F482341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 823 | 336 | 808 | 605 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10048738|Ga0207695_100487383 |
| Length | 683 |
| Sequence | MEQRRGFHLTKCTDIFEKCNRLHLLLIFLVRLPAESGPRREEMWVAAVAEEFWKTGRPERTTVYLYRLLTGNMARSKTPAATEPLTWKQRLNALRNLPRFFRLVWQTSPGIMLANILLRITRSAIPVIILYVGKLIIDEVILLAKTGGKGDLHYIWELVALEFGLALISDGMARAVSLMDSLLGDKFSNFTSVRIMAHAARLDLDQFEDSTFYDKLERARQQTNGRTVLLSQVLGQVQDLISMGFLAAGLMAFNPWLILLLLVAVVPAFLGESYFNDRSYALTRSQTTERRELDYLRFLGASDETAKEVKLFGLSGFLIDRFSLLAEKFYRDGRKLAIKRSAWGTFFALLGSAGYYSAYVVIIFRAIHGSLSIGDLAFLAGSFRQLRSLLEGILTRFTSVSQGAIYLQDLFEFFEIEPRIKPVAHPRPFXXPVKEGFVFEDVGFRYLHSERWANRHLNFTLKAGERLALVGENGAGKTTLIKLLTRLYDPTEGRILLDGVDLREYDPDDLRRNIGVIFQDYLRYQMTMAQNIAVGNIGHKEDRALIETAAQQSLADTVVEKLPGRYDQKLGRWFGQGVDLSGGEWQKIALARAYIRDAQLLILDEPTAALDARAEYEVFQRFSELTQGRTAVLISHRFSTVRMADRILVLDKGQLLEIGSHEELLARNGRYAELFHLQARGYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 2 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 3 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 4 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 5 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 6 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 7 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 8 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 9 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 10 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 11 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 12 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 13 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 14 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 15 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 16 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 126 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 127 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 282 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 283 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 284 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 308 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 325 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 326 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 328 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 330 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 332 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 333 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 334 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.81 |
| Metatranscriptomes | 0.36 |
| Isolates | 1.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.16 |
| Nodule | 0 |
| Rhizoplane | 1.82 |
| Rhizosphere | 89.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000166 | 3300000546 | Bacteria | 10816 |
| 2 | LJNas_1000968 | 3300000546 | Bacteria | 4581 |
| 3 | JGI24737J22298_10007369 | 3300001990 | Bacteria | 3717 |
| 4 | JGI25162J39368_1000141 | 3300002737 | Bacteria | 77973 |
| 5 | JGI25162J39368_1000852 | 3300002737 | Bacteria | 20132 |
| 6 | JGI25164J39214_1000617 | 3300002772 | Bacteria | 15116 |
| 7 | JGI25165J46597_1000157 | 3300003214 | Bacteria | 108987 |
| 8 | rootH2_10000327 | 3300003320 | Bacteria | 51947 |
| 9 | rootH2_10006617 | 3300003320 | Bacteria | 52484 |
| 10 | rootH2_10108130 | 3300003320 | Bacteria | 7338 |
| 11 | rootL2_10093656 | 3300003322 | Bacteria | 5225 |
| 12 | rootH1_10126443 | 3300003323 | Unclassified | 2992 |
| 13 | rootH1_10139100 | 3300003323 | Bacteria | 4355 |
| 14 | Ga0065714_10066555 | 3300005288 | Bacteria | 6653 |
| 15 | Ga0065704_10071014 | 3300005289 | Bacteria | 13752 |
| 16 | Ga0065704_10076291 | 3300005289 | Bacteria | 5181 |
| 17 | Ga0065707_10103932 | 3300005295 | Bacteria | 2722 |
| 18 | Ga0070658_10000008 | 3300005327 | Bacteria | 319912 |
| 19 | Ga0070658_10000074 | 3300005327 | Bacteria | 95827 |
| 20 | Ga0070658_10000230 | 3300005327 | Bacteria | 49640 |
| 21 | Ga0070658_10002294 | 3300005327 | Bacteria | 16046 |
| 22 | Ga0070658_10034259 | 3300005327 | Bacteria | 4086 |
| 23 | Ga0070658_10110586 | 3300005327 | Unclassified | 2276 |
| 24 | Ga0070676_10001002 | 3300005328 | Bacteria | 14031 |
| 25 | Ga0070683_100129003 | 3300005329 | Bacteria | 2392 |
| 26 | Ga0070677_10004081 | 3300005333 | Bacteria | 4739 |
| 27 | Ga0068869_100000733 | 3300005334 | Bacteria | 18626 |
| 28 | Ga0068869_100022814 | 3300005334 | Unclassified | 4317 |
| 29 | Ga0068869_100076046 | 3300005334 | Bacteria | 2495 |
| 30 | Ga0070666_10000165 | 3300005335 | Bacteria | 45323 |
| 31 | Ga0070666_10001005 | 3300005335 | Bacteria | 17249 |
| 32 | Ga0070666_10024138 | 3300005335 | Unclassified | 3959 |
| 33 | Ga0070680_100005084 | 3300005336 | Bacteria | 9924 |
| 34 | Ga0070680_100016335 | 3300005336 | Bacteria | 5842 |
| 35 | Ga0070682_100007190 | 3300005337 | Bacteria | 6272 |
| 36 | Ga0068868_100002352 | 3300005338 | Bacteria | 13087 |
| 37 | Ga0068868_100005239 | 3300005338 | Bacteria | 9103 |
| 38 | Ga0068868_100008266 | 3300005338 | Bacteria | 7451 |
| 39 | Ga0070660_100000870 | 3300005339 | Bacteria | 20145 |
| 40 | Ga0070691_10002535 | 3300005341 | Bacteria | 8137 |
| 41 | Ga0070691_10009231 | 3300005341 | Bacteria | 4508 |
| 42 | Ga0070661_100062757 | 3300005344 | Unclassified | 2728 |
| 43 | Ga0070661_100107872 | 3300005344 | Bacteria | 2077 |
| 44 | Ga0070668_100009328 | 3300005347 | Bacteria | 7280 |
| 45 | Ga0070675_100048866 | 3300005354 | Bacteria | 3470 |
| 46 | Ga0070675_100056061 | 3300005354 | Bacteria | 3246 |
| 47 | Ga0070671_100038052 | 3300005355 | Bacteria | 3993 |
| 48 | Ga0070674_100053400 | 3300005356 | Bacteria | 2790 |
| 49 | Ga0070673_100000096 | 3300005364 | Bacteria | 39184 |
| 50 | Ga0070673_100030771 | 3300005364 | Bacteria | 4022 |
| 51 | Ga0070688_100009314 | 3300005365 | Bacteria | 5365 |
| 52 | Ga0070659_100004697 | 3300005366 | Bacteria | 9753 |
| 53 | Ga0070659_100123379 | 3300005366 | Bacteria | 2100 |
| 54 | Ga0070667_100002462 | 3300005367 | Bacteria | 16163 |
| 55 | Ga0070709_10005054 | 3300005434 | Bacteria | 7132 |
| 56 | Ga0070709_10028343 | 3300005434 | Bacteria | 3338 |
| 57 | Ga0070709_10076770 | 3300005434 | Bacteria | 2170 |
| 58 | Ga0070714_100001471 | 3300005435 | Bacteria | 17162 |
| 59 | Ga0070713_100001335 | 3300005436 | Bacteria | 15771 |
| 60 | Ga0070713_100038053 | 3300005436 | Bacteria | 3894 |
| 61 | Ga0070713_100045224 | 3300005436 | Bacteria | 3606 |
| 62 | Ga0070710_10001260 | 3300005437 | Bacteria | 12035 |
| 63 | Ga0070710_10012873 | 3300005437 | Bacteria | 4169 |
| 64 | Ga0070710_10016203 | 3300005437 | Bacteria | 3788 |
| 65 | Ga0070711_100001977 | 3300005439 | Bacteria | 11516 |
| 66 | Ga0070711_100021677 | 3300005439 | Bacteria | 4157 |
| 67 | Ga0070708_100000141 | 3300005445 | Bacteria | 49530 |
| 68 | Ga0070708_100004536 | 3300005445 | Bacteria | 10933 |
| 69 | Ga0070708_100030444 | 3300005445 | Bacteria | 4665 |
| 70 | Ga0070663_100000586 | 3300005455 | Bacteria | 19455 |
| 71 | Ga0070678_100030075 | 3300005456 | Bacteria | 3728 |
| 72 | Ga0070678_100031688 | 3300005456 | Bacteria | 3651 |
| 73 | Ga0070662_100000020 | 3300005457 | Bacteria | 99425 |
| 74 | Ga0070662_100008816 | 3300005457 | Bacteria | 6575 |
| 75 | Ga0070662_100018002 | 3300005457 | Bacteria | 4772 |
| 76 | Ga0070662_100099864 | 3300005457 | Bacteria | 2195 |
| 77 | Ga0070681_10000293 | 3300005458 | Bacteria | 40403 |
| 78 | Ga0070681_10006018 | 3300005458 | Bacteria | 11754 |
| 79 | Ga0070681_10008225 | 3300005458 | Bacteria | 10206 |
| 80 | Ga0070681_10105955 | 3300005458 | Unclassified | 2753 |
| 81 | Ga0068867_100012223 | 3300005459 | Bacteria | 6068 |
| 82 | Ga0068867_100106407 | 3300005459 | Unclassified | 2149 |
| 83 | Ga0070685_10018240 | 3300005466 | Bacteria | 3771 |
| 84 | Ga0070685_10019301 | 3300005466 | Bacteria | 3676 |
| 85 | Ga0070706_100002149 | 3300005467 | Bacteria | 20081 |
| 86 | Ga0070707_100004191 | 3300005468 | Bacteria | 13515 |
| 87 | Ga0070698_100004301 | 3300005471 | Bacteria | 15665 |
| 88 | Ga0070699_100000132 | 3300005518 | Bacteria | 69186 |
| 89 | Ga0070679_100018669 | 3300005530 | Bacteria | 6732 |
| 90 | Ga0070679_100031281 | 3300005530 | Bacteria | 5257 |
| 91 | Ga0070679_100036612 | 3300005530 | Bacteria | 4870 |
| 92 | Ga0070679_100045509 | 3300005530 | Unclassified | 4373 |
| 93 | Ga0070679_100126134 | 3300005530 | Unclassified | 2542 |
| 94 | Ga0070684_100067299 | 3300005535 | Bacteria | 3146 |
| 95 | Ga0070684_100073890 | 3300005535 | Bacteria | 3005 |
| 96 | Ga0070684_100096428 | 3300005535 | Bacteria | 2636 |
| 97 | Ga0070697_100000261 | 3300005536 | Bacteria | 42660 |
| 98 | Ga0070697_100001102 | 3300005536 | Bacteria | 20411 |
| 99 | Ga0068853_100004755 | 3300005539 | Bacteria | 10557 |
| 100 | Ga0068853_100069644 | 3300005539 | Unclassified | 3061 |
| 101 | Ga0068853_100100389 | 3300005539 | Unclassified | 2558 |
| 102 | Ga0070672_100000033 | 3300005543 | Bacteria | 61516 |
| 103 | Ga0070686_100094564 | 3300005544 | Bacteria | 2006 |
| 104 | Ga0070665_100000041 | 3300005548 | Bacteria | 297849 |
| 105 | Ga0070665_100001161 | 3300005548 | Bacteria | 32366 |
| 106 | Ga0070665_100001625 | 3300005548 | Bacteria | 25892 |
| 107 | Ga0070665_100032975 | 3300005548 | Bacteria | 5211 |
| 108 | Ga0068855_100000026 | 3300005563 | Bacteria | 175140 |
| 109 | Ga0068855_100000275 | 3300005563 | Bacteria | 63345 |
| 110 | Ga0068855_100000500 | 3300005563 | Bacteria | 48457 |
| 111 | Ga0068855_100001157 | 3300005563 | Bacteria | 32696 |
| 112 | Ga0068855_100005062 | 3300005563 | Bacteria | 16079 |
| 113 | Ga0068855_100014026 | 3300005563 | Bacteria | 9659 |
| 114 | Ga0068855_100024706 | 3300005563 | Bacteria | 7188 |
| 115 | Ga0068855_100047039 | 3300005563 | Bacteria | 5098 |
| 116 | Ga0068855_100065776 | 3300005563 | Bacteria | 4227 |
| 117 | Ga0068855_100068978 | 3300005563 | Bacteria | 4115 |
| 118 | Ga0068855_100075546 | 3300005563 | Bacteria | 3912 |
| 119 | Ga0068855_100096081 | 3300005563 | Bacteria | 3415 |
| 120 | Ga0068855_100099240 | 3300005563 | Bacteria | 3354 |
| 121 | Ga0068855_100104433 | 3300005563 | Unclassified | 3259 |
| 122 | Ga0070664_100000583 | 3300005564 | Bacteria | 27797 |
| 123 | Ga0070664_100034117 | 3300005564 | Unclassified | 4268 |
| 124 | Ga0068857_100001802 | 3300005577 | Bacteria | 17235 |
| 125 | Ga0068857_100005388 | 3300005577 | Bacteria | 10908 |
| 126 | Ga0068857_100015189 | 3300005577 | Bacteria | 6719 |
| 127 | Ga0068857_100040949 | 3300005577 | Bacteria | 4107 |
| 128 | Ga0068854_100009116 | 3300005578 | Bacteria | 6398 |
| 129 | Ga0068854_100095595 | 3300005578 | Unclassified | 2218 |
| 130 | Ga0068856_100001116 | 3300005614 | Bacteria | 28358 |
| 131 | Ga0068856_100004130 | 3300005614 | Bacteria | 14509 |
| 132 | Ga0068856_100004768 | 3300005614 | Bacteria | 13445 |
| 133 | Ga0068856_100018770 | 3300005614 | Bacteria | 6706 |
| 134 | Ga0068856_100041934 | 3300005614 | Bacteria | 4500 |
| 135 | Ga0068856_100058747 | 3300005614 | Bacteria | 3798 |
| 136 | Ga0068856_100059504 | 3300005614 | Bacteria | 3773 |
| 137 | Ga0068856_100091069 | 3300005614 | Bacteria | 3034 |
| 138 | Ga0068856_100105561 | 3300005614 | Bacteria | 2811 |
| 139 | Ga0068856_100179104 | 3300005614 | Unclassified | 2132 |
| 140 | Ga0068852_100000649 | 3300005616 | Bacteria | 22756 |
| 141 | Ga0068852_100010317 | 3300005616 | Bacteria | 6975 |
| 142 | Ga0068852_100022599 | 3300005616 | Bacteria | 5046 |
| 143 | Ga0068852_100028898 | 3300005616 | Bacteria | 4545 |
| 144 | Ga0068852_100052799 | 3300005616 | Bacteria | 3495 |
| 145 | Ga0068859_100000163 | 3300005617 | Bacteria | 64401 |
| 146 | Ga0068859_100005316 | 3300005617 | Bacteria | 13091 |
| 147 | Ga0068859_100110964 | 3300005617 | Unclassified | 2805 |
| 148 | Ga0068864_100002828 | 3300005618 | Bacteria | 14323 |
| 149 | Ga0068864_100003380 | 3300005618 | Bacteria | 13195 |
| 150 | Ga0068864_100003869 | 3300005618 | Bacteria | 12329 |
| 151 | Ga0068864_100013821 | 3300005618 | Bacteria | 6689 |
| 152 | Ga0068864_100100603 | 3300005618 | Unclassified | 2563 |
| 153 | Ga0068866_10052792 | 3300005718 | Unclassified | 2075 |
| 154 | Ga0068861_100001398 | 3300005719 | Bacteria | 15165 |
| 155 | Ga0068861_100034641 | 3300005719 | Bacteria | 3735 |
| 156 | Ga0068863_100000696 | 3300005841 | Bacteria | 33755 |
| 157 | Ga0068863_100003177 | 3300005841 | Bacteria | 16251 |
| 158 | Ga0068863_100016617 | 3300005841 | Bacteria | 7061 |
| 159 | Ga0068863_100057605 | 3300005841 | Bacteria | 3677 |
| 160 | Ga0068858_100002290 | 3300005842 | Bacteria | 19387 |
| 161 | Ga0068858_100002561 | 3300005842 | Bacteria | 18317 |
| 162 | Ga0068858_100036970 | 3300005842 | Unclassified | 4527 |
| 163 | Ga0068858_100073685 | 3300005842 | Unclassified | 3170 |
| 164 | Ga0068858_100083288 | 3300005842 | Bacteria | 2974 |
| 165 | Ga0068860_100000208 | 3300005843 | Bacteria | 92818 |
| 166 | Ga0068860_100005487 | 3300005843 | Bacteria | 12854 |
| 167 | Ga0068860_100005989 | 3300005843 | Bacteria | 12239 |
| 168 | Ga0068860_100007052 | 3300005843 | Bacteria | 11250 |
| 169 | Ga0068860_100031363 | 3300005843 | Bacteria | 5109 |
| 170 | Ga0068860_100075676 | 3300005843 | Bacteria | 3202 |
| 171 | Ga0068862_100016835 | 3300005844 | Bacteria | 6085 |
| 172 | Ga0068862_100020920 | 3300005844 | Bacteria | 5466 |
| 173 | Ga0081540_1012173 | 3300005983 | Bacteria | 5687 |
| 174 | Ga0070717_10000703 | 3300006028 | Bacteria | 21636 |
| 175 | Ga0070717_10003890 | 3300006028 | Bacteria | 10743 |
| 176 | Ga0070717_10013658 | 3300006028 | Bacteria | 6230 |
| 177 | Ga0070717_10030810 | 3300006028 | Bacteria | 4310 |
| 178 | Ga0070717_10058506 | 3300006028 | Bacteria | 3187 |
| 179 | Ga0070717_10082418 | 3300006028 | Bacteria | 2703 |
| 180 | Ga0070716_100010951 | 3300006173 | Bacteria | 4563 |
| 181 | Ga0070716_100035785 | 3300006173 | Bacteria | 2732 |
| 182 | Ga0070712_100000876 | 3300006175 | Bacteria | 17970 |
| 183 | Ga0070712_100012057 | 3300006175 | Bacteria | 5493 |
| 184 | Ga0075366_10002387 | 3300006195 | Bacteria | 9631 |
| 185 | Ga0075366_10030835 | 3300006195 | Bacteria | 3153 |
| 186 | Ga0097621_100000954 | 3300006237 | Bacteria | 20273 |
| 187 | Ga0097621_100003319 | 3300006237 | Bacteria | 11074 |
| 188 | Ga0097621_100004993 | 3300006237 | Bacteria | 9303 |
| 189 | Ga0097621_100007615 | 3300006237 | Bacteria | 7761 |
| 190 | Ga0097621_100017632 | 3300006237 | Bacteria | 5428 |
| 191 | Ga0097621_100044086 | 3300006237 | Bacteria | 3598 |
| 192 | Ga0068871_100000435 | 3300006358 | Bacteria | 28742 |
| 193 | Ga0068871_100004350 | 3300006358 | Bacteria | 9844 |
| 194 | Ga0068871_100005053 | 3300006358 | Bacteria | 9213 |
| 195 | Ga0068871_100019977 | 3300006358 | Bacteria | 5124 |
| 196 | Ga0068871_100024054 | 3300006358 | Bacteria | 4720 |
| 197 | Ga0075428_100008359 | 3300006844 | Bacteria | 11476 |
| 198 | Ga0075428_100224589 | 3300006844 | Bacteria | 2027 |
| 199 | Ga0075434_100002147 | 3300006871 | Bacteria | 17171 |
| 200 | Ga0075429_100068857 | 3300006880 | Bacteria | 3081 |
| 201 | Ga0068865_100001201 | 3300006881 | Bacteria | 15074 |
| 202 | Ga0068865_100009033 | 3300006881 | Bacteria | 6165 |
| 203 | Ga0097620_100000163 | 3300006931 | Bacteria | 64401 |
| 204 | Ga0097620_100005316 | 3300006931 | Bacteria | 13091 |
| 205 | Ga0097620_100110963 | 3300006931 | Unclassified | 2805 |
| 206 | Ga0099795_10023036 | 3300007788 | Bacteria | 2062 |
| 207 | Ga0105240_10000147 | 3300009093 | Bacteria | 142340 |
| 208 | Ga0105240_10000168 | 3300009093 | Bacteria | 133212 |
| 209 | Ga0105240_10000224 | 3300009093 | Bacteria | 113175 |
| 210 | Ga0105240_10001324 | 3300009093 | Bacteria | 42710 |
| 211 | Ga0105240_10004368 | 3300009093 | Bacteria | 21581 |
| 212 | Ga0105240_10005950 | 3300009093 | Bacteria | 18048 |
| 213 | Ga0105240_10007328 | 3300009093 | Bacteria | 16052 |
| 214 | Ga0105240_10034786 | 3300009093 | Bacteria | 6496 |
| 215 | Ga0105240_10035761 | 3300009093 | Bacteria | 6397 |
| 216 | Ga0105240_10054554 | 3300009093 | Bacteria | 5008 |
| 217 | Ga0105240_10094379 | 3300009093 | Bacteria | 3649 |
| 218 | Ga0105240_10194099 | 3300009093 | Bacteria | 2386 |
| 219 | Ga0111539_10032468 | 3300009094 | Bacteria | 6339 |
| 220 | Ga0111539_10143468 | 3300009094 | Bacteria | 2795 |
| 221 | Ga0105245_10025885 | 3300009098 | Bacteria | 5161 |
| 222 | Ga0105241_10000169 | 3300009174 | Bacteria | 48051 |
| 223 | Ga0105241_10000319 | 3300009174 | Bacteria | 36268 |
| 224 | Ga0105241_10000578 | 3300009174 | Bacteria | 27595 |
| 225 | Ga0105241_10000776 | 3300009174 | Bacteria | 24269 |
| 226 | Ga0105241_10003320 | 3300009174 | Bacteria | 11971 |
| 227 | Ga0105241_10008924 | 3300009174 | Bacteria | 7372 |
| 228 | Ga0105241_10073520 | 3300009174 | Unclassified | 2660 |
| 229 | Ga0105242_10137727 | 3300009176 | Unclassified | 2115 |
| 230 | Ga0105248_10141399 | 3300009177 | Bacteria | 2715 |
| 231 | Ga0105237_10000052 | 3300009545 | Bacteria | 160459 |
| 232 | Ga0105237_10001301 | 3300009545 | Bacteria | 33228 |
| 233 | Ga0105237_10003655 | 3300009545 | Bacteria | 18145 |
| 234 | Ga0105237_10003711 | 3300009545 | Bacteria | 17988 |
| 235 | Ga0105237_10007444 | 3300009545 | Bacteria | 11979 |
| 236 | Ga0105237_10007588 | 3300009545 | Bacteria | 11857 |
| 237 | Ga0105237_10008207 | 3300009545 | Bacteria | 11342 |
| 238 | Ga0105237_10022438 | 3300009545 | Bacteria | 6476 |
| 239 | Ga0105237_10045664 | 3300009545 | Bacteria | 4407 |
| 240 | Ga0105237_10047019 | 3300009545 | Bacteria | 4338 |
| 241 | Ga0105237_10136627 | 3300009545 | Unclassified | 2446 |
| 242 | Ga0105238_10000198 | 3300009551 | Bacteria | 66586 |
| 243 | Ga0105238_10014111 | 3300009551 | Bacteria | 8079 |
| 244 | Ga0105238_10015881 | 3300009551 | Bacteria | 7618 |
| 245 | Ga0105238_10071623 | 3300009551 | Bacteria | 3464 |
| 246 | Ga0105249_10001077 | 3300009553 | Bacteria | 24238 |
| 247 | Ga0105249_10004075 | 3300009553 | Bacteria | 12607 |
| 248 | Ga0105249_10022927 | 3300009553 | Bacteria | 5597 |
| 249 | Ga0105249_10022928 | 3300009553 | Bacteria | 5596 |
| 250 | Ga0099796_10004036 | 3300010159 | Bacteria | 3498 |
| 251 | Ga0105239_10000043 | 3300010375 | Bacteria | 196600 |
| 252 | Ga0105239_10000270 | 3300010375 | Bacteria | 76875 |
| 253 | Ga0105239_10000370 | 3300010375 | Bacteria | 66106 |
| 254 | Ga0105239_10000578 | 3300010375 | Bacteria | 52273 |
| 255 | Ga0105239_10000981 | 3300010375 | Bacteria | 40055 |
| 256 | Ga0105239_10002131 | 3300010375 | Bacteria | 25480 |
| 257 | Ga0105239_10002974 | 3300010375 | Bacteria | 21140 |
| 258 | Ga0105239_10003513 | 3300010375 | Bacteria | 19193 |
| 259 | Ga0105239_10009124 | 3300010375 | Bacteria | 11221 |
| 260 | Ga0105239_10031048 | 3300010375 | Bacteria | 5877 |
| 261 | Ga0105239_10048809 | 3300010375 | Bacteria | 4641 |
| 262 | Ga0105239_10161533 | 3300010375 | Bacteria | 2503 |
| 263 | Ga0157373_10000152 | 3300013100 | Bacteria | 55831 |
| 264 | Ga0157373_10000464 | 3300013100 | Bacteria | 32220 |
| 265 | Ga0157373_10006725 | 3300013100 | Bacteria | 8562 |
| 266 | Ga0157373_10009314 | 3300013100 | Bacteria | 7260 |
| 267 | Ga0157373_10015167 | 3300013100 | Bacteria | 5636 |
| 268 | Ga0157373_10030507 | 3300013100 | Bacteria | 3880 |
| 269 | Ga0157371_10000689 | 3300013102 | Bacteria | 39887 |
| 270 | Ga0157371_10000749 | 3300013102 | Bacteria | 37566 |
| 271 | Ga0157371_10001046 | 3300013102 | Bacteria | 30367 |
| 272 | Ga0157371_10002152 | 3300013102 | Bacteria | 19201 |
| 273 | Ga0157371_10003049 | 3300013102 | Bacteria | 15547 |
| 274 | Ga0157371_10008186 | 3300013102 | Bacteria | 8359 |
| 275 | Ga0157371_10009630 | 3300013102 | Bacteria | 7597 |
| 276 | Ga0157371_10024416 | 3300013102 | Bacteria | 4414 |
| 277 | Ga0157371_10062499 | 3300013102 | Bacteria | 2640 |
| 278 | Ga0157370_10000479 | 3300013104 | Bacteria | 49878 |
| 279 | Ga0157370_10002460 | 3300013104 | Bacteria | 22346 |
| 280 | Ga0157370_10008425 | 3300013104 | Bacteria | 11123 |
| 281 | Ga0157370_10050686 | 3300013104 | Bacteria | 3967 |
| 282 | Ga0157370_10154322 | 3300013104 | Bacteria | 2136 |
| 283 | Ga0157369_10001064 | 3300013105 | Bacteria | 34528 |
| 284 | Ga0157369_10045179 | 3300013105 | Bacteria | 4792 |
| 285 | Ga0157369_10062401 | 3300013105 | Bacteria | 4016 |
| 286 | Ga0157369_10076084 | 3300013105 | Bacteria | 3598 |
| 287 | Ga0157369_10082714 | 3300013105 | Bacteria | 3435 |
| 288 | Ga0157369_10145907 | 3300013105 | Bacteria | 2502 |
| 289 | Ga0157374_10000007 | 3300013296 | Bacteria | 595643 |
| 290 | Ga0157374_10000079 | 3300013296 | Bacteria | 95883 |
| 291 | Ga0157374_10000264 | 3300013296 | Bacteria | 48546 |
| 292 | Ga0157374_10004484 | 3300013296 | Bacteria | 11725 |
| 293 | Ga0157374_10004925 | 3300013296 | Bacteria | 11207 |
| 294 | Ga0157374_10005864 | 3300013296 | Bacteria | 10373 |
| 295 | Ga0157374_10007113 | 3300013296 | Bacteria | 9530 |
| 296 | Ga0157374_10007634 | 3300013296 | Bacteria | 9231 |
| 297 | Ga0157374_10015974 | 3300013296 | Bacteria | 6594 |
| 298 | Ga0157374_10157011 | 3300013296 | Bacteria | 2215 |
| 299 | Ga0157374_10160957 | 3300013296 | Bacteria | 2186 |
| 300 | Ga0157378_10000134 | 3300013297 | Bacteria | 70195 |
| 301 | Ga0157378_10000279 | 3300013297 | Bacteria | 49611 |
| 302 | Ga0157378_10000549 | 3300013297 | Bacteria | 35656 |
| 303 | Ga0157378_10007173 | 3300013297 | Bacteria | 9733 |
| 304 | Ga0157378_10012935 | 3300013297 | Bacteria | 7301 |
| 305 | Ga0157378_10025193 | 3300013297 | Bacteria | 5241 |
| 306 | Ga0157378_10044018 | 3300013297 | Bacteria | 3963 |
| 307 | Ga0157378_10090345 | 3300013297 | Bacteria | 2783 |
| 308 | Ga0163162_10000288 | 3300013306 | Bacteria | 46072 |
| 309 | Ga0163162_10000370 | 3300013306 | Bacteria | 40835 |
| 310 | Ga0163162_10000785 | 3300013306 | Bacteria | 29535 |
| 311 | Ga0163162_10002012 | 3300013306 | Bacteria | 19132 |
| 312 | Ga0163162_10002932 | 3300013306 | Bacteria | 16276 |
| 313 | Ga0163162_10005510 | 3300013306 | Bacteria | 12235 |
| 314 | Ga0163162_10006472 | 3300013306 | Bacteria | 11340 |
| 315 | Ga0163162_10013767 | 3300013306 | Bacteria | 7899 |
| 316 | Ga0163162_10025204 | 3300013306 | Bacteria | 5877 |
| 317 | Ga0163162_10050178 | 3300013306 | Bacteria | 4185 |
| 318 | Ga0163162_10069505 | 3300013306 | Bacteria | 3574 |
| 319 | Ga0157372_10000042 | 3300013307 | Bacteria | 157651 |
| 320 | Ga0157372_10000476 | 3300013307 | Bacteria | 44270 |
| 321 | Ga0157372_10001554 | 3300013307 | Bacteria | 24992 |
| 322 | Ga0157372_10002120 | 3300013307 | Bacteria | 21568 |
| 323 | Ga0157372_10005305 | 3300013307 | Bacteria | 13688 |
| 324 | Ga0157372_10008021 | 3300013307 | Bacteria | 11230 |
| 325 | Ga0157372_10014529 | 3300013307 | Bacteria | 8425 |
| 326 | Ga0157372_10015554 | 3300013307 | Bacteria | 8154 |
| 327 | Ga0157372_10029059 | 3300013307 | Bacteria | 6032 |
| 328 | Ga0157372_10065533 | 3300013307 | Bacteria | 4079 |
| 329 | Ga0157372_10084442 | 3300013307 | Bacteria | 3599 |
| 330 | Ga0157372_10096608 | 3300013307 | Bacteria | 3368 |
| 331 | Ga0157372_10113438 | 3300013307 | Bacteria | 3106 |
| 332 | Ga0157372_10120177 | 3300013307 | Bacteria | 3017 |
| 333 | Ga0157372_10132058 | 3300013307 | Bacteria | 2873 |
| 334 | Ga0157375_10002060 | 3300013308 | Bacteria | 17358 |
| 335 | Ga0157375_10044527 | 3300013308 | Bacteria | 4313 |
| 336 | Ga0157375_10083886 | 3300013308 | Bacteria | 3233 |
| 337 | Ga0157375_10130975 | 3300013308 | Bacteria | 2627 |
| 338 | Ga0157375_10156042 | 3300013308 | Unclassified | 2421 |
| 339 | Ga0163163_10006654 | 3300014325 | Bacteria | 10126 |
| 340 | Ga0163163_10027369 | 3300014325 | Bacteria | 5460 |
| 341 | Ga0163163_10031829 | 3300014325 | Bacteria | 5094 |
| 342 | Ga0163163_10049855 | 3300014325 | Bacteria | 4121 |
| 343 | Ga0163163_10076963 | 3300014325 | Bacteria | 3332 |
| 344 | Ga0157380_10004889 | 3300014326 | Bacteria | 9336 |
| 345 | Ga0182008_10000024 | 3300014497 | Bacteria | 199978 |
| 346 | Ga0157379_10002887 | 3300014968 | Bacteria | 14494 |
| 347 | Ga0157379_10013613 | 3300014968 | Bacteria | 7127 |
| 348 | Ga0157379_10024953 | 3300014968 | Bacteria | 5306 |
| 349 | Ga0157379_10025189 | 3300014968 | Bacteria | 5282 |
| 350 | Ga0157379_10037079 | 3300014968 | Bacteria | 4347 |
| 351 | Ga0157379_10047498 | 3300014968 | Bacteria | 3829 |
| 352 | Ga0157379_10148777 | 3300014968 | Unclassified | 2112 |
| 353 | Ga0157376_10001813 | 3300014969 | Bacteria | 14211 |
| 354 | Ga0157376_10012790 | 3300014969 | Bacteria | 6242 |
| 355 | Ga0157376_10019104 | 3300014969 | Bacteria | 5273 |
| 356 | Ga0157376_10019653 | 3300014969 | Bacteria | 5212 |
| 357 | Ga0157376_10027618 | 3300014969 | Bacteria | 4501 |
| 358 | Ga0157376_10045731 | 3300014969 | Bacteria | 3606 |
| 359 | Ga0157376_10061965 | 3300014969 | Unclassified | 3146 |
| 360 | Ga0157376_10066861 | 3300014969 | Bacteria | 3039 |
| 361 | Ga0182006_1014138 | 3300015261 | Bacteria | 3446 |
| 362 | Ga0163161_10012799 | 3300017792 | Bacteria | 5828 |
| 363 | Ga0163161_10044947 | 3300017792 | Unclassified | 3182 |
| 364 | Ga0213872_10003201 | 3300021361 | Bacteria | 9169 |
| 365 | Ga0213872_10004135 | 3300021361 | Bacteria | 7803 |
| 366 | Ga0224569_100072 | 3300022732 | Bacteria | 6583 |
| 367 | Ga0228598_1001851 | 3300024227 | Bacteria | 4605 |
| 368 | Ga0228598_1002000 | 3300024227 | Bacteria | 4453 |
| 369 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 370 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 371 | Ga0209437_100070 | 3300025233 | Bacteria | 306718 |
| 372 | Ga0209026_1000301 | 3300025250 | Bacteria | 53883 |
| 373 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 374 | Ga0209455_1004625 | 3300025272 | Bacteria | 4446 |
| 375 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 376 | Ga0207682_10005490 | 3300025893 | Bacteria | 5164 |
| 377 | Ga0207692_10001733 | 3300025898 | Bacteria | 8262 |
| 378 | Ga0207692_10006488 | 3300025898 | Bacteria | 4745 |
| 379 | Ga0207692_10028642 | 3300025898 | Unclassified | 2638 |
| 380 | Ga0207642_10005445 | 3300025899 | Unclassified | 4158 |
| 381 | Ga0207642_10018855 | 3300025899 | Bacteria | 2658 |
| 382 | Ga0207680_10000543 | 3300025903 | Bacteria | 17912 |
| 383 | Ga0207680_10009835 | 3300025903 | Bacteria | 4761 |
| 384 | Ga0207647_10000043 | 3300025904 | Bacteria | 91109 |
| 385 | Ga0207647_10000102 | 3300025904 | Bacteria | 66103 |
| 386 | Ga0207647_10000900 | 3300025904 | Bacteria | 23009 |
| 387 | Ga0207647_10001316 | 3300025904 | Bacteria | 19075 |
| 388 | Ga0207647_10064739 | 3300025904 | Bacteria | 2221 |
| 389 | Ga0207685_10009398 | 3300025905 | Bacteria | 2839 |
| 390 | Ga0207645_10002569 | 3300025907 | Bacteria | 14159 |
| 391 | Ga0207645_10007346 | 3300025907 | Bacteria | 7791 |
| 392 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 393 | Ga0207705_10000081 | 3300025909 | Bacteria | 118488 |
| 394 | Ga0207705_10019298 | 3300025909 | Bacteria | 4875 |
| 395 | Ga0207705_10039272 | 3300025909 | Bacteria | 3391 |
| 396 | Ga0207684_10000398 | 3300025910 | Bacteria | 58071 |
| 397 | Ga0207654_10000235 | 3300025911 | Bacteria | 33984 |
| 398 | Ga0207654_10001369 | 3300025911 | Bacteria | 12925 |
| 399 | Ga0207654_10003304 | 3300025911 | Bacteria | 8154 |
| 400 | Ga0207654_10005463 | 3300025911 | Bacteria | 6428 |
| 401 | Ga0207654_10030809 | 3300025911 | Bacteria | 2948 |
| 402 | Ga0207707_10000721 | 3300025912 | Bacteria | 32676 |
| 403 | Ga0207707_10012472 | 3300025912 | Bacteria | 7389 |
| 404 | Ga0207707_10019352 | 3300025912 | Bacteria | 5943 |
| 405 | Ga0207707_10020399 | 3300025912 | Bacteria | 5788 |
| 406 | Ga0207707_10043275 | 3300025912 | Bacteria | 3928 |
| 407 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 408 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 409 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 410 | Ga0207695_10000262 | 3300025913 | Bacteria | 133005 |
| 411 | Ga0207695_10000812 | 3300025913 | Bacteria | 58133 |
| 412 | Ga0207695_10005266 | 3300025913 | Bacteria | 17253 |
| 413 | Ga0207695_10013560 | 3300025913 | Bacteria | 9711 |
| 414 | Ga0207695_10024212 | 3300025913 | Bacteria | 6836 |
| 415 | Ga0207695_10026453 | 3300025913 | Bacteria | 6476 |
| 416 | Ga0207695_10032923 | 3300025913 | Bacteria | 5665 |
| 417 | Ga0207695_10048738 | 3300025913 | Bacteria | 4472 |
| 418 | Ga0207695_10119214 | 3300025913 | Bacteria | 2609 |
| 419 | Ga0207671_10002787 | 3300025914 | Bacteria | 18240 |
| 420 | Ga0207671_10003201 | 3300025914 | Bacteria | 16484 |
| 421 | Ga0207671_10003442 | 3300025914 | Bacteria | 15773 |
| 422 | Ga0207671_10004509 | 3300025914 | Bacteria | 13258 |
| 423 | Ga0207671_10005689 | 3300025914 | Bacteria | 11395 |
| 424 | Ga0207671_10007249 | 3300025914 | Bacteria | 9659 |
| 425 | Ga0207671_10011525 | 3300025914 | Bacteria | 7184 |
| 426 | Ga0207671_10016565 | 3300025914 | Bacteria | 5724 |
| 427 | Ga0207671_10017978 | 3300025914 | Bacteria | 5439 |
| 428 | Ga0207671_10105198 | 3300025914 | Unclassified | 2141 |
| 429 | Ga0207693_10001244 | 3300025915 | Bacteria | 22675 |
| 430 | Ga0207663_10004252 | 3300025916 | Bacteria | 7103 |
| 431 | Ga0207663_10031448 | 3300025916 | Bacteria | 3142 |
| 432 | Ga0207660_10001254 | 3300025917 | Bacteria | 17002 |
| 433 | Ga0207660_10001426 | 3300025917 | Bacteria | 16045 |
| 434 | Ga0207660_10015959 | 3300025917 | Bacteria | 4965 |
| 435 | Ga0207657_10002882 | 3300025919 | Bacteria | 18481 |
| 436 | Ga0207657_10013145 | 3300025919 | Bacteria | 8130 |
| 437 | Ga0207657_10040183 | 3300025919 | Bacteria | 4147 |
| 438 | Ga0207649_10058674 | 3300025920 | Unclassified | 2411 |
| 439 | Ga0207652_10000366 | 3300025921 | Bacteria | 46915 |
| 440 | Ga0207652_10002045 | 3300025921 | Bacteria | 17358 |
| 441 | Ga0207652_10035342 | 3300025921 | Bacteria | 4217 |
| 442 | Ga0207652_10053982 | 3300025921 | Unclassified | 3453 |
| 443 | Ga0207652_10064209 | 3300025921 | Bacteria | 3177 |
| 444 | Ga0207646_10000194 | 3300025922 | Bacteria | 82991 |
| 445 | Ga0207694_10003110 | 3300025924 | Bacteria | 13270 |
| 446 | Ga0207694_10029048 | 3300025924 | Bacteria | 4217 |
| 447 | Ga0207694_10032680 | 3300025924 | Bacteria | 3984 |
| 448 | Ga0207694_10066240 | 3300025924 | Bacteria | 2817 |
| 449 | Ga0207650_10006983 | 3300025925 | Bacteria | 7701 |
| 450 | Ga0207700_10013881 | 3300025928 | Bacteria | 5261 |
| 451 | Ga0207700_10047627 | 3300025928 | Bacteria | 3179 |
| 452 | Ga0207700_10048114 | 3300025928 | Bacteria | 3165 |
| 453 | Ga0207664_10002361 | 3300025929 | Bacteria | 12465 |
| 454 | Ga0207664_10046497 | 3300025929 | Unclassified | 3406 |
| 455 | Ga0207690_10017866 | 3300025932 | Bacteria | 4340 |
| 456 | Ga0207706_10000044 | 3300025933 | Bacteria | 123576 |
| 457 | Ga0207706_10023341 | 3300025933 | Bacteria | 5555 |
| 458 | Ga0207706_10127102 | 3300025933 | Bacteria | 2241 |
| 459 | Ga0207704_10001086 | 3300025938 | Bacteria | 12068 |
| 460 | Ga0207704_10064558 | 3300025938 | Bacteria | 2288 |
| 461 | Ga0207704_10081821 | 3300025938 | Bacteria | 2090 |
| 462 | Ga0207665_10003445 | 3300025939 | Bacteria | 10581 |
| 463 | Ga0207665_10005323 | 3300025939 | Bacteria | 8601 |
| 464 | Ga0207665_10042924 | 3300025939 | Bacteria | 3023 |
| 465 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 466 | Ga0207711_10097116 | 3300025941 | Bacteria | 2601 |
| 467 | Ga0207689_10000166 | 3300025942 | Bacteria | 57369 |
| 468 | Ga0207689_10001614 | 3300025942 | Bacteria | 21366 |
| 469 | Ga0207689_10001987 | 3300025942 | Bacteria | 19318 |
| 470 | Ga0207689_10030022 | 3300025942 | Unclassified | 4532 |
| 471 | Ga0207689_10060483 | 3300025942 | Unclassified | 3115 |
| 472 | Ga0207689_10091530 | 3300025942 | Unclassified | 2499 |
| 473 | Ga0207667_10000022 | 3300025949 | Bacteria | 369570 |
| 474 | Ga0207667_10000144 | 3300025949 | Bacteria | 108295 |
| 475 | Ga0207667_10001554 | 3300025949 | Bacteria | 28868 |
| 476 | Ga0207667_10001980 | 3300025949 | Bacteria | 25670 |
| 477 | Ga0207667_10002154 | 3300025949 | Bacteria | 24694 |
| 478 | Ga0207667_10002374 | 3300025949 | Bacteria | 23561 |
| 479 | Ga0207667_10003192 | 3300025949 | Bacteria | 20255 |
| 480 | Ga0207667_10004214 | 3300025949 | Bacteria | 17648 |
| 481 | Ga0207667_10005069 | 3300025949 | Bacteria | 16094 |
| 482 | Ga0207667_10025618 | 3300025949 | Bacteria | 6453 |
| 483 | Ga0207667_10026300 | 3300025949 | Bacteria | 6360 |
| 484 | Ga0207667_10049025 | 3300025949 | Bacteria | 4463 |
| 485 | Ga0207667_10058190 | 3300025949 | Unclassified | 4055 |
| 486 | Ga0207667_10109905 | 3300025949 | Unclassified | 2844 |
| 487 | Ga0207667_10157638 | 3300025949 | Bacteria | 2335 |
| 488 | Ga0207651_10002700 | 3300025960 | Bacteria | 8502 |
| 489 | Ga0207651_10068403 | 3300025960 | Bacteria | 2504 |
| 490 | Ga0207712_10010403 | 3300025961 | Bacteria | 5906 |
| 491 | Ga0207712_10012498 | 3300025961 | Bacteria | 5425 |
| 492 | Ga0207712_10040562 | 3300025961 | Bacteria | 3196 |
| 493 | Ga0207668_10002957 | 3300025972 | Bacteria | 9959 |
| 494 | Ga0207640_10006656 | 3300025981 | Bacteria | 6348 |
| 495 | Ga0207640_10044681 | 3300025981 | Unclassified | 2840 |
| 496 | Ga0207658_10002549 | 3300025986 | Bacteria | 13238 |
| 497 | Ga0207658_10049382 | 3300025986 | Bacteria | 3092 |
| 498 | Ga0207677_10002241 | 3300026023 | Bacteria | 10147 |
| 499 | Ga0207677_10002804 | 3300026023 | Bacteria | 9197 |
| 500 | Ga0207677_10003282 | 3300026023 | Bacteria | 8552 |
| 501 | Ga0207703_10001414 | 3300026035 | Bacteria | 21864 |
| 502 | Ga0207703_10028669 | 3300026035 | Bacteria | 4391 |
| 503 | Ga0207639_10005718 | 3300026041 | Bacteria | 8418 |
| 504 | Ga0207639_10063382 | 3300026041 | Unclassified | 2862 |
| 505 | Ga0207678_10001417 | 3300026067 | Bacteria | 21979 |
| 506 | Ga0207678_10003224 | 3300026067 | Bacteria | 14742 |
| 507 | Ga0207702_10001291 | 3300026078 | Bacteria | 25054 |
| 508 | Ga0207702_10006466 | 3300026078 | Bacteria | 10103 |
| 509 | Ga0207702_10011101 | 3300026078 | Bacteria | 7519 |
| 510 | Ga0207702_10012221 | 3300026078 | Bacteria | 7144 |
| 511 | Ga0207702_10020428 | 3300026078 | Bacteria | 5486 |
| 512 | Ga0207702_10031494 | 3300026078 | Bacteria | 4420 |
| 513 | Ga0207702_10046926 | 3300026078 | Bacteria | 3638 |
| 514 | Ga0207702_10067825 | 3300026078 | Bacteria | 3063 |
| 515 | Ga0207641_10000176 | 3300026088 | Bacteria | 88863 |
| 516 | Ga0207641_10027718 | 3300026088 | Bacteria | 4680 |
| 517 | Ga0207641_10028939 | 3300026088 | Bacteria | 4580 |
| 518 | Ga0207641_10033647 | 3300026088 | Unclassified | 4258 |
| 519 | Ga0207648_10002251 | 3300026089 | Bacteria | 20862 |
| 520 | Ga0207648_10018584 | 3300026089 | Bacteria | 6291 |
| 521 | Ga0207648_10055158 | 3300026089 | Bacteria | 3470 |
| 522 | Ga0207676_10025947 | 3300026095 | Bacteria | 4351 |
| 523 | Ga0207676_10085556 | 3300026095 | Unclassified | 2573 |
| 524 | Ga0207674_10002833 | 3300026116 | Bacteria | 21566 |
| 525 | Ga0207674_10005277 | 3300026116 | Bacteria | 15380 |
| 526 | Ga0207674_10009215 | 3300026116 | Bacteria | 11314 |
| 527 | Ga0207674_10051156 | 3300026116 | Bacteria | 4216 |
| 528 | Ga0207674_10080291 | 3300026116 | Bacteria | 3265 |
| 529 | Ga0207674_10082056 | 3300026116 | Unclassified | 3226 |
| 530 | Ga0207675_100020554 | 3300026118 | Bacteria | 6153 |
| 531 | Ga0207675_100026324 | 3300026118 | Bacteria | 5414 |
| 532 | Ga0207683_10001589 | 3300026121 | Bacteria | 20496 |
| 533 | Ga0207698_10006151 | 3300026142 | Bacteria | 7474 |
| 534 | Ga0207698_10020378 | 3300026142 | Bacteria | 4563 |
| 535 | Ga0207698_10036534 | 3300026142 | Bacteria | 3607 |
| 536 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 537 | Ga0268266_10003319 | 3300028379 | Bacteria | 16146 |
| 538 | Ga0268266_10004612 | 3300028379 | Bacteria | 13153 |
| 539 | Ga0268266_10012317 | 3300028379 | Bacteria | 7397 |
| 540 | Ga0268266_10015592 | 3300028379 | Bacteria | 6513 |
| 541 | Ga0268266_10040838 | 3300028379 | Bacteria | 3955 |
| 542 | Ga0268266_10104402 | 3300028379 | Bacteria | 2502 |
| 543 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 544 | Ga0268264_10003033 | 3300028381 | Bacteria | 14561 |
| 545 | Ga0268264_10004916 | 3300028381 | Bacteria | 11325 |
| 546 | Ga0268264_10026431 | 3300028381 | Bacteria | 4743 |
| 547 | Ga0268264_10031781 | 3300028381 | Bacteria | 4329 |
| 548 | Ga0307517_10004917 | 3300028786 | Bacteria | 20360 |
| 549 | Ga0307517_10083164 | 3300028786 | Bacteria | 2709 |
| 550 | Ga0307515_10000107 | 3300028794 | Bacteria | 197046 |
| 551 | Ga0307515_10000144 | 3300028794 | Bacteria | 170910 |
| 552 | Ga0307515_10003557 | 3300028794 | Bacteria | 32734 |
| 553 | Ga0307515_10076530 | 3300028794 | Bacteria | 4437 |
| 554 | Ga0265338_10023165 | 3300028800 | Bacteria | 6395 |
| 555 | Ga0307511_10000808 | 3300030521 | Bacteria | 33418 |
| 556 | Ga0265762_1000173 | 3300030760 | Bacteria | 10249 |
| 557 | Ga0265762_1000258 | 3300030760 | Bacteria | 8780 |
| 558 | Ga0265760_10009115 | 3300031090 | Bacteria | 2835 |
| 559 | Ga0265327_10000146 | 3300031251 | Bacteria | 154436 |
| 560 | Ga0307513_10110629 | 3300031456 | Bacteria | 2741 |
| 561 | Ga0307509_10026077 | 3300031507 | Bacteria | 6522 |
| 562 | Ga0307509_10041505 | 3300031507 | Bacteria | 4992 |
| 563 | Ga0307509_10075276 | 3300031507 | Bacteria | 3507 |
| 564 | Ga0307508_10010293 | 3300031616 | Bacteria | 8556 |
| 565 | Ga0307516_10001744 | 3300031730 | Bacteria | 29907 |
| 566 | Ga0307413_10025147 | 3300031824 | Bacteria | 3259 |
| 567 | Ga0307412_10000030 | 3300031911 | Bacteria | 208541 |
| 568 | Ga0307414_10011176 | 3300032004 | Bacteria | 5253 |
| 569 | Ga0307510_10001458 | 3300033180 | Bacteria | 26051 |
| 570 | Ga0373934_0010268 | 3300035086 | Bacteria | 3514 |
| 571 | Ga0373936_0017090 | 3300035113 | Unclassified | 2791 |
| 572 | Ga0373956_0006681 | 3300035119 | Bacteria | 4627 |
| 573 | Ga0373931_0055954 | 3300035691 | Bacteria | 2112 |
| 574 | Ga0373935_0080200 | 3300035692 | Bacteria | 2120 |
| 575 | Ga0373933_0000470 | 3300035724 | Bacteria | 25182 |
| 576 | Ga0373933_0009387 | 3300035724 | Bacteria | 5344 |
| 577 | Ga0373937_0000051 | 3300036401 | Bacteria | 104818 |
| 578 | Ga0373937_0022929 | 3300036401 | Bacteria | 5614 |
| 579 | Ga0373937_0024157 | 3300036401 | Bacteria | 5479 |
| 580 | Ga0373925_0002014 | 3300037068 | Bacteria | 16828 |
| 581 | Ga0395899_0000401 | 3300037312 | Bacteria | 50789 |
| 582 | Ga0395899_0003295 | 3300037312 | Bacteria | 12804 |
| 583 | Ga0395899_0037693 | 3300037312 | Bacteria | 3624 |
| 584 | Ga0395899_0039707 | 3300037312 | Bacteria | 3521 |
| 585 | Ga0395900_0021037 | 3300037418 | Bacteria | 6667 |
| 586 | Ga0395900_0038610 | 3300037418 | Bacteria | 4922 |
| 587 | Ga0395900_0159718 | 3300037418 | Bacteria | 2299 |
| 588 | Ga0395898_0033448 | 3300037466 | Bacteria | 5131 |
| 589 | Ga0395905_0001841 | 3300037471 | Bacteria | 24475 |
| 590 | Ga0395905_0003680 | 3300037471 | Bacteria | 16238 |
| 591 | Ga0395905_0011240 | 3300037471 | Bacteria | 8654 |
| 592 | Ga0395905_0059953 | 3300037471 | Unclassified | 3558 |
| 593 | Ga0436364_0372332 | 3300037853 | Bacteria | 18280 |
| 594 | Ga0436364_0871624 | 3300037853 | Bacteria | 117373 |
| 595 | Ga0436364_1460474 | 3300037853 | Bacteria | 2694 |
| 596 | Ga0395901_0000722 | 3300038443 | Bacteria | 37562 |
| 597 | Ga0395901_0010861 | 3300038443 | Bacteria | 9229 |
| 598 | Ga0436365_0793046 | 3300039437 | Bacteria | 2745 |
| 599 | Ga0436360_0150364 | 3300039438 | Bacteria | 5156 |
| 600 | Ga0436360_1278397 | 3300039438 | Bacteria | 18835 |
| 601 | Ga0436361_0072947 | 3300039447 | Bacteria | 4662 |
| 602 | Ga0436361_0130986 | 3300039447 | Bacteria | 11891 |
| 603 | Ga0436363_0218926 | 3300039450 | Bacteria | 6114 |
| 604 | Ga0436362_1196168 | 3300039453 | Bacteria | 10009 |
| 605 | Ga0466969_0000972 | 3300044656 | Bacteria | 15442 |
| 606 | Ga0466972_0000007 | 3300044658 | Bacteria | 277010 |
| 607 | Ga0466966_0000018 | 3300044684 | Bacteria | 122605 |
| 608 | Ga0466961_0076050 | 3300044693 | Bacteria | 2128 |
| 609 | Ga0466963_0014163 | 3300044694 | Bacteria | 4914 |
| 610 | Ga0466964_0022634 | 3300044706 | Bacteria | 2440 |
| 611 | Ga0466957_0002210 | 3300044842 | Bacteria | 10434 |
| 612 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 613 | Ga0451576_0008203 | 3300045051 | Bacteria | 12295 |
| 614 | Ga0451576_0058438 | 3300045051 | Bacteria | 4030 |
| 615 | Ga0451576_0063258 | 3300045051 | Bacteria | 3857 |
| 616 | Ga0451576_0154676 | 3300045051 | Bacteria | 2392 |
| 617 | Ga0466958_0017331 | 3300045836 | Bacteria | 4162 |
| 618 | Ga0495592_0035834 | 3300046454 | Bacteria | 3739 |
| 619 | Ga0495629_0010544 | 3300046459 | Bacteria | 6725 |
| 620 | Ga0495638_0011001 | 3300046460 | Bacteria | 6257 |
| 621 | Ga0495651_0007694 | 3300046462 | Bacteria | 8239 |
| 622 | Ga0495651_0008741 | 3300046462 | Bacteria | 7769 |
| 623 | Ga0495651_0088748 | 3300046462 | Bacteria | 2323 |
| 624 | Ga0495651_0098308 | 3300046462 | Unclassified | 2184 |
| 625 | Ga0495650_0000022 | 3300046471 | Bacteria | 530747 |
| 626 | Ga0495650_0007377 | 3300046471 | Bacteria | 6617 |
| 627 | Ga0495650_0020756 | 3300046471 | Unclassified | 3195 |
| 628 | Ga0495580_0002060 | 3300046472 | Bacteria | 17664 |
| 629 | Ga0495580_0006959 | 3300046472 | Bacteria | 9123 |
| 630 | Ga0495580_0007312 | 3300046472 | Bacteria | 8881 |
| 631 | Ga0495580_0019360 | 3300046472 | Bacteria | 5058 |
| 632 | Ga0495580_0100461 | 3300046472 | Bacteria | 2012 |
| 633 | Ga0495582_0000342 | 3300046473 | Bacteria | 25603 |
| 634 | Ga0495582_0021119 | 3300046473 | Bacteria | 3565 |
| 635 | Ga0495662_0005651 | 3300046476 | Bacteria | 6250 |
| 636 | Ga0495664_0004651 | 3300046477 | Bacteria | 7509 |
| 637 | Ga0495585_0003372 | 3300046492 | Bacteria | 10813 |
| 638 | Ga0495594_0001240 | 3300046499 | Bacteria | 13361 |
| 639 | Ga0495594_0002472 | 3300046499 | Bacteria | 9625 |
| 640 | Ga0495606_0010358 | 3300046507 | Bacteria | 7747 |
| 641 | Ga0495606_0033722 | 3300046507 | Bacteria | 3526 |
| 642 | Ga0495606_0072148 | 3300046507 | Bacteria | 2171 |
| 643 | Ga0495628_0021608 | 3300046516 | Bacteria | 5291 |
| 644 | Ga0495630_0006029 | 3300046517 | Bacteria | 8582 |
| 645 | Ga0495630_0039277 | 3300046517 | Bacteria | 3540 |
| 646 | Ga0495630_0112712 | 3300046517 | Bacteria | 2060 |
| 647 | Ga0495643_0032638 | 3300046522 | Bacteria | 2888 |
| 648 | Ga0495644_0000020 | 3300046523 | Bacteria | 83035 |
| 649 | Ga0495644_0001921 | 3300046523 | Bacteria | 8358 |
| 650 | Ga0495648_0013439 | 3300046524 | Bacteria | 6052 |
| 651 | Ga0495648_0028456 | 3300046524 | Bacteria | 3722 |
| 652 | Ga0495665_0001294 | 3300046531 | Bacteria | 13356 |
| 653 | Ga0495665_0018016 | 3300046531 | Bacteria | 3796 |
| 654 | Ga0495587_0000381 | 3300046536 | Bacteria | 31640 |
| 655 | Ga0495587_0039774 | 3300046536 | Bacteria | 2813 |
| 656 | Ga0495609_0018416 | 3300046538 | Bacteria | 3236 |
| 657 | Ga0495645_0010375 | 3300046543 | Bacteria | 6528 |
| 658 | Ga0495633_0000027 | 3300046558 | Bacteria | 204613 |
| 659 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 660 | Ga0495668_0043313 | 3300046616 | Bacteria | 2504 |
| 661 | Ga0495634_0002267 | 3300046642 | Bacteria | 16124 |
| 662 | Ga0495611_0000100 | 3300046648 | Bacteria | 59688 |
| 663 | Ga0495625_0000381 | 3300046660 | Bacteria | 67732 |
| 664 | Ga0495625_0000450 | 3300046660 | Bacteria | 61820 |
| 665 | Ga0495625_0000939 | 3300046660 | Bacteria | 39095 |
| 666 | Ga0495625_0015468 | 3300046660 | Bacteria | 6043 |
| 667 | Ga0495625_0024679 | 3300046660 | Bacteria | 4571 |
| 668 | Ga0495625_0059881 | 3300046660 | Bacteria | 2700 |
| 669 | Ga0495588_0008235 | 3300046674 | Bacteria | 4774 |
| 670 | Ga0495599_0002927 | 3300046678 | Bacteria | 9930 |
| 671 | Ga0495623_0016773 | 3300046679 | Bacteria | 4733 |
| 672 | Ga0495623_0033499 | 3300046679 | Bacteria | 3296 |
| 673 | Ga0495623_0037207 | 3300046679 | Bacteria | 3116 |
| 674 | Ga0495623_0052046 | 3300046679 | Bacteria | 2589 |
| 675 | Ga0495613_0005798 | 3300046689 | Bacteria | 9245 |
| 676 | Ga0495613_0086318 | 3300046689 | Bacteria | 2276 |
| 677 | Ga0495649_0014016 | 3300046694 | Bacteria | 4609 |
| 678 | Ga0495604_0018641 | 3300047317 | Bacteria | 5560 |
| 679 | Ga0495604_0044907 | 3300047317 | Bacteria | 3449 |
| 680 | Ga0495604_0087328 | 3300047317 | Bacteria | 2323 |
| 681 | Ga0495674_0025828 | 3300047319 | Bacteria | 5377 |
| 682 | Ga0495672_0001375 | 3300047320 | Bacteria | 23991 |
| 683 | Ga0495672_0070623 | 3300047320 | Bacteria | 1978 |
| 684 | Ga0495680_0040322 | 3300047322 | Bacteria | 3721 |
| 685 | Ga0495680_0063104 | 3300047322 | Bacteria | 2846 |
| 686 | Ga0495683_0028971 | 3300047323 | Bacteria | 2830 |
| 687 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 688 | Ga0495675_0006576 | 3300047444 | Bacteria | 7118 |
| 689 | Ga0495675_0065938 | 3300047444 | Bacteria | 2289 |
| 690 | Ga0495677_0022648 | 3300047445 | Bacteria | 2279 |
| 691 | Ga0495684_0010156 | 3300047471 | Bacteria | 7281 |
| 692 | Ga0495684_0016716 | 3300047471 | Bacteria | 5653 |
| 693 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 694 | Ga0495686_0000031 | 3300047472 | Bacteria | 350171 |
| 695 | Ga0495686_0001061 | 3300047472 | Bacteria | 32862 |
| 696 | Ga0495686_0001778 | 3300047472 | Bacteria | 21957 |
| 697 | Ga0495602_0000048 | 3300048088 | Bacteria | 116248 |
| 698 | Ga0495602_0128051 | 3300048088 | Unclassified | 2030 |
| 699 | Ga0495614_0007939 | 3300048089 | Bacteria | 4715 |
| 700 | Ga0495615_0003788 | 3300048090 | Bacteria | 2570 |
| 701 | Ga0496101_0032829 | 3300048904 | Bacteria | 3657 |
| 702 | Ga0496102_0029575 | 3300048905 | Bacteria | 4902 |
| 703 | Ga0496102_0130377 | 3300048905 | Bacteria | 2353 |
| 704 | Ga0496104_0000050 | 3300048907 | Bacteria | 143556 |
| 705 | Ga0496104_0012291 | 3300048907 | Bacteria | 7696 |
| 706 | Ga0496105_0005478 | 3300048908 | Bacteria | 9633 |
| 707 | Ga0496107_0077750 | 3300048910 | Bacteria | 2417 |
| 708 | Ga0496112_0003084 | 3300048915 | Bacteria | 13653 |
| 709 | Ga0496112_0004578 | 3300048915 | Bacteria | 11754 |
| 710 | Ga0496112_0025884 | 3300048915 | Bacteria | 5638 |
| 711 | Ga0496112_0158290 | 3300048915 | Bacteria | 2231 |
| 712 | Ga0496113_0025684 | 3300048916 | Bacteria | 4202 |
| 713 | Ga0496114_0056201 | 3300048917 | Bacteria | 3284 |
| 714 | Ga0496114_0118475 | 3300048917 | Bacteria | 2275 |
| 715 | Ga0496115_0019460 | 3300048918 | Bacteria | 5225 |
| 716 | Ga0496117_0014403 | 3300048920 | Bacteria | 6815 |
| 717 | Ga0496118_0005063 | 3300048921 | Bacteria | 15173 |
| 718 | Ga0496118_0005243 | 3300048921 | Bacteria | 14821 |
| 719 | Ga0496119_0000531 | 3300048922 | Bacteria | 51990 |
| 720 | Ga0496120_0000182 | 3300048923 | Bacteria | 107094 |
| 721 | Ga0496126_0000020 | 3300048929 | Bacteria | 490805 |
| 722 | Ga0496126_0000130 | 3300048929 | Bacteria | 173900 |
| 723 | Ga0496126_0001108 | 3300048929 | Bacteria | 45172 |
| 724 | Ga0496126_0003894 | 3300048929 | Bacteria | 18354 |
| 725 | Ga0496126_0128415 | 3300048929 | Bacteria | 2192 |
| 726 | Ga0495678_015285 | 3300049459 | Bacteria | 3538 |
| 727 | Ga0501032_0005435 | 3300049569 | Bacteria | 9459 |
| 728 | Ga0501032_0037103 | 3300049569 | Unclassified | 3325 |
| 729 | Ga0501033_0002918 | 3300049570 | Bacteria | 14305 |
| 730 | Ga0501033_0016474 | 3300049570 | Bacteria | 5599 |
| 731 | Ga0501034_0003395 | 3300049571 | Bacteria | 18186 |
| 732 | Ga0501034_0061940 | 3300049571 | Bacteria | 3756 |
| 733 | Ga0501034_0068104 | 3300049571 | Unclassified | 3571 |
| 734 | Ga0501036_0000910 | 3300049572 | Bacteria | 22168 |
| 735 | Ga0501036_0007747 | 3300049572 | Bacteria | 8779 |
| 736 | Ga0501037_0001569 | 3300049573 | Bacteria | 16649 |
| 737 | Ga0501037_0010636 | 3300049573 | Bacteria | 6762 |
| 738 | Ga0501038_0001130 | 3300049574 | Bacteria | 24207 |
| 739 | Ga0501038_0005645 | 3300049574 | Bacteria | 11608 |
| 740 | Ga0501038_0016485 | 3300049574 | Bacteria | 6696 |
| 741 | Ga0501039_0007035 | 3300049575 | Bacteria | 8563 |
| 742 | Ga0501039_0085294 | 3300049575 | Bacteria | 2460 |
| 743 | Ga0501042_0009219 | 3300049578 | Bacteria | 6565 |
| 744 | Ga0501043_0007381 | 3300049579 | Bacteria | 8724 |
| 745 | Ga0501043_0008002 | 3300049579 | Bacteria | 8343 |
| 746 | Ga0501046_0002534 | 3300049580 | Bacteria | 17086 |
| 747 | Ga0501046_0010481 | 3300049580 | Bacteria | 7955 |
| 748 | Ga0501047_0002976 | 3300049581 | Bacteria | 16067 |
| 749 | Ga0501047_0010418 | 3300049581 | Bacteria | 8796 |
| 750 | Ga0501047_0018973 | 3300049581 | Bacteria | 6596 |
| 751 | Ga0501047_0026303 | 3300049581 | Bacteria | 5598 |
| 752 | Ga0501048_0017623 | 3300049582 | Bacteria | 5258 |
| 753 | Ga0501067_0006094 | 3300049583 | Bacteria | 6686 |
| 754 | Ga0501068_0008546 | 3300049584 | Bacteria | 5702 |
| 755 | Ga0501069_0000155 | 3300049585 | Bacteria | 30339 |
| 756 | Ga0501070_0021406 | 3300049586 | Bacteria | 5424 |
| 757 | Ga0501070_0045641 | 3300049586 | Bacteria | 3644 |
| 758 | Ga0501070_0080596 | 3300049586 | Bacteria | 2694 |
| 759 | Ga0501070_0092157 | 3300049586 | Bacteria | 2508 |
| 760 | Ga0501072_0002255 | 3300049588 | Bacteria | 14406 |
| 761 | Ga0501072_0027699 | 3300049588 | Bacteria | 4420 |
| 762 | Ga0501073_0002338 | 3300049589 | Bacteria | 14194 |
| 763 | Ga0501073_0011241 | 3300049589 | Bacteria | 6548 |
| 764 | Ga0501074_0101990 | 3300049590 | Bacteria | 2054 |
| 765 | Ga0501076_0072607 | 3300049592 | Bacteria | 2754 |
| 766 | Ga0501217_000173 | 3300049661 | Bacteria | 9361 |
| 767 | Ga0501233_001763 | 3300049668 | Bacteria | 3736 |
| 768 | Ga0501079_0010815 | 3300049741 | Bacteria | 6949 |
| 769 | Ga0501080_0014429 | 3300049742 | Bacteria | 7276 |
| 770 | Ga0501083_0014288 | 3300049744 | Bacteria | 5552 |
| 771 | Ga0501035_0007075 | 3300049822 | Bacteria | 10486 |
| 772 | Ga0501035_0009965 | 3300049822 | Bacteria | 8820 |
| 773 | Ga0501035_0013011 | 3300049822 | Bacteria | 7678 |
| 774 | Ga0501044_0000903 | 3300049823 | Bacteria | 35807 |
| 775 | Ga0501044_0020988 | 3300049823 | Bacteria | 6974 |
| 776 | Ga0501044_0021923 | 3300049823 | Bacteria | 6811 |
| 777 | Ga0501044_0055618 | 3300049823 | Bacteria | 4064 |
| 778 | Ga0501044_0077668 | 3300049823 | Bacteria | 3367 |
| 779 | nmdc:mga0k408_2754_c1 | 3300050493 | Bacteria | 9344 |
| 780 | nmdc:mga0k408_7363_c1 | 3300050493 | Bacteria | 5878 |
| 781 | nmdc:mga09592_47844_c1 | 3300050508 | Bacteria | 3605 |
| 782 | nmdc:mga0qj67_6396_c1 | 3300050509 | Bacteria | 8655 |
| 783 | nmdc:mga08y16_12657_c1 | 3300050511 | Bacteria | 8874 |
| 784 | nmdc:mga08y16_22607_c1 | 3300050511 | Bacteria | 6639 |
| 785 | nmdc:mga0n895_338_c1 | 3300050512 | Bacteria | 31338 |
| 786 | nmdc:mga0n895_3571_c1 | 3300050512 | Bacteria | 12577 |
| 787 | nmdc:mga0rr50_3538_c1 | 3300050513 | Bacteria | 9015 |
| 788 | nmdc:mga08x19_16802_c1 | 3300050514 | Bacteria | 4469 |
| 789 | nmdc:mga08x19_24037_c1 | 3300050514 | Bacteria | 3783 |
| 790 | nmdc:mga0a205_9848_c1 | 3300050515 | Bacteria | 8767 |
| 791 | Ga0500635_0000598 | 3300053080 | Bacteria | 9548 |
| 792 | Ga0495619_0016053 | 3300053085 | Bacteria | 4741 |
| 793 | Ga0500583_0001469 | 3300053092 | Bacteria | 6770 |
| 794 | Ga0500651_0000003 | 3300053093 | Bacteria | 422045 |
| 795 | Ga0500651_0000462 | 3300053093 | Bacteria | 21501 |
| 796 | Ga0500555_000117 | 3300053103 | Bacteria | 37913 |
| 797 | Ga0500595_000005 | 3300053119 | Bacteria | 340896 |
| 798 | Ga0500608_007533 | 3300053122 | Bacteria | 4512 |
| 799 | Ga0500573_0028767 | 3300053140 | Bacteria | 3202 |
| 800 | Ga0500616_0000204 | 3300053153 | Bacteria | 96997 |
| 801 | Ga0500622_0003562 | 3300053156 | Bacteria | 10288 |
| 802 | Ga0500624_000397 | 3300053157 | Bacteria | 13683 |
| 803 | Ga0500645_000345 | 3300053730 | Bacteria | 33099 |
| 804 | Ga0501084_0001521 | 3300054114 | Bacteria | 18403 |
| 805 | Ga0501082_0001743 | 3300060353 | Bacteria | 19195 |
| 806 | Ga0501082_0022216 | 3300060353 | Bacteria | 5467 |
| 807 | Ga0501082_0079798 | 3300060353 | Bacteria | 2824 |
| 808 | Ga0530510_0002645 | 3300061734 | Bacteria | 12315 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0059881 | Ga0495625_0059881_15_1550 | 499 |
| 2 | 3300035113 | Ga0373936_0017090 | Ga0373936_0017090_23_1552 | 509 |
| 3 | 3300005434 | Ga0070709_10076770 | Ga0070709_100767702 | 514 |
| 4 | 3300049575 | Ga0501039_0085294 | Ga0501039_0085294_717_2378 | 546 |
| 5 | 3300009093 | Ga0105240_10054554 | Ga0105240_100545541 | 550 |
| 6 | 3300046507 | Ga0495606_0010358 | Ga0495606_0010358_153_1847 | 551 |
| 7 | 3300046472 | Ga0495580_0100461 | Ga0495580_0100461_281_1945 | 554 |
| 8 | 3300005563 | Ga0068855_100099240 | Ga0068855_1000992403 | 555 |
| 9 | 3300025913 | Ga0207695_10000031 | Ga0207695_10000031308 | 556 |
| 10 | 3300044706 | Ga0466964_0022634 | Ga0466964_0022634_555_2273 | 556 |
| 11 | 3300046471 | Ga0495650_0007377 | Ga0495650_0007377_1329_3041 | 558 |
| 12 | 3300005355 | Ga0070671_100038052 | Ga0070671_1000380522 | 559 |
| 13 | 3300035119 | Ga0373956_0006681 | Ga0373956_0006681_19_1737 | 559 |
| 14 | 3300031824 | Ga0307413_10025147 | Ga0307413_100251472 | 560 |
| 15 | 3300032004 | Ga0307414_10011176 | Ga0307414_100111762 | 560 |
| 16 | 3300037312 | Ga0395899_0037693 | Ga0395899_0037693_1855_3546 | 562 |
| 17 | 3300047317 | Ga0495604_0087328 | Ga0495604_0087328_545_2287 | 567 |
| 18 | 3300013306 | Ga0163162_10002012 | Ga0163162_100020125 | 568 |
| 19 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_39855_41579 | 568 |
| 20 | 3300009545 | Ga0105237_10008207 | Ga0105237_100082076 | 569 |
| 21 | 3300010375 | Ga0105239_10009124 | Ga0105239_100091245 | 569 |
| 22 | 3300013100 | Ga0157373_10030507 | Ga0157373_100305073 | 569 |
| 23 | 3300009093 | Ga0105240_10005950 | Ga0105240_100059507 | 570 |
| 24 | 3300009174 | Ga0105241_10000578 | Ga0105241_1000057826 | 570 |
| 25 | 3300013105 | Ga0157369_10062401 | Ga0157369_100624012 | 570 |
| 26 | 3300013296 | Ga0157374_10000079 | Ga0157374_1000007952 | 570 |
| 27 | 3300013307 | Ga0157372_10000042 | Ga0157372_100000424 | 570 |
| 28 | 3300013307 | Ga0157372_10132058 | Ga0157372_101320581 | 570 |
| 29 | 3300037312 | Ga0395899_0000401 | Ga0395899_0000401_696_2414 | 570 |
| 30 | 3300045836 | Ga0466958_0017331 | Ga0466958_0017331_1680_3398 | 570 |
| 31 | 3300003320 | rootH2_10000327 | rootH2_1000032719 | 571 |
| 32 | 3300046517 | Ga0495630_0112712 | Ga0495630_0112712_53_1774 | 571 |
| 33 | 3300046660 | Ga0495625_0015468 | Ga0495625_0015468_4166_5881 | 571 |
| 34 | 3300039450 | Ga0436363_0218926 | Ga0436363_0218926_3675_5507 | 572 |
| 35 | 3300050512 | nmdc:mga0n895_338_c1 | nmdc:mga0n895_338_c1_29602_31320 | 572 |
| 36 | 3300048929 | Ga0496126_0000020 | Ga0496126_0000020_352134_353891 | 573 |
| 37 | 3300047317 | Ga0495604_0018641 | Ga0495604_0018641_184_2019 | 574 |
| 38 | 3300013100 | Ga0157373_10009314 | Ga0157373_100093145 | 577 |
| 39 | 3300039437 | Ga0436365_0793046 | Ga0436365_0793046_598_2430 | 577 |
| 40 | 3300005563 | Ga0068855_100068978 | Ga0068855_1000689783 | 578 |
| 41 | 3300005577 | Ga0068857_100040949 | Ga0068857_1000409498 | 578 |
| 42 | 3300005614 | Ga0068856_100091069 | Ga0068856_1000910693 | 578 |
| 43 | 3300009545 | Ga0105237_10045664 | Ga0105237_100456642 | 578 |
| 44 | 3300025949 | Ga0207667_10157638 | Ga0207667_101576382 | 578 |
| 45 | 3300026078 | Ga0207702_10067825 | Ga0207702_100678252 | 578 |
| 46 | 3300026116 | Ga0207674_10080291 | Ga0207674_100802912 | 578 |
| 47 | 3300049574 | Ga0501038_0016485 | Ga0501038_0016485_3041_4846 | 578 |
| 48 | 3300049823 | Ga0501044_0055618 | Ga0501044_0055618_443_2248 | 578 |
| 49 | 3300009094 | Ga0111539_10032468 | Ga0111539_100324682 | 579 |
| 50 | 3300044693 | Ga0466961_0076050 | Ga0466961_0076050_101_1846 | 579 |
| 51 | 3300048090 | Ga0495615_0003788 | Ga0495615_0003788_454_2232 | 579 |
| 52 | 3300050511 | nmdc:mga08y16_22607_c1 | nmdc:mga08y16_22607_c1_1976_3715 | 579 |
| 53 | 3300009098 | Ga0105245_10025885 | Ga0105245_100258852 | 580 |
| 54 | 3300013297 | Ga0157378_10000134 | Ga0157378_1000013426 | 580 |
| 55 | 3300045051 | Ga0451576_0154676 | Ga0451576_0154676_608_2350 | 580 |
| 56 | 3300046689 | Ga0495613_0086318 | Ga0495613_0086318_299_2041 | 580 |
| 57 | 3300047322 | Ga0495680_0040322 | Ga0495680_0040322_74_1816 | 580 |
| 58 | 3300046674 | Ga0495588_0008235 | Ga0495588_0008235_2757_4571 | 585 |
| 59 | 3300005535 | Ga0070684_100096428 | Ga0070684_1000964282 | 587 |
| 60 | 3300005539 | Ga0068853_100100389 | Ga0068853_1001003892 | 587 |
| 61 | 3300005614 | Ga0068856_100179104 | Ga0068856_1001791042 | 587 |
| 62 | 3300009174 | Ga0105241_10073520 | Ga0105241_100735202 | 587 |
| 63 | 3300009545 | Ga0105237_10136627 | Ga0105237_101366272 | 587 |
| 64 | 3300026041 | Ga0207639_10005718 | Ga0207639_100057188 | 587 |
| 65 | 3300026142 | Ga0207698_10036534 | Ga0207698_100365342 | 587 |
| 66 | 3300031730 | Ga0307516_10001744 | Ga0307516_1000174412 | 587 |
| 67 | 3300035086 | Ga0373934_0010268 | Ga0373934_0010268_952_2808 | 587 |
| 68 | 3300035724 | Ga0373933_0000470 | Ga0373933_0000470_6084_7940 | 587 |
| 69 | 3300036401 | Ga0373937_0000051 | Ga0373937_0000051_73352_75208 | 587 |
| 70 | 3300046462 | Ga0495651_0008741 | Ga0495651_0008741_5381_7237 | 587 |
| 71 | 3300046536 | Ga0495587_0000381 | Ga0495587_0000381_28979_30835 | 587 |
| 72 | 3300046679 | Ga0495623_0016773 | Ga0495623_0016773_1211_3067 | 587 |
| 73 | 3300047444 | Ga0495675_0006576 | Ga0495675_0006576_4814_6670 | 587 |
| 74 | 3300048088 | Ga0495602_0000048 | Ga0495602_0000048_36004_37860 | 587 |
| 75 | 3300005295 | Ga0065707_10103932 | Ga0065707_101039321 | 588 |
| 76 | 3300009093 | Ga0105240_10000168 | Ga0105240_1000016841 | 588 |
| 77 | 3300013102 | Ga0157371_10001046 | Ga0157371_1000104624 | 588 |
| 78 | 3300046616 | Ga0495668_0000010 | Ga0495668_0000010_26909_28678 | 588 |
| 79 | 3300005578 | Ga0068854_100009116 | Ga0068854_1000091164 | 589 |
| 80 | 3300005616 | Ga0068852_100000649 | Ga0068852_1000006496 | 589 |
| 81 | 3300009551 | Ga0105238_10071623 | Ga0105238_100716232 | 589 |
| 82 | 3300025920 | Ga0207649_10058674 | Ga0207649_100586741 | 589 |
| 83 | 3300025924 | Ga0207694_10029048 | Ga0207694_100290483 | 589 |
| 84 | 3300025928 | Ga0207700_10048114 | Ga0207700_100481142 | 589 |
| 85 | 3300025949 | Ga0207667_10004214 | Ga0207667_1000421416 | 589 |
| 86 | 3300025981 | Ga0207640_10006656 | Ga0207640_100066563 | 589 |
| 87 | 3300026116 | Ga0207674_10005277 | Ga0207674_1000527715 | 589 |
| 88 | 3300047472 | Ga0495686_0001061 | Ga0495686_0001061_28646_30463 | 589 |
| 89 | 3300049592 | Ga0501076_0072607 | Ga0501076_0072607_15_1784 | 589 |
| 90 | 3300005327 | Ga0070658_10110586 | Ga0070658_101105862 | 590 |
| 91 | 3300005983 | Ga0081540_1012173 | Ga0081540_10121733 | 590 |
| 92 | 3300046492 | Ga0495585_0003372 | Ga0495585_0003372_8060_9883 | 590 |
| 93 | 3300046499 | Ga0495594_0001240 | Ga0495594_0001240_2367_4190 | 590 |
| 94 | 3300046523 | Ga0495644_0000020 | Ga0495644_0000020_314_2137 | 590 |
| 95 | 3300046538 | Ga0495609_0018416 | Ga0495609_0018416_1257_3080 | 590 |
| 96 | 3300046616 | Ga0495668_0043313 | Ga0495668_0043313_492_2315 | 590 |
| 97 | 3300047445 | Ga0495677_0022648 | Ga0495677_0022648_185_2008 | 590 |
| 98 | 3300005327 | Ga0070658_10000074 | Ga0070658_100000745 | 591 |
| 99 | 3300005548 | Ga0070665_100032975 | Ga0070665_1000329752 | 591 |
| 100 | 3300005841 | Ga0068863_100057605 | Ga0068863_1000576052 | 591 |
| 101 | 3300013104 | Ga0157370_10050686 | Ga0157370_100506862 | 591 |
| 102 | 3300013306 | Ga0163162_10000370 | Ga0163162_1000037029 | 591 |
| 103 | 3300013306 | Ga0163162_10025204 | Ga0163162_100252043 | 591 |
| 104 | 3300014325 | Ga0163163_10006654 | Ga0163163_100066542 | 591 |
| 105 | 3300021361 | Ga0213872_10004135 | Ga0213872_100041352 | 591 |
| 106 | 3300025909 | Ga0207705_10000081 | Ga0207705_1000008123 | 591 |
| 107 | 3300025949 | Ga0207667_10001980 | Ga0207667_100019802 | 591 |
| 108 | 3300028379 | Ga0268266_10012317 | Ga0268266_100123172 | 591 |
| 109 | 3300028379 | Ga0268266_10015592 | Ga0268266_100155923 | 591 |
| 110 | 3300028379 | Ga0268266_10040838 | Ga0268266_100408382 | 591 |
| 111 | 3300031251 | Ga0265327_10000146 | Ga0265327_1000014699 | 591 |
| 112 | 3300039438 | Ga0436360_0150364 | Ga0436360_0150364_1792_3618 | 591 |
| 113 | 3300039438 | Ga0436360_1278397 | Ga0436360_1278397_13636_15462 | 591 |
| 114 | 3300039447 | Ga0436361_0072947 | Ga0436361_0072947_2363_4189 | 591 |
| 115 | 3300039447 | Ga0436361_0130986 | Ga0436361_0130986_4460_6286 | 591 |
| 116 | 3300046459 | Ga0495629_0010544 | Ga0495629_0010544_2568_4394 | 591 |
| 117 | 3300046462 | Ga0495651_0007694 | Ga0495651_0007694_6137_7963 | 591 |
| 118 | 3300046462 | Ga0495651_0088748 | Ga0495651_0088748_285_2111 | 591 |
| 119 | 3300046472 | Ga0495580_0019360 | Ga0495580_0019360_1513_3339 | 591 |
| 120 | 3300046473 | Ga0495582_0021119 | Ga0495582_0021119_498_2324 | 591 |
| 121 | 3300046476 | Ga0495662_0005651 | Ga0495662_0005651_3260_5086 | 591 |
| 122 | 3300046477 | Ga0495664_0004651 | Ga0495664_0004651_3547_5373 | 591 |
| 123 | 3300046499 | Ga0495594_0002472 | Ga0495594_0002472_3540_5366 | 591 |
| 124 | 3300046507 | Ga0495606_0033722 | Ga0495606_0033722_1616_3442 | 591 |
| 125 | 3300046516 | Ga0495628_0021608 | Ga0495628_0021608_2605_4431 | 591 |
| 126 | 3300046517 | Ga0495630_0039277 | Ga0495630_0039277_1192_3018 | 591 |
| 127 | 3300046531 | Ga0495665_0001294 | Ga0495665_0001294_4113_5939 | 591 |
| 128 | 3300046543 | Ga0495645_0010375 | Ga0495645_0010375_4614_6440 | 591 |
| 129 | 3300046642 | Ga0495634_0002267 | Ga0495634_0002267_14007_15833 | 591 |
| 130 | 3300046660 | Ga0495625_0000450 | Ga0495625_0000450_25463_27289 | 591 |
| 131 | 3300046660 | Ga0495625_0024679 | Ga0495625_0024679_560_2386 | 591 |
| 132 | 3300046678 | Ga0495599_0002927 | Ga0495599_0002927_6882_8708 | 591 |
| 133 | 3300046679 | Ga0495623_0037207 | Ga0495623_0037207_1013_2839 | 591 |
| 134 | 3300046689 | Ga0495613_0005798 | Ga0495613_0005798_3165_4991 | 591 |
| 135 | 3300047317 | Ga0495604_0044907 | Ga0495604_0044907_59_1885 | 591 |
| 136 | 3300047319 | Ga0495674_0025828 | Ga0495674_0025828_22_1848 | 591 |
| 137 | 3300047320 | Ga0495672_0001375 | Ga0495672_0001375_19167_20993 | 591 |
| 138 | 3300047322 | Ga0495680_0063104 | Ga0495680_0063104_812_2638 | 591 |
| 139 | 3300047323 | Ga0495683_0028971 | Ga0495683_0028971_303_2129 | 591 |
| 140 | 3300048089 | Ga0495614_0007939 | Ga0495614_0007939_512_2338 | 591 |
| 141 | 3300048917 | Ga0496114_0056201 | Ga0496114_0056201_871_2697 | 591 |
| 142 | 3300048917 | Ga0496114_0118475 | Ga0496114_0118475_333_2162 | 591 |
| 143 | 3300048929 | Ga0496126_0000130 | Ga0496126_0000130_131235_133061 | 591 |
| 144 | 3300049571 | Ga0501034_0003395 | Ga0501034_0003395_3642_5468 | 591 |
| 145 | 3300049572 | Ga0501036_0007747 | Ga0501036_0007747_1784_3610 | 591 |
| 146 | 3300049574 | Ga0501038_0001130 | Ga0501038_0001130_5996_7822 | 591 |
| 147 | 3300049579 | Ga0501043_0007381 | Ga0501043_0007381_1031_2857 | 591 |
| 148 | 3300049580 | Ga0501046_0002534 | Ga0501046_0002534_13929_15755 | 591 |
| 149 | 3300049581 | Ga0501047_0002976 | Ga0501047_0002976_2805_4631 | 591 |
| 150 | 3300049589 | Ga0501073_0002338 | Ga0501073_0002338_3869_5695 | 591 |
| 151 | 3300049822 | Ga0501035_0007075 | Ga0501035_0007075_2665_4491 | 591 |
| 152 | 3300049823 | Ga0501044_0021923 | Ga0501044_0021923_3869_5695 | 591 |
| 153 | 3300053119 | Ga0500595_000005 | Ga0500595_000005_56323_58149 | 591 |
| 154 | 3300006173 | Ga0070716_100035785 | Ga0070716_1000357852 | 592 |
| 155 | 3300009174 | Ga0105241_10008924 | Ga0105241_100089242 | 592 |
| 156 | 3300013296 | Ga0157374_10005864 | Ga0157374_100058643 | 592 |
| 157 | 3300013306 | Ga0163162_10000288 | Ga0163162_1000028814 | 592 |
| 158 | 3300014968 | Ga0157379_10002887 | Ga0157379_100028875 | 592 |
| 159 | 3300014968 | Ga0157379_10047498 | Ga0157379_100474982 | 592 |
| 160 | 3300025911 | Ga0207654_10030809 | Ga0207654_100308092 | 592 |
| 161 | 3300048905 | Ga0496102_0029575 | Ga0496102_0029575_1741_3558 | 592 |
| 162 | 3300048907 | Ga0496104_0012291 | Ga0496104_0012291_54_1871 | 592 |
| 163 | 3300053085 | Ga0495619_0016053 | Ga0495619_0016053_82_1899 | 592 |
| 164 | 3300005437 | Ga0070710_10016203 | Ga0070710_100162032 | 593 |
| 165 | 3300005439 | Ga0070711_100001977 | Ga0070711_1000019775 | 593 |
| 166 | 3300005445 | Ga0070708_100030444 | Ga0070708_1000304441 | 593 |
| 167 | 3300005536 | Ga0070697_100001102 | Ga0070697_10000110215 | 593 |
| 168 | 3300006173 | Ga0070716_100010951 | Ga0070716_1000109512 | 593 |
| 169 | 3300006175 | Ga0070712_100000876 | Ga0070712_10000087610 | 593 |
| 170 | 3300013105 | Ga0157369_10045179 | Ga0157369_100451792 | 593 |
| 171 | 3300025898 | Ga0207692_10006488 | Ga0207692_100064882 | 593 |
| 172 | 3300025905 | Ga0207685_10009398 | Ga0207685_100093982 | 593 |
| 173 | 3300025915 | Ga0207693_10001244 | Ga0207693_1000124410 | 593 |
| 174 | 3300025916 | Ga0207663_10004252 | Ga0207663_100042521 | 593 |
| 175 | 3300025928 | Ga0207700_10013881 | Ga0207700_100138812 | 593 |
| 176 | 3300025939 | Ga0207665_10005323 | Ga0207665_100053232 | 593 |
| 177 | 3300005439 | Ga0070711_100021677 | Ga0070711_1000216772 | 594 |
| 178 | 3300013297 | Ga0157378_10090345 | Ga0157378_100903452 | 594 |
| 179 | 3300025916 | Ga0207663_10031448 | Ga0207663_100314482 | 594 |
| 180 | 3300046471 | Ga0495650_0000022 | Ga0495650_0000022_487109_488893 | 594 |
| 181 | 3300048910 | Ga0496107_0077750 | Ga0496107_0077750_557_2374 | 594 |
| 182 | 3300005548 | Ga0070665_100000041 | Ga0070665_100000041155 | 595 |
| 183 | 3300005843 | Ga0068860_100000208 | Ga0068860_10000020857 | 595 |
| 184 | 3300009545 | Ga0105237_10047019 | Ga0105237_100470192 | 595 |
| 185 | 3300028379 | Ga0268266_10000014 | Ga0268266_1000001440 | 595 |
| 186 | 3300028381 | Ga0268264_10000041 | Ga0268264_1000004126 | 595 |
| 187 | 3300053092 | Ga0500583_0001469 | Ga0500583_0001469_2734_4554 | 595 |
| 188 | 3300053156 | Ga0500622_0003562 | Ga0500622_0003562_6213_8033 | 595 |
| 189 | 3300003323 | rootH1_10126443 | rootH1_101264432 | 596 |
| 190 | 3300005327 | Ga0070658_10000230 | Ga0070658_1000023046 | 596 |
| 191 | 3300005328 | Ga0070676_10001002 | Ga0070676_1000100216 | 596 |
| 192 | 3300005335 | Ga0070666_10001005 | Ga0070666_100010056 | 596 |
| 193 | 3300005335 | Ga0070666_10024138 | Ga0070666_100241384 | 596 |
| 194 | 3300005338 | Ga0068868_100005239 | Ga0068868_1000052396 | 596 |
| 195 | 3300005344 | Ga0070661_100062757 | Ga0070661_1000627571 | 596 |
| 196 | 3300005344 | Ga0070661_100107872 | Ga0070661_1001078721 | 596 |
| 197 | 3300005347 | Ga0070668_100009328 | Ga0070668_1000093285 | 596 |
| 198 | 3300005364 | Ga0070673_100000096 | Ga0070673_1000000963 | 596 |
| 199 | 3300005364 | Ga0070673_100030771 | Ga0070673_1000307712 | 596 |
| 200 | 3300005365 | Ga0070688_100009314 | Ga0070688_1000093142 | 596 |
| 201 | 3300005366 | Ga0070659_100123379 | Ga0070659_1001233791 | 596 |
| 202 | 3300005367 | Ga0070667_100002462 | Ga0070667_1000024625 | 596 |
| 203 | 3300005457 | Ga0070662_100008816 | Ga0070662_1000088165 | 596 |
| 204 | 3300005457 | Ga0070662_100018002 | Ga0070662_1000180024 | 596 |
| 205 | 3300005457 | Ga0070662_100099864 | Ga0070662_1000998641 | 596 |
| 206 | 3300005459 | Ga0068867_100106407 | Ga0068867_1001064071 | 596 |
| 207 | 3300005466 | Ga0070685_10018240 | Ga0070685_100182401 | 596 |
| 208 | 3300005543 | Ga0070672_100000033 | Ga0070672_1000000333 | 596 |
| 209 | 3300005544 | Ga0070686_100094564 | Ga0070686_1000945642 | 596 |
| 210 | 3300005548 | Ga0070665_100001625 | Ga0070665_1000016253 | 596 |
| 211 | 3300005563 | Ga0068855_100065776 | Ga0068855_1000657763 | 596 |
| 212 | 3300005616 | Ga0068852_100022599 | Ga0068852_1000225993 | 596 |
| 213 | 3300005617 | Ga0068859_100110964 | Ga0068859_1001109643 | 596 |
| 214 | 3300005618 | Ga0068864_100003380 | Ga0068864_10000338010 | 596 |
| 215 | 3300005618 | Ga0068864_100100603 | Ga0068864_1001006031 | 596 |
| 216 | 3300005718 | Ga0068866_10052792 | Ga0068866_100527922 | 596 |
| 217 | 3300005719 | Ga0068861_100001398 | Ga0068861_10000139814 | 596 |
| 218 | 3300005841 | Ga0068863_100003177 | Ga0068863_1000031774 | 596 |
| 219 | 3300005842 | Ga0068858_100002290 | Ga0068858_1000022908 | 596 |
| 220 | 3300005842 | Ga0068858_100073685 | Ga0068858_1000736852 | 596 |
| 221 | 3300005843 | Ga0068860_100005487 | Ga0068860_1000054876 | 596 |
| 222 | 3300005843 | Ga0068860_100007052 | Ga0068860_1000070522 | 596 |
| 223 | 3300005843 | Ga0068860_100031363 | Ga0068860_1000313635 | 596 |
| 224 | 3300006358 | Ga0068871_100004350 | Ga0068871_10000435012 | 596 |
| 225 | 3300006881 | Ga0068865_100001201 | Ga0068865_1000012013 | 596 |
| 226 | 3300006931 | Ga0097620_100110963 | Ga0097620_1001109633 | 596 |
| 227 | 3300009093 | Ga0105240_10194099 | Ga0105240_101940991 | 596 |
| 228 | 3300009177 | Ga0105248_10141399 | Ga0105248_101413993 | 596 |
| 229 | 3300009553 | Ga0105249_10004075 | Ga0105249_100040753 | 596 |
| 230 | 3300009553 | Ga0105249_10022928 | Ga0105249_100229281 | 596 |
| 231 | 3300010375 | Ga0105239_10002974 | Ga0105239_100029745 | 596 |
| 232 | 3300010375 | Ga0105239_10161533 | Ga0105239_101615331 | 596 |
| 233 | 3300013102 | Ga0157371_10003049 | Ga0157371_1000304910 | 596 |
| 234 | 3300013104 | Ga0157370_10008425 | Ga0157370_100084252 | 596 |
| 235 | 3300013296 | Ga0157374_10015974 | Ga0157374_100159742 | 596 |
| 236 | 3300013297 | Ga0157378_10012935 | Ga0157378_100129353 | 596 |
| 237 | 3300013306 | Ga0163162_10002932 | Ga0163162_1000293212 | 596 |
| 238 | 3300013306 | Ga0163162_10006472 | Ga0163162_100064727 | 596 |
| 239 | 3300013306 | Ga0163162_10013767 | Ga0163162_100137678 | 596 |
| 240 | 3300013307 | Ga0157372_10120177 | Ga0157372_101201771 | 596 |
| 241 | 3300013308 | Ga0157375_10002060 | Ga0157375_100020606 | 596 |
| 242 | 3300013308 | Ga0157375_10156042 | Ga0157375_101560422 | 596 |
| 243 | 3300014325 | Ga0163163_10027369 | Ga0163163_100273694 | 596 |
| 244 | 3300014325 | Ga0163163_10031829 | Ga0163163_100318293 | 596 |
| 245 | 3300014968 | Ga0157379_10013613 | Ga0157379_100136132 | 596 |
| 246 | 3300014968 | Ga0157379_10024953 | Ga0157379_100249535 | 596 |
| 247 | 3300014969 | Ga0157376_10001813 | Ga0157376_1000181312 | 596 |
| 248 | 3300014969 | Ga0157376_10061965 | Ga0157376_100619653 | 596 |
| 249 | 3300017792 | Ga0163161_10012799 | Ga0163161_100127995 | 596 |
| 250 | 3300017792 | Ga0163161_10044947 | Ga0163161_100449473 | 596 |
| 251 | 3300025903 | Ga0207680_10009835 | Ga0207680_100098353 | 596 |
| 252 | 3300025907 | Ga0207645_10002569 | Ga0207645_1000256915 | 596 |
| 253 | 3300025913 | Ga0207695_10119214 | Ga0207695_101192142 | 596 |
| 254 | 3300025933 | Ga0207706_10023341 | Ga0207706_100233414 | 596 |
| 255 | 3300025933 | Ga0207706_10127102 | Ga0207706_101271021 | 596 |
| 256 | 3300025938 | Ga0207704_10001086 | Ga0207704_100010869 | 596 |
| 257 | 3300025940 | Ga0207691_10000001 | Ga0207691_1000000198 | 596 |
| 258 | 3300025942 | Ga0207689_10030022 | Ga0207689_100300224 | 596 |
| 259 | 3300025942 | Ga0207689_10060483 | Ga0207689_100604832 | 596 |
| 260 | 3300025949 | Ga0207667_10026300 | Ga0207667_100263002 | 596 |
| 261 | 3300025960 | Ga0207651_10002700 | Ga0207651_100027003 | 596 |
| 262 | 3300025961 | Ga0207712_10010403 | Ga0207712_100104033 | 596 |
| 263 | 3300025972 | Ga0207668_10002957 | Ga0207668_100029575 | 596 |
| 264 | 3300025986 | Ga0207658_10002549 | Ga0207658_100025494 | 596 |
| 265 | 3300026023 | Ga0207677_10002241 | Ga0207677_100022418 | 596 |
| 266 | 3300026035 | Ga0207703_10028669 | Ga0207703_100286696 | 596 |
| 267 | 3300026088 | Ga0207641_10028939 | Ga0207641_100289396 | 596 |
| 268 | 3300026089 | Ga0207648_10002251 | Ga0207648_100022516 | 596 |
| 269 | 3300026089 | Ga0207648_10055158 | Ga0207648_100551582 | 596 |
| 270 | 3300026095 | Ga0207676_10025947 | Ga0207676_100259472 | 596 |
| 271 | 3300026118 | Ga0207675_100026324 | Ga0207675_1000263243 | 596 |
| 272 | 3300028379 | Ga0268266_10003319 | Ga0268266_100033196 | 596 |
| 273 | 3300028381 | Ga0268264_10003033 | Ga0268264_100030333 | 596 |
| 274 | 3300028381 | Ga0268264_10004916 | Ga0268264_100049166 | 596 |
| 275 | 3300031456 | Ga0307513_10110629 | Ga0307513_101106291 | 596 |
| 276 | 3300036401 | Ga0373937_0024157 | Ga0373937_0024157_365_2170 | 596 |
| 277 | 3300037312 | Ga0395899_0039707 | Ga0395899_0039707_980_2785 | 596 |
| 278 | 3300037471 | Ga0395905_0011240 | Ga0395905_0011240_146_1951 | 596 |
| 279 | 3300037471 | Ga0395905_0059953 | Ga0395905_0059953_1087_2892 | 596 |
| 280 | 3300044656 | Ga0466969_0000972 | Ga0466969_0000972_8076_9881 | 596 |
| 281 | 3300044658 | Ga0466972_0000007 | Ga0466972_0000007_46685_48490 | 596 |
| 282 | 3300044684 | Ga0466966_0000018 | Ga0466966_0000018_56965_58770 | 596 |
| 283 | 3300044842 | Ga0466957_0002210 | Ga0466957_0002210_5389_7200 | 596 |
| 284 | 3300045049 | Ga0466959_0000002 | Ga0466959_0000002_117479_119284 | 596 |
| 285 | 3300046454 | Ga0495592_0035834 | Ga0495592_0035834_1328_3133 | 596 |
| 286 | 3300046517 | Ga0495630_0006029 | Ga0495630_0006029_3537_5342 | 596 |
| 287 | 3300049661 | Ga0501217_000173 | Ga0501217_000173_6323_8128 | 596 |
| 288 | 3300049668 | Ga0501233_001763 | Ga0501233_001763_1378_3183 | 596 |
| 289 | 3300053140 | Ga0500573_0028767 | Ga0500573_0028767_70_1875 | 596 |
| 290 | iso_pu_bacteria | 2818991460 | 2819677096 | 596 |
| 291 | iso_pu_bacteria | 2929177148 | 2929177503 | 596 |
| 292 | iso_pu_bacteria | 2945977869 | 2945979875 | 596 |
| 293 | iso_pu_bacteria | 2946013367 | 2946014261 | 596 |
| 294 | 3300005327 | Ga0070658_10000008 | Ga0070658_1000000816 | 597 |
| 295 | 3300006195 | Ga0075366_10030835 | Ga0075366_100308353 | 597 |
| 296 | 3300009553 | Ga0105249_10022927 | Ga0105249_100229273 | 597 |
| 297 | 3300013307 | Ga0157372_10084442 | Ga0157372_100844423 | 597 |
| 298 | 3300025909 | Ga0207705_10000026 | Ga0207705_1000002616 | 597 |
| 299 | 3300025942 | Ga0207689_10091530 | Ga0207689_100915302 | 597 |
| 300 | 3300025949 | Ga0207667_10025618 | Ga0207667_100256186 | 597 |
| 301 | 3300025961 | Ga0207712_10012498 | Ga0207712_100124983 | 597 |
| 302 | 3300037853 | Ga0436364_1460474 | Ga0436364_1460474_334_2166 | 597 |
| 303 | 3300049569 | Ga0501032_0037103 | Ga0501032_0037103_434_2254 | 597 |
| 304 | 3300049570 | Ga0501033_0016474 | Ga0501033_0016474_3130_4950 | 597 |
| 305 | 3300049573 | Ga0501037_0010636 | Ga0501037_0010636_45_1865 | 597 |
| 306 | 3300049578 | Ga0501042_0009219 | Ga0501042_0009219_2800_4614 | 597 |
| 307 | 3300049581 | Ga0501047_0026303 | Ga0501047_0026303_1120_2940 | 597 |
| 308 | 3300049588 | Ga0501072_0027699 | Ga0501072_0027699_2357_4171 | 597 |
| 309 | 3300049590 | Ga0501074_0101990 | Ga0501074_0101990_52_1866 | 597 |
| 310 | 3300049822 | Ga0501035_0013011 | Ga0501035_0013011_492_2312 | 597 |
| 311 | 3300049823 | Ga0501044_0000903 | Ga0501044_0000903_824_2644 | 597 |
| 312 | 3300050493 | nmdc:mga0k408_7363_c1 | nmdc:mga0k408_7363_c1_3642_5450 | 597 |
| 313 | 3300060353 | Ga0501082_0079798 | Ga0501082_0079798_813_2627 | 597 |
| 314 | 3300061734 | Ga0530510_0002645 | Ga0530510_0002645_5260_7074 | 597 |
| 315 | iso_pu_bacteria | 2738541284 | 2738763510 | 597 |
| 316 | iso_pu_bacteria | 2775506987 | 2776615053 | 597 |
| 317 | iso_pu_bacteria | 2852627209 | 2852628913 | 597 |
| 318 | iso_pu_bacteria | 2883068021 | 2883072138 | 597 |
| 319 | iso_pu_bacteria | 2884791551 | 2884796945 | 597 |
| 320 | iso_pu_bacteria | 2896109856 | 2896111206 | 597 |
| 321 | 3300005333 | Ga0070677_10004081 | Ga0070677_100040812 | 598 |
| 322 | 3300005354 | Ga0070675_100056061 | Ga0070675_1000560612 | 598 |
| 323 | 3300005356 | Ga0070674_100053400 | Ga0070674_1000534002 | 598 |
| 324 | 3300005456 | Ga0070678_100031688 | Ga0070678_1000316882 | 598 |
| 325 | 3300021361 | Ga0213872_10003201 | Ga0213872_100032012 | 598 |
| 326 | 3300025893 | Ga0207682_10005490 | Ga0207682_100054902 | 598 |
| 327 | 3300025949 | Ga0207667_10003192 | Ga0207667_100031927 | 598 |
| 328 | 3300028786 | Ga0307517_10083164 | Ga0307517_100831642 | 598 |
| 329 | iso_pu_bacteria | 2839989709 | 2839990560 | 598 |
| 330 | 3300003320 | rootH2_10108130 | rootH2_101081301 | 599 |
| 331 | 3300005336 | Ga0070680_100005084 | Ga0070680_1000050845 | 599 |
| 332 | 3300005339 | Ga0070660_100000870 | Ga0070660_1000008706 | 599 |
| 333 | 3300005458 | Ga0070681_10008225 | Ga0070681_100082259 | 599 |
| 334 | 3300005530 | Ga0070679_100018669 | Ga0070679_1000186696 | 599 |
| 335 | 3300005530 | Ga0070679_100031281 | Ga0070679_1000312814 | 599 |
| 336 | 3300005535 | Ga0070684_100073890 | Ga0070684_1000738902 | 599 |
| 337 | 3300005563 | Ga0068855_100024706 | Ga0068855_1000247069 | 599 |
| 338 | 3300009094 | Ga0111539_10143468 | Ga0111539_101434681 | 599 |
| 339 | 3300009176 | Ga0105242_10137727 | Ga0105242_101377272 | 599 |
| 340 | 3300013102 | Ga0157371_10008186 | Ga0157371_100081866 | 599 |
| 341 | 3300013102 | Ga0157371_10009630 | Ga0157371_100096304 | 599 |
| 342 | 3300013102 | Ga0157371_10062499 | Ga0157371_100624991 | 599 |
| 343 | 3300013104 | Ga0157370_10154322 | Ga0157370_101543221 | 599 |
| 344 | 3300013105 | Ga0157369_10082714 | Ga0157369_100827144 | 599 |
| 345 | 3300013307 | Ga0157372_10113438 | Ga0157372_101134382 | 599 |
| 346 | 3300025302 | Ga0207426_1000024 | Ga0207426_1000024270 | 599 |
| 347 | 3300025909 | Ga0207705_10019298 | Ga0207705_100192983 | 599 |
| 348 | 3300025912 | Ga0207707_10020399 | Ga0207707_100203997 | 599 |
| 349 | 3300025917 | Ga0207660_10001426 | Ga0207660_1000142613 | 599 |
| 350 | 3300025919 | Ga0207657_10002882 | Ga0207657_100028824 | 599 |
| 351 | 3300025919 | Ga0207657_10040183 | Ga0207657_100401831 | 599 |
| 352 | 3300025921 | Ga0207652_10000366 | Ga0207652_1000036637 | 599 |
| 353 | 3300025921 | Ga0207652_10035342 | Ga0207652_100353422 | 599 |
| 354 | 3300025949 | Ga0207667_10005069 | Ga0207667_1000506910 | 599 |
| 355 | 3300025949 | Ga0207667_10049025 | Ga0207667_100490252 | 599 |
| 356 | 3300026067 | Ga0207678_10003224 | Ga0207678_1000322410 | 599 |
| 357 | 3300026078 | Ga0207702_10020428 | Ga0207702_100204283 | 599 |
| 358 | 3300026116 | Ga0207674_10051156 | Ga0207674_100511563 | 599 |
| 359 | 3300031507 | Ga0307509_10026077 | Ga0307509_100260773 | 599 |
| 360 | 3300031507 | Ga0307509_10041505 | Ga0307509_100415053 | 599 |
| 361 | 3300037418 | Ga0395900_0159718 | Ga0395900_0159718_42_1871 | 599 |
| 362 | 3300046460 | Ga0495638_0011001 | Ga0495638_0011001_590_2419 | 599 |
| 363 | 3300046523 | Ga0495644_0001921 | Ga0495644_0001921_5666_7498 | 599 |
| 364 | 3300049571 | Ga0501034_0068104 | Ga0501034_0068104_1396_3225 | 599 |
| 365 | 3300049586 | Ga0501070_0092157 | Ga0501070_0092157_55_1884 | 599 |
| 366 | 3300049823 | Ga0501044_0077668 | Ga0501044_0077668_114_1943 | 599 |
| 367 | 3300053080 | Ga0500635_0000598 | Ga0500635_0000598_2699_4531 | 599 |
| 368 | iso_pu_bacteria | 2884215851 | 2884219122 | 599 |
| 369 | 3300001990 | JGI24737J22298_10007369 | JGI24737J22298_100073691 | 600 |
| 370 | 3300002737 | JGI25162J39368_1000141 | JGI25162J39368_100014161 | 600 |
| 371 | 3300002737 | JGI25162J39368_1000852 | JGI25162J39368_100085212 | 600 |
| 372 | 3300002772 | JGI25164J39214_1000617 | JGI25164J39214_10006177 | 600 |
| 373 | 3300003214 | JGI25165J46597_1000157 | JGI25165J46597_100015750 | 600 |
| 374 | 3300003320 | rootH2_10006617 | rootH2_100066173 | 600 |
| 375 | 3300005288 | Ga0065714_10066555 | Ga0065714_100665552 | 600 |
| 376 | 3300005289 | Ga0065704_10071014 | Ga0065704_100710149 | 600 |
| 377 | 3300005289 | Ga0065704_10076291 | Ga0065704_100762912 | 600 |
| 378 | 3300005341 | Ga0070691_10009231 | Ga0070691_100092313 | 600 |
| 379 | 3300005366 | Ga0070659_100004697 | Ga0070659_1000046976 | 600 |
| 380 | 3300005457 | Ga0070662_100000020 | Ga0070662_10000002059 | 600 |
| 381 | 3300005548 | Ga0070665_100001161 | Ga0070665_1000011616 | 600 |
| 382 | 3300005563 | Ga0068855_100000026 | Ga0068855_10000002671 | 600 |
| 383 | 3300005563 | Ga0068855_100000275 | Ga0068855_10000027516 | 600 |
| 384 | 3300005563 | Ga0068855_100047039 | Ga0068855_1000470395 | 600 |
| 385 | 3300005577 | Ga0068857_100005388 | Ga0068857_1000053886 | 600 |
| 386 | 3300005614 | Ga0068856_100041934 | Ga0068856_1000419344 | 600 |
| 387 | 3300006195 | Ga0075366_10002387 | Ga0075366_100023873 | 600 |
| 388 | 3300009093 | Ga0105240_10000224 | Ga0105240_1000022422 | 600 |
| 389 | 3300009093 | Ga0105240_10034786 | Ga0105240_100347864 | 600 |
| 390 | 3300009093 | Ga0105240_10094379 | Ga0105240_100943792 | 600 |
| 391 | 3300009174 | Ga0105241_10000169 | Ga0105241_1000016933 | 600 |
| 392 | 3300009545 | Ga0105237_10001301 | Ga0105237_1000130118 | 600 |
| 393 | 3300009545 | Ga0105237_10007444 | Ga0105237_100074447 | 600 |
| 394 | 3300009545 | Ga0105237_10007588 | Ga0105237_100075887 | 600 |
| 395 | 3300009545 | Ga0105237_10022438 | Ga0105237_100224383 | 600 |
| 396 | 3300009551 | Ga0105238_10014111 | Ga0105238_100141115 | 600 |
| 397 | 3300009551 | Ga0105238_10015881 | Ga0105238_100158815 | 600 |
| 398 | 3300010375 | Ga0105239_10000270 | Ga0105239_1000027023 | 600 |
| 399 | 3300010375 | Ga0105239_10000578 | Ga0105239_1000057825 | 600 |
| 400 | 3300010375 | Ga0105239_10002131 | Ga0105239_1000213118 | 600 |
| 401 | 3300010375 | Ga0105239_10003513 | Ga0105239_100035139 | 600 |
| 402 | 3300010375 | Ga0105239_10031048 | Ga0105239_100310484 | 600 |
| 403 | 3300013100 | Ga0157373_10000464 | Ga0157373_1000046416 | 600 |
| 404 | 3300013100 | Ga0157373_10006725 | Ga0157373_100067254 | 600 |
| 405 | 3300013102 | Ga0157371_10000689 | Ga0157371_1000068918 | 600 |
| 406 | 3300013102 | Ga0157371_10000749 | Ga0157371_100007493 | 600 |
| 407 | 3300013102 | Ga0157371_10002152 | Ga0157371_100021524 | 600 |
| 408 | 3300013104 | Ga0157370_10002460 | Ga0157370_1000246016 | 600 |
| 409 | 3300013296 | Ga0157374_10000007 | Ga0157374_10000007271 | 600 |
| 410 | 3300013297 | Ga0157378_10025193 | Ga0157378_100251932 | 600 |
| 411 | 3300013307 | Ga0157372_10065533 | Ga0157372_100655332 | 600 |
| 412 | 3300013307 | Ga0157372_10096608 | Ga0157372_100966082 | 600 |
| 413 | 3300014497 | Ga0182008_10000024 | Ga0182008_1000002430 | 600 |
| 414 | 3300014969 | Ga0157376_10012790 | Ga0157376_100127909 | 600 |
| 415 | 3300015261 | Ga0182006_1014138 | Ga0182006_10141384 | 600 |
| 416 | 3300025231 | Ga0207427_100025 | Ga0207427_10002592 | 600 |
| 417 | 3300025233 | Ga0209437_100010 | Ga0209437_100010354 | 600 |
| 418 | 3300025233 | Ga0209437_100070 | Ga0209437_10007019 | 600 |
| 419 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017367 | 600 |
| 420 | 3300025272 | Ga0209455_1004625 | Ga0209455_10046253 | 600 |
| 421 | 3300025904 | Ga0207647_10000043 | Ga0207647_1000004324 | 600 |
| 422 | 3300025904 | Ga0207647_10000102 | Ga0207647_100001023 | 600 |
| 423 | 3300025911 | Ga0207654_10000235 | Ga0207654_1000023523 | 600 |
| 424 | 3300025913 | Ga0207695_10000812 | Ga0207695_1000081227 | 600 |
| 425 | 3300025913 | Ga0207695_10032923 | Ga0207695_100329233 | 600 |
| 426 | 3300025914 | Ga0207671_10002787 | Ga0207671_100027877 | 600 |
| 427 | 3300025914 | Ga0207671_10003442 | Ga0207671_1000344212 | 600 |
| 428 | 3300025914 | Ga0207671_10007249 | Ga0207671_100072493 | 600 |
| 429 | 3300025914 | Ga0207671_10011525 | Ga0207671_100115255 | 600 |
| 430 | 3300025914 | Ga0207671_10017978 | Ga0207671_100179783 | 600 |
| 431 | 3300025924 | Ga0207694_10032680 | Ga0207694_100326804 | 600 |
| 432 | 3300025924 | Ga0207694_10066240 | Ga0207694_100662402 | 600 |
| 433 | 3300025933 | Ga0207706_10000044 | Ga0207706_1000004481 | 600 |
| 434 | 3300025949 | Ga0207667_10000022 | Ga0207667_10000022104 | 600 |
| 435 | 3300025949 | Ga0207667_10001554 | Ga0207667_1000155411 | 600 |
| 436 | 3300026078 | Ga0207702_10046926 | Ga0207702_100469261 | 600 |
| 437 | 3300026116 | Ga0207674_10082056 | Ga0207674_100820562 | 600 |
| 438 | 3300028379 | Ga0268266_10004612 | Ga0268266_100046127 | 600 |
| 439 | 3300028794 | Ga0307515_10000144 | Ga0307515_10000144121 | 600 |
| 440 | 3300028794 | Ga0307515_10003557 | Ga0307515_100035577 | 600 |
| 441 | 3300028794 | Ga0307515_10076530 | Ga0307515_100765301 | 600 |
| 442 | 3300031616 | Ga0307508_10010293 | Ga0307508_100102932 | 600 |
| 443 | 3300031911 | Ga0307412_10000030 | Ga0307412_10000030164 | 600 |
| 444 | 3300037312 | Ga0395899_0003295 | Ga0395899_0003295_4779_6608 | 600 |
| 445 | 3300037418 | Ga0395900_0021037 | Ga0395900_0021037_3624_5459 | 600 |
| 446 | 3300037418 | Ga0395900_0038610 | Ga0395900_0038610_719_2548 | 600 |
| 447 | 3300037466 | Ga0395898_0033448 | Ga0395898_0033448_1047_2876 | 600 |
| 448 | 3300037471 | Ga0395905_0001841 | Ga0395905_0001841_22239_24074 | 600 |
| 449 | 3300037471 | Ga0395905_0003680 | Ga0395905_0003680_3865_5694 | 600 |
| 450 | 3300038443 | Ga0395901_0000722 | Ga0395901_0000722_5427_7262 | 600 |
| 451 | 3300038443 | Ga0395901_0010861 | Ga0395901_0010861_3863_5692 | 600 |
| 452 | 3300046471 | Ga0495650_0020756 | Ga0495650_0020756_338_2176 | 600 |
| 453 | 3300046507 | Ga0495606_0072148 | Ga0495606_0072148_81_1916 | 600 |
| 454 | 3300046524 | Ga0495648_0013439 | Ga0495648_0013439_4036_5874 | 600 |
| 455 | 3300046524 | Ga0495648_0028456 | Ga0495648_0028456_1381_3219 | 600 |
| 456 | 3300046558 | Ga0495633_0000027 | Ga0495633_0000027_140513_142351 | 600 |
| 457 | 3300046660 | Ga0495625_0000381 | Ga0495625_0000381_57_1895 | 600 |
| 458 | 3300046660 | Ga0495625_0000939 | Ga0495625_0000939_19628_21466 | 600 |
| 459 | 3300049459 | Ga0495678_015285 | Ga0495678_015285_646_2526 | 600 |
| 460 | 3300050493 | nmdc:mga0k408_2754_c1 | nmdc:mga0k408_2754_c1_281_2119 | 600 |
| 461 | 3300053093 | Ga0500651_0000462 | Ga0500651_0000462_14633_16474 | 600 |
| 462 | 3300053122 | Ga0500608_007533 | Ga0500608_007533_145_1986 | 600 |
| 463 | 3300053157 | Ga0500624_000397 | Ga0500624_000397_455_2335 | 600 |
| 464 | iso_pu_bacteria | 2911138879 | 2911143643 | 600 |
| 465 | 3300003323 | rootH1_10139100 | rootH1_101391002 | 601 |
| 466 | 3300005616 | Ga0068852_100052799 | Ga0068852_1000527992 | 601 |
| 467 | 3300005843 | Ga0068860_100005989 | Ga0068860_1000059896 | 601 |
| 468 | 3300010375 | Ga0105239_10048809 | Ga0105239_100488093 | 601 |
| 469 | 3300013100 | Ga0157373_10000152 | Ga0157373_1000015233 | 601 |
| 470 | 3300013307 | Ga0157372_10014529 | Ga0157372_100145299 | 601 |
| 471 | 3300013308 | Ga0157375_10044527 | Ga0157375_100445274 | 601 |
| 472 | 3300014968 | Ga0157379_10025189 | Ga0157379_100251895 | 601 |
| 473 | 3300025904 | Ga0207647_10000900 | Ga0207647_1000090025 | 601 |
| 474 | 3300025913 | Ga0207695_10013560 | Ga0207695_100135606 | 601 |
| 475 | 3300025914 | Ga0207671_10005689 | Ga0207671_100056895 | 601 |
| 476 | 3300025932 | Ga0207690_10017866 | Ga0207690_100178662 | 601 |
| 477 | 3300028800 | Ga0265338_10023165 | Ga0265338_100231653 | 601 |
| 478 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_635229_637115 | 601 |
| 479 | iso_pu_bacteria | 2739367866 | 2740033823 | 601 |
| 480 | iso_pu_bacteria | 2910245624 | 2910249935 | 601 |
| 481 | 3300000546 | LJNas_1000968 | LJNas_10009682 | 602 |
| 482 | 3300005334 | Ga0068869_100076046 | Ga0068869_1000760461 | 602 |
| 483 | 3300005337 | Ga0070682_100007190 | Ga0070682_1000071903 | 602 |
| 484 | 3300005338 | Ga0068868_100008266 | Ga0068868_1000082663 | 602 |
| 485 | 3300005341 | Ga0070691_10002535 | Ga0070691_100025357 | 602 |
| 486 | 3300005354 | Ga0070675_100048866 | Ga0070675_1000488661 | 602 |
| 487 | 3300005456 | Ga0070678_100030075 | Ga0070678_1000300752 | 602 |
| 488 | 3300005458 | Ga0070681_10105955 | Ga0070681_101059553 | 602 |
| 489 | 3300005530 | Ga0070679_100045509 | Ga0070679_1000455093 | 602 |
| 490 | 3300005539 | Ga0068853_100004755 | Ga0068853_1000047556 | 602 |
| 491 | 3300005539 | Ga0068853_100069644 | Ga0068853_1000696443 | 602 |
| 492 | 3300005563 | Ga0068855_100014026 | Ga0068855_1000140263 | 602 |
| 493 | 3300005563 | Ga0068855_100104433 | Ga0068855_1001044332 | 602 |
| 494 | 3300005719 | Ga0068861_100034641 | Ga0068861_1000346412 | 602 |
| 495 | 3300006237 | Ga0097621_100017632 | Ga0097621_1000176327 | 602 |
| 496 | 3300006358 | Ga0068871_100024054 | Ga0068871_1000240543 | 602 |
| 497 | 3300009093 | Ga0105240_10000147 | Ga0105240_1000014746 | 602 |
| 498 | 3300009093 | Ga0105240_10001324 | Ga0105240_1000132425 | 602 |
| 499 | 3300009174 | Ga0105241_10000319 | Ga0105241_1000031919 | 602 |
| 500 | 3300010375 | Ga0105239_10000981 | Ga0105239_1000098115 | 602 |
| 501 | 3300013104 | Ga0157370_10000479 | Ga0157370_1000047926 | 602 |
| 502 | 3300013296 | Ga0157374_10160957 | Ga0157374_101609572 | 602 |
| 503 | 3300013306 | Ga0163162_10050178 | Ga0163162_100501781 | 602 |
| 504 | 3300014969 | Ga0157376_10027618 | Ga0157376_100276183 | 602 |
| 505 | 3300014969 | Ga0157376_10045731 | Ga0157376_100457312 | 602 |
| 506 | 3300025250 | Ga0209026_1000301 | Ga0209026_100030130 | 602 |
| 507 | 3300025904 | Ga0207647_10064739 | Ga0207647_100647391 | 602 |
| 508 | 3300025907 | Ga0207645_10007346 | Ga0207645_100073464 | 602 |
| 509 | 3300025911 | Ga0207654_10001369 | Ga0207654_100013695 | 602 |
| 510 | 3300025912 | Ga0207707_10000721 | Ga0207707_1000072110 | 602 |
| 511 | 3300025913 | Ga0207695_10000023 | Ga0207695_10000023261 | 602 |
| 512 | 3300025913 | Ga0207695_10048738 | Ga0207695_100487383 | 602 |
| 513 | 3300025917 | Ga0207660_10001254 | Ga0207660_100012549 | 602 |
| 514 | 3300025921 | Ga0207652_10002045 | Ga0207652_100020458 | 602 |
| 515 | 3300025942 | Ga0207689_10001614 | Ga0207689_1000161418 | 602 |
| 516 | 3300025949 | Ga0207667_10002374 | Ga0207667_100023742 | 602 |
| 517 | 3300025949 | Ga0207667_10109905 | Ga0207667_101099053 | 602 |
| 518 | 3300025960 | Ga0207651_10068403 | Ga0207651_100684032 | 602 |
| 519 | 3300025986 | Ga0207658_10049382 | Ga0207658_100493821 | 602 |
| 520 | 3300026041 | Ga0207639_10063382 | Ga0207639_100633823 | 602 |
| 521 | 3300026067 | Ga0207678_10001417 | Ga0207678_1000141721 | 602 |
| 522 | 3300026121 | Ga0207683_10001589 | Ga0207683_1000158919 | 602 |
| 523 | 3300048916 | Ga0496113_0025684 | Ga0496113_0025684_1582_3408 | 602 |
| 524 | 3300048929 | Ga0496126_0128415 | Ga0496126_0128415_46_1872 | 602 |
| 525 | 3300003322 | rootL2_10093656 | rootL2_100936563 | 603 |
| 526 | 3300005327 | Ga0070658_10034259 | Ga0070658_100342594 | 603 |
| 527 | 3300005335 | Ga0070666_10000165 | Ga0070666_1000016518 | 603 |
| 528 | 3300005336 | Ga0070680_100016335 | Ga0070680_1000163355 | 603 |
| 529 | 3300005563 | Ga0068855_100001157 | Ga0068855_1000011579 | 603 |
| 530 | 3300005614 | Ga0068856_100105561 | Ga0068856_1001055611 | 603 |
| 531 | 3300005616 | Ga0068852_100010317 | Ga0068852_1000103172 | 603 |
| 532 | 3300005617 | Ga0068859_100000163 | Ga0068859_10000016335 | 603 |
| 533 | 3300005618 | Ga0068864_100002828 | Ga0068864_1000028283 | 603 |
| 534 | 3300005841 | Ga0068863_100000696 | Ga0068863_10000069618 | 603 |
| 535 | 3300005842 | Ga0068858_100083288 | Ga0068858_1000832882 | 603 |
| 536 | 3300006237 | Ga0097621_100007615 | Ga0097621_1000076152 | 603 |
| 537 | 3300006931 | Ga0097620_100000163 | Ga0097620_10000016335 | 603 |
| 538 | 3300009093 | Ga0105240_10004368 | Ga0105240_1000436813 | 603 |
| 539 | 3300009174 | Ga0105241_10000776 | Ga0105241_1000077616 | 603 |
| 540 | 3300009545 | Ga0105237_10000052 | Ga0105237_100000522 | 603 |
| 541 | 3300009545 | Ga0105237_10003655 | Ga0105237_100036553 | 603 |
| 542 | 3300009545 | Ga0105237_10003711 | Ga0105237_100037114 | 603 |
| 543 | 3300009553 | Ga0105249_10001077 | Ga0105249_1000107710 | 603 |
| 544 | 3300010375 | Ga0105239_10000370 | Ga0105239_1000037024 | 603 |
| 545 | 3300013105 | Ga0157369_10145907 | Ga0157369_101459072 | 603 |
| 546 | 3300013306 | Ga0163162_10000785 | Ga0163162_1000078521 | 603 |
| 547 | 3300013307 | Ga0157372_10002120 | Ga0157372_100021207 | 603 |
| 548 | 3300013308 | Ga0157375_10083886 | Ga0157375_100838862 | 603 |
| 549 | 3300014326 | Ga0157380_10004889 | Ga0157380_100048898 | 603 |
| 550 | 3300014969 | Ga0157376_10019104 | Ga0157376_100191042 | 603 |
| 551 | 3300025903 | Ga0207680_10000543 | Ga0207680_1000054314 | 603 |
| 552 | 3300025911 | Ga0207654_10005463 | Ga0207654_100054635 | 603 |
| 553 | 3300025913 | Ga0207695_10000110 | Ga0207695_1000011053 | 603 |
| 554 | 3300025914 | Ga0207671_10003201 | Ga0207671_100032013 | 603 |
| 555 | 3300025914 | Ga0207671_10004509 | Ga0207671_100045092 | 603 |
| 556 | 3300025914 | Ga0207671_10016565 | Ga0207671_100165652 | 603 |
| 557 | 3300025942 | Ga0207689_10001987 | Ga0207689_100019873 | 603 |
| 558 | 3300025949 | Ga0207667_10000144 | Ga0207667_1000014477 | 603 |
| 559 | 3300025961 | Ga0207712_10040562 | Ga0207712_100405622 | 603 |
| 560 | 3300026088 | Ga0207641_10000176 | Ga0207641_1000017659 | 603 |
| 561 | 3300026118 | Ga0207675_100020554 | Ga0207675_1000205542 | 603 |
| 562 | 3300026142 | Ga0207698_10006151 | Ga0207698_100061512 | 603 |
| 563 | 3300028379 | Ga0268266_10104402 | Ga0268266_101044022 | 603 |
| 564 | 3300028794 | Ga0307515_10000107 | Ga0307515_1000010724 | 603 |
| 565 | 3300030521 | Ga0307511_10000808 | Ga0307511_1000080811 | 603 |
| 566 | 3300031507 | Ga0307509_10075276 | Ga0307509_100752762 | 603 |
| 567 | 3300033180 | Ga0307510_10001458 | Ga0307510_1000145814 | 603 |
| 568 | 3300037853 | Ga0436364_0871624 | Ga0436364_0871624_84653_86479 | 603 |
| 569 | 3300046522 | Ga0495643_0032638 | Ga0495643_0032638_54_1871 | 603 |
| 570 | 3300046648 | Ga0495611_0000100 | Ga0495611_0000100_8080_9930 | 603 |
| 571 | 3300046694 | Ga0495649_0014016 | Ga0495649_0014016_331_2148 | 603 |
| 572 | 3300047320 | Ga0495672_0070623 | Ga0495672_0070623_139_1965 | 603 |
| 573 | 3300047472 | Ga0495686_0000031 | Ga0495686_0000031_201691_203514 | 603 |
| 574 | 3300047472 | Ga0495686_0001778 | Ga0495686_0001778_11859_13682 | 603 |
| 575 | 3300048907 | Ga0496104_0000050 | Ga0496104_0000050_66039_67856 | 603 |
| 576 | 3300048929 | Ga0496126_0003894 | Ga0496126_0003894_3902_5734 | 603 |
| 577 | 3300049569 | Ga0501032_0005435 | Ga0501032_0005435_4496_6319 | 603 |
| 578 | 3300049570 | Ga0501033_0002918 | Ga0501033_0002918_9969_11792 | 603 |
| 579 | 3300049571 | Ga0501034_0061940 | Ga0501034_0061940_702_2525 | 603 |
| 580 | 3300049572 | Ga0501036_0000910 | Ga0501036_0000910_7800_9623 | 603 |
| 581 | 3300049573 | Ga0501037_0001569 | Ga0501037_0001569_5152_6975 | 603 |
| 582 | 3300049574 | Ga0501038_0005645 | Ga0501038_0005645_4190_6013 | 603 |
| 583 | 3300049575 | Ga0501039_0007035 | Ga0501039_0007035_2694_4517 | 603 |
| 584 | 3300049579 | Ga0501043_0008002 | Ga0501043_0008002_2386_4209 | 603 |
| 585 | 3300049580 | Ga0501046_0010481 | Ga0501046_0010481_3969_5792 | 603 |
| 586 | 3300049581 | Ga0501047_0010418 | Ga0501047_0010418_4869_6695 | 603 |
| 587 | 3300049581 | Ga0501047_0018973 | Ga0501047_0018973_2115_3938 | 603 |
| 588 | 3300049582 | Ga0501048_0017623 | Ga0501048_0017623_910_2733 | 603 |
| 589 | 3300049583 | Ga0501067_0006094 | Ga0501067_0006094_3920_5743 | 603 |
| 590 | 3300049584 | Ga0501068_0008546 | Ga0501068_0008546_3701_5524 | 603 |
| 591 | 3300049585 | Ga0501069_0000155 | Ga0501069_0000155_4079_5902 | 603 |
| 592 | 3300049586 | Ga0501070_0021406 | Ga0501070_0021406_2115_3938 | 603 |
| 593 | 3300049586 | Ga0501070_0045641 | Ga0501070_0045641_1493_3319 | 603 |
| 594 | 3300049586 | Ga0501070_0080596 | Ga0501070_0080596_308_2134 | 603 |
| 595 | 3300049588 | Ga0501072_0002255 | Ga0501072_0002255_584_2407 | 603 |
| 596 | 3300049589 | Ga0501073_0011241 | Ga0501073_0011241_2340_4163 | 603 |
| 597 | 3300049741 | Ga0501079_0010815 | Ga0501079_0010815_2659_4482 | 603 |
| 598 | 3300049742 | Ga0501080_0014429 | Ga0501080_0014429_3967_5790 | 603 |
| 599 | 3300049744 | Ga0501083_0014288 | Ga0501083_0014288_2115_3938 | 603 |
| 600 | 3300049822 | Ga0501035_0009965 | Ga0501035_0009965_1581_3404 | 603 |
| 601 | 3300049823 | Ga0501044_0020988 | Ga0501044_0020988_3920_5743 | 603 |
| 602 | 3300050511 | nmdc:mga08y16_12657_c1 | nmdc:mga08y16_12657_c1_2619_4436 | 603 |
| 603 | 3300053093 | Ga0500651_0000003 | Ga0500651_0000003_275785_277611 | 603 |
| 604 | 3300054114 | Ga0501084_0001521 | Ga0501084_0001521_4291_6114 | 603 |
| 605 | 3300060353 | Ga0501082_0022216 | Ga0501082_0022216_2285_4108 | 603 |
| 606 | 3300006844 | Ga0075428_100008359 | Ga0075428_1000083593 | 604 |
| 607 | 3300006844 | Ga0075428_100224589 | Ga0075428_1002245892 | 604 |
| 608 | 3300014325 | Ga0163163_10076963 | Ga0163163_100769632 | 604 |
| 609 | 3300025941 | Ga0207711_10097116 | Ga0207711_100971162 | 604 |
| 610 | 3300026088 | Ga0207641_10033647 | Ga0207641_100336471 | 604 |
| 611 | 3300035692 | Ga0373935_0080200 | Ga0373935_0080200_148_1980 | 604 |
| 612 | 3300045051 | Ga0451576_0063258 | Ga0451576_0063258_475_2307 | 604 |
| 613 | 3300046462 | Ga0495651_0098308 | Ga0495651_0098308_169_2001 | 604 |
| 614 | 3300046472 | Ga0495580_0002060 | Ga0495580_0002060_6635_8467 | 604 |
| 615 | 3300046531 | Ga0495665_0018016 | Ga0495665_0018016_66_1898 | 604 |
| 616 | 3300046679 | Ga0495623_0052046 | Ga0495623_0052046_448_2280 | 604 |
| 617 | 3300047444 | Ga0495675_0065938 | Ga0495675_0065938_331_2163 | 604 |
| 618 | 3300047471 | Ga0495684_0016716 | Ga0495684_0016716_1732_3564 | 604 |
| 619 | 3300048088 | Ga0495602_0128051 | Ga0495602_0128051_58_1890 | 604 |
| 620 | 3300060353 | Ga0501082_0001743 | Ga0501082_0001743_6788_8620 | 604 |
| 621 | 3300005327 | Ga0070658_10002294 | Ga0070658_100022942 | 605 |
| 622 | 3300005455 | Ga0070663_100000586 | Ga0070663_1000005863 | 605 |
| 623 | 3300005563 | Ga0068855_100096081 | Ga0068855_1000960812 | 605 |
| 624 | 3300005618 | Ga0068864_100013821 | Ga0068864_1000138211 | 605 |
| 625 | 3300005844 | Ga0068862_100016835 | Ga0068862_1000168353 | 605 |
| 626 | 3300006880 | Ga0075429_100068857 | Ga0075429_1000688572 | 605 |
| 627 | 3300010375 | Ga0105239_10000043 | Ga0105239_1000004368 | 605 |
| 628 | 3300013102 | Ga0157371_10024416 | Ga0157371_100244161 | 605 |
| 629 | 3300013296 | Ga0157374_10007113 | Ga0157374_100071135 | 605 |
| 630 | 3300013306 | Ga0163162_10069505 | Ga0163162_100695053 | 605 |
| 631 | 3300025909 | Ga0207705_10039272 | Ga0207705_100392723 | 605 |
| 632 | 3300025913 | Ga0207695_10000262 | Ga0207695_1000026281 | 605 |
| 633 | 3300025919 | Ga0207657_10013145 | Ga0207657_100131455 | 605 |
| 634 | 3300047471 | Ga0495684_0010156 | Ga0495684_0010156_4816_6663 | 605 |
| 635 | 3300048904 | Ga0496101_0032829 | Ga0496101_0032829_1095_2996 | 605 |
| 636 | 3300048908 | Ga0496105_0005478 | Ga0496105_0005478_5578_7479 | 605 |
| 637 | 3300048915 | Ga0496112_0158290 | Ga0496112_0158290_292_2145 | 605 |
| 638 | 3300048920 | Ga0496117_0014403 | Ga0496117_0014403_4016_5917 | 605 |
| 639 | 3300048921 | Ga0496118_0005063 | Ga0496118_0005063_5974_7875 | 605 |
| 640 | 3300048921 | Ga0496118_0005243 | Ga0496118_0005243_11023_12924 | 605 |
| 641 | 3300048922 | Ga0496119_0000531 | Ga0496119_0000531_24141_26042 | 605 |
| 642 | 3300048923 | Ga0496120_0000182 | Ga0496120_0000182_81013_82914 | 605 |
| 643 | 3300048929 | Ga0496126_0001108 | Ga0496126_0001108_114_2015 | 605 |
| 644 | 3300050508 | nmdc:mga09592_47844_c1 | nmdc:mga09592_47844_c1_26_1843 | 605 |
| 645 | 3300050509 | nmdc:mga0qj67_6396_c1 | nmdc:mga0qj67_6396_c1_2787_4604 | 605 |
| 646 | 3300053153 | Ga0500616_0000204 | Ga0500616_0000204_9120_10943 | 605 |
| 647 | 3300000546 | LJNas_1000166 | LJNas_10001662 | 606 |
| 648 | 3300005329 | Ga0070683_100129003 | Ga0070683_1001290031 | 606 |
| 649 | 3300005334 | Ga0068869_100000733 | Ga0068869_1000007332 | 606 |
| 650 | 3300005334 | Ga0068869_100022814 | Ga0068869_1000228143 | 606 |
| 651 | 3300005338 | Ga0068868_100002352 | Ga0068868_1000023528 | 606 |
| 652 | 3300005434 | Ga0070709_10005054 | Ga0070709_100050544 | 606 |
| 653 | 3300005434 | Ga0070709_10028343 | Ga0070709_100283432 | 606 |
| 654 | 3300005435 | Ga0070714_100001471 | Ga0070714_1000014714 | 606 |
| 655 | 3300005436 | Ga0070713_100001335 | Ga0070713_1000013358 | 606 |
| 656 | 3300005436 | Ga0070713_100038053 | Ga0070713_1000380532 | 606 |
| 657 | 3300005436 | Ga0070713_100045224 | Ga0070713_1000452242 | 606 |
| 658 | 3300005437 | Ga0070710_10001260 | Ga0070710_100012605 | 606 |
| 659 | 3300005437 | Ga0070710_10012873 | Ga0070710_100128732 | 606 |
| 660 | 3300005445 | Ga0070708_100000141 | Ga0070708_10000014125 | 606 |
| 661 | 3300005445 | Ga0070708_100004536 | Ga0070708_1000045367 | 606 |
| 662 | 3300005458 | Ga0070681_10000293 | Ga0070681_1000029313 | 606 |
| 663 | 3300005458 | Ga0070681_10006018 | Ga0070681_100060184 | 606 |
| 664 | 3300005459 | Ga0068867_100012223 | Ga0068867_1000122233 | 606 |
| 665 | 3300005466 | Ga0070685_10019301 | Ga0070685_100193012 | 606 |
| 666 | 3300005467 | Ga0070706_100002149 | Ga0070706_10000214911 | 606 |
| 667 | 3300005468 | Ga0070707_100004191 | Ga0070707_1000041915 | 606 |
| 668 | 3300005471 | Ga0070698_100004301 | Ga0070698_1000043014 | 606 |
| 669 | 3300005518 | Ga0070699_100000132 | Ga0070699_10000013218 | 606 |
| 670 | 3300005530 | Ga0070679_100036612 | Ga0070679_1000366122 | 606 |
| 671 | 3300005530 | Ga0070679_100126134 | Ga0070679_1001261342 | 606 |
| 672 | 3300005535 | Ga0070684_100067299 | Ga0070684_1000672991 | 606 |
| 673 | 3300005536 | Ga0070697_100000261 | Ga0070697_1000002615 | 606 |
| 674 | 3300005563 | Ga0068855_100000500 | Ga0068855_1000005007 | 606 |
| 675 | 3300005563 | Ga0068855_100005062 | Ga0068855_10000506212 | 606 |
| 676 | 3300005563 | Ga0068855_100075546 | Ga0068855_1000755462 | 606 |
| 677 | 3300005564 | Ga0070664_100000583 | Ga0070664_1000005839 | 606 |
| 678 | 3300005564 | Ga0070664_100034117 | Ga0070664_1000341173 | 606 |
| 679 | 3300005577 | Ga0068857_100001802 | Ga0068857_1000018025 | 606 |
| 680 | 3300005577 | Ga0068857_100015189 | Ga0068857_1000151892 | 606 |
| 681 | 3300005578 | Ga0068854_100095595 | Ga0068854_1000955951 | 606 |
| 682 | 3300005614 | Ga0068856_100001116 | Ga0068856_10000111612 | 606 |
| 683 | 3300005614 | Ga0068856_100004130 | Ga0068856_1000041303 | 606 |
| 684 | 3300005614 | Ga0068856_100004768 | Ga0068856_1000047689 | 606 |
| 685 | 3300005614 | Ga0068856_100018770 | Ga0068856_1000187702 | 606 |
| 686 | 3300005614 | Ga0068856_100058747 | Ga0068856_1000587471 | 606 |
| 687 | 3300005614 | Ga0068856_100059504 | Ga0068856_1000595042 | 606 |
| 688 | 3300005616 | Ga0068852_100028898 | Ga0068852_1000288982 | 606 |
| 689 | 3300005617 | Ga0068859_100005316 | Ga0068859_1000053165 | 606 |
| 690 | 3300005618 | Ga0068864_100003869 | Ga0068864_1000038695 | 606 |
| 691 | 3300005841 | Ga0068863_100016617 | Ga0068863_1000166174 | 606 |
| 692 | 3300005842 | Ga0068858_100002561 | Ga0068858_1000025614 | 606 |
| 693 | 3300005842 | Ga0068858_100036970 | Ga0068858_1000369703 | 606 |
| 694 | 3300005843 | Ga0068860_100075676 | Ga0068860_1000756762 | 606 |
| 695 | 3300005844 | Ga0068862_100020920 | Ga0068862_1000209202 | 606 |
| 696 | 3300006028 | Ga0070717_10000703 | Ga0070717_1000070315 | 606 |
| 697 | 3300006028 | Ga0070717_10003890 | Ga0070717_100038904 | 606 |
| 698 | 3300006028 | Ga0070717_10013658 | Ga0070717_100136582 | 606 |
| 699 | 3300006028 | Ga0070717_10030810 | Ga0070717_100308102 | 606 |
| 700 | 3300006028 | Ga0070717_10058506 | Ga0070717_100585062 | 606 |
| 701 | 3300006028 | Ga0070717_10082418 | Ga0070717_100824181 | 606 |
| 702 | 3300006175 | Ga0070712_100012057 | Ga0070712_1000120572 | 606 |
| 703 | 3300006237 | Ga0097621_100000954 | Ga0097621_1000009542 | 606 |
| 704 | 3300006237 | Ga0097621_100003319 | Ga0097621_1000033195 | 606 |
| 705 | 3300006237 | Ga0097621_100004993 | Ga0097621_1000049931 | 606 |
| 706 | 3300006237 | Ga0097621_100044086 | Ga0097621_1000440862 | 606 |
| 707 | 3300006358 | Ga0068871_100000435 | Ga0068871_10000043520 | 606 |
| 708 | 3300006358 | Ga0068871_100005053 | Ga0068871_1000050535 | 606 |
| 709 | 3300006358 | Ga0068871_100019977 | Ga0068871_1000199772 | 606 |
| 710 | 3300006871 | Ga0075434_100002147 | Ga0075434_1000021476 | 606 |
| 711 | 3300006881 | Ga0068865_100009033 | Ga0068865_1000090332 | 606 |
| 712 | 3300006931 | Ga0097620_100005316 | Ga0097620_1000053165 | 606 |
| 713 | 3300007788 | Ga0099795_10023036 | Ga0099795_100230361 | 606 |
| 714 | 3300009093 | Ga0105240_10007328 | Ga0105240_100073282 | 606 |
| 715 | 3300009093 | Ga0105240_10035761 | Ga0105240_100357612 | 606 |
| 716 | 3300009174 | Ga0105241_10003320 | Ga0105241_100033204 | 606 |
| 717 | 3300009551 | Ga0105238_10000198 | Ga0105238_100001986 | 606 |
| 718 | 3300010159 | Ga0099796_10004036 | Ga0099796_100040363 | 606 |
| 719 | 3300013100 | Ga0157373_10015167 | Ga0157373_100151673 | 606 |
| 720 | 3300013105 | Ga0157369_10001064 | Ga0157369_1000106417 | 606 |
| 721 | 3300013105 | Ga0157369_10076084 | Ga0157369_100760842 | 606 |
| 722 | 3300013296 | Ga0157374_10000264 | Ga0157374_100002648 | 606 |
| 723 | 3300013296 | Ga0157374_10004484 | Ga0157374_100044842 | 606 |
| 724 | 3300013296 | Ga0157374_10004925 | Ga0157374_100049252 | 606 |
| 725 | 3300013296 | Ga0157374_10007634 | Ga0157374_100076342 | 606 |
| 726 | 3300013296 | Ga0157374_10157011 | Ga0157374_101570112 | 606 |
| 727 | 3300013297 | Ga0157378_10000279 | Ga0157378_100002795 | 606 |
| 728 | 3300013297 | Ga0157378_10000549 | Ga0157378_1000054912 | 606 |
| 729 | 3300013297 | Ga0157378_10007173 | Ga0157378_100071736 | 606 |
| 730 | 3300013297 | Ga0157378_10044018 | Ga0157378_100440182 | 606 |
| 731 | 3300013306 | Ga0163162_10005510 | Ga0163162_100055107 | 606 |
| 732 | 3300013307 | Ga0157372_10000476 | Ga0157372_1000047625 | 606 |
| 733 | 3300013307 | Ga0157372_10001554 | Ga0157372_100015544 | 606 |
| 734 | 3300013307 | Ga0157372_10005305 | Ga0157372_100053054 | 606 |
| 735 | 3300013307 | Ga0157372_10008021 | Ga0157372_100080215 | 606 |
| 736 | 3300013307 | Ga0157372_10015554 | Ga0157372_100155542 | 606 |
| 737 | 3300013307 | Ga0157372_10029059 | Ga0157372_100290592 | 606 |
| 738 | 3300013308 | Ga0157375_10130975 | Ga0157375_101309752 | 606 |
| 739 | 3300014325 | Ga0163163_10049855 | Ga0163163_100498552 | 606 |
| 740 | 3300014968 | Ga0157379_10037079 | Ga0157379_100370792 | 606 |
| 741 | 3300014968 | Ga0157379_10148777 | Ga0157379_101487772 | 606 |
| 742 | 3300014969 | Ga0157376_10019653 | Ga0157376_100196532 | 606 |
| 743 | 3300014969 | Ga0157376_10066861 | Ga0157376_100668612 | 606 |
| 744 | 3300022732 | Ga0224569_100072 | Ga0224569_1000722 | 606 |
| 745 | 3300024227 | Ga0228598_1001851 | Ga0228598_10018513 | 606 |
| 746 | 3300024227 | Ga0228598_1002000 | Ga0228598_10020003 | 606 |
| 747 | 3300025898 | Ga0207692_10001733 | Ga0207692_100017333 | 606 |
| 748 | 3300025898 | Ga0207692_10028642 | Ga0207692_100286422 | 606 |
| 749 | 3300025899 | Ga0207642_10005445 | Ga0207642_100054453 | 606 |
| 750 | 3300025899 | Ga0207642_10018855 | Ga0207642_100188551 | 606 |
| 751 | 3300025904 | Ga0207647_10001316 | Ga0207647_100013168 | 606 |
| 752 | 3300025910 | Ga0207684_10000398 | Ga0207684_1000039840 | 606 |
| 753 | 3300025911 | Ga0207654_10003304 | Ga0207654_100033044 | 606 |
| 754 | 3300025912 | Ga0207707_10012472 | Ga0207707_100124722 | 606 |
| 755 | 3300025912 | Ga0207707_10019352 | Ga0207707_100193522 | 606 |
| 756 | 3300025912 | Ga0207707_10043275 | Ga0207707_100432752 | 606 |
| 757 | 3300025913 | Ga0207695_10005266 | Ga0207695_100052663 | 606 |
| 758 | 3300025913 | Ga0207695_10024212 | Ga0207695_100242122 | 606 |
| 759 | 3300025913 | Ga0207695_10026453 | Ga0207695_100264532 | 606 |
| 760 | 3300025914 | Ga0207671_10105198 | Ga0207671_101051982 | 606 |
| 761 | 3300025917 | Ga0207660_10015959 | Ga0207660_100159592 | 606 |
| 762 | 3300025921 | Ga0207652_10053982 | Ga0207652_100539822 | 606 |
| 763 | 3300025921 | Ga0207652_10064209 | Ga0207652_100642092 | 606 |
| 764 | 3300025922 | Ga0207646_10000194 | Ga0207646_1000019443 | 606 |
| 765 | 3300025924 | Ga0207694_10003110 | Ga0207694_100031102 | 606 |
| 766 | 3300025925 | Ga0207650_10006983 | Ga0207650_100069833 | 606 |
| 767 | 3300025928 | Ga0207700_10047627 | Ga0207700_100476272 | 606 |
| 768 | 3300025929 | Ga0207664_10002361 | Ga0207664_100023612 | 606 |
| 769 | 3300025929 | Ga0207664_10046497 | Ga0207664_100464971 | 606 |
| 770 | 3300025938 | Ga0207704_10064558 | Ga0207704_100645581 | 606 |
| 771 | 3300025938 | Ga0207704_10081821 | Ga0207704_100818211 | 606 |
| 772 | 3300025939 | Ga0207665_10003445 | Ga0207665_100034453 | 606 |
| 773 | 3300025939 | Ga0207665_10042924 | Ga0207665_100429242 | 606 |
| 774 | 3300025942 | Ga0207689_10000166 | Ga0207689_1000016644 | 606 |
| 775 | 3300025949 | Ga0207667_10002154 | Ga0207667_100021544 | 606 |
| 776 | 3300025949 | Ga0207667_10058190 | Ga0207667_100581902 | 606 |
| 777 | 3300025981 | Ga0207640_10044681 | Ga0207640_100446812 | 606 |
| 778 | 3300026023 | Ga0207677_10002804 | Ga0207677_100028045 | 606 |
| 779 | 3300026023 | Ga0207677_10003282 | Ga0207677_100032824 | 606 |
| 780 | 3300026035 | Ga0207703_10001414 | Ga0207703_1000141410 | 606 |
| 781 | 3300026078 | Ga0207702_10001291 | Ga0207702_1000129111 | 606 |
| 782 | 3300026078 | Ga0207702_10006466 | Ga0207702_100064663 | 606 |
| 783 | 3300026078 | Ga0207702_10011101 | Ga0207702_100111012 | 606 |
| 784 | 3300026078 | Ga0207702_10012221 | Ga0207702_100122212 | 606 |
| 785 | 3300026078 | Ga0207702_10031494 | Ga0207702_100314942 | 606 |
| 786 | 3300026088 | Ga0207641_10027718 | Ga0207641_100277182 | 606 |
| 787 | 3300026089 | Ga0207648_10018584 | Ga0207648_100185843 | 606 |
| 788 | 3300026095 | Ga0207676_10085556 | Ga0207676_100855563 | 606 |
| 789 | 3300026116 | Ga0207674_10002833 | Ga0207674_100028337 | 606 |
| 790 | 3300026116 | Ga0207674_10009215 | Ga0207674_100092156 | 606 |
| 791 | 3300026142 | Ga0207698_10020378 | Ga0207698_100203782 | 606 |
| 792 | 3300028381 | Ga0268264_10026431 | Ga0268264_100264311 | 606 |
| 793 | 3300028381 | Ga0268264_10031781 | Ga0268264_100317811 | 606 |
| 794 | 3300028786 | Ga0307517_10004917 | Ga0307517_1000491716 | 606 |
| 795 | 3300030760 | Ga0265762_1000173 | Ga0265762_10001732 | 606 |
| 796 | 3300030760 | Ga0265762_1000258 | Ga0265762_10002586 | 606 |
| 797 | 3300031090 | Ga0265760_10009115 | Ga0265760_100091152 | 606 |
| 798 | 3300035691 | Ga0373931_0055954 | Ga0373931_0055954_78_1898 | 606 |
| 799 | 3300035724 | Ga0373933_0009387 | Ga0373933_0009387_1216_3036 | 606 |
| 800 | 3300036401 | Ga0373937_0022929 | Ga0373937_0022929_185_2005 | 606 |
| 801 | 3300037068 | Ga0373925_0002014 | Ga0373925_0002014_1988_3808 | 606 |
| 802 | 3300037853 | Ga0436364_0372332 | Ga0436364_0372332_11650_13473 | 606 |
| 803 | 3300039453 | Ga0436362_1196168 | Ga0436362_1196168_1358_3178 | 606 |
| 804 | 3300044694 | Ga0466963_0014163 | Ga0466963_0014163_1325_3145 | 606 |
| 805 | 3300045051 | Ga0451576_0008203 | Ga0451576_0008203_1596_3461 | 606 |
| 806 | 3300045051 | Ga0451576_0058438 | Ga0451576_0058438_983_2803 | 606 |
| 807 | 3300046472 | Ga0495580_0006959 | Ga0495580_0006959_1834_3654 | 606 |
| 808 | 3300046472 | Ga0495580_0007312 | Ga0495580_0007312_6945_8810 | 606 |
| 809 | 3300046473 | Ga0495582_0000342 | Ga0495582_0000342_14067_15887 | 606 |
| 810 | 3300046536 | Ga0495587_0039774 | Ga0495587_0039774_645_2465 | 606 |
| 811 | 3300046679 | Ga0495623_0033499 | Ga0495623_0033499_939_2804 | 606 |
| 812 | 3300048905 | Ga0496102_0130377 | Ga0496102_0130377_278_2098 | 606 |
| 813 | 3300048915 | Ga0496112_0003084 | Ga0496112_0003084_1078_3072 | 606 |
| 814 | 3300048915 | Ga0496112_0004578 | Ga0496112_0004578_6771_8591 | 606 |
| 815 | 3300048915 | Ga0496112_0025884 | Ga0496112_0025884_3067_4887 | 606 |
| 816 | 3300048918 | Ga0496115_0019460 | Ga0496115_0019460_2648_4468 | 606 |
| 817 | 3300050512 | nmdc:mga0n895_3571_c1 | nmdc:mga0n895_3571_c1_7240_9060 | 606 |
| 818 | 3300050513 | nmdc:mga0rr50_3538_c1 | nmdc:mga0rr50_3538_c1_6789_8609 | 606 |
| 819 | 3300050514 | nmdc:mga08x19_16802_c1 | nmdc:mga08x19_16802_c1_2520_4340 | 606 |
| 820 | 3300050514 | nmdc:mga08x19_24037_c1 | nmdc:mga08x19_24037_c1_1013_2833 | 606 |
| 821 | 3300050515 | nmdc:mga0a205_9848_c1 | nmdc:mga0a205_9848_c1_3547_5367 | 606 |
| 822 | 3300053103 | Ga0500555_000117 | Ga0500555_000117_33001_34827 | 606 |
| 823 | 3300053730 | Ga0500645_000345 | Ga0500645_000345_10806_12632 | 606 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ghi-assembly3.cif.gz_C | crystal structure of plasmodium yoelii multidrug resistance protein 2 | 0.9517 | 360 | 600 |
| 3nh9-assembly1.cif.gz_A | nucleotide binding domain of human abcb6 (atp bound structure) | 0.9432 | 343 | 602 |
| 2ghi-assembly1.cif.gz_A | crystal structure of plasmodium yoelii multidrug resistance protein 2 | 0.9419 | 360 | 602 |
| 2ghi-assembly4.cif.gz_D | crystal structure of plasmodium yoelii multidrug resistance protein 2 | 0.9413 | 360 | 600 |
| 2fgk-assembly2.cif.gz_B | crystal structure of the abc-cassette e631q mutant of hlyb with bound atp | 0.9282 | 360 | 601 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghiC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9517 | 360 | 600 | 3.40.50.300 |
| af_P23886_333_572_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9422 | 360 | 599 | 3.40.50.300 |
| af_P0AAG5_335_579_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9413 | 357 | 604 | 3.40.50.300 |
| af_P9WQJ9_605_853_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9406 | 360 | 605 | 3.40.50.300 |
| af_Q2FVJ2_326_574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9402 | 348 | 606 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1X004-F1-model_v4 | ABC transporter domain-containing protein | 0.9678 | 430 | 587 |
GO:0005524
GO:0005737 GO:0016020 GO:0016887 GO:0042626 |
| AF-A0A519X245-F1-model_v4 | deleted | 0.9638 | 403 | 604 |
|
| AF-A0A2A8D2P9-F1-model_v4 | ABC transporter domain-containing protein | 0.9625 | 360 | 605 |
GO:0005524
GO:0016887 GO:0034040 |
| AF-A0A6P7HDW7-F1-model_v4 | Multidrug resistance protein 1B-like | 0.9593 | 360 | 600 |
GO:0005524
GO:0016020 GO:0016887 GO:0042626 |
| AF-A0A537DY65-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9587 | 410 | 605 |
GO:0005524
GO:0016020 GO:0016887 GO:0042626 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar