0068852_100028898 3300005616 Bacteria 4545
144 Ga0068852_100052799 3300005616 Bacteria 3495
145 Ga0068859_100000163 3300005617 Bacteria 64401
146 Ga0068859_100005316 3300005617 Bacteria 13091
147 Ga0068859_100110964 3300005617 Unclassified 2805
148 Ga0068864_100002828 3300005618 Bacteria 14323
149 Ga0068864_100003380 3300005618 Bacteria 13195
150 Ga0068864_100003869 3300005618 Bacteria 12329
151 Ga0068864_100013821 3300005618 Bacteria 6689
152 Ga0068864_100100603 3300005618 Unclassified 2563
153 Ga0068866_10052792 3300005718 Unclassified 2075
154 Ga0068861_100001398 3300005719 Bacteria 15165
155 Ga0068861_100034641 3300005719 Bacteria 3735
156 Ga0068863_100000696 3300005841 Bacteria 33755
157 Ga0068863_100003177 3300005841 Bacteria 16251
158 Ga0068863_100016617 3300005841 Bacteria 7061
159 Ga0068863_100057605 3300005841 Bacteria 3677
160 Ga0068858_100002290 3300005842 Bacteria 19387
161 Ga0068858_100002561 3300005842 Bacteria 18317
162 Ga0068858_100036970 3300005842 Unclassified 4527
163 Ga0068858_100073685 3300005842 Unclassified 3170
164 Ga0068858_100083288 3300005842 Bacteria 2974
165 Ga0068860_100000208 3300005843 Bacteria 92818
166 Ga0068860_100005487 3300005843 Bacteria 12854
167 Ga0068860_100005989 3300005843 Bacteria 12239
168 Ga0068860_100007052 3300005843 Bacteria 11250
169 Ga0068860_100031363 3300005843 Bacteria 5109
170 Ga0068860_100075676 3300005843 Bacteria 3202
171 Ga0068862_100016835 3300005844 Bacteria 6085
172 Ga0068862_100020920 3300005844 Bacteria 5466
173 Ga0081540_1012173 3300005983 Bacteria 5687
174 Ga0070717_10000703 3300006028 Bacteria 21636
175 Ga0070717_10003890 3300006028 Bacteria 10743
176 Ga0070717_10013658 3300006028 Bacteria 6230
177 Ga0070717_10030810 3300006028 Bacteria 4310
178 Ga0070717_10058506 3300006028 Bacteria 3187
179 Ga0070717_10082418 3300006028 Bacteria 2703
180 Ga0070716_100010951 3300006173 Bacteria 4563
181 Ga0070716_100035785 3300006173 Bacteria 2732
182 Ga0070712_100000876 3300006175 Bacteria 17970
183 Ga0070712_100012057 3300006175 Bacteria 5493
184 Ga0075366_10002387 3300006195 Bacteria 9631
185 Ga0075366_10030835 3300006195 Bacteria 3153
186 Ga0097621_100000954 3300006237 Bacteria 20273
187 Ga0097621_100003319 3300006237 Bacteria 11074
188 Ga0097621_100004993 3300006237 Bacteria 9303
189 Ga0097621_100007615 3300006237 Bacteria 7761
190 Ga0097621_100017632 3300006237 Bacteria 5428
191 Ga0097621_100044086 3300006237 Bacteria 3598
192 Ga0068871_100000435 3300006358 Bacteria 28742
193 Ga0068871_100004350 3300006358 Bacteria 9844
194 Ga0068871_100005053 3300006358 Bacteria 9213
195 Ga0068871_100019977 3300006358 Bacteria 5124
196 Ga0068871_100024054 3300006358 Bacteria 4720
197 Ga0075428_100008359 3300006844 Bacteria 11476
198 Ga0075428_100224589 3300006844 Bacteria 2027
199 Ga0075434_100002147 3300006871 Bacteria 17171
200 Ga0075429_100068857 3300006880 Bacteria 3081
201 Ga0068865_100001201 3300006881 Bacteria 15074
202 Ga0068865_100009033 3300006881 Bacteria 6165
203 Ga0097620_100000163 3300006931 Bacteria 64401
204 Ga0097620_100005316 3300006931 Bacteria 13091
205 Ga0097620_100110963 3300006931 Unclassified 2805
206 Ga0099795_10023036 3300007788 Bacteria 2062
207 Ga0105240_10000147 3300009093 Bacteria 142340
208 Ga0105240_10000168 3300009093 Bacteria 133212
209 Ga0105240_10000224 3300009093 Bacteria 113175
210 Ga0105240_10001324 3300009093 Bacteria 42710
211 Ga0105240_10004368 3300009093 Bacteria 21581
212 Ga0105240_10005950 3300009093 Bacteria 18048
213 Ga0105240_10007328 3300009093 Bacteria 16052
214 Ga0105240_10034786 3300009093 Bacteria 6496
215 Ga0105240_10035761 3300009093 Bacteria 6397
216 Ga0105240_10054554 3300009093 Bacteria 5008
217 Ga0105240_10094379 3300009093 Bacteria 3649
218 Ga0105240_10194099 3300009093 Bacteria 2386
219 Ga0111539_10032468 3300009094 Bacteria 6339
220 Ga0111539_10143468 3300009094 Bacteria 2795
221 Ga0105245_10025885 3300009098 Bacteria 5161
222 Ga0105241_10000169 3300009174 Bacteria 48051
223 Ga0105241_10000319 3300009174 Bacteria 36268
224 Ga0105241_10000578 3300009174 Bacteria 27595
225 Ga0105241_10000776 3300009174 Bacteria 24269
226 Ga0105241_10003320 3300009174 Bacteria 11971
227 Ga0105241_10008924 3300009174 Bacteria 7372
228 Ga0105241_10073520 3300009174 Unclassified 2660
229 Ga0105242_10137727 3300009176 Unclassified 2115
230 Ga0105248_10141399 3300009177 Bacteria 2715
231 Ga0105237_10000052 3300009545 Bacteria 160459
232 Ga0105237_10001301 3300009545 Bacteria 33228
233 Ga0105237_10003655 3300009545 Bacteria 18145
234 Ga0105237_10003711 3300009545 Bacteria 17988
235 Ga0105237_10007444 3300009545 Bacteria 11979
236 Ga0105237_10007588 3300009545 Bacteria 11857
237 Ga0105237_10008207 3300009545 Bacteria 11342
238 Ga0105237_10022438 3300009545 Bacteria 6476
239 Ga0105237_10045664 3300009545 Bacteria 4407
240 Ga0105237_10047019 3300009545 Bacteria 4338
241 Ga0105237_10136627 3300009545 Unclassified 2446
242 Ga0105238_10000198 3300009551 Bacteria 66586
243 Ga0105238_10014111 3300009551 Bacteria 8079
244 Ga0105238_10015881 3300009551 Bacteria 7618
245 Ga0105238_10071623 3300009551 Bacteria 3464
246 Ga0105249_10001077 3300009553 Bacteria 24238
247 Ga0105249_10004075 3300009553 Bacteria 12607
248 Ga0105249_10022927 3300009553 Bacteria 5597
249 Ga0105249_10022928 3300009553 Bacteria 5596
250 Ga0099796_10004036 3300010159 Bacteria 3498
251 Ga0105239_10000043 3300010375 Bacteria 196600
252 Ga0105239_10000270 3300010375 Bacteria 76875
253 Ga0105239_10000370 3300010375 Bacteria 66106
254 Ga0105239_10000578 3300010375 Bacteria 52273
255 Ga0105239_10000981 3300010375 Bacteria 40055
256 Ga0105239_10002131 3300010375 Bacteria 25480
257 Ga0105239_10002974 3300010375 Bacteria 21140
258 Ga0105239_10003513 3300010375 Bacteria 19193
259 Ga0105239_10009124 3300010375 Bacteria 11221
260 Ga0105239_10031048 3300010375 Bacteria 5877
261 Ga0105239_10048809 3300010375 Bacteria 4641
262 Ga0105239_10161533 3300010375 Bacteria 2503
263 Ga0157373_10000152 3300013100 Bacteria 55831
264 Ga0157373_10000464 3300013100 Bacteria 32220
265 Ga0157373_10006725 3300013100 Bacteria 8562
266 Ga0157373_10009314 3300013100 Bacteria 7260
267 Ga0157373_10015167 3300013100 Bacteria 5636
268 Ga0157373_10030507 3300013100 Bacteria 3880
269 Ga0157371_10000689 3300013102 Bacteria 39887
270 Ga0157371_10000749 3300013102 Bacteria 37566
271 Ga0157371_10001046 3300013102 Bacteria 30367
272 Ga0157371_10002152 3300013102 Bacteria 19201
273 Ga0157371_10003049 3300013102 Bacteria 15547
274 Ga0157371_10008186 3300013102 Bacteria 8359
275 Ga0157371_10009630 3300013102 Bacteria 7597
276 Ga0157371_10024416 3300013102 Bacteria 4414
277 Ga0157371_10062499 3300013102 Bacteria 2640
278 Ga0157370_10000479 3300013104 Bacteria 49878
279 Ga0157370_10002460 3300013104 Bacteria 22346
280 Ga0157370_10008425 3300013104 Bacteria 11123
281 Ga0157370_10050686 3300013104 Bacteria 3967
282 Ga0157370_10154322 3300013104 Bacteria 2136
283 Ga0157369_10001064 3300013105 Bacteria 34528
284 Ga0157369_10045179 3300013105 Bacteria 4792
285 Ga0157369_10062401 3300013105 Bacteria 4016
286 Ga0157369_10076084 3300013105 Bacteria 3598
287 Ga0157369_10082714 3300013105 Bacteria 3435
288 Ga0157369_10145907 3300013105 Bacteria 2502
289 Ga0157374_10000007 3300013296 Bacteria 595643
290 Ga0157374_10000079 3300013296 Bacteria 95883
291 Ga0157374_10000264 3300013296 Bacteria 48546
292 Ga0157374_10004484 3300013296 Bacteria 11725
293 Ga0157374_10004925 3300013296 Bacteria 11207
294 Ga0157374_10005864 3300013296 Bacteria 10373
295 Ga0157374_10007113 3300013296 Bacteria 9530
296 Ga0157374_10007634 3300013296 Bacteria 9231
297 Ga0157374_10015974 3300013296 Bacteria 6594
298 Ga0157374_10157011 3300013296 Bacteria 2215
299 Ga0157374_10160957 3300013296 Bacteria 2186
300 Ga0157378_10000134 3300013297 Bacteria 70195
301 Ga0157378_10000279 3300013297 Bacteria 49611
302 Ga0157378_10000549 3300013297 Bacteria 35656
303 Ga0157378_10007173 3300013297 Bacteria 9733
304 Ga0157378_10012935 3300013297 Bacteria 7301
305 Ga0157378_10025193 3300013297 Bacteria 5241
306 Ga0157378_10044018 3300013297 Bacteria 3963
307 Ga0157378_10090345 3300013297 Bacteria 2783
308 Ga0163162_10000288 3300013306 Bacteria 46072
309 Ga0163162_10000370 3300013306 Bacteria 40835
310 Ga0163162_10000785 3300013306 Bacteria 29535
311 Ga0163162_10002012 3300013306 Bacteria 19132
312 Ga0163162_10002932 3300013306 Bacteria 16276
313 Ga0163162_10005510 3300013306 Bacteria 12235
314 Ga0163162_10006472 3300013306 Bacteria 11340
315 Ga0163162_10013767 3300013306 Bacteria 7899
316 Ga0163162_10025204 3300013306 Bacteria 5877
317 Ga0163162_10050178 3300013306 Bacteria 4185
318 Ga0163162_10069505 3300013306 Bacteria 3574
319 Ga0157372_10000042 3300013307 Bacteria 157651
320 Ga0157372_10000476 3300013307 Bacteria 44270
321 Ga0157372_10001554 3300013307 Bacteria 24992
322 Ga0157372_10002120 3300013307 Bacteria 21568
323 Ga0157372_10005305 3300013307 Bacteria 13688
324 Ga0157372_10008021 3300013307 Bacteria 11230
325 Ga0157372_10014529 3300013307 Bacteria 8425
326 Ga0157372_10015554 3300013307 Bacteria 8154
327 Ga0157372_10029059 3300013307 Bacteria 6032
328 Ga0157372_10065533 3300013307 Bacteria 4079
329 Ga0157372_10084442 3300013307 Bacteria 3599
330 Ga0157372_10096608 3300013307 Bacteria 3368
331 Ga0157372_10113438 3300013307 Bacteria 3106
332 Ga0157372_10120177 3300013307 Bacteria 3017
333 Ga0157372_10132058 3300013307 Bacteria 2873
334 Ga0157375_10002060 3300013308 Bacteria 17358
335 Ga0157375_10044527 3300013308 Bacteria 4313
336 Ga0157375_10083886 3300013308 Bacteria 3233
337 Ga0157375_10130975 3300013308 Bacteria 2627
338 Ga0157375_10156042 3300013308 Unclassified 2421
339 Ga0163163_10006654 3300014325 Bacteria 10126
340 Ga0163163_10027369 3300014325 Bacteria 5460
341 Ga0163163_10031829 3300014325 Bacteria 5094
342 Ga0163163_10049855 3300014325 Bacteria 4121
343 Ga0163163_10076963 3300014325 Bacteria 3332
344 Ga0157380_10004889 3300014326 Bacteria 9336
345 Ga0182008_10000024 3300014497 Bacteria 199978
346 Ga0157379_10002887 3300014968 Bacteria 14494
347 Ga0157379_10013613 3300014968 Bacteria 7127
348 Ga0157379_10024953 3300014968 Bacteria 5306
349 Ga0157379_10025189 3300014968 Bacteria 5282
350 Ga0157379_10037079 3300014968 Bacteria 4347
351 Ga0157379_10047498 3300014968 Bacteria 3829
352 Ga0157379_10148777 3300014968 Unclassified 2112
353 Ga0157376_10001813 3300014969 Bacteria 14211
354 Ga0157376_10012790 3300014969 Bacteria 6242
355 Ga0157376_10019104 3300014969 Bacteria 5273
356 Ga0157376_10019653 3300014969 Bacteria 5212
357 Ga0157376_10027618 3300014969 Bacteria 4501
358 Ga0157376_10045731 3300014969 Bacteria 3606
359 Ga0157376_10061965 3300014969 Unclassified 3146
360 Ga0157376_10066861 3300014969 Bacteria 3039
361 Ga0182006_1014138 3300015261 Bacteria 3446
362 Ga0163161_10012799 3300017792 Bacteria 5828
363 Ga0163161_10044947 3300017792 Unclassified 3182
364 Ga0213872_10003201 3300021361 Bacteria 9169
365 Ga0213872_10004135 3300021361 Bacteria 7803
366 Ga0224569_100072 3300022732 Bacteria 6583
367 Ga0228598_1001851 3300024227 Bacteria 4605
368 Ga0228598_1002000 3300024227 Bacteria 4453
369 Ga0207427_100025 3300025231 Bacteria 433726
370 Ga0209437_100010 3300025233 Bacteria 838447
371 Ga0209437_100070 3300025233 Bacteria 306718
372 Ga0209026_1000301 3300025250 Bacteria 53883
373 Ga0209233_1000017 3300025261 Bacteria 898076
374 Ga0209455_1004625 3300025272 Bacteria 4446
375 Ga0207426_1000024 3300025302 Bacteria 534075
376 Ga0207682_10005490 3300025893 Bacteria 5164
377 Ga0207692_10001733 3300025898 Bacteria 8262
378 Ga0207692_10006488 3300025898 Bacteria 4745
379 Ga0207692_10028642 3300025898 Unclassified 2638
380 Ga0207642_10005445 3300025899 Unclassified 4158
381 Ga0207642_10018855 3300025899 Bacteria 2658
382 Ga0207680_10000543 3300025903 Bacteria 17912
383 Ga0207680_10009835 3300025903 Bacteria 4761
384 Ga0207647_10000043 3300025904 Bacteria 91109
385 Ga0207647_10000102 3300025904 Bacteria 66103
386 Ga0207647_10000900 3300025904 Bacteria 23009
387 Ga0207647_10001316 3300025904 Bacteria 19075
388 Ga0207647_10064739 3300025904 Bacteria 2221
389 Ga0207685_10009398 3300025905 Bacteria 2839
390 Ga0207645_10002569 3300025907 Bacteria 14159
391 Ga0207645_10007346 3300025907 Bacteria 7791
392 Ga0207705_10000026 3300025909 Bacteria 256051
393 Ga0207705_10000081 3300025909 Bacteria 118488
394 Ga0207705_10019298 3300025909 Bacteria 4875
395 Ga0207705_10039272 3300025909 Bacteria 3391
396 Ga0207684_10000398 3300025910 Bacteria 58071
397 Ga0207654_10000235 3300025911 Bacteria 33984
398 Ga0207654_10001369 3300025911 Bacteria 12925
399 Ga0207654_10003304 3300025911 Bacteria 8154
400 Ga0207654_10005463 3300025911 Bacteria 6428
401 Ga0207654_10030809 3300025911 Bacteria 2948
402 Ga0207707_10000721 3300025912 Bacteria 32676
403 Ga0207707_10012472 3300025912 Bacteria 7389
404 Ga0207707_10019352 3300025912 Bacteria 5943
405 Ga0207707_10020399 3300025912 Bacteria 5788
406 Ga0207707_10043275 3300025912 Bacteria 3928
407 Ga0207695_10000023 3300025913 Bacteria 657903
408 Ga0207695_10000031 3300025913 Bacteria 526801
409 Ga0207695_10000110 3300025913 Bacteria 250079
410 Ga0207695_10000262 3300025913 Bacteria 133005
411 Ga0207695_10000812 3300025913 Bacteria 58133
412 Ga0207695_10005266 3300025913 Bacteria 17253
413 Ga0207695_10013560 3300025913 Bacteria 9711
414 Ga0207695_10024212 3300025913 Bacteria 6836
415 Ga0207695_10026453 3300025913 Bacteria 6476
416 Ga0207695_10032923 3300025913 Bacteria 5665
417 Ga0207695_10048738 3300025913 Bacteria 4472
418 Ga0207695_10119214 3300025913 Bacteria 2609
419 Ga0207671_10002787 3300025914 Bacteria 18240
420 Ga0207671_10003201 3300025914 Bacteria 16484
421 Ga0207671_10003442 3300025914 Bacteria 15773
422 Ga0207671_10004509 3300025914 Bacteria 13258
423 Ga0207671_10005689 3300025914 Bacteria 11395
424 Ga0207671_10007249 3300025914 Bacteria 9659
425 Ga0207671_10011525 3300025914 Bacteria 7184
426 Ga0207671_10016565 3300025914 Bacteria 5724
427 Ga0207671_10017978 3300025914 Bacteria 5439
428 Ga0207671_10105198 3300025914 Unclassified 2141
429 Ga0207693_10001244 3300025915 Bacteria 22675
430 Ga0207663_10004252 3300025916 Bacteria 7103
431 Ga0207663_10031448 3300025916 Bacteria 3142
432 Ga0207660_10001254 3300025917 Bacteria 17002
433 Ga0207660_10001426 3300025917 Bacteria 16045
434 Ga0207660_10015959 3300025917 Bacteria 4965
435 Ga0207657_10002882 3300025919 Bacteria 18481
436 Ga0207657_10013145 3300025919 Bacteria 8130
437 Ga0207657_10040183 3300025919 Bacteria 4147
438 Ga0207649_10058674 3300025920 Unclassified 2411
439 Ga0207652_10000366 3300025921 Bacteria 46915
440 Ga0207652_10002045 3300025921 Bacteria 17358
441 Ga0207652_10035342 3300025921 Bacteria 4217
442 Ga0207652_10053982 3300025921 Unclassified 3453
443 Ga0207652_10064209 3300025921 Bacteria 3177
444 Ga0207646_10000194 3300025922 Bacteria 82991
445 Ga0207694_10003110 3300025924 Bacteria 13270
446 Ga0207694_10029048 3300025924 Bacteria 4217
447 Ga0207694_10032680 3300025924 Bacteria 3984
448 Ga0207694_10066240 3300025924 Bacteria 2817
449 Ga0207650_10006983 3300025925 Bacteria 7701
450 Ga0207700_10013881 3300025928 Bacteria 5261
451 Ga0207700_10047627 3300025928 Bacteria 3179
452 Ga0207700_10048114 3300025928 Bacteria 3165
453 Ga0207664_10002361 3300025929 Bacteria 12465
454 Ga0207664_10046497 3300025929 Unclassified 3406
455 Ga0207690_10017866 3300025932 Bacteria 4340
456 Ga0207706_10000044 3300025933 Bacteria 123576
457 Ga0207706_10023341 3300025933 Bacteria 5555
458 Ga0207706_10127102 3300025933 Bacteria 2241
459 Ga0207704_10001086 3300025938 Bacteria 12068
460 Ga0207704_10064558 3300025938 Bacteria 2288
461 Ga0207704_10081821 3300025938 Bacteria 2090
462 Ga0207665_10003445 3300025939 Bacteria 10581
463 Ga0207665_10005323 3300025939 Bacteria 8601
464 Ga0207665_10042924 3300025939 Bacteria 3023
465 Ga0207691_10000001 3300025940 Bacteria 220829
466 Ga0207711_10097116 3300025941 Bacteria 2601
467 Ga0207689_10000166 3300025942 Bacteria 57369
468 Ga0207689_10001614 3300025942 Bacteria 21366
469 Ga0207689_10001987 3300025942 Bacteria 19318
470 Ga0207689_10030022 3300025942 Unclassified 4532
471 Ga0207689_10060483 3300025942 Unclassified 3115
472 Ga0207689_10091530 3300025942 Unclassified 2499
473 Ga0207667_10000022 3300025949 Bacteria 369570
474 Ga0207667_10000144 3300025949 Bacteria 108295
475 Ga0207667_10001554 3300025949 Bacteria 28868
476 Ga0207667_10001980 3300025949 Bacteria 25670
477 Ga0207667_10002154 3300025949 Bacteria 24694
478 Ga0207667_10002374 3300025949 Bacteria 23561
479 Ga0207667_10003192 3300025949 Bacteria 20255
480 Ga0207667_10004214 3300025949 Bacteria 17648
481 Ga0207667_10005069 3300025949 Bacteria 16094
482 Ga0207667_10025618 3300025949 Bacteria 6453
483 Ga0207667_10026300 3300025949 Bacteria 6360
484 Ga0207667_10049025 3300025949 Bacteria 4463
485 Ga0207667_10058190 3300025949 Unclassified 4055
486 Ga0207667_10109905 3300025949 Unclassified 2844
487 Ga0207667_10157638 3300025949 Bacteria 2335
488 Ga0207651_10002700 3300025960 Bacteria 8502
489 Ga0207651_10068403 3300025960 Bacteria 2504
490 Ga0207712_10010403 3300025961 Bacteria 5906
491 Ga0207712_10012498 3300025961 Bacteria 5425
492 Ga0207712_10040562 3300025961 Bacteria 3196
493 Ga0207668_10002957 3300025972 Bacteria 9959
494 Ga0207640_10006656 3300025981 Bacteria 6348
495 Ga0207640_10044681 3300025981 Unclassified 2840
496 Ga0207658_10002549 3300025986 Bacteria 13238
497 Ga0207658_10049382 3300025986 Bacteria 3092
498 Ga0207677_10002241 3300026023 Bacteria 10147
499 Ga0207677_10002804 3300026023 Bacteria 9197
500 Ga0207677_10003282 3300026023 Bacteria 8552
501 Ga0207703_10001414 3300026035 Bacteria 21864
502 Ga0207703_10028669 3300026035 Bacteria 4391
503 Ga0207639_10005718 3300026041 Bacteria 8418
504 Ga0207639_10063382 3300026041 Unclassified 2862
505 Ga0207678_10001417 3300026067 Bacteria 21979
506 Ga0207678_10003224 3300026067 Bacteria 14742
507 Ga0207702_10001291 3300026078 Bacteria 25054
508 Ga0207702_10006466 3300026078 Bacteria 10103
509 Ga0207702_10011101 3300026078 Bacteria 7519
510 Ga0207702_10012221 3300026078 Bacteria 7144
511 Ga0207702_10020428 3300026078 Bacteria 5486
512 Ga0207702_10031494 3300026078 Bacteria 4420
513 Ga0207702_10046926 3300026078 Bacteria 3638
514 Ga0207702_10067825 3300026078 Bacteria 3063
515 Ga0207641_10000176 3300026088 Bacteria 88863
516 Ga0207641_10027718 3300026088 Bacteria 4680
517 Ga0207641_10028939 3300026088 Bacteria 4580
518 Ga0207641_10033647 3300026088 Unclassified 4258
519 Ga0207648_10002251 3300026089 Bacteria 20862
520 Ga0207648_10018584 3300026089 Bacteria 6291
521 Ga0207648_10055158 3300026089 Bacteria 3470
522 Ga0207676_10025947 3300026095 Bacteria 4351
523 Ga0207676_10085556 3300026095 Unclassified 2573
524 Ga0207674_10002833 3300026116 Bacteria 21566
525 Ga0207674_10005277 3300026116 Bacteria 15380
526 Ga0207674_10009215 3300026116 Bacteria 11314
527 Ga0207674_10051156 3300026116 Bacteria 4216
528 Ga0207674_10080291 3300026116 Bacteria 3265
529 Ga0207674_10082056 3300026116 Unclassified 3226
530 Ga0207675_100020554 3300026118 Bacteria 6153
531 Ga0207675_100026324 3300026118 Bacteria 5414
532 Ga0207683_10001589 3300026121 Bacteria 20496
533 Ga0207698_10006151 3300026142 Bacteria 7474
534 Ga0207698_10020378 3300026142 Bacteria 4563
535 Ga0207698_10036534 3300026142 Bacteria 3607
536 Ga0268266_10000014 3300028379 Bacteria 644033
537 Ga0268266_10003319 3300028379 Bacteria 16146
538 Ga0268266_10004612 3300028379 Bacteria 13153
539 Ga0268266_10012317 3300028379 Bacteria 7397
540 Ga0268266_10015592 3300028379 Bacteria 6513
541 Ga0268266_10040838 3300028379 Bacteria 3955
542 Ga0268266_10104402 3300028379 Bacteria 2502
543 Ga0268264_10000041 3300028381 Bacteria 372501
544 Ga0268264_10003033 3300028381 Bacteria 14561
545 Ga0268264_10004916 3300028381 Bacteria 11325
546 Ga0268264_10026431 3300028381 Bacteria 4743
547 Ga0268264_10031781 3300028381 Bacteria 4329
548 Ga0307517_10004917 3300028786 Bacteria 20360
549 Ga0307517_10083164 3300028786 Bacteria 2709
550 Ga0307515_10000107 3300028794 Bacteria 197046
551 Ga0307515_10000144 3300028794 Bacteria 170910
552 Ga0307515_10003557 3300028794 Bacteria 32734
553 Ga0307515_10076530 3300028794 Bacteria 4437
554 Ga0265338_10023165 3300028800 Bacteria 6395
555 Ga0307511_10000808 3300030521 Bacteria 33418
556 Ga0265762_1000173 3300030760 Bacteria 10249
557 Ga0265762_1000258 3300030760 Bacteria 8780
558 Ga0265760_10009115 3300031090 Bacteria 2835
559 Ga0265327_10000146 3300031251 Bacteria 154436
560 Ga0307513_10110629 3300031456 Bacteria 2741
561 Ga0307509_10026077 3300031507 Bacteria 6522
562 Ga0307509_10041505 3300031507 Bacteria 4992
563 Ga0307509_10075276 3300031507 Bacteria 3507
564 Ga0307508_10010293 3300031616 Bacteria 8556
565 Ga0307516_10001744 3300031730 Bacteria 29907
566 Ga0307413_10025147 3300031824 Bacteria 3259
567 Ga0307412_10000030 3300031911 Bacteria 208541
568 Ga0307414_10011176 3300032004 Bacteria 5253
569 Ga0307510_10001458 3300033180 Bacteria 26051
570 Ga0373934_0010268 3300035086 Bacteria 3514
571 Ga0373936_0017090 3300035113 Unclassified 2791
572 Ga0373956_0006681 3300035119 Bacteria 4627
573 Ga0373931_0055954 3300035691 Bacteria 2112
574 Ga0373935_0080200 3300035692 Bacteria 2120
575 Ga0373933_0000470 3300035724 Bacteria 25182
576 Ga0373933_0009387 3300035724 Bacteria 5344
577 Ga0373937_0000051 3300036401 Bacteria 104818
578 Ga0373937_0022929 3300036401 Bacteria 5614
579 Ga0373937_0024157 3300036401 Bacteria 5479
580 Ga0373925_0002014 3300037068 Bacteria 16828
581 Ga0395899_0000401 3300037312 Bacteria 50789
582 Ga0395899_0003295 3300037312 Bacteria 12804
583 Ga0395899_0037693 3300037312 Bacteria 3624
584 Ga0395899_0039707 3300037312 Bacteria 3521
585 Ga0395900_0021037 3300037418 Bacteria 6667
586 Ga0395900_0038610 3300037418 Bacteria 4922
587 Ga0395900_0159718 3300037418 Bacteria 2299
588 Ga0395898_0033448 3300037466 Bacteria 5131
589 Ga0395905_0001841 3300037471 Bacteria 24475
590 Ga0395905_0003680 3300037471 Bacteria 16238
591 Ga0395905_0011240 3300037471 Bacteria 8654
592 Ga0395905_0059953 3300037471 Unclassified 3558
593 Ga0436364_0372332 3300037853 Bacteria 18280
594 Ga0436364_0871624 3300037853 Bacteria 117373
595 Ga0436364_1460474 3300037853 Bacteria 2694
596 Ga0395901_0000722 3300038443 Bacteria 37562
597 Ga0395901_0010861 3300038443 Bacteria 9229
598 Ga0436365_0793046 3300039437 Bacteria 2745
599 Ga0436360_0150364 3300039438 Bacteria 5156
600 Ga0436360_1278397 3300039438 Bacteria 18835
601 Ga0436361_0072947 3300039447 Bacteria 4662
602 Ga0436361_0130986 3300039447 Bacteria 11891
603 Ga0436363_0218926 3300039450 Bacteria 6114
604 Ga0436362_1196168 3300039453 Bacteria 10009
605 Ga0466969_0000972 3300044656 Bacteria 15442
606 Ga0466972_0000007 3300044658 Bacteria 277010
607 Ga0466966_0000018 3300044684 Bacteria 122605
608 Ga0466961_0076050 3300044693 Bacteria 2128
609 Ga0466963_0014163 3300044694 Bacteria 4914
610 Ga0466964_0022634 3300044706 Bacteria 2440
611 Ga0466957_0002210 3300044842 Bacteria 10434
612 Ga0466959_0000002 3300045049 Bacteria 362671
613 Ga0451576_0008203 3300045051 Bacteria 12295
614 Ga0451576_0058438 3300045051 Bacteria 4030
615 Ga0451576_0063258 3300045051 Bacteria 3857
616 Ga0451576_0154676 3300045051 Bacteria 2392
617 Ga0466958_0017331 3300045836 Bacteria 4162
618 Ga0495592_0035834 3300046454 Bacteria 3739
619 Ga0495629_0010544 3300046459 Bacteria 6725
620 Ga0495638_0011001 3300046460 Bacteria 6257
621 Ga0495651_0007694 3300046462 Bacteria 8239
622 Ga0495651_0008741 3300046462 Bacteria 7769
623 Ga0495651_0088748 3300046462 Bacteria 2323
624 Ga0495651_0098308 3300046462 Unclassified 2184
625 Ga0495650_0000022 3300046471 Bacteria 530747
626 Ga0495650_0007377 3300046471 Bacteria 6617
627 Ga0495650_0020756 3300046471 Unclassified 3195
628 Ga0495580_0002060 3300046472 Bacteria 17664
629 Ga0495580_0006959 3300046472 Bacteria 9123
630 Ga0495580_0007312 3300046472 Bacteria 8881
631 Ga0495580_0019360 3300046472 Bacteria 5058
632 Ga0495580_0100461 3300046472 Bacteria 2012
633 Ga0495582_0000342 3300046473 Bacteria 25603
634 Ga0495582_0021119 3300046473 Bacteria 3565
635 Ga0495662_0005651 3300046476 Bacteria 6250
636 Ga0495664_0004651 3300046477 Bacteria 7509
637 Ga0495585_0003372 3300046492 Bacteria 10813
638 Ga0495594_0001240 3300046499 Bacteria 13361
639 Ga0495594_0002472 3300046499 Bacteria 9625
640 Ga0495606_0010358 3300046507 Bacteria 7747
641 Ga0495606_0033722 3300046507 Bacteria 3526
642 Ga0495606_0072148 3300046507 Bacteria 2171
643 Ga0495628_0021608 3300046516 Bacteria 5291
644 Ga0495630_0006029 3300046517 Bacteria 8582
645 Ga0495630_0039277 3300046517 Bacteria 3540
646 Ga0495630_0112712 3300046517 Bacteria 2060
647 Ga0495643_0032638 3300046522 Bacteria 2888
648 Ga0495644_0000020 3300046523 Bacteria 83035
649 Ga0495644_0001921 3300046523 Bacteria 8358
650 Ga0495648_0013439 3300046524 Bacteria 6052
651 Ga0495648_0028456 3300046524 Bacteria 3722
652 Ga0495665_0001294 3300046531 Bacteria 13356
653 Ga0495665_0018016 3300046531 Bacteria 3796
654 Ga0495587_0000381 3300046536 Bacteria 31640
655 Ga0495587_0039774 3300046536 Bacteria 2813
656 Ga0495609_0018416 3300046538 Bacteria 3236
657 Ga0495645_0010375 3300046543 Bacteria 6528
658 Ga0495633_0000027 3300046558 Bacteria 204613
659 Ga0495668_0000010 3300046616 Bacteria 487308
660 Ga0495668_0043313 3300046616 Bacteria 2504
661 Ga0495634_0002267 3300046642 Bacteria 16124
662 Ga0495611_0000100 3300046648 Bacteria 59688
663 Ga0495625_0000381 3300046660 Bacteria 67732
664 Ga0495625_0000450 3300046660 Bacteria 61820
665 Ga0495625_0000939 3300046660 Bacteria 39095
666 Ga0495625_0015468 3300046660 Bacteria 6043
667 Ga0495625_0024679 3300046660 Bacteria 4571
668 Ga0495625_0059881 3300046660 Bacteria 2700
669 Ga0495588_0008235 3300046674 Bacteria 4774
670 Ga0495599_0002927 3300046678 Bacteria 9930
671 Ga0495623_0016773 3300046679 Bacteria 4733
672 Ga0495623_0033499 3300046679 Bacteria 3296
673 Ga0495623_0037207 3300046679 Bacteria 3116
674 Ga0495623_0052046 3300046679 Bacteria 2589
675 Ga0495613_0005798 3300046689 Bacteria 9245
676 Ga0495613_0086318 3300046689 Bacteria 2276
677 Ga0495649_0014016 3300046694 Bacteria 4609
678 Ga0495604_0018641 3300047317 Bacteria 5560
679 Ga0495604_0044907 3300047317 Bacteria 3449
680 Ga0495604_0087328 3300047317 Bacteria 2323
681 Ga0495674_0025828 3300047319 Bacteria 5377
682 Ga0495672_0001375 3300047320 Bacteria 23991
683 Ga0495672_0070623 3300047320 Bacteria 1978
684 Ga0495680_0040322 3300047322 Bacteria 3721
685 Ga0495680_0063104 3300047322 Bacteria 2846
686 Ga0495683_0028971 3300047323 Bacteria 2830
687 Ga0495687_000001 3300047443 Bacteria 1215582
688 Ga0495675_0006576 3300047444 Bacteria 7118
689 Ga0495675_0065938 3300047444 Bacteria 2289
690 Ga0495677_0022648 3300047445 Bacteria 2279
691 Ga0495684_0010156 3300047471 Bacteria 7281
692 Ga0495684_0016716 3300047471 Bacteria 5653
693 Ga0495686_0000004 3300047472 Bacteria 869019
694 Ga0495686_0000031 3300047472 Bacteria 350171
695 Ga0495686_0001061 3300047472 Bacteria 32862
696 Ga0495686_0001778 3300047472 Bacteria 21957
697 Ga0495602_0000048 3300048088 Bacteria 116248
698 Ga0495602_0128051 3300048088 Unclassified 2030
699 Ga0495614_0007939 3300048089 Bacteria 4715
700 Ga0495615_0003788 3300048090 Bacteria 2570
701 Ga0496101_0032829 3300048904 Bacteria 3657
702 Ga0496102_0029575 3300048905 Bacteria 4902
703 Ga0496102_0130377 3300048905 Bacteria 2353
704 Ga0496104_0000050 3300048907 Bacteria 143556
705 Ga0496104_0012291 3300048907 Bacteria 7696
706 Ga0496105_0005478 3300048908 Bacteria 9633
707 Ga0496107_0077750 3300048910 Bacteria 2417
708 Ga0496112_0003084 3300048915 Bacteria 13653
709 Ga0496112_0004578 3300048915 Bacteria 11754
710 Ga0496112_0025884 3300048915 Bacteria 5638
711 Ga0496112_0158290 3300048915 Bacteria 2231
712 Ga0496113_0025684 3300048916 Bacteria 4202
713 Ga0496114_0056201 3300048917 Bacteria 3284
714 Ga0496114_0118475 3300048917 Bacteria 2275
715 Ga0496115_0019460 3300048918 Bacteria 5225
716 Ga0496117_0014403 3300048920 Bacteria 6815
717 Ga0496118_0005063 3300048921 Bacteria 15173
718 Ga0496118_0005243 3300048921 Bacteria 14821
719 Ga0496119_0000531 3300048922 Bacteria 51990
720 Ga0496120_0000182 3300048923 Bacteria 107094
721 Ga0496126_0000020 3300048929 Bacteria 490805
722 Ga0496126_0000130 3300048929 Bacteria 173900
723 Ga0496126_0001108 3300048929 Bacteria 45172
724 Ga0496126_0003894 3300048929 Bacteria 18354
725 Ga0496126_0128415 3300048929 Bacteria 2192
726 Ga0495678_015285 3300049459 Bacteria 3538
727 Ga0501032_0005435 3300049569 Bacteria 9459
728 Ga0501032_0037103 3300049569 Unclassified 3325
729 Ga0501033_0002918 3300049570 Bacteria 14305
730 Ga0501033_0016474 3300049570 Bacteria 5599
731 Ga0501034_0003395 3300049571 Bacteria 18186
732 Ga0501034_0061940 3300049571 Bacteria 3756
733 Ga0501034_0068104 3300049571 Unclassified 3571
734 Ga0501036_0000910 3300049572 Bacteria 22168
735 Ga0501036_0007747 3300049572 Bacteria 8779
736 Ga0501037_0001569 3300049573 Bacteria 16649
737 Ga0501037_0010636 3300049573 Bacteria 6762
738 Ga0501038_0001130 3300049574 Bacteria 24207
739 Ga0501038_0005645 3300049574 Bacteria 11608
740 Ga0501038_0016485 3300049574 Bacteria 6696
741 Ga0501039_0007035 3300049575 Bacteria 8563
742 Ga0501039_0085294 3300049575 Bacteria 2460
743 Ga0501042_0009219 3300049578 Bacteria 6565
744 Ga0501043_0007381 3300049579 Bacteria 8724
745 Ga0501043_0008002 3300049579 Bacteria 8343
746 Ga0501046_0002534 3300049580 Bacteria 17086
747 Ga0501046_0010481 3300049580 Bacteria 7955
748 Ga0501047_0002976 3300049581 Bacteria 16067
749 Ga0501047_0010418 3300049581 Bacteria 8796
750 Ga0501047_0018973 3300049581 Bacteria 6596
751 Ga0501047_0026303 3300049581 Bacteria 5598
752 Ga0501048_0017623 3300049582 Bacteria 5258
753 Ga0501067_0006094 3300049583 Bacteria 6686
754 Ga0501068_0008546 3300049584 Bacteria 5702
755 Ga0501069_0000155 3300049585 Bacteria 30339
756 Ga0501070_0021406 3300049586 Bacteria 5424
757 Ga0501070_0045641 3300049586 Bacteria 3644
758 Ga0501070_0080596 3300049586 Bacteria 2694
759 Ga0501070_0092157 3300049586 Bacteria 2508
760 Ga0501072_0002255 3300049588 Bacteria 14406
761 Ga0501072_0027699 3300049588 Bacteria 4420
762 Ga0501073_0002338 3300049589 Bacteria 14194
763 Ga0501073_0011241 3300049589 Bacteria 6548
764 Ga0501074_0101990 3300049590 Bacteria 2054
765 Ga0501076_0072607 3300049592 Bacteria 2754
766 Ga0501217_000173 3300049661 Bacteria 9361
767 Ga0501233_001763 3300049668 Bacteria 3736
768 Ga0501079_0010815 3300049741 Bacteria 6949
769 Ga0501080_0014429 3300049742 Bacteria 7276
770 Ga0501083_0014288 3300049744 Bacteria 5552
771 Ga0501035_0007075 3300049822 Bacteria 10486
772 Ga0501035_0009965 3300049822 Bacteria 8820
773 Ga0501035_0013011 3300049822 Bacteria 7678
774 Ga0501044_0000903 3300049823 Bacteria 35807
775 Ga0501044_0020988 3300049823 Bacteria 6974
776 Ga0501044_0021923 3300049823 Bacteria 6811
777 Ga0501044_0055618 3300049823 Bacteria 4064
778 Ga0501044_0077668 3300049823 Bacteria 3367
779 nmdc:mga0k408_2754_c1 3300050493 Bacteria 9344
780 nmdc:mga0k408_7363_c1 3300050493 Bacteria 5878
781 nmdc:mga09592_47844_c1 3300050508 Bacteria 3605
782 nmdc:mga0qj67_6396_c1 3300050509 Bacteria 8655
783 nmdc:mga08y16_12657_c1 3300050511 Bacteria 8874
784 nmdc:mga08y16_22607_c1 3300050511 Bacteria 6639
785 nmdc:mga0n895_338_c1 3300050512 Bacteria 31338
786 nmdc:mga0n895_3571_c1 3300050512 Bacteria 12577
787 nmdc:mga0rr50_3538_c1 3300050513 Bacteria 9015
788 nmdc:mga08x19_16802_c1 3300050514 Bacteria 4469
789 nmdc:mga08x19_24037_c1 3300050514 Bacteria 3783
790 nmdc:mga0a205_9848_c1 3300050515 Bacteria 8767
791 Ga0500635_0000598 3300053080 Bacteria 9548
792 Ga0495619_0016053 3300053085 Bacteria 4741
793 Ga0500583_0001469 3300053092 Bacteria 6770
794 Ga0500651_0000003 3300053093 Bacteria 422045
795 Ga0500651_0000462 3300053093 Bacteria 21501
796 Ga0500555_000117 3300053103 Bacteria 37913
797 Ga0500595_000005 3300053119 Bacteria 340896
798 Ga0500608_007533 3300053122 Bacteria 4512
799 Ga0500573_0028767 3300053140 Bacteria 3202
800 Ga0500616_0000204 3300053153 Bacteria 96997
801 Ga0500622_0003562 3300053156 Bacteria 10288
802 Ga0500624_000397 3300053157 Bacteria 13683
803 Ga0500645_000345 3300053730 Bacteria 33099
804 Ga0501084_0001521 3300054114 Bacteria 18403
805 Ga0501082_0001743 3300060353 Bacteria 19195
806 Ga0501082_0022216 3300060353 Bacteria 5467
807 Ga0501082_0079798 3300060353 Bacteria 2824
808 Ga0530510_0002645 3300061734 Bacteria 12315

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0059881 Ga0495625_0059881_15_1550 499
2 3300035113 Ga0373936_0017090 Ga0373936_0017090_23_1552 509
3 3300005434 Ga0070709_10076770 Ga0070709_100767702 514
4 3300049575 Ga0501039_0085294 Ga0501039_0085294_717_2378 546
5 3300009093 Ga0105240_10054554 Ga0105240_100545541 550
6 3300046507 Ga0495606_0010358 Ga0495606_0010358_153_1847 551
7 3300046472 Ga0495580_0100461 Ga0495580_0100461_281_1945 554
8 3300005563 Ga0068855_100099240 Ga0068855_1000992403 555
9 3300025913 Ga0207695_10000031 Ga0207695_10000031308 556
10 3300044706 Ga0466964_0022634 Ga0466964_0022634_555_2273 556
11 3300046471 Ga0495650_0007377 Ga0495650_0007377_1329_3041 558
12 3300005355 Ga0070671_100038052 Ga0070671_1000380522 559
13 3300035119 Ga0373956_0006681 Ga0373956_0006681_19_1737 559
14 3300031824 Ga0307413_10025147 Ga0307413_100251472 560
15 3300032004 Ga0307414_10011176 Ga0307414_100111762 560
16 3300037312 Ga0395899_0037693 Ga0395899_0037693_1855_3546 562
17 3300047317 Ga0495604_0087328 Ga0495604_0087328_545_2287 567
18 3300013306 Ga0163162_10002012 Ga0163162_100020125 568
19 3300047443 Ga0495687_000001 Ga0495687_000001_39855_41579 568
20 3300009545 Ga0105237_10008207 Ga0105237_100082076 569
21 3300010375 Ga0105239_10009124 Ga0105239_100091245 569
22 3300013100 Ga0157373_10030507 Ga0157373_100305073 569
23 3300009093 Ga0105240_10005950 Ga0105240_100059507 570
24 3300009174 Ga0105241_10000578 Ga0105241_1000057826 570
25 3300013105 Ga0157369_10062401 Ga0157369_100624012 570
26 3300013296 Ga0157374_10000079 Ga0157374_1000007952 570
27 3300013307 Ga0157372_10000042 Ga0157372_100000424 570
28 3300013307 Ga0157372_10132058 Ga0157372_101320581 570
29 3300037312 Ga0395899_0000401 Ga0395899_0000401_696_2414 570
30 3300045836 Ga0466958_0017331 Ga0466958_0017331_1680_3398 570
31 3300003320 rootH2_10000327 rootH2_1000032719 571
32 3300046517 Ga0495630_0112712 Ga0495630_0112712_53_1774 571
33 3300046660 Ga0495625_0015468 Ga0495625_0015468_4166_5881 571
34 3300039450 Ga0436363_0218926 Ga0436363_0218926_3675_5507 572
35 3300050512 nmdc:mga0n895_338_c1 nmdc:mga0n895_338_c1_29602_31320 572
36 3300048929 Ga0496126_0000020 Ga0496126_0000020_352134_353891 573
37 3300047317 Ga0495604_0018641 Ga0495604_0018641_184_2019 574
38 3300013100 Ga0157373_10009314 Ga0157373_100093145 577
39 3300039437 Ga0436365_0793046 Ga0436365_0793046_598_2430 577
40 3300005563 Ga0068855_100068978 Ga0068855_1000689783 578
41 3300005577 Ga0068857_100040949 Ga0068857_1000409498 578
42 3300005614 Ga0068856_100091069 Ga0068856_1000910693 578
43 3300009545 Ga0105237_10045664 Ga0105237_100456642 578
44 3300025949 Ga0207667_10157638 Ga0207667_101576382 578
45 3300026078 Ga0207702_10067825 Ga0207702_100678252 578
46 3300026116 Ga0207674_10080291 Ga0207674_100802912 578
47 3300049574 Ga0501038_0016485 Ga0501038_0016485_3041_4846 578
48 3300049823 Ga0501044_0055618 Ga0501044_0055618_443_2248 578
49 3300009094 Ga0111539_10032468 Ga0111539_100324682 579
50 3300044693 Ga0466961_0076050 Ga0466961_0076050_101_1846 579
51 3300048090 Ga0495615_0003788 Ga0495615_0003788_454_2232 579
52 3300050511 nmdc:mga08y16_22607_c1 nmdc:mga08y16_22607_c1_1976_3715 579
53 3300009098 Ga0105245_10025885 Ga0105245_100258852 580
54 3300013297 Ga0157378_10000134 Ga0157378_1000013426 580
55 3300045051 Ga0451576_0154676 Ga0451576_0154676_608_2350 580
56 3300046689 Ga0495613_0086318 Ga0495613_0086318_299_2041 580
57 3300047322 Ga0495680_0040322 Ga0495680_0040322_74_1816 580
58 3300046674 Ga0495588_0008235 Ga0495588_0008235_2757_4571 585
59 3300005535 Ga0070684_100096428 Ga0070684_1000964282 587
60 3300005539 Ga0068853_100100389 Ga0068853_1001003892 587
61 3300005614 Ga0068856_100179104 Ga0068856_1001791042 587
62 3300009174 Ga0105241_10073520 Ga0105241_100735202 587
63 3300009545 Ga0105237_10136627 Ga0105237_101366272 587
64 3300026041 Ga0207639_10005718 Ga0207639_100057188 587
65 3300026142 Ga0207698_10036534 Ga0207698_100365342 587
66 3300031730 Ga0307516_10001744 Ga0307516_1000174412 587
67 3300035086 Ga0373934_0010268 Ga0373934_0010268_952_2808 587
68 3300035724 Ga0373933_0000470 Ga0373933_0000470_6084_7940 587
69 3300036401 Ga0373937_0000051 Ga0373937_0000051_73352_75208 587
70 3300046462 Ga0495651_0008741 Ga0495651_0008741_5381_7237 587
71 3300046536 Ga0495587_0000381 Ga0495587_0000381_28979_30835 587
72 3300046679 Ga0495623_0016773 Ga0495623_0016773_1211_3067 587
73 3300047444 Ga0495675_0006576 Ga0495675_0006576_4814_6670 587
74 3300048088 Ga0495602_0000048 Ga0495602_0000048_36004_37860 587
75 3300005295 Ga0065707_10103932 Ga0065707_101039321 588
76 3300009093 Ga0105240_10000168 Ga0105240_1000016841 588
77 3300013102 Ga0157371_10001046 Ga0157371_1000104624 588
78 3300046616 Ga0495668_0000010 Ga0495668_0000010_26909_28678 588
79 3300005578 Ga0068854_100009116 Ga0068854_1000091164 589
80 3300005616 Ga0068852_100000649 Ga0068852_1000006496 589
81 3300009551 Ga0105238_10071623 Ga0105238_100716232 589
82 3300025920 Ga0207649_10058674 Ga0207649_100586741 589
83 3300025924 Ga0207694_10029048 Ga0207694_100290483 589
84 3300025928 Ga0207700_10048114 Ga0207700_100481142 589
85 3300025949 Ga0207667_10004214 Ga0207667_1000421416 589
86 3300025981 Ga0207640_10006656 Ga0207640_100066563 589
87 3300026116 Ga0207674_10005277 Ga0207674_1000527715 589
88 3300047472 Ga0495686_0001061 Ga0495686_0001061_28646_30463 589
89 3300049592 Ga0501076_0072607 Ga0501076_0072607_15_1784 589
90 3300005327 Ga0070658_10110586 Ga0070658_101105862 590
91 3300005983 Ga0081540_1012173 Ga0081540_10121733 590
92 3300046492 Ga0495585_0003372 Ga0495585_0003372_8060_9883 590
93 3300046499 Ga0495594_0001240 Ga0495594_0001240_2367_4190 590
94 3300046523 Ga0495644_0000020 Ga0495644_0000020_314_2137 590
95 3300046538 Ga0495609_0018416 Ga0495609_0018416_1257_3080 590
96 3300046616 Ga0495668_0043313 Ga0495668_0043313_492_2315 590
97 3300047445 Ga0495677_0022648 Ga0495677_0022648_185_2008 590
98 3300005327 Ga0070658_10000074 Ga0070658_100000745 591
99 3300005548 Ga0070665_100032975 Ga0070665_1000329752 591
100 3300005841 Ga0068863_100057605 Ga0068863_1000576052 591
101 3300013104 Ga0157370_10050686 Ga0157370_100506862 591
102 3300013306 Ga0163162_10000370 Ga0163162_1000037029 591
103 3300013306 Ga0163162_10025204 Ga0163162_100252043 591
104 3300014325 Ga0163163_10006654 Ga0163163_100066542 591
105 3300021361 Ga0213872_10004135 Ga0213872_100041352 591
106 3300025909 Ga0207705_10000081 Ga0207705_1000008123 591
107 3300025949 Ga0207667_10001980 Ga0207667_100019802 591
108 3300028379 Ga0268266_10012317 Ga0268266_100123172 591
109 3300028379 Ga0268266_10015592 Ga0268266_100155923 591
110 3300028379 Ga0268266_10040838 Ga0268266_100408382 591
111 3300031251 Ga0265327_10000146 Ga0265327_1000014699 591
112 3300039438 Ga0436360_0150364 Ga0436360_0150364_1792_3618 591
113 3300039438 Ga0436360_1278397 Ga0436360_1278397_13636_15462 591
114 3300039447 Ga0436361_0072947 Ga0436361_0072947_2363_4189 591
115 3300039447 Ga0436361_0130986 Ga0436361_0130986_4460_6286 591
116 3300046459 Ga0495629_0010544 Ga0495629_0010544_2568_4394 591
117 3300046462 Ga0495651_0007694 Ga0495651_0007694_6137_7963 591
118 3300046462 Ga0495651_0088748 Ga0495651_0088748_285_2111 591
119 3300046472 Ga0495580_0019360 Ga0495580_0019360_1513_3339 591
120 3300046473 Ga0495582_0021119 Ga0495582_0021119_498_2324 591
121 3300046476 Ga0495662_0005651 Ga0495662_0005651_3260_5086 591
122 3300046477 Ga0495664_0004651 Ga0495664_0004651_3547_5373 591
123 3300046499 Ga0495594_0002472 Ga0495594_0002472_3540_5366 591
124 3300046507 Ga0495606_0033722 Ga0495606_0033722_1616_3442 591
125 3300046516 Ga0495628_0021608 Ga0495628_0021608_2605_4431 591
126 3300046517 Ga0495630_0039277 Ga0495630_0039277_1192_3018 591
127 3300046531 Ga0495665_0001294 Ga0495665_0001294_4113_5939 591
128 3300046543 Ga0495645_0010375 Ga0495645_0010375_4614_6440 591
129 3300046642 Ga0495634_0002267 Ga0495634_0002267_14007_15833 591
130 3300046660 Ga0495625_0000450 Ga0495625_0000450_25463_27289 591
131 3300046660 Ga0495625_0024679 Ga0495625_0024679_560_2386 591
132 3300046678 Ga0495599_0002927 Ga0495599_0002927_6882_8708 591
133 3300046679 Ga0495623_0037207 Ga0495623_0037207_1013_2839 591
134 3300046689 Ga0495613_0005798 Ga0495613_0005798_3165_4991 591
135 3300047317 Ga0495604_0044907 Ga0495604_0044907_59_1885 591
136 3300047319 Ga0495674_0025828 Ga0495674_0025828_22_1848 591
137 3300047320 Ga0495672_0001375 Ga0495672_0001375_19167_20993 591
138 3300047322 Ga0495680_0063104 Ga0495680_0063104_812_2638 591
139 3300047323 Ga0495683_0028971 Ga0495683_0028971_303_2129 591
140 3300048089 Ga0495614_0007939 Ga0495614_0007939_512_2338 591
141 3300048917 Ga0496114_0056201 Ga0496114_0056201_871_2697 591
142 3300048917 Ga0496114_0118475 Ga0496114_0118475_333_2162 591
143 3300048929 Ga0496126_0000130 Ga0496126_0000130_131235_133061 591
144 3300049571 Ga0501034_0003395 Ga0501034_0003395_3642_5468 591
145 3300049572 Ga0501036_0007747 Ga0501036_0007747_1784_3610 591
146 3300049574 Ga0501038_0001130 Ga0501038_0001130_5996_7822 591
147 3300049579 Ga0501043_0007381 Ga0501043_0007381_1031_2857 591
148 3300049580 Ga0501046_0002534 Ga0501046_0002534_13929_15755 591
149 3300049581 Ga0501047_0002976 Ga0501047_0002976_2805_4631 591
150 3300049589 Ga0501073_0002338 Ga0501073_0002338_3869_5695 591
151 3300049822 Ga0501035_0007075 Ga0501035_0007075_2665_4491 591
152 3300049823 Ga0501044_0021923 Ga0501044_0021923_3869_5695 591
153 3300053119 Ga0500595_000005 Ga0500595_000005_56323_58149 591
154 3300006173 Ga0070716_100035785 Ga0070716_1000357852 592
155 3300009174 Ga0105241_10008924 Ga0105241_100089242 592
156 3300013296 Ga0157374_10005864 Ga0157374_100058643 592
157 3300013306 Ga0163162_10000288 Ga0163162_1000028814 592
158 3300014968 Ga0157379_10002887 Ga0157379_100028875 592
159 3300014968 Ga0157379_10047498 Ga0157379_100474982 592
160 3300025911 Ga0207654_10030809 Ga0207654_100308092 592
161 3300048905 Ga0496102_0029575 Ga0496102_0029575_1741_3558 592
162 3300048907 Ga0496104_0012291 Ga0496104_0012291_54_1871 592
163 3300053085 Ga0495619_0016053 Ga0495619_0016053_82_1899 592
164 3300005437 Ga0070710_10016203 Ga0070710_100162032 593
165 3300005439 Ga0070711_100001977 Ga0070711_1000019775 593
166 3300005445 Ga0070708_100030444 Ga0070708_1000304441 593
167 3300005536 Ga0070697_100001102 Ga0070697_10000110215 593
168 3300006173 Ga0070716_100010951 Ga0070716_1000109512 593
169 3300006175 Ga0070712_100000876 Ga0070712_10000087610 593
170 3300013105 Ga0157369_10045179 Ga0157369_100451792 593
171 3300025898 Ga0207692_10006488 Ga0207692_100064882 593
172 3300025905 Ga0207685_10009398 Ga0207685_100093982 593
173 3300025915 Ga0207693_10001244 Ga0207693_1000124410 593
174 3300025916 Ga0207663_10004252 Ga0207663_100042521 593
175 3300025928 Ga0207700_10013881 Ga0207700_100138812 593
176 3300025939 Ga0207665_10005323 Ga0207665_100053232 593
177 3300005439 Ga0070711_100021677 Ga0070711_1000216772 594
178 3300013297 Ga0157378_10090345 Ga0157378_100903452 594
179 3300025916 Ga0207663_10031448 Ga0207663_100314482 594
180 3300046471 Ga0495650_0000022 Ga0495650_0000022_487109_488893 594
181 3300048910 Ga0496107_0077750 Ga0496107_0077750_557_2374 594
182 3300005548 Ga0070665_100000041 Ga0070665_100000041155 595
183 3300005843 Ga0068860_100000208 Ga0068860_10000020857 595
184 3300009545 Ga0105237_10047019 Ga0105237_100470192 595
185 3300028379 Ga0268266_10000014 Ga0268266_1000001440 595
186 3300028381 Ga0268264_10000041 Ga0268264_1000004126 595
187 3300053092 Ga0500583_0001469 Ga0500583_0001469_2734_4554 595
188 3300053156 Ga0500622_0003562 Ga0500622_0003562_6213_8033 595
189 3300003323 rootH1_10126443 rootH1_101264432 596
190 3300005327 Ga0070658_10000230 Ga0070658_1000023046 596
191 3300005328 Ga0070676_10001002 Ga0070676_1000100216 596
192 3300005335 Ga0070666_10001005 Ga0070666_100010056 596
193 3300005335 Ga0070666_10024138 Ga0070666_100241384 596
194 3300005338 Ga0068868_100005239 Ga0068868_1000052396 596
195 3300005344 Ga0070661_100062757 Ga0070661_1000627571 596
196 3300005344 Ga0070661_100107872 Ga0070661_1001078721 596
197 3300005347 Ga0070668_100009328 Ga0070668_1000093285 596
198 3300005364 Ga0070673_100000096 Ga0070673_1000000963 596
199 3300005364 Ga0070673_100030771 Ga0070673_1000307712 596
200 3300005365 Ga0070688_100009314 Ga0070688_1000093142 596
201 3300005366 Ga0070659_100123379 Ga0070659_1001233791 596
202 3300005367 Ga0070667_100002462 Ga0070667_1000024625 596
203 3300005457 Ga0070662_100008816 Ga0070662_1000088165 596
204 3300005457 Ga0070662_100018002 Ga0070662_1000180024 596
205 3300005457 Ga0070662_100099864 Ga0070662_1000998641 596
206 3300005459 Ga0068867_100106407 Ga0068867_1001064071 596
207 3300005466 Ga0070685_10018240 Ga0070685_100182401 596
208 3300005543 Ga0070672_100000033 Ga0070672_1000000333 596
209 3300005544 Ga0070686_100094564 Ga0070686_1000945642 596
210 3300005548 Ga0070665_100001625 Ga0070665_1000016253 596
211 3300005563 Ga0068855_100065776 Ga0068855_1000657763 596
212 3300005616 Ga0068852_100022599 Ga0068852_1000225993 596
213 3300005617 Ga0068859_100110964 Ga0068859_1001109643 596
214 3300005618 Ga0068864_100003380 Ga0068864_10000338010 596
215 3300005618 Ga0068864_100100603 Ga0068864_1001006031 596
216 3300005718 Ga0068866_10052792 Ga0068866_100527922 596
217 3300005719 Ga0068861_100001398 Ga0068861_10000139814 596
218 3300005841 Ga0068863_100003177 Ga0068863_1000031774 596
219 3300005842 Ga0068858_100002290 Ga0068858_1000022908 596
220 3300005842 Ga0068858_100073685 Ga0068858_1000736852 596
221 3300005843 Ga0068860_100005487 Ga0068860_1000054876 596
222 3300005843 Ga0068860_100007052 Ga0068860_1000070522 596
223 3300005843 Ga0068860_100031363 Ga0068860_1000313635 596
224 3300006358 Ga0068871_100004350 Ga0068871_10000435012 596
225 3300006881 Ga0068865_100001201 Ga0068865_1000012013 596
226 3300006931 Ga0097620_100110963 Ga0097620_1001109633 596
227 3300009093 Ga0105240_10194099 Ga0105240_101940991 596
228 3300009177 Ga0105248_10141399 Ga0105248_101413993 596
229 3300009553 Ga0105249_10004075 Ga0105249_100040753 596
230 3300009553 Ga0105249_10022928 Ga0105249_100229281 596
231 3300010375 Ga0105239_10002974 Ga0105239_100029745 596
232 3300010375 Ga0105239_10161533 Ga0105239_101615331 596
233 3300013102 Ga0157371_10003049 Ga0157371_1000304910 596
234 3300013104 Ga0157370_10008425 Ga0157370_100084252 596
235 3300013296 Ga0157374_10015974 Ga0157374_100159742 596
236 3300013297 Ga0157378_10012935 Ga0157378_100129353 596
237 3300013306 Ga0163162_10002932 Ga0163162_1000293212 596
238 3300013306 Ga0163162_10006472 Ga0163162_100064727 596
239 3300013306 Ga0163162_10013767 Ga0163162_100137678 596
240 3300013307 Ga0157372_10120177 Ga0157372_101201771 596
241 3300013308 Ga0157375_10002060 Ga0157375_100020606 596
242 3300013308 Ga0157375_10156042 Ga0157375_101560422 596
243 3300014325 Ga0163163_10027369 Ga0163163_100273694 596
244 3300014325 Ga0163163_10031829 Ga0163163_100318293 596
245 3300014968 Ga0157379_10013613 Ga0157379_100136132 596
246 3300014968 Ga0157379_10024953 Ga0157379_100249535 596
247 3300014969 Ga0157376_10001813 Ga0157376_1000181312 596
248 3300014969 Ga0157376_10061965 Ga0157376_100619653 596
249 3300017792 Ga0163161_10012799 Ga0163161_100127995 596
250 3300017792 Ga0163161_10044947 Ga0163161_100449473 596
251 3300025903 Ga0207680_10009835 Ga0207680_100098353 596
252 3300025907 Ga0207645_10002569 Ga0207645_1000256915 596
253 3300025913 Ga0207695_10119214 Ga0207695_101192142 596
254 3300025933 Ga0207706_10023341 Ga0207706_100233414 596
255 3300025933 Ga0207706_10127102 Ga0207706_101271021 596
256 3300025938 Ga0207704_10001086 Ga0207704_100010869 596
257 3300025940 Ga0207691_10000001 Ga0207691_1000000198 596
258 3300025942 Ga0207689_10030022 Ga0207689_100300224 596
259 3300025942 Ga0207689_10060483 Ga0207689_100604832 596
260 3300025949 Ga0207667_10026300 Ga0207667_100263002 596
261 3300025960 Ga0207651_10002700 Ga0207651_100027003 596
262 3300025961 Ga0207712_10010403 Ga0207712_100104033 596
263 3300025972 Ga0207668_10002957 Ga0207668_100029575 596
264 3300025986 Ga0207658_10002549 Ga0207658_100025494 596
265 3300026023 Ga0207677_10002241 Ga0207677_100022418 596
266 3300026035 Ga0207703_10028669 Ga0207703_100286696 596
267 3300026088 Ga0207641_10028939 Ga0207641_100289396 596
268 3300026089 Ga0207648_10002251 Ga0207648_100022516 596
269 3300026089 Ga0207648_10055158 Ga0207648_100551582 596
270 3300026095 Ga0207676_10025947 Ga0207676_100259472 596
271 3300026118 Ga0207675_100026324 Ga0207675_1000263243 596
272 3300028379 Ga0268266_10003319 Ga0268266_100033196 596
273 3300028381 Ga0268264_10003033 Ga0268264_100030333 596
274 3300028381 Ga0268264_10004916 Ga0268264_100049166 596
275 3300031456 Ga0307513_10110629 Ga0307513_101106291 596
276 3300036401 Ga0373937_0024157 Ga0373937_0024157_365_2170 596
277 3300037312 Ga0395899_0039707 Ga0395899_0039707_980_2785 596
278 3300037471 Ga0395905_0011240 Ga0395905_0011240_146_1951 596
279 3300037471 Ga0395905_0059953 Ga0395905_0059953_1087_2892 596
280 3300044656 Ga0466969_0000972 Ga0466969_0000972_8076_9881 596
281 3300044658 Ga0466972_0000007 Ga0466972_0000007_46685_48490 596
282 3300044684 Ga0466966_0000018 Ga0466966_0000018_56965_58770 596
283 3300044842 Ga0466957_0002210 Ga0466957_0002210_5389_7200 596
284 3300045049 Ga0466959_0000002 Ga0466959_0000002_117479_119284 596
285 3300046454 Ga0495592_0035834 Ga0495592_0035834_1328_3133 596
286 3300046517 Ga0495630_0006029 Ga0495630_0006029_3537_5342 596
287 3300049661 Ga0501217_000173 Ga0501217_000173_6323_8128 596
288 3300049668 Ga0501233_001763 Ga0501233_001763_1378_3183 596
289 3300053140 Ga0500573_0028767 Ga0500573_0028767_70_1875 596
290 iso_pu_bacteria 2818991460 2819677096 596
291 iso_pu_bacteria 2929177148 2929177503 596
292 iso_pu_bacteria 2945977869 2945979875 596
293 iso_pu_bacteria 2946013367 2946014261 596
294 3300005327 Ga0070658_10000008 Ga0070658_1000000816 597
295 3300006195 Ga0075366_10030835 Ga0075366_100308353 597
296 3300009553 Ga0105249_10022927 Ga0105249_100229273 597
297 3300013307 Ga0157372_10084442 Ga0157372_100844423 597
298 3300025909 Ga0207705_10000026 Ga0207705_1000002616 597
299 3300025942 Ga0207689_10091530 Ga0207689_100915302 597
300 3300025949 Ga0207667_10025618 Ga0207667_100256186 597
301 3300025961 Ga0207712_10012498 Ga0207712_100124983 597
302 3300037853 Ga0436364_1460474 Ga0436364_1460474_334_2166 597
303 3300049569 Ga0501032_0037103 Ga0501032_0037103_434_2254 597
304 3300049570 Ga0501033_0016474 Ga0501033_0016474_3130_4950 597
305 3300049573 Ga0501037_0010636 Ga0501037_0010636_45_1865 597
306 3300049578 Ga0501042_0009219 Ga0501042_0009219_2800_4614 597
307 3300049581 Ga0501047_0026303 Ga0501047_0026303_1120_2940 597
308 3300049588 Ga0501072_0027699 Ga0501072_0027699_2357_4171 597
309 3300049590 Ga0501074_0101990 Ga0501074_0101990_52_1866 597
310 3300049822 Ga0501035_0013011 Ga0501035_0013011_492_2312 597
311 3300049823 Ga0501044_0000903 Ga0501044_0000903_824_2644 597
312 3300050493 nmdc:mga0k408_7363_c1 nmdc:mga0k408_7363_c1_3642_5450 597
313 3300060353 Ga0501082_0079798 Ga0501082_0079798_813_2627 597
314 3300061734 Ga0530510_0002645 Ga0530510_0002645_5260_7074 597
315 iso_pu_bacteria 2738541284 2738763510 597
316 iso_pu_bacteria 2775506987 2776615053 597
317 iso_pu_bacteria 2852627209 2852628913 597
318 iso_pu_bacteria 2883068021 2883072138 597
319 iso_pu_bacteria 2884791551 2884796945 597
320 iso_pu_bacteria 2896109856 2896111206 597
321 3300005333 Ga0070677_10004081 Ga0070677_100040812 598
322 3300005354 Ga0070675_100056061 Ga0070675_1000560612 598
323 3300005356 Ga0070674_100053400 Ga0070674_1000534002 598
324 3300005456 Ga0070678_100031688 Ga0070678_1000316882 598
325 3300021361 Ga0213872_10003201 Ga0213872_100032012 598
326 3300025893 Ga0207682_10005490 Ga0207682_100054902 598
327 3300025949 Ga0207667_10003192 Ga0207667_100031927 598
328 3300028786 Ga0307517_10083164 Ga0307517_100831642 598
329 iso_pu_bacteria 2839989709 2839990560 598
330 3300003320 rootH2_10108130 rootH2_101081301 599
331 3300005336 Ga0070680_100005084 Ga0070680_1000050845 599
332 3300005339 Ga0070660_100000870 Ga0070660_1000008706 599
333 3300005458 Ga0070681_10008225 Ga0070681_100082259 599
334 3300005530 Ga0070679_100018669 Ga0070679_1000186696 599
335 3300005530 Ga0070679_100031281 Ga0070679_1000312814 599
336 3300005535 Ga0070684_100073890 Ga0070684_1000738902 599
337 3300005563 Ga0068855_100024706 Ga0068855_1000247069 599
338 3300009094 Ga0111539_10143468 Ga0111539_101434681 599
339 3300009176 Ga0105242_10137727 Ga0105242_101377272 599
340 3300013102 Ga0157371_10008186 Ga0157371_100081866 599
341 3300013102 Ga0157371_10009630 Ga0157371_100096304 599
342 3300013102 Ga0157371_10062499 Ga0157371_100624991 599
343 3300013104 Ga0157370_10154322 Ga0157370_101543221 599
344 3300013105 Ga0157369_10082714 Ga0157369_100827144 599
345 3300013307 Ga0157372_10113438 Ga0157372_101134382 599
346 3300025302 Ga0207426_1000024 Ga0207426_1000024270 599
347 3300025909 Ga0207705_10019298 Ga0207705_100192983 599
348 3300025912 Ga0207707_10020399 Ga0207707_100203997 599
349 3300025917 Ga0207660_10001426 Ga0207660_1000142613 599
350 3300025919 Ga0207657_10002882 Ga0207657_100028824 599
351 3300025919 Ga0207657_10040183 Ga0207657_100401831 599
352 3300025921 Ga0207652_10000366 Ga0207652_1000036637 599
353 3300025921 Ga0207652_10035342 Ga0207652_100353422 599
354 3300025949 Ga0207667_10005069 Ga0207667_1000506910 599
355 3300025949 Ga0207667_10049025 Ga0207667_100490252 599
356 3300026067 Ga0207678_10003224 Ga0207678_1000322410 599
357 3300026078 Ga0207702_10020428 Ga0207702_100204283 599
358 3300026116 Ga0207674_10051156 Ga0207674_100511563 599
359 3300031507 Ga0307509_10026077 Ga0307509_100260773 599
360 3300031507 Ga0307509_10041505 Ga0307509_100415053 599
361 3300037418 Ga0395900_0159718 Ga0395900_0159718_42_1871 599
362 3300046460 Ga0495638_0011001 Ga0495638_0011001_590_2419 599
363 3300046523 Ga0495644_0001921 Ga0495644_0001921_5666_7498 599
364 3300049571 Ga0501034_0068104 Ga0501034_0068104_1396_3225 599
365 3300049586 Ga0501070_0092157 Ga0501070_0092157_55_1884 599
366 3300049823 Ga0501044_0077668 Ga0501044_0077668_114_1943 599
367 3300053080 Ga0500635_0000598 Ga0500635_0000598_2699_4531 599
368 iso_pu_bacteria 2884215851 2884219122 599
369 3300001990 JGI24737J22298_10007369 JGI24737J22298_100073691 600
370 3300002737 JGI25162J39368_1000141 JGI25162J39368_100014161 600
371 3300002737 JGI25162J39368_1000852 JGI25162J39368_100085212 600
372 3300002772 JGI25164J39214_1000617 JGI25164J39214_10006177 600
373 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015750 600
374 3300003320 rootH2_10006617 rootH2_100066173 600
375 3300005288 Ga0065714_10066555 Ga0065714_100665552 600
376 3300005289 Ga0065704_10071014 Ga0065704_100710149 600
377 3300005289 Ga0065704_10076291 Ga0065704_100762912 600
378 3300005341 Ga0070691_10009231 Ga0070691_100092313 600
379 3300005366 Ga0070659_100004697 Ga0070659_1000046976 600
380 3300005457 Ga0070662_100000020 Ga0070662_10000002059 600
381 3300005548 Ga0070665_100001161 Ga0070665_1000011616 600
382 3300005563 Ga0068855_100000026 Ga0068855_10000002671 600
383 3300005563 Ga0068855_100000275 Ga0068855_10000027516 600
384 3300005563 Ga0068855_100047039 Ga0068855_1000470395 600
385 3300005577 Ga0068857_100005388 Ga0068857_1000053886 600
386 3300005614 Ga0068856_100041934 Ga0068856_1000419344 600
387 3300006195 Ga0075366_10002387 Ga0075366_100023873 600
388 3300009093 Ga0105240_10000224 Ga0105240_1000022422 600
389 3300009093 Ga0105240_10034786 Ga0105240_100347864 600
390 3300009093 Ga0105240_10094379 Ga0105240_100943792 600
391 3300009174 Ga0105241_10000169 Ga0105241_1000016933 600
392 3300009545 Ga0105237_10001301 Ga0105237_1000130118 600
393 3300009545 Ga0105237_10007444 Ga0105237_100074447 600
394 3300009545 Ga0105237_10007588 Ga0105237_100075887 600
395 3300009545 Ga0105237_10022438 Ga0105237_100224383 600
396 3300009551 Ga0105238_10014111 Ga0105238_100141115 600
397 3300009551 Ga0105238_10015881 Ga0105238_100158815 600
398 3300010375 Ga0105239_10000270 Ga0105239_1000027023 600
399 3300010375 Ga0105239_10000578 Ga0105239_1000057825 600
400 3300010375 Ga0105239_10002131 Ga0105239_1000213118 600
401 3300010375 Ga0105239_10003513 Ga0105239_100035139 600
402 3300010375 Ga0105239_10031048 Ga0105239_100310484 600
403 3300013100 Ga0157373_10000464 Ga0157373_1000046416 600
404 3300013100 Ga0157373_10006725 Ga0157373_100067254 600
405 3300013102 Ga0157371_10000689 Ga0157371_1000068918 600
406 3300013102 Ga0157371_10000749 Ga0157371_100007493 600
407 3300013102 Ga0157371_10002152 Ga0157371_100021524 600
408 3300013104 Ga0157370_10002460 Ga0157370_1000246016 600
409 3300013296 Ga0157374_10000007 Ga0157374_10000007271 600
410 3300013297 Ga0157378_10025193 Ga0157378_100251932 600
411 3300013307 Ga0157372_10065533 Ga0157372_100655332 600
412 3300013307 Ga0157372_10096608 Ga0157372_100966082 600
413 3300014497 Ga0182008_10000024 Ga0182008_1000002430 600
414 3300014969 Ga0157376_10012790 Ga0157376_100127909 600
415 3300015261 Ga0182006_1014138 Ga0182006_10141384 600
416 3300025231 Ga0207427_100025 Ga0207427_10002592 600
417 3300025233 Ga0209437_100010 Ga0209437_100010354 600
418 3300025233 Ga0209437_100070 Ga0209437_10007019 600
419 3300025261 Ga0209233_1000017 Ga0209233_1000017367 600
420 3300025272 Ga0209455_1004625 Ga0209455_10046253 600
421 3300025904 Ga0207647_10000043 Ga0207647_1000004324 600
422 3300025904 Ga0207647_10000102 Ga0207647_100001023 600
423 3300025911 Ga0207654_10000235 Ga0207654_1000023523 600
424 3300025913 Ga0207695_10000812 Ga0207695_1000081227 600
425 3300025913 Ga0207695_10032923 Ga0207695_100329233 600
426 3300025914 Ga0207671_10002787 Ga0207671_100027877 600
427 3300025914 Ga0207671_10003442 Ga0207671_1000344212 600
428 3300025914 Ga0207671_10007249 Ga0207671_100072493 600
429 3300025914 Ga0207671_10011525 Ga0207671_100115255 600
430 3300025914 Ga0207671_10017978 Ga0207671_100179783 600
431 3300025924 Ga0207694_10032680 Ga0207694_100326804 600
432 3300025924 Ga0207694_10066240 Ga0207694_100662402 600
433 3300025933 Ga0207706_10000044 Ga0207706_1000004481 600
434 3300025949 Ga0207667_10000022 Ga0207667_10000022104 600
435 3300025949 Ga0207667_10001554 Ga0207667_1000155411 600
436 3300026078 Ga0207702_10046926 Ga0207702_100469261 600
437 3300026116 Ga0207674_10082056 Ga0207674_100820562 600
438 3300028379 Ga0268266_10004612 Ga0268266_100046127 600
439 3300028794 Ga0307515_10000144 Ga0307515_10000144121 600
440 3300028794 Ga0307515_10003557 Ga0307515_100035577 600
441 3300028794 Ga0307515_10076530 Ga0307515_100765301 600
442 3300031616 Ga0307508_10010293 Ga0307508_100102932 600
443 3300031911 Ga0307412_10000030 Ga0307412_10000030164 600
444 3300037312 Ga0395899_0003295 Ga0395899_0003295_4779_6608 600
445 3300037418 Ga0395900_0021037 Ga0395900_0021037_3624_5459 600
446 3300037418 Ga0395900_0038610 Ga0395900_0038610_719_2548 600
447 3300037466 Ga0395898_0033448 Ga0395898_0033448_1047_2876 600
448 3300037471 Ga0395905_0001841 Ga0395905_0001841_22239_24074 600
449 3300037471 Ga0395905_0003680 Ga0395905_0003680_3865_5694 600
450 3300038443 Ga0395901_0000722 Ga0395901_0000722_5427_7262 600
451 3300038443 Ga0395901_0010861 Ga0395901_0010861_3863_5692 600
452 3300046471 Ga0495650_0020756 Ga0495650_0020756_338_2176 600
453 3300046507 Ga0495606_0072148 Ga0495606_0072148_81_1916 600
454 3300046524 Ga0495648_0013439 Ga0495648_0013439_4036_5874 600
455 3300046524 Ga0495648_0028456 Ga0495648_0028456_1381_3219 600
456 3300046558 Ga0495633_0000027 Ga0495633_0000027_140513_142351 600
457 3300046660 Ga0495625_0000381 Ga0495625_0000381_57_1895 600
458 3300046660 Ga0495625_0000939 Ga0495625_0000939_19628_21466 600
459 3300049459 Ga0495678_015285 Ga0495678_015285_646_2526 600
460 3300050493 nmdc:mga0k408_2754_c1 nmdc:mga0k408_2754_c1_281_2119 600
461 3300053093 Ga0500651_0000462 Ga0500651_0000462_14633_16474 600
462 3300053122 Ga0500608_007533 Ga0500608_007533_145_1986 600
463 3300053157 Ga0500624_000397 Ga0500624_000397_455_2335 600
464 iso_pu_bacteria 2911138879 2911143643 600
465 3300003323 rootH1_10139100 rootH1_101391002 601
466 3300005616 Ga0068852_100052799 Ga0068852_1000527992 601
467 3300005843 Ga0068860_100005989 Ga0068860_1000059896 601
468 3300010375 Ga0105239_10048809 Ga0105239_100488093 601
469 3300013100 Ga0157373_10000152 Ga0157373_1000015233 601
470 3300013307 Ga0157372_10014529 Ga0157372_100145299 601
471 3300013308 Ga0157375_10044527 Ga0157375_100445274 601
472 3300014968 Ga0157379_10025189 Ga0157379_100251895 601
473 3300025904 Ga0207647_10000900 Ga0207647_1000090025 601
474 3300025913 Ga0207695_10013560 Ga0207695_100135606 601
475 3300025914 Ga0207671_10005689 Ga0207671_100056895 601
476 3300025932 Ga0207690_10017866 Ga0207690_100178662 601
477 3300028800 Ga0265338_10023165 Ga0265338_100231653 601
478 3300047472 Ga0495686_0000004 Ga0495686_0000004_635229_637115 601
479 iso_pu_bacteria 2739367866 2740033823 601
480 iso_pu_bacteria 2910245624 2910249935 601
481 3300000546 LJNas_1000968 LJNas_10009682 602
482 3300005334 Ga0068869_100076046 Ga0068869_1000760461 602
483 3300005337 Ga0070682_100007190 Ga0070682_1000071903 602
484 3300005338 Ga0068868_100008266 Ga0068868_1000082663 602
485 3300005341 Ga0070691_10002535 Ga0070691_100025357 602
486 3300005354 Ga0070675_100048866 Ga0070675_1000488661 602
487 3300005456 Ga0070678_100030075 Ga0070678_1000300752 602
488 3300005458 Ga0070681_10105955 Ga0070681_101059553 602
489 3300005530 Ga0070679_100045509 Ga0070679_1000455093 602
490 3300005539 Ga0068853_100004755 Ga0068853_1000047556 602
491 3300005539 Ga0068853_100069644 Ga0068853_1000696443 602
492 3300005563 Ga0068855_100014026 Ga0068855_1000140263 602
493 3300005563 Ga0068855_100104433 Ga0068855_1001044332 602
494 3300005719 Ga0068861_100034641 Ga0068861_1000346412 602
495 3300006237 Ga0097621_100017632 Ga0097621_1000176327 602
496 3300006358 Ga0068871_100024054 Ga0068871_1000240543 602
497 3300009093 Ga0105240_10000147 Ga0105240_1000014746 602
498 3300009093 Ga0105240_10001324 Ga0105240_1000132425 602
499 3300009174 Ga0105241_10000319 Ga0105241_1000031919 602
500 3300010375 Ga0105239_10000981 Ga0105239_1000098115 602
501 3300013104 Ga0157370_10000479 Ga0157370_1000047926 602
502 3300013296 Ga0157374_10160957 Ga0157374_101609572 602
503 3300013306 Ga0163162_10050178 Ga0163162_100501781 602
504 3300014969 Ga0157376_10027618 Ga0157376_100276183 602
505 3300014969 Ga0157376_10045731 Ga0157376_100457312 602
506 3300025250 Ga0209026_1000301 Ga0209026_100030130 602
507 3300025904 Ga0207647_10064739 Ga0207647_100647391 602
508 3300025907 Ga0207645_10007346 Ga0207645_100073464 602
509 3300025911 Ga0207654_10001369 Ga0207654_100013695 602
510 3300025912 Ga0207707_10000721 Ga0207707_1000072110 602
511 3300025913 Ga0207695_10000023 Ga0207695_10000023261 602
512 3300025913 Ga0207695_10048738 Ga0207695_100487383 602
513 3300025917 Ga0207660_10001254 Ga0207660_100012549 602
514 3300025921 Ga0207652_10002045 Ga0207652_100020458 602
515 3300025942 Ga0207689_10001614 Ga0207689_1000161418 602
516 3300025949 Ga0207667_10002374 Ga0207667_100023742 602
517 3300025949 Ga0207667_10109905 Ga0207667_101099053 602
518 3300025960 Ga0207651_10068403 Ga0207651_100684032 602
519 3300025986 Ga0207658_10049382 Ga0207658_100493821 602
520 3300026041 Ga0207639_10063382 Ga0207639_100633823 602
521 3300026067 Ga0207678_10001417 Ga0207678_1000141721 602
522 3300026121 Ga0207683_10001589 Ga0207683_1000158919 602
523 3300048916 Ga0496113_0025684 Ga0496113_0025684_1582_3408 602
524 3300048929 Ga0496126_0128415 Ga0496126_0128415_46_1872 602
525 3300003322 rootL2_10093656 rootL2_100936563 603
526 3300005327 Ga0070658_10034259 Ga0070658_100342594 603
527 3300005335 Ga0070666_10000165 Ga0070666_1000016518 603
528 3300005336 Ga0070680_100016335 Ga0070680_1000163355 603
529 3300005563 Ga0068855_100001157 Ga0068855_1000011579 603
530 3300005614 Ga0068856_100105561 Ga0068856_1001055611 603
531 3300005616 Ga0068852_100010317 Ga0068852_1000103172 603
532 3300005617 Ga0068859_100000163 Ga0068859_10000016335 603
533 3300005618 Ga0068864_100002828 Ga0068864_1000028283 603
534 3300005841 Ga0068863_100000696 Ga0068863_10000069618 603
535 3300005842 Ga0068858_100083288 Ga0068858_1000832882 603
536 3300006237 Ga0097621_100007615 Ga0097621_1000076152 603
537 3300006931 Ga0097620_100000163 Ga0097620_10000016335 603
538 3300009093 Ga0105240_10004368 Ga0105240_1000436813 603
539 3300009174 Ga0105241_10000776 Ga0105241_1000077616 603
540 3300009545 Ga0105237_10000052 Ga0105237_100000522 603
541 3300009545 Ga0105237_10003655 Ga0105237_100036553 603
542 3300009545 Ga0105237_10003711 Ga0105237_100037114 603
543 3300009553 Ga0105249_10001077 Ga0105249_1000107710 603
544 3300010375 Ga0105239_10000370 Ga0105239_1000037024 603
545 3300013105 Ga0157369_10145907 Ga0157369_101459072 603
546 3300013306 Ga0163162_10000785 Ga0163162_1000078521 603
547 3300013307 Ga0157372_10002120 Ga0157372_100021207 603
548 3300013308 Ga0157375_10083886 Ga0157375_100838862 603
549 3300014326 Ga0157380_10004889 Ga0157380_100048898 603
550 3300014969 Ga0157376_10019104 Ga0157376_100191042 603
551 3300025903 Ga0207680_10000543 Ga0207680_1000054314 603
552 3300025911 Ga0207654_10005463 Ga0207654_100054635 603
553 3300025913 Ga0207695_10000110 Ga0207695_1000011053 603
554 3300025914 Ga0207671_10003201 Ga0207671_100032013 603
555 3300025914 Ga0207671_10004509 Ga0207671_100045092 603
556 3300025914 Ga0207671_10016565 Ga0207671_100165652 603
557 3300025942 Ga0207689_10001987 Ga0207689_100019873 603
558 3300025949 Ga0207667_10000144 Ga0207667_1000014477 603
559 3300025961 Ga0207712_10040562 Ga0207712_100405622 603
560 3300026088 Ga0207641_10000176 Ga0207641_1000017659 603
561 3300026118 Ga0207675_100020554 Ga0207675_1000205542 603
562 3300026142 Ga0207698_10006151 Ga0207698_100061512 603
563 3300028379 Ga0268266_10104402 Ga0268266_101044022 603
564 3300028794 Ga0307515_10000107 Ga0307515_1000010724 603
565 3300030521 Ga0307511_10000808 Ga0307511_1000080811 603
566 3300031507 Ga0307509_10075276 Ga0307509_100752762 603
567 3300033180 Ga0307510_10001458 Ga0307510_1000145814 603
568 3300037853 Ga0436364_0871624 Ga0436364_0871624_84653_86479 603
569 3300046522 Ga0495643_0032638 Ga0495643_0032638_54_1871 603
570 3300046648 Ga0495611_0000100 Ga0495611_0000100_8080_9930 603
571 3300046694 Ga0495649_0014016 Ga0495649_0014016_331_2148 603
572 3300047320 Ga0495672_0070623 Ga0495672_0070623_139_1965 603
573 3300047472 Ga0495686_0000031 Ga0495686_0000031_201691_203514 603
574 3300047472 Ga0495686_0001778 Ga0495686_0001778_11859_13682 603
575 3300048907 Ga0496104_0000050 Ga0496104_0000050_66039_67856 603
576 3300048929 Ga0496126_0003894 Ga0496126_0003894_3902_5734 603
577 3300049569 Ga0501032_0005435 Ga0501032_0005435_4496_6319 603
578 3300049570 Ga0501033_0002918 Ga0501033_0002918_9969_11792 603
579 3300049571 Ga0501034_0061940 Ga0501034_0061940_702_2525 603
580 3300049572 Ga0501036_0000910 Ga0501036_0000910_7800_9623 603
581 3300049573 Ga0501037_0001569 Ga0501037_0001569_5152_6975 603
582 3300049574 Ga0501038_0005645 Ga0501038_0005645_4190_6013 603
583 3300049575 Ga0501039_0007035 Ga0501039_0007035_2694_4517 603
584 3300049579 Ga0501043_0008002 Ga0501043_0008002_2386_4209 603
585 3300049580 Ga0501046_0010481 Ga0501046_0010481_3969_5792 603
586 3300049581 Ga0501047_0010418 Ga0501047_0010418_4869_6695 603
587 3300049581 Ga0501047_0018973 Ga0501047_0018973_2115_3938 603
588 3300049582 Ga0501048_0017623 Ga0501048_0017623_910_2733 603
589 3300049583 Ga0501067_0006094 Ga0501067_0006094_3920_5743 603
590 3300049584 Ga0501068_0008546 Ga0501068_0008546_3701_5524 603
591 3300049585 Ga0501069_0000155 Ga0501069_0000155_4079_5902 603
592 3300049586 Ga0501070_0021406 Ga0501070_0021406_2115_3938 603
593 3300049586 Ga0501070_0045641 Ga0501070_0045641_1493_3319 603
594 3300049586 Ga0501070_0080596 Ga0501070_0080596_308_2134 603
595 3300049588 Ga0501072_0002255 Ga0501072_0002255_584_2407 603
596 3300049589 Ga0501073_0011241 Ga0501073_0011241_2340_4163 603
597 3300049741 Ga0501079_0010815 Ga0501079_0010815_2659_4482 603
598 3300049742 Ga0501080_0014429 Ga0501080_0014429_3967_5790 603
599 3300049744 Ga0501083_0014288 Ga0501083_0014288_2115_3938 603
600 3300049822 Ga0501035_0009965 Ga0501035_0009965_1581_3404 603
601 3300049823 Ga0501044_0020988 Ga0501044_0020988_3920_5743 603
602 3300050511 nmdc:mga08y16_12657_c1 nmdc:mga08y16_12657_c1_2619_4436 603
603 3300053093 Ga0500651_0000003 Ga0500651_0000003_275785_277611 603
604 3300054114 Ga0501084_0001521 Ga0501084_0001521_4291_6114 603
605 3300060353 Ga0501082_0022216 Ga0501082_0022216_2285_4108 603
606 3300006844 Ga0075428_100008359 Ga0075428_1000083593 604
607 3300006844 Ga0075428_100224589 Ga0075428_1002245892 604
608 3300014325 Ga0163163_10076963 Ga0163163_100769632 604
609 3300025941 Ga0207711_10097116 Ga0207711_100971162 604
610 3300026088 Ga0207641_10033647 Ga0207641_100336471 604
611 3300035692 Ga0373935_0080200 Ga0373935_0080200_148_1980 604
612 3300045051 Ga0451576_0063258 Ga0451576_0063258_475_2307 604
613 3300046462 Ga0495651_0098308 Ga0495651_0098308_169_2001 604
614 3300046472 Ga0495580_0002060 Ga0495580_0002060_6635_8467 604
615 3300046531 Ga0495665_0018016 Ga0495665_0018016_66_1898 604
616 3300046679 Ga0495623_0052046 Ga0495623_0052046_448_2280 604
617 3300047444 Ga0495675_0065938 Ga0495675_0065938_331_2163 604
618 3300047471 Ga0495684_0016716 Ga0495684_0016716_1732_3564 604
619 3300048088 Ga0495602_0128051 Ga0495602_0128051_58_1890 604
620 3300060353 Ga0501082_0001743 Ga0501082_0001743_6788_8620 604
621 3300005327 Ga0070658_10002294 Ga0070658_100022942 605
622 3300005455 Ga0070663_100000586 Ga0070663_1000005863 605
623 3300005563 Ga0068855_100096081 Ga0068855_1000960812 605
624 3300005618 Ga0068864_100013821 Ga0068864_1000138211 605
625 3300005844 Ga0068862_100016835 Ga0068862_1000168353 605
626 3300006880 Ga0075429_100068857 Ga0075429_1000688572 605
627 3300010375 Ga0105239_10000043 Ga0105239_1000004368 605
628 3300013102 Ga0157371_10024416 Ga0157371_100244161 605
629 3300013296 Ga0157374_10007113 Ga0157374_100071135 605
630 3300013306 Ga0163162_10069505 Ga0163162_100695053 605
631 3300025909 Ga0207705_10039272 Ga0207705_100392723 605
632 3300025913 Ga0207695_10000262 Ga0207695_1000026281 605
633 3300025919 Ga0207657_10013145 Ga0207657_100131455 605
634 3300047471 Ga0495684_0010156 Ga0495684_0010156_4816_6663 605
635 3300048904 Ga0496101_0032829 Ga0496101_0032829_1095_2996 605
636 3300048908 Ga0496105_0005478 Ga0496105_0005478_5578_7479 605
637 3300048915 Ga0496112_0158290 Ga0496112_0158290_292_2145 605
638 3300048920 Ga0496117_0014403 Ga0496117_0014403_4016_5917 605
639 3300048921 Ga0496118_0005063 Ga0496118_0005063_5974_7875 605
640 3300048921 Ga0496118_0005243 Ga0496118_0005243_11023_12924 605
641 3300048922 Ga0496119_0000531 Ga0496119_0000531_24141_26042 605
642 3300048923 Ga0496120_0000182 Ga0496120_0000182_81013_82914 605
643 3300048929 Ga0496126_0001108 Ga0496126_0001108_114_2015 605
644 3300050508 nmdc:mga09592_47844_c1 nmdc:mga09592_47844_c1_26_1843 605
645 3300050509 nmdc:mga0qj67_6396_c1 nmdc:mga0qj67_6396_c1_2787_4604 605
646 3300053153 Ga0500616_0000204 Ga0500616_0000204_9120_10943 605
647 3300000546 LJNas_1000166 LJNas_10001662 606
648 3300005329 Ga0070683_100129003 Ga0070683_1001290031 606
649 3300005334 Ga0068869_100000733 Ga0068869_1000007332 606
650 3300005334 Ga0068869_100022814 Ga0068869_1000228143 606
651 3300005338 Ga0068868_100002352 Ga0068868_1000023528 606
652 3300005434 Ga0070709_10005054 Ga0070709_100050544 606
653 3300005434 Ga0070709_10028343 Ga0070709_100283432 606
654 3300005435 Ga0070714_100001471 Ga0070714_1000014714 606
655 3300005436 Ga0070713_100001335 Ga0070713_1000013358 606
656 3300005436 Ga0070713_100038053 Ga0070713_1000380532 606
657 3300005436 Ga0070713_100045224 Ga0070713_1000452242 606
658 3300005437 Ga0070710_10001260 Ga0070710_100012605 606
659 3300005437 Ga0070710_10012873 Ga0070710_100128732 606
660 3300005445 Ga0070708_100000141 Ga0070708_10000014125 606
661 3300005445 Ga0070708_100004536 Ga0070708_1000045367 606
662 3300005458 Ga0070681_10000293 Ga0070681_1000029313 606
663 3300005458 Ga0070681_10006018 Ga0070681_100060184 606
664 3300005459 Ga0068867_100012223 Ga0068867_1000122233 606
665 3300005466 Ga0070685_10019301 Ga0070685_100193012 606
666 3300005467 Ga0070706_100002149 Ga0070706_10000214911 606
667 3300005468 Ga0070707_100004191 Ga0070707_1000041915 606
668 3300005471 Ga0070698_100004301 Ga0070698_1000043014 606
669 3300005518 Ga0070699_100000132 Ga0070699_10000013218 606
670 3300005530 Ga0070679_100036612 Ga0070679_1000366122 606
671 3300005530 Ga0070679_100126134 Ga0070679_1001261342 606
672 3300005535 Ga0070684_100067299 Ga0070684_1000672991 606
673 3300005536 Ga0070697_100000261 Ga0070697_1000002615 606
674 3300005563 Ga0068855_100000500 Ga0068855_1000005007 606
675 3300005563 Ga0068855_100005062 Ga0068855_10000506212 606
676 3300005563 Ga0068855_100075546 Ga0068855_1000755462 606
677 3300005564 Ga0070664_100000583 Ga0070664_1000005839 606
678 3300005564 Ga0070664_100034117 Ga0070664_1000341173 606
679 3300005577 Ga0068857_100001802 Ga0068857_1000018025 606
680 3300005577 Ga0068857_100015189 Ga0068857_1000151892 606
681 3300005578 Ga0068854_100095595 Ga0068854_1000955951 606
682 3300005614 Ga0068856_100001116 Ga0068856_10000111612 606
683 3300005614 Ga0068856_100004130 Ga0068856_1000041303 606
684 3300005614 Ga0068856_100004768 Ga0068856_1000047689 606
685 3300005614 Ga0068856_100018770 Ga0068856_1000187702 606
686 3300005614 Ga0068856_100058747 Ga0068856_1000587471 606
687 3300005614 Ga0068856_100059504 Ga0068856_1000595042 606
688 3300005616 Ga0068852_100028898 Ga0068852_1000288982 606
689 3300005617 Ga0068859_100005316 Ga0068859_1000053165 606
690 3300005618 Ga0068864_100003869 Ga0068864_1000038695 606
691 3300005841 Ga0068863_100016617 Ga0068863_1000166174 606
692 3300005842 Ga0068858_100002561 Ga0068858_1000025614 606
693 3300005842 Ga0068858_100036970 Ga0068858_1000369703 606
694 3300005843 Ga0068860_100075676 Ga0068860_1000756762 606
695 3300005844 Ga0068862_100020920 Ga0068862_1000209202 606
696 3300006028 Ga0070717_10000703 Ga0070717_1000070315 606
697 3300006028 Ga0070717_10003890 Ga0070717_100038904 606
698 3300006028 Ga0070717_10013658 Ga0070717_100136582 606
699 3300006028 Ga0070717_10030810 Ga0070717_100308102 606
700 3300006028 Ga0070717_10058506 Ga0070717_100585062 606
701 3300006028 Ga0070717_10082418 Ga0070717_100824181 606
702 3300006175 Ga0070712_100012057 Ga0070712_1000120572 606
703 3300006237 Ga0097621_100000954 Ga0097621_1000009542 606
704 3300006237 Ga0097621_100003319 Ga0097621_1000033195 606
705 3300006237 Ga0097621_100004993 Ga0097621_1000049931 606
706 3300006237 Ga0097621_100044086 Ga0097621_1000440862 606
707 3300006358 Ga0068871_100000435 Ga0068871_10000043520 606
708 3300006358 Ga0068871_100005053 Ga0068871_1000050535 606
709 3300006358 Ga0068871_100019977 Ga0068871_1000199772 606
710 3300006871 Ga0075434_100002147 Ga0075434_1000021476 606
711 3300006881 Ga0068865_100009033 Ga0068865_1000090332 606
712 3300006931 Ga0097620_100005316 Ga0097620_1000053165 606
713 3300007788 Ga0099795_10023036 Ga0099795_100230361 606
714 3300009093 Ga0105240_10007328 Ga0105240_100073282 606
715 3300009093 Ga0105240_10035761 Ga0105240_100357612 606
716 3300009174 Ga0105241_10003320 Ga0105241_100033204 606
717 3300009551 Ga0105238_10000198 Ga0105238_100001986 606
718 3300010159 Ga0099796_10004036 Ga0099796_100040363 606
719 3300013100 Ga0157373_10015167 Ga0157373_100151673 606
720 3300013105 Ga0157369_10001064 Ga0157369_1000106417 606
721 3300013105 Ga0157369_10076084 Ga0157369_100760842 606
722 3300013296 Ga0157374_10000264 Ga0157374_100002648 606
723 3300013296 Ga0157374_10004484 Ga0157374_100044842 606
724 3300013296 Ga0157374_10004925 Ga0157374_100049252 606
725 3300013296 Ga0157374_10007634 Ga0157374_100076342 606
726 3300013296 Ga0157374_10157011 Ga0157374_101570112 606
727 3300013297 Ga0157378_10000279 Ga0157378_100002795 606
728 3300013297 Ga0157378_10000549 Ga0157378_1000054912 606
729 3300013297 Ga0157378_10007173 Ga0157378_100071736 606
730 3300013297 Ga0157378_10044018 Ga0157378_100440182 606
731 3300013306 Ga0163162_10005510 Ga0163162_100055107 606
732 3300013307 Ga0157372_10000476 Ga0157372_1000047625 606
733 3300013307 Ga0157372_10001554 Ga0157372_100015544 606
734 3300013307 Ga0157372_10005305 Ga0157372_100053054 606
735 3300013307 Ga0157372_10008021 Ga0157372_100080215 606
736 3300013307 Ga0157372_10015554 Ga0157372_100155542 606
737 3300013307 Ga0157372_10029059 Ga0157372_100290592 606
738 3300013308 Ga0157375_10130975 Ga0157375_101309752 606
739 3300014325 Ga0163163_10049855 Ga0163163_100498552 606
740 3300014968 Ga0157379_10037079 Ga0157379_100370792 606
741 3300014968 Ga0157379_10148777 Ga0157379_101487772 606
742 3300014969 Ga0157376_10019653 Ga0157376_100196532 606
743 3300014969 Ga0157376_10066861 Ga0157376_100668612 606
744 3300022732 Ga0224569_100072 Ga0224569_1000722 606
745 3300024227 Ga0228598_1001851 Ga0228598_10018513 606
746 3300024227 Ga0228598_1002000 Ga0228598_10020003 606
747 3300025898 Ga0207692_10001733 Ga0207692_100017333 606
748 3300025898 Ga0207692_10028642 Ga0207692_100286422 606
749 3300025899 Ga0207642_10005445 Ga0207642_100054453 606
750 3300025899 Ga0207642_10018855 Ga0207642_100188551 606
751 3300025904 Ga0207647_10001316 Ga0207647_100013168 606
752 3300025910 Ga0207684_10000398 Ga0207684_1000039840 606
753 3300025911 Ga0207654_10003304 Ga0207654_100033044 606
754 3300025912 Ga0207707_10012472 Ga0207707_100124722 606
755 3300025912 Ga0207707_10019352 Ga0207707_100193522 606
756 3300025912 Ga0207707_10043275 Ga0207707_100432752 606
757 3300025913 Ga0207695_10005266 Ga0207695_100052663 606
758 3300025913 Ga0207695_10024212 Ga0207695_100242122 606
759 3300025913 Ga0207695_10026453 Ga0207695_100264532 606
760 3300025914 Ga0207671_10105198 Ga0207671_101051982 606
761 3300025917 Ga0207660_10015959 Ga0207660_100159592 606
762 3300025921 Ga0207652_10053982 Ga0207652_100539822 606
763 3300025921 Ga0207652_10064209 Ga0207652_100642092 606
764 3300025922 Ga0207646_10000194 Ga0207646_1000019443 606
765 3300025924 Ga0207694_10003110 Ga0207694_100031102 606
766 3300025925 Ga0207650_10006983 Ga0207650_100069833 606
767 3300025928 Ga0207700_10047627 Ga0207700_100476272 606
768 3300025929 Ga0207664_10002361 Ga0207664_100023612 606
769 3300025929 Ga0207664_10046497 Ga0207664_100464971 606
770 3300025938 Ga0207704_10064558 Ga0207704_100645581 606
771 3300025938 Ga0207704_10081821 Ga0207704_100818211 606
772 3300025939 Ga0207665_10003445 Ga0207665_100034453 606
773 3300025939 Ga0207665_10042924 Ga0207665_100429242 606
774 3300025942 Ga0207689_10000166 Ga0207689_1000016644 606
775 3300025949 Ga0207667_10002154 Ga0207667_100021544 606
776 3300025949 Ga0207667_10058190 Ga0207667_100581902 606
777 3300025981 Ga0207640_10044681 Ga0207640_100446812 606
778 3300026023 Ga0207677_10002804 Ga0207677_100028045 606
779 3300026023 Ga0207677_10003282 Ga0207677_100032824 606
780 3300026035 Ga0207703_10001414 Ga0207703_1000141410 606
781 3300026078 Ga0207702_10001291 Ga0207702_1000129111 606
782 3300026078 Ga0207702_10006466 Ga0207702_100064663 606
783 3300026078 Ga0207702_10011101 Ga0207702_100111012 606
784 3300026078 Ga0207702_10012221 Ga0207702_100122212 606
785 3300026078 Ga0207702_10031494 Ga0207702_100314942 606
786 3300026088 Ga0207641_10027718 Ga0207641_100277182 606
787 3300026089 Ga0207648_10018584 Ga0207648_100185843 606
788 3300026095 Ga0207676_10085556 Ga0207676_100855563 606
789 3300026116 Ga0207674_10002833 Ga0207674_100028337 606
790 3300026116 Ga0207674_10009215 Ga0207674_100092156 606
791 3300026142 Ga0207698_10020378 Ga0207698_100203782 606
792 3300028381 Ga0268264_10026431 Ga0268264_100264311 606
793 3300028381 Ga0268264_10031781 Ga0268264_100317811 606
794 3300028786 Ga0307517_10004917 Ga0307517_1000491716 606
795 3300030760 Ga0265762_1000173 Ga0265762_10001732 606
796 3300030760 Ga0265762_1000258 Ga0265762_10002586 606
797 3300031090 Ga0265760_10009115 Ga0265760_100091152 606
798 3300035691 Ga0373931_0055954 Ga0373931_0055954_78_1898 606
799 3300035724 Ga0373933_0009387 Ga0373933_0009387_1216_3036 606
800 3300036401 Ga0373937_0022929 Ga0373937_0022929_185_2005 606
801 3300037068 Ga0373925_0002014 Ga0373925_0002014_1988_3808 606
802 3300037853 Ga0436364_0372332 Ga0436364_0372332_11650_13473 606
803 3300039453 Ga0436362_1196168 Ga0436362_1196168_1358_3178 606
804 3300044694 Ga0466963_0014163 Ga0466963_0014163_1325_3145 606
805 3300045051 Ga0451576_0008203 Ga0451576_0008203_1596_3461 606
806 3300045051 Ga0451576_0058438 Ga0451576_0058438_983_2803 606
807 3300046472 Ga0495580_0006959 Ga0495580_0006959_1834_3654 606
808 3300046472 Ga0495580_0007312 Ga0495580_0007312_6945_8810 606
809 3300046473 Ga0495582_0000342 Ga0495582_0000342_14067_15887 606
810 3300046536 Ga0495587_0039774 Ga0495587_0039774_645_2465 606
811 3300046679 Ga0495623_0033499 Ga0495623_0033499_939_2804 606
812 3300048905 Ga0496102_0130377 Ga0496102_0130377_278_2098 606
813 3300048915 Ga0496112_0003084 Ga0496112_0003084_1078_3072 606
814 3300048915 Ga0496112_0004578 Ga0496112_0004578_6771_8591 606
815 3300048915 Ga0496112_0025884 Ga0496112_0025884_3067_4887 606
816 3300048918 Ga0496115_0019460 Ga0496115_0019460_2648_4468 606
817 3300050512 nmdc:mga0n895_3571_c1 nmdc:mga0n895_3571_c1_7240_9060 606
818 3300050513 nmdc:mga0rr50_3538_c1 nmdc:mga0rr50_3538_c1_6789_8609 606
819 3300050514 nmdc:mga08x19_16802_c1 nmdc:mga08x19_16802_c1_2520_4340 606
820 3300050514 nmdc:mga08x19_24037_c1 nmdc:mga08x19_24037_c1_1013_2833 606
821 3300050515 nmdc:mga0a205_9848_c1 nmdc:mga0a205_9848_c1_3547_5367 606
822 3300053103 Ga0500555_000117 Ga0500555_000117_33001_34827 606
823 3300053730 Ga0500645_000345 Ga0500645_000345_10806_12632 606

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

454

608

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ghi-assembly3.cif.gz_C crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9517 360 600
3nh9-assembly1.cif.gz_A nucleotide binding domain of human abcb6 (atp bound structure) 0.9432 343 602
2ghi-assembly1.cif.gz_A crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9419 360 602
2ghi-assembly4.cif.gz_D crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9413 360 600
2fgk-assembly2.cif.gz_B crystal structure of the abc-cassette e631q mutant of hlyb with bound atp 0.9282 360 601
ID Description Score Start End Superfamily
2ghiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9517 360 600 3.40.50.300
af_P23886_333_572_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9422 360 599 3.40.50.300
af_P0AAG5_335_579_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9413 357 604 3.40.50.300
af_P9WQJ9_605_853_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9406 360 605 3.40.50.300
af_Q2FVJ2_326_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9402 348 606 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7S1X004-F1-model_v4 ABC transporter domain-containing protein 0.9678 430 587 GO:0005524
GO:0005737
GO:0016020
GO:0016887
GO:0042626
AF-A0A519X245-F1-model_v4 deleted 0.9638 403 604
AF-A0A2A8D2P9-F1-model_v4 ABC transporter domain-containing protein 0.9625 360 605 GO:0005524
GO:0016887
GO:0034040
AF-A0A6P7HDW7-F1-model_v4 Multidrug resistance protein 1B-like 0.9593 360 600 GO:0005524
GO:0016020
GO:0016887
GO:0042626
AF-A0A537DY65-F1-model_v4 ATP-binding cassette domain-containing protein 0.9587 410 605 GO:0005524
GO:0016020
GO:0016887
GO:0042626

Feature Viewer

pLDDT pTM Quality
86.02 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map