F482406

General Info

Members Datasets Scaffolds Average Seq Length
824 550 542 209

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0000140|Ga0500568_0000140_61944_62573
Length 209
Sequence VLQPDRDGELERLAARIRACRICVDSPAGRPLPHEPRPVVVPSATAKILIAGQAPGTKVHLSGKPFSDASGDRLRDWLGVSSEIFYDAEKIAMAGMGFCFPGQDAKGGDLRPRRECAPAWRSPLMALMPQIELVVAVGLYAQAWHIGGRARSLTDTVRDWRGILERTNGPKIIPLPHSSWRNTGWIRMNPWFETDLLPRLKTEIALRLG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
15 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
16 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
19 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
20 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
21 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
22 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
23 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
24 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
25 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
26 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
27 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
28 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
29 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
30 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
31 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
32 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
33 2643221568 Rhizobium sp. Root564 Isolate Unclassified
34 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
35 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
36 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
37 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
38 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
39 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
40 2718217927 Rhizobium sp. N324 Isolate Nodule
41 2718218423 Rhizobium sp. N941 Isolate Nodule
42 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
43 2721755809 Rhizobium sp. N541 Isolate Nodule
44 2738543024 Aminobacter sp. AP02 Isolate Unclassified
45 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
46 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
47 2791355266 Rhizobium sp. L43 Isolate Nodule
48 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
49 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
50 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
51 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
52 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
53 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
54 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
55 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
56 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
57 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
58 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
59 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
60 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
61 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
62 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
63 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
64 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
65 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
66 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
67 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
68 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
69 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
70 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
71 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
72 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
73 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
74 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
75 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
76 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
77 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
78 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
79 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
80 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
81 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
82 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
83 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
84 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
85 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
86 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
87 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
88 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
89 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
90 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
91 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
92 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
93 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
94 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
95 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
96 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
97 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
98 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
99 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
100 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
101 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
102 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
103 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
104 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
105 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
106 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
107 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
108 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
109 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
110 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
111 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
112 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
113 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
114 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
115 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
116 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
117 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
118 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
119 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
120 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
121 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
122 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
123 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
124 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
125 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
126 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
127 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
128 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
129 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
130 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
131 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
132 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
133 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
134 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
135 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
136 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
137 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
138 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
139 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
140 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
141 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
142 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
143 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
144 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
145 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
146 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
147 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
148 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
149 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
150 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
151 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
152 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
153 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
154 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
155 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
156 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
157 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
158 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
159 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
160 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
161 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
162 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
163 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
164 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
165 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
166 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
167 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
168 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
169 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
170 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
171 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
172 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
173 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
174 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
175 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
176 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
177 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
178 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
179 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
180 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
181 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
182 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
183 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
184 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
185 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
186 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
187 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
188 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
189 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
190 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
191 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
192 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
193 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
194 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
195 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
196 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
197 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
198 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
199 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
200 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
201 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
202 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
203 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
204 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
205 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
206 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
207 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
208 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
209 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
210 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
211 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
212 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
213 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
214 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
215 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
216 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
217 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
218 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
219 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
220 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
221 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
222 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
223 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
224 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
225 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
226 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
227 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
228 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
229 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
230 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
231 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
232 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
233 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
234 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
235 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
236 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
237 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
238 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
239 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
240 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
241 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
242 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
243 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
244 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
245 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
246 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
247 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
248 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
249 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
250 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
251 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
252 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
253 3004167301 Mesorhizobium loti 582 Isolate Unclassified
254 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
255 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
256 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
257 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
258 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
259 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
260 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
261 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
262 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
263 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
264 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
265 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
266 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
267 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
268 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
269 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
270 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
271 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
272 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
273 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
274 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
275 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
276 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
277 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
278 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
279 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
280 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
281 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
282 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
283 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
284 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
285 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
286 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
287 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
288 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
289 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
290 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
291 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
292 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
293 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
294 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
295 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
296 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
297 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
298 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
299 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
300 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
301 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
302 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
303 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
304 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
305 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
306 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
307 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
308 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
309 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
310 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
311 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
312 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
313 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
314 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
315 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
316 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
317 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
318 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
319 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
320 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
321 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
322 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
323 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
324 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
325 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
326 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
327 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
328 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
329 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
330 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
331 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
332 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
333 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
334 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
335 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
336 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
337 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
338 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
339 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
340 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
341 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
342 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
343 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
344 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
345 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
346 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
349 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
350 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
351 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
353 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
354 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
355 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
356 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
357 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
359 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
389 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
390 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
393 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
394 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
395 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
396 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
397 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
398 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
399 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
400 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
401 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
402 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
403 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
404 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
405 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
406 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
407 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
408 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
409 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
410 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
411 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
412 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
413 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
414 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
415 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
416 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
417 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
418 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
419 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
420 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
421 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
422 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
423 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
424 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
425 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
426 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
427 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
428 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
429 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
430 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
431 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
432 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
433 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
434 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
435 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
436 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
437 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
438 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
439 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
440 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
441 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
442 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
443 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
444 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
445 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
446 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
447 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
448 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
449 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
450 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
451 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
452 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
453 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
454 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
455 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
456 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
457 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
458 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
459 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
460 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
461 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
484 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
485 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
486 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
487 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
488 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
489 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
490 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
491 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
492 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
493 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
494 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
495 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
496 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
497 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
498 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
500 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
501 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
502 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
503 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
504 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
505 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
506 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
507 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
508 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
509 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
510 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
511 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
512 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
513 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
514 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
515 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
516 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
517 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
518 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
519 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
520 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
521 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
522 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
523 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
524 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
525 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
526 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
527 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
528 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
529 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
530 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
531 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
532 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
533 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
534 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
535 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
536 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
537 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
538 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
539 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
540 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
541 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
542 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
543 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
544 8005275841 Rhizobium sp. N4311 Isolate Nodule
545 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
546 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
547 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
548 8018176218 Rhizobium sp. N122 Isolate Nodule
549 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
550 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.78
Metatranscriptomes 0
Isolates 34.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 13.23
Nodule 27.06
Rhizoplane 5.1
Rhizosphere 45.02
Stem 0
Stem Tuber 0
Unclassified 9.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10018881 3300001989 Bacteria 2473
2 JGI24739J22299_10041069 3300001989 Bacteria 1541
3 JGI24735J21928_10017647 3300002067 Bacteria 2206
4 JGI25152J39213_1001161 3300002773 Bacteria 12171
5 JGI25152J39213_1003234 3300002773 Bacteria 5662
6 JGI25152J39213_1008147 3300002773 Bacteria 2628
7 JGI25152J39213_1008149 3300002773 Bacteria 2628
8 JGI25150J39212_1000160 3300002774 Bacteria 38064
9 JGI25159J45721_1002671 3300002987 Bacteria 6639
10 JGI25151J46595_10000083 3300003187 Bacteria 130658
11 JGI25151J46595_10054262 3300003187 Bacteria 1331
12 JGI25153J46596_10000965 3300003215 Bacteria 17426
13 JGI25153J46596_10005509 3300003215 Bacteria 6626
14 JGI25153J46596_10019173 3300003215 Bacteria 2628
15 JGI25153J46596_10019175 3300003215 Bacteria 2628
16 JGI25160J50197_1013793 3300003354 Bacteria 2736
17 JGI25161J50226_1000414 3300003374 Bacteria 20639
18 Ga0055542_1000709 3300003762 Bacteria 26239
19 Ga0055526_1001540 3300003771 Bacteria 16308
20 Ga0055524_1009863 3300003775 Bacteria 3845
21 Ga0055528_1022222 3300003790 Bacteria 1982
22 Ga0055540_1014360 3300003792 Bacteria 2360
23 Ga0055543_1000219 3300004625 Bacteria 45978
24 Ga0070658_10169662 3300005327 Bacteria 1833
25 Ga0070666_10504762 3300005335 Bacteria 877
26 Ga0070660_100217678 3300005339 Bacteria 1552
27 Ga0070689_100302016 3300005340 Bacteria 1333
28 Ga0070674_100136550 3300005356 Bacteria 1835
29 Ga0070673_100145380 3300005364 Bacteria 2004
30 Ga0070688_100189615 3300005365 Bacteria 1431
31 Ga0070688_100497805 3300005365 Bacteria 919
32 Ga0070688_100855855 3300005365 Bacteria 714
33 Ga0070667_101117083 3300005367 Bacteria 737
34 Ga0070711_100110767 3300005439 Bacteria 2015
35 Ga0070700_100306757 3300005441 Bacteria 1161
36 Ga0070708_101088606 3300005445 Bacteria 749
37 Ga0068867_100086622 3300005459 Bacteria 2370
38 Ga0070684_100916166 3300005535 Bacteria 821
39 Ga0070697_100918069 3300005536 Bacteria 777
40 Ga0068853_100077411 3300005539 Bacteria 2905
41 Ga0068853_100103070 3300005539 Bacteria 2525
42 Ga0070665_100105659 3300005548 Bacteria 2818
43 Ga0070665_100114636 3300005548 Bacteria 2698
44 Ga0070665_100182460 3300005548 Bacteria 2100
45 Ga0070665_100380116 3300005548 Bacteria 1419
46 Ga0070665_100808426 3300005548 Bacteria 950
47 Ga0070664_100474056 3300005564 Bacteria 1151
48 Ga0068857_100848818 3300005577 Bacteria 874
49 Ga0068854_100215787 3300005578 Bacteria 1516
50 Ga0068859_100017558 3300005617 Bacteria 7194
51 Ga0068866_10050358 3300005718 Bacteria 2115
52 Ga0068858_100035950 3300005842 Bacteria 4594
53 Ga0068858_100413743 3300005842 Bacteria 1296
54 Ga0081540_1008997 3300005983 Bacteria 6908
55 Ga0081539_10003985 3300005985 Bacteria 17045
56 Ga0081539_10021439 3300005985 Bacteria 4318
57 Ga0075365_10014999 3300006038 Bacteria 4675
58 Ga0075365_10027101 3300006038 Bacteria 3642
59 Ga0075365_10091312 3300006038 Bacteria 2075
60 Ga0075365_10193096 3300006038 Bacteria 1425
61 Ga0075365_10349904 3300006038 Bacteria 1042
62 Ga0075365_10352199 3300006038 Bacteria 1038
63 Ga0075368_10012900 3300006042 Bacteria 3061
64 Ga0075368_10014251 3300006042 Bacteria 2934
65 Ga0075363_100110039 3300006048 Bacteria 1531
66 Ga0075364_10000062 3300006051 Bacteria 40697
67 Ga0075364_10013107 3300006051 Bacteria 5087
68 Ga0075364_10211377 3300006051 Bacteria 1316
69 Ga0075362_10081134 3300006177 Bacteria 1495
70 Ga0075362_10215162 3300006177 Bacteria 938
71 Ga0075367_10080105 3300006178 Bacteria 1975
72 Ga0075367_10090395 3300006178 Bacteria 1862
73 Ga0075369_10021398 3300006186 Bacteria 2658
74 Ga0075369_10045442 3300006186 Bacteria 1889
75 Ga0097621_100313580 3300006237 Bacteria 1388
76 Ga0075370_10023686 3300006353 Bacteria 3384
77 Ga0075370_10137672 3300006353 Bacteria 1427
78 Ga0075370_10185657 3300006353 Bacteria 1224
79 Ga0075428_100137737 3300006844 Bacteria 2654
80 Ga0075428_100186959 3300006844 Bacteria 2241
81 Ga0075428_100349710 3300006844 Bacteria 1586
82 Ga0075430_100114035 3300006846 Bacteria 2252
83 Ga0075430_100275110 3300006846 Bacteria 1393
84 Ga0075431_100163193 3300006847 Bacteria 2290
85 Ga0075429_100119139 3300006880 Bacteria 2306
86 Ga0097620_100017559 3300006931 Bacteria 7194
87 Ga0105240_10129075 3300009093 Bacteria 3034
88 Ga0105240_10738840 3300009093 Bacteria 1071
89 Ga0111539_10031929 3300009094 Bacteria 6397
90 Ga0111539_10504970 3300009094 Bacteria 1408
91 Ga0105245_11128131 3300009098 Bacteria 831
92 Ga0105247_10003673 3300009101 Bacteria 9968
93 Ga0105243_10108387 3300009148 Bacteria 2318
94 Ga0105243_10287991 3300009148 Bacteria 1483
95 Ga0105241_10102121 3300009174 Bacteria 2281
96 Ga0105248_10099697 3300009177 Bacteria 3273
97 Ga0105237_10118005 3300009545 Bacteria 2647
98 Ga0105237_10122860 3300009545 Bacteria 2590
99 Ga0105237_10148857 3300009545 Bacteria 2337
100 Ga0105238_10001891 3300009551 Bacteria 21002
101 Ga0105238_10671985 3300009551 Bacteria 1047
102 Ga0105249_11033699 3300009553 Bacteria 891
103 Ga0105239_10038780 3300010375 Bacteria 5220
104 Ga0105239_10067789 3300010375 Bacteria 3920
105 Ga0105239_10269759 3300010375 Bacteria 1914
106 Ga0105239_10402337 3300010375 Bacteria 1549
107 Ga0105239_10415438 3300010375 Bacteria 1523
108 Ga0105246_10029897 3300011119 Bacteria 3593
109 Ga0105246_11104067 3300011119 Bacteria 724
110 Ga0157321_1007870 3300012487 Bacteria 761
111 Ga0157315_1002326 3300012508 Bacteria 1177
112 Ga0157370_10178323 3300013104 Bacteria 1975
113 Ga0157369_10134081 3300013105 Bacteria 2623
114 Ga0157369_10262250 3300013105 Bacteria 1802
115 Ga0157374_10370978 3300013296 Bacteria 1424
116 Ga0157374_10575989 3300013296 Bacteria 1135
117 Ga0157372_10696416 3300013307 Bacteria 1182
118 Ga0157375_10006048 3300013308 Bacteria 10553
119 Ga0157375_10789118 3300013308 Bacteria 1099
120 Ga0163163_10094507 3300014325 Bacteria 3008
121 Ga0182008_10060664 3300014497 Bacteria 1864
122 Ga0157379_10123932 3300014968 Bacteria 2325
123 Ga0157376_10035430 3300014969 Bacteria 4037
124 Ga0182006_1069305 3300015261 Bacteria 1312
125 Ga0182007_10029650 3300015262 Bacteria 1873
126 Ga0182005_1028972 3300015265 Bacteria 1510
127 Ga0209436_100020 3300025208 Bacteria 104602
128 Ga0207425_1000024 3300025245 Bacteria 328978
129 Ga0207425_1008008 3300025245 Bacteria 2739
130 Ga0209026_1000002 3300025250 Bacteria 1136158
131 Ga0209677_111155 3300025253 Bacteria 1426
132 Ga0209148_1000072 3300025254 Bacteria 325292
133 Ga0209148_1009801 3300025254 Bacteria 1846
134 Ga0209759_1000146 3300025256 Bacteria 121497
135 Ga0209129_1000184 3300025258 Bacteria 87102
136 Ga0209129_1006281 3300025258 Bacteria 3903
137 Ga0209129_1006407 3300025258 Bacteria 3811
138 Ga0209129_1009808 3300025258 Bacteria 2467
139 Ga0209233_1000027 3300025261 Bacteria 652089
140 Ga0209455_1000153 3300025272 Bacteria 124411
141 Ga0209673_1005268 3300025273 Bacteria 6568
142 Ga0209673_1005745 3300025273 Bacteria 6179
143 Ga0209130_1000004 3300025284 Bacteria 633436
144 Ga0209025_1000050 3300025294 Bacteria 331531
145 Ga0209025_1003187 3300025294 Bacteria 15914
146 Ga0209025_1042481 3300025294 Bacteria 1931
147 Ga0209564_1000362 3300025295 Bacteria 84376
148 Ga0209758_1000083 3300025297 Bacteria 257283
149 Ga0209758_1000540 3300025297 Bacteria 60103
150 Ga0209758_1000564 3300025297 Bacteria 58328
151 Ga0209758_1003996 3300025297 Bacteria 12765
152 Ga0209758_1005023 3300025297 Bacteria 10539
153 Ga0209256_1000383 3300025299 Bacteria 70773
154 Ga0209256_1006317 3300025299 Bacteria 6338
155 Ga0207426_1000003 3300025302 Bacteria 1063212
156 Ga0209051_1001845 3300025303 Bacteria 16708
157 Ga0209051_1004341 3300025303 Bacteria 8795
158 Ga0207642_10053532 3300025899 Bacteria 1836
159 Ga0207710_10026346 3300025900 Bacteria 2512
160 Ga0207710_10133801 3300025900 Bacteria 1192
161 Ga0207647_10013583 3300025904 Bacteria 5639
162 Ga0207647_10150832 3300025904 Bacteria 1359
163 Ga0207647_10238100 3300025904 Bacteria 1046
164 Ga0207645_10366041 3300025907 Bacteria 966
165 Ga0207705_10257032 3300025909 Bacteria 1333
166 Ga0207654_10283590 3300025911 Bacteria 1121
167 Ga0207695_10169295 3300025913 Bacteria 2111
168 Ga0207671_10074585 3300025914 Bacteria 2536
169 Ga0207671_10364726 3300025914 Bacteria 1147
170 Ga0207663_10113354 3300025916 Bacteria 1844
171 Ga0207663_10165687 3300025916 Bacteria 1565
172 Ga0207657_10172967 3300025919 Bacteria 1749
173 Ga0207649_10376537 3300025920 Bacteria 1057
174 Ga0207690_10450295 3300025932 Bacteria 1035
175 Ga0207690_10841420 3300025932 Unclassified 759
176 Ga0207670_10145945 3300025936 Bacteria 1750
177 Ga0207704_10083845 3300025938 Bacteria 2069
178 Ga0207711_10096136 3300025941 Bacteria 2614
179 Ga0207667_10354717 3300025949 Bacteria 1495
180 Ga0207651_10199005 3300025960 Bacteria 1604
181 Ga0207712_10817146 3300025961 Bacteria 820
182 Ga0207668_10429349 3300025972 Bacteria 1123
183 Ga0207658_10297764 3300025986 Bacteria 1389
184 Ga0207703_10113317 3300026035 Bacteria 2317
185 Ga0207703_10209918 3300026035 Bacteria 1735
186 Ga0207639_10062734 3300026041 Bacteria 2875
187 Ga0207639_10453860 3300026041 Bacteria 1164
188 Ga0207678_10033030 3300026067 Bacteria 4509
189 Ga0207708_10148393 3300026075 Bacteria 1844
190 Ga0207674_10023876 3300026116 Bacteria 6540
191 Ga0207674_10297808 3300026116 Bacteria 1562
192 Ga0207675_100062687 3300026118 Bacteria 3473
193 Ga0207675_100478715 3300026118 Bacteria 1237
194 Ga0207683_10243403 3300026121 Bacteria 1641
195 Ga0207698_10174110 3300026142 Bacteria 1898
196 Ga0207698_11115947 3300026142 Bacteria 802
197 Ga0209813_10004378 3300027866 Bacteria 3373
198 Ga0209813_10047150 3300027866 Bacteria 1333
199 Ga0207428_10023808 3300027907 Bacteria 5144
200 Ga0268266_10034806 3300028379 Bacteria 4285
201 Ga0268266_10057364 3300028379 Bacteria 3351
202 Ga0268266_10058320 3300028379 Bacteria 3324
203 Ga0268266_10156687 3300028379 Bacteria 2058
204 Ga0268266_10190330 3300028379 Bacteria 1873
205 Ga0268266_10312154 3300028379 Bacteria 1469
206 Ga0268266_10492430 3300028379 Bacteria 1170
207 Ga0268264_10194798 3300028381 Bacteria 1850
208 Ga0268264_11120963 3300028381 Bacteria 795
209 Ga0307408_100222905 3300031548 Bacteria 1540
210 Ga0307405_10002270 3300031731 Bacteria 8416
211 Ga0316577_10168792 3300031733 Bacteria 1234
212 Ga0316577_10243815 3300031733 Bacteria 1016
213 Ga0307412_10001552 3300031911 Bacteria 12679
214 Ga0307416_100263980 3300032002 Bacteria 1685
215 Ga0316585_10099936 3300032137 Bacteria 951
216 Ga0373960_0046026 3300035121 Bacteria 1279
217 Ga0316574_0089728 3300035398 Bacteria 1958
218 Ga0373931_0019173 3300035691 Bacteria 3411
219 Ga0316582_0029995 3300036647 Bacteria 3308
220 Ga0316582_0222899 3300036647 Bacteria 1289
221 Ga0316584_0383742 3300036712 Bacteria 1003
222 Ga0395899_0000130 3300037312 Bacteria 117976
223 Ga0395900_0000020 3300037418 Bacteria 353500
224 Ga0395900_0063098 3300037418 Bacteria 3809
225 Ga0395900_0189461 3300037418 Bacteria 2087
226 Ga0395900_0484345 3300037418 Bacteria 1189
227 Ga0395898_0000104 3300037466 Bacteria 223462
228 Ga0395898_0082399 3300037466 Bacteria 3101
229 Ga0395898_0593280 3300037466 Bacteria 1050
230 Ga0395905_0000019 3300037471 Bacteria 353500
231 Ga0395905_0013264 3300037471 Bacteria 7905
232 Ga0395905_0259547 3300037471 Bacteria 1622
233 Ga0395905_0291790 3300037471 Bacteria 1518
234 Ga0395905_0325403 3300037471 Bacteria 1427
235 Ga0395901_0000016 3300038443 Bacteria 354008
236 Ga0395901_0072706 3300038443 Bacteria 3585
237 Ga0395901_0197977 3300038443 Bacteria 2106
238 Ga0395901_0360121 3300038443 Bacteria 1500
239 Ga0395901_0550412 3300038443 Bacteria 1169
240 Ga0395901_0601542 3300038443 Bacteria 1109
241 Ga0395901_0631794 3300038443 Bacteria 1076
242 Ga0439465_0013562 3300041413 Bacteria 2539
243 Ga0451853_1125249 3300041512 Bacteria 1012
244 Ga0466972_0015679 3300044658 Bacteria 3789
245 Ga0466972_0050436 3300044658 Bacteria 2009
246 Ga0466960_0017406 3300044901 Bacteria 3133
247 Ga0495627_087496 3300046453 Bacteria 898
248 Ga0495592_0150150 3300046454 Bacteria 1612
249 Ga0495638_0063514 3300046460 Bacteria 2276
250 Ga0495638_0110086 3300046460 Bacteria 1637
251 Ga0495650_0165222 3300046471 Bacteria 786
252 Ga0495584_0055155 3300046491 Bacteria 2000
253 Ga0495596_0047199 3300046500 Bacteria 1690
254 Ga0495607_0024169 3300046501 Bacteria 3792
255 Ga0495583_0039963 3300046506 Bacteria 2206
256 Ga0495610_0046741 3300046512 Bacteria 2133
257 Ga0495610_0069620 3300046512 Bacteria 1646
258 Ga0495632_0121825 3300046519 Bacteria 1219
259 Ga0495643_0003338 3300046522 Bacteria 11827
260 Ga0495643_0020809 3300046522 Bacteria 3775
261 Ga0495643_0075461 3300046522 Bacteria 1764
262 Ga0495652_0514347 3300046529 Bacteria 828
263 Ga0495597_0010723 3300046542 Bacteria 4467
264 Ga0495597_0022344 3300046542 Bacteria 2935
265 Ga0495622_0081107 3300046557 Bacteria 1492
266 Ga0495656_0356199 3300046615 Bacteria 759
267 Ga0495668_0091293 3300046616 Bacteria 1669
268 Ga0495668_0173265 3300046616 Bacteria 1182
269 Ga0495625_0195480 3300046660 Bacteria 1338
270 Ga0495625_0221508 3300046660 Bacteria 1239
271 Ga0495625_0229691 3300046660 Bacteria 1212
272 Ga0495649_0027292 3300046694 Bacteria 3169
273 Ga0495600_0006725 3300046809 Bacteria 7009
274 Ga0495660_0033393 3300046810 Bacteria 2885
275 Ga0495604_0059509 3300047317 Bacteria 2927
276 Ga0495672_0154252 3300047320 Bacteria 1188
277 Ga0495683_0110752 3300047323 Bacteria 1311
278 Ga0495687_023368 3300047443 Bacteria 2953
279 Ga0495687_051359 3300047443 Bacteria 1750
280 Ga0495677_0178026 3300047445 Bacteria 824
281 Ga0495673_0057222 3300047469 Bacteria 1684
282 Ga0495686_0043882 3300047472 Bacteria 2832
283 Ga0495686_0242374 3300047472 Bacteria 1016
284 Ga0495602_0512096 3300048088 Bacteria 837
285 Ga0495626_0119284 3300048091 Bacteria 1136
286 Ga0496100_0042786 3300048903 Bacteria 2894
287 Ga0496101_0024156 3300048904 Bacteria 4204
288 Ga0496101_0121113 3300048904 Bacteria 1978
289 Ga0496101_0195603 3300048904 Bacteria 1562
290 Ga0496102_0012754 3300048905 Bacteria 7277
291 Ga0496102_0073490 3300048905 Bacteria 3142
292 Ga0496102_0078314 3300048905 Bacteria 3043
293 Ga0496102_0241989 3300048905 Bacteria 1701
294 Ga0496102_0286409 3300048905 Bacteria 1553
295 Ga0496102_0816474 3300048905 Bacteria 855
296 Ga0496103_0089799 3300048906 Bacteria 1938
297 Ga0496104_0003490 3300048907 Bacteria 13560
298 Ga0496104_0013865 3300048907 Bacteria 7271
299 Ga0496105_0008593 3300048908 Bacteria 7935
300 Ga0496105_0061772 3300048908 Bacteria 3092
301 Ga0496105_0773586 3300048908 Bacteria 732
302 Ga0496106_0004483 3300048909 Bacteria 10356
303 Ga0496106_0235767 3300048909 Bacteria 1461
304 Ga0496106_0264761 3300048909 Bacteria 1376
305 Ga0496106_0542304 3300048909 Bacteria 933
306 Ga0496107_0003137 3300048910 Bacteria 10993
307 Ga0496107_0153283 3300048910 Bacteria 1705
308 Ga0496108_0043855 3300048911 Bacteria 3736
309 Ga0496108_0167653 3300048911 Bacteria 1899
310 Ga0496109_0008718 3300048912 Bacteria 8635
311 Ga0496109_0029960 3300048912 Bacteria 4877
312 Ga0496109_0178176 3300048912 Bacteria 1996
313 Ga0496109_0293262 3300048912 Bacteria 1533
314 Ga0496110_0074846 3300048913 Bacteria 3008
315 Ga0496110_0786980 3300048913 Bacteria 855
316 Ga0496111_0125368 3300048914 Bacteria 1898
317 Ga0496111_0416213 3300048914 Bacteria 993
318 Ga0496112_0014397 3300048915 Bacteria 7335
319 Ga0496112_0055798 3300048915 Bacteria 3886
320 Ga0496112_0426904 3300048915 Bacteria 1264
321 Ga0496113_0022191 3300048916 Bacteria 4486
322 Ga0496113_0510636 3300048916 Bacteria 965
323 Ga0496114_0003619 3300048917 Bacteria 11881
324 Ga0496114_0019558 3300048917 Bacteria 5487
325 Ga0496115_0006559 3300048918 Bacteria 8532
326 Ga0496115_0041346 3300048918 Bacteria 3668
327 Ga0496115_0136319 3300048918 Bacteria 2024
328 Ga0496116_0001253 3300048919 Bacteria 29488
329 Ga0496116_0005379 3300048919 Bacteria 11916
330 Ga0496116_0026038 3300048919 Bacteria 4286
331 Ga0496116_0134978 3300048919 Bacteria 1399
332 Ga0496116_0144724 3300048919 Bacteria 1330
333 Ga0496117_0006763 3300048920 Bacteria 11452
334 Ga0496117_0119188 3300048920 Bacteria 1625
335 Ga0496118_0009778 3300048921 Bacteria 9615
336 Ga0496118_0135320 3300048921 Bacteria 1574
337 Ga0496118_0140714 3300048921 Bacteria 1530
338 Ga0496119_0026981 3300048922 Bacteria 3965
339 Ga0496119_0178653 3300048922 Bacteria 1115
340 Ga0496120_0001570 3300048923 Bacteria 26727
341 Ga0496121_0018899 3300048924 Bacteria 6917
342 Ga0496121_0040712 3300048924 Bacteria 4071
343 Ga0496122_0011480 3300048925 Bacteria 8962
344 Ga0496122_0022378 3300048925 Bacteria 5620
345 Ga0496122_0032443 3300048925 Bacteria 4318
346 Ga0496122_0048321 3300048925 Bacteria 3274
347 Ga0496122_0088520 3300048925 Bacteria 2121
348 Ga0496122_0164325 3300048925 Bacteria 1348
349 Ga0496123_0020989 3300048926 Bacteria 5090
350 Ga0496123_0058781 3300048926 Bacteria 2491
351 Ga0496123_0113413 3300048926 Bacteria 1543
352 Ga0496123_0131238 3300048926 Bacteria 1387
353 Ga0496124_0003917 3300048927 Bacteria 17784
354 Ga0496124_0004950 3300048927 Bacteria 15269
355 Ga0496124_0084022 3300048927 Bacteria 2611
356 Ga0496124_0193123 3300048927 Bacteria 1556
357 Ga0496125_0008039 3300048928 Bacteria 11135
358 Ga0496125_0032793 3300048928 Bacteria 4608
359 Ga0496126_0000824 3300048929 Bacteria 55178
360 Ga0496126_0049161 3300048929 Bacteria 3851
361 Ga0496126_0150033 3300048929 Bacteria 1999
362 Ga0496126_0247957 3300048929 Bacteria 1485
363 Ga0496126_0506216 3300048929 Bacteria 964
364 Ga0501031_0000561 3300049568 Bacteria 21728
365 Ga0501031_0046582 3300049568 Bacteria 2827
366 Ga0501031_0125145 3300049568 Bacteria 1679
367 Ga0501032_0000022 3300049569 Bacteria 146790
368 Ga0501032_0000786 3300049569 Bacteria 25679
369 Ga0501032_0026619 3300049569 Bacteria 3975
370 Ga0501032_0044629 3300049569 Bacteria 3000
371 Ga0501033_0000037 3300049570 Bacteria 146582
372 Ga0501033_0000197 3300049570 Bacteria 57691
373 Ga0501033_0020370 3300049570 Bacteria 5009
374 Ga0501033_0342938 3300049570 Bacteria 1047
375 Ga0501033_0439683 3300049570 Bacteria 907
376 Ga0501033_0614192 3300049570 Bacteria 745
377 Ga0501034_0000901 3300049571 Bacteria 43252
378 Ga0501034_0000960 3300049571 Bacteria 41575
379 Ga0501034_0006623 3300049571 Bacteria 12429
380 Ga0501034_0045975 3300049571 Bacteria 4410
381 Ga0501034_0087179 3300049571 Bacteria 3121
382 Ga0501034_0710203 3300049571 Bacteria 903
383 Ga0501034_0904398 3300049571 Unclassified 770
384 Ga0501036_0001200 3300049572 Bacteria 19770
385 Ga0501036_0018522 3300049572 Bacteria 5835
386 Ga0501036_0032407 3300049572 Bacteria 4415
387 Ga0501036_0040737 3300049572 Bacteria 3929
388 Ga0501036_0307900 3300049572 Bacteria 1325
389 Ga0501037_0000016 3300049573 Bacteria 161027
390 Ga0501037_0000067 3300049573 Bacteria 96388
391 Ga0501037_0100302 3300049573 Bacteria 2090
392 Ga0501038_0000013 3300049574 Bacteria 167219
393 Ga0501038_0000015 3300049574 Bacteria 161983
394 Ga0501038_0082955 3300049574 Bacteria 2698
395 Ga0501039_0000010 3300049575 Bacteria 247832
396 Ga0501039_0000013 3300049575 Bacteria 234418
397 Ga0501039_0098384 3300049575 Bacteria 2282
398 Ga0501039_0223390 3300049575 Bacteria 1480
399 Ga0501039_0238480 3300049575 Bacteria 1430
400 Ga0501039_0619956 3300049575 Bacteria 847
401 Ga0501039_0783997 3300049575 Bacteria 744
402 Ga0501040_0028998 3300049576 Bacteria 3734
403 Ga0501040_0043688 3300049576 Bacteria 3055
404 Ga0501040_0066538 3300049576 Bacteria 2483
405 Ga0501040_0072292 3300049576 Bacteria 2382
406 Ga0501040_0624934 3300049576 Bacteria 778
407 Ga0501041_0361667 3300049577 Bacteria 917
408 Ga0501042_0060858 3300049578 Bacteria 2697
409 Ga0501042_0132816 3300049578 Bacteria 1794
410 Ga0501042_0583877 3300049578 Bacteria 812
411 Ga0501043_0000056 3300049579 Bacteria 104302
412 Ga0501043_0001689 3300049579 Bacteria 19157
413 Ga0501043_0293523 3300049579 Bacteria 1244
414 Ga0501043_0687824 3300049579 Bacteria 748
415 Ga0501046_0000029 3300049580 Bacteria 194168
416 Ga0501046_0063035 3300049580 Bacteria 2895
417 Ga0501046_0216363 3300049580 Bacteria 1420
418 Ga0501046_0664101 3300049580 Unclassified 736
419 Ga0501047_0039969 3300049581 Bacteria 4536
420 Ga0501047_0076770 3300049581 Bacteria 3215
421 Ga0501047_0101519 3300049581 Bacteria 2756
422 Ga0501047_0114089 3300049581 Bacteria 2584
423 Ga0501047_0851872 3300049581 Unclassified 725
424 Ga0501048_0067827 3300049582 Bacteria 2521
425 Ga0501048_0109138 3300049582 Bacteria 1954
426 Ga0501048_0153872 3300049582 Bacteria 1626
427 Ga0501067_0114155 3300049583 Bacteria 1502
428 Ga0501067_0418675 3300049583 Unclassified 747
429 Ga0501068_0006137 3300049584 Bacteria 6608
430 Ga0501069_0137818 3300049585 Unclassified 1399
431 Ga0501070_0036389 3300049586 Bacteria 4110
432 Ga0501070_0068371 3300049586 Bacteria 2940
433 Ga0501070_0071851 3300049586 Bacteria 2865
434 Ga0501070_0142969 3300049586 Bacteria 1975
435 Ga0501070_0621505 3300049586 Bacteria 860
436 Ga0501071_0057893 3300049587 Bacteria 2801
437 Ga0501071_0098627 3300049587 Bacteria 2152
438 Ga0501071_0133286 3300049587 Bacteria 1847
439 Ga0501071_0720243 3300049587 Bacteria 768
440 Ga0501072_0052680 3300049588 Bacteria 3204
441 Ga0501072_0087455 3300049588 Bacteria 2473
442 Ga0501072_0104530 3300049588 Bacteria 2252
443 Ga0501073_0001144 3300049589 Bacteria 19318
444 Ga0501073_0034560 3300049589 Bacteria 3597
445 Ga0501073_0076946 3300049589 Bacteria 2322
446 Ga0501073_0594910 3300049589 Bacteria 764
447 Ga0501074_0092177 3300049590 Bacteria 2170
448 Ga0501074_0117551 3300049590 Bacteria 1902
449 Ga0501074_0144933 3300049590 Bacteria 1698
450 Ga0501074_0554233 3300049590 Bacteria 814
451 Ga0501074_0609984 3300049590 Bacteria 772
452 Ga0501075_0085894 3300049591 Bacteria 2384
453 Ga0501075_0100523 3300049591 Bacteria 2196
454 Ga0501075_0900786 3300049591 Bacteria 673
455 Ga0501076_0070720 3300049592 Bacteria 2790
456 Ga0501076_0317841 3300049592 Bacteria 1277
457 Ga0501077_0017557 3300049593 Bacteria 4519
458 Ga0501077_0120409 3300049593 Bacteria 1663
459 Ga0501077_0222177 3300049593 Bacteria 1201
460 Ga0501079_0048036 3300049741 Bacteria 3293
461 Ga0501079_0936123 3300049741 Bacteria 682
462 Ga0501080_0046328 3300049742 Bacteria 4048
463 Ga0501080_0768021 3300049742 Bacteria 847
464 Ga0501080_1068324 3300049742 Bacteria 698
465 Ga0501081_0038161 3300049743 Bacteria 3280
466 Ga0501081_0427394 3300049743 Bacteria 982
467 Ga0501081_0759228 3300049743 Bacteria 729
468 Ga0501083_0041591 3300049744 Bacteria 3116
469 Ga0501083_0078681 3300049744 Bacteria 2187
470 Ga0501035_0000046 3300049822 Bacteria 146599
471 Ga0501035_0000063 3300049822 Bacteria 131515
472 Ga0501035_0016341 3300049822 Bacteria 6845
473 Ga0501035_0054393 3300049822 Bacteria 3577
474 Ga0501035_0117867 3300049822 Bacteria 2323
475 Ga0501035_0218563 3300049822 Bacteria 1628
476 Ga0501035_0912729 3300049822 Bacteria 695
477 Ga0501044_0000038 3300049823 Bacteria 161027
478 Ga0501044_0008677 3300049823 Bacteria 11126
479 Ga0501044_0152236 3300049823 Bacteria 2295
480 Ga0501044_0155184 3300049823 Bacteria 2269
481 Ga0501044_0194859 3300049823 Bacteria 1987
482 Ga0501044_0488664 3300049823 Bacteria 1133
483 Ga0501045_0114464 3300049824 Bacteria 2000
484 Ga0501045_0132995 3300049824 Bacteria 1849
485 Ga0501045_0320467 3300049824 Bacteria 1153
486 nmdc:mga03683_65469_c1 3300050489 Bacteria 1543
487 nmdc:mga03683_78309_c1 3300050489 Bacteria 1423
488 nmdc:mga03n38_49826_c1 3300050490 Bacteria 1864
489 nmdc:mga00v17_15298_c1 3300050491 Bacteria 4305
490 nmdc:mga00v17_24846_c1 3300050491 Bacteria 3478
491 nmdc:mga00v17_548532_c1 3300050491 Bacteria 747
492 nmdc:mga0yw44_107498_c1 3300050492 Bacteria 1784
493 nmdc:mga0yw44_393848_c1 3300050492 Bacteria 936
494 nmdc:mga0yw44_539577_c1 3300050492 Bacteria 792
495 nmdc:mga0yw44_70272_c1 3300050492 Bacteria 2171
496 nmdc:mga0yw44_7495_c1 3300050492 Bacteria 5374
497 nmdc:mga06z11_14332_c1 3300050494 Bacteria 3509
498 nmdc:mga06z11_36544_c1 3300050494 Bacteria 2425
499 nmdc:mga06z11_37380_c1 3300050494 Bacteria 2404
500 nmdc:mga06z11_953_c1 3300050494 Bacteria 10536
501 nmdc:mga04h51_3158_c1 3300050495 Bacteria 3976
502 nmdc:mga04h51_49544_c1 3300050495 Bacteria 1404
503 nmdc:mga07m45_90489_c1 3300050496 Bacteria 1753
504 nmdc:mga05p37_318228_c1 3300050507 Bacteria 1842
505 nmdc:mga05p37_645475_c1 3300050507 Bacteria 1186
506 nmdc:mga09592_110807_c1 3300050508 Bacteria 2355
507 nmdc:mga09592_38371_c1 3300050508 Bacteria 4021
508 nmdc:mga0qj67_108903_c1 3300050509 Bacteria 2236
509 nmdc:mga0qj67_165435_c1 3300050509 Bacteria 1796
510 nmdc:mga06r32_105020_c1 3300050510 Bacteria 2775
511 nmdc:mga06r32_400751_c2 3300050510 Bacteria 938
512 nmdc:mga06r32_548924_c1 3300050510 Bacteria 1130
513 nmdc:mga0a205_530248_c1 3300050515 Bacteria 1033
514 nmdc:mga0sz30_19195_c2 3300050516 Bacteria 2200
515 nmdc:mga0sz30_220647_c1 3300050516 Bacteria 843
516 Ga0500610_0198005 3300053079 Bacteria 970
517 Ga0500578_0015228 3300053086 Bacteria 4942
518 Ga0500643_036920 3300053087 Bacteria 1458
519 Ga0500651_0177387 3300053093 Bacteria 1267
520 Ga0500562_048723 3300053108 Bacteria 1132
521 Ga0500594_0125362 3300053118 Bacteria 809
522 Ga0500595_026555 3300053119 Bacteria 1994
523 Ga0500607_106366 3300053121 Bacteria 1384
524 Ga0500658_0003930 3300053134 Bacteria 5583
525 Ga0500658_0190284 3300053134 Bacteria 936
526 Ga0500568_0000140 3300053139 Bacteria 65109
527 Ga0500590_004361 3300053148 Bacteria 6670
528 Ga0500604_0144891 3300053151 Bacteria 804
529 Ga0500622_0000275 3300053156 Bacteria 52724
530 Ga0500627_0102756 3300053158 Bacteria 1283
531 Ga0500627_0186305 3300053158 Bacteria 933
532 Ga0500636_0059334 3300053177 Bacteria 2236
533 Ga0501084_0227769 3300054114 Bacteria 1573
534 Ga0501084_0396353 3300054114 Bacteria 1166
535 Ga0501084_0531818 3300054114 Bacteria 994
536 Ga0501082_0049338 3300060353 Bacteria 3630
537 Ga0501082_0093043 3300060353 Bacteria 2604
538 Ga0501082_0104451 3300060353 Bacteria 2451
539 Ga0501082_0274087 3300060353 Bacteria 1469
540 Ga0501082_0652129 3300060353 Unclassified 921
541 Ga0530510_0016551 3300061734 Bacteria 5221
542 Ga0530510_0038121 3300061734 Bacteria 3469

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8004312739 8004318636 184
2 3300025986 Ga0207658_10297764 Ga0207658_102977642 188
3 3300046460 Ga0495638_0063514 Ga0495638_0063514_371_1012 192
4 3300006844 Ga0075428_100137737 Ga0075428_1001377373 196
5 3300009098 Ga0105245_11128131 Ga0105245_111281311 196
6 3300014325 Ga0163163_10094507 Ga0163163_100945072 196
7 3300014968 Ga0157379_10123932 Ga0157379_101239323 196
8 3300027907 Ga0207428_10023808 Ga0207428_100238085 196
9 3300048905 Ga0496102_0073490 Ga0496102_0073490_1648_2238 196
10 3300048907 Ga0496104_0003490 Ga0496104_0003490_7779_8369 196
11 3300048908 Ga0496105_0061772 Ga0496105_0061772_1941_2531 196
12 3300048909 Ga0496106_0235767 Ga0496106_0235767_801_1391 196
13 3300048911 Ga0496108_0167653 Ga0496108_0167653_251_841 196
14 3300048912 Ga0496109_0029960 Ga0496109_0029960_3868_4458 196
15 3300048913 Ga0496110_0074846 Ga0496110_0074846_22_612 196
16 3300048914 Ga0496111_0125368 Ga0496111_0125368_296_886 196
17 3300048915 Ga0496112_0426904 Ga0496112_0426904_502_1092 196
18 3300048917 Ga0496114_0019558 Ga0496114_0019558_939_1529 196
19 3300048918 Ga0496115_0006559 Ga0496115_0006559_6809_7399 196
20 3300005365 Ga0070688_100189615 Ga0070688_1001896152 197
21 3300005842 Ga0068858_100413743 Ga0068858_1004137432 197
22 3300009094 Ga0111539_10031929 Ga0111539_100319297 197
23 3300049575 Ga0501039_0098384 Ga0501039_0098384_21_614 197
24 3300049579 Ga0501043_0687824 Ga0501043_0687824_134_727 197
25 3300049590 Ga0501074_0609984 Ga0501074_0609984_30_623 197
26 3300049741 Ga0501079_0936123 Ga0501079_0936123_73_666 197
27 3300049822 Ga0501035_0117867 Ga0501035_0117867_1281_1940 198
28 3300049823 Ga0501044_0488664 Ga0501044_0488664_274_903 198
29 iso_pu_bacteria 2512875024 2512958472 199
30 iso_pu_bacteria 2513237164 2514038437 199
31 iso_pu_bacteria 2894652903 2894656208 199
32 3300005367 Ga0070667_101117083 Ga0070667_1011170831 200
33 3300049580 Ga0501046_0664101 Ga0501046_0664101_14_616 200
34 3300005365 Ga0070688_100855855 Ga0070688_1008558551 201
35 3300005535 Ga0070684_100916166 Ga0070684_1009161661 201
36 3300010375 Ga0105239_10269759 Ga0105239_102697593 201
37 3300031733 Ga0316577_10168792 Ga0316577_101687922 201
38 3300031733 Ga0316577_10243815 Ga0316577_102438151 201
39 3300032137 Ga0316585_10099936 Ga0316585_100999362 201
40 3300035398 Ga0316574_0089728 Ga0316574_0089728_1319_1930 201
41 3300036647 Ga0316582_0029995 Ga0316582_0029995_2399_3010 201
42 3300036647 Ga0316582_0222899 Ga0316582_0222899_440_1051 201
43 3300036712 Ga0316584_0383742 Ga0316584_0383742_29_640 201
44 3300048905 Ga0496102_0286409 Ga0496102_0286409_366_977 201
45 3300049571 Ga0501034_0710203 Ga0501034_0710203_19_657 201
46 3300049571 Ga0501034_0904398 Ga0501034_0904398_31_669 201
47 3300049581 Ga0501047_0101519 Ga0501047_0101519_212_850 201
48 3300049581 Ga0501047_0851872 Ga0501047_0851872_10_684 201
49 3300049583 Ga0501067_0418675 Ga0501067_0418675_49_723 201
50 3300049585 Ga0501069_0137818 Ga0501069_0137818_526_1200 201
51 3300049586 Ga0501070_0142969 Ga0501070_0142969_436_1074 201
52 3300049586 Ga0501070_0621505 Ga0501070_0621505_48_722 201
53 3300049590 Ga0501074_0554233 Ga0501074_0554233_87_725 201
54 3300049742 Ga0501080_1068324 Ga0501080_1068324_43_681 201
55 3300049744 Ga0501083_0041591 Ga0501083_0041591_2297_2935 201
56 3300049822 Ga0501035_0218563 Ga0501035_0218563_114_752 201
57 3300049823 Ga0501044_0152236 Ga0501044_0152236_1188_1862 201
58 3300053139 Ga0500568_0000140 Ga0500568_0000140_61944_62573 201
59 3300054114 Ga0501084_0396353 Ga0501084_0396353_427_1065 201
60 3300060353 Ga0501082_0652129 Ga0501082_0652129_73_747 201
61 iso_pu_bacteria 2503198000 2503202495 201
62 iso_pu_bacteria 2508501127 2509140405 201
63 iso_pu_bacteria 2513237351 2514589820 201
64 iso_pu_bacteria 2588253730 2588516389 201
65 iso_pu_bacteria 2597489875 2597813882 201
66 iso_pu_bacteria 2643221550 2643773643 201
67 iso_pu_bacteria 2643221551 2643775323 201
68 iso_pu_bacteria 2643221555 2643793769 201
69 iso_pu_bacteria 2643221564 2643837391 201
70 iso_pu_bacteria 2643221623 2644132272 201
71 iso_pu_bacteria 2693429783 2694632085 201
72 iso_pu_bacteria 2693429784 2694634508 201
73 iso_pu_bacteria 2738543024 2739308091 201
74 iso_pu_bacteria 2841734538 2841740218 201
75 iso_pu_bacteria 2844009547 2844014549 201
76 iso_pu_bacteria 2847670302 2847670738 201
77 iso_pu_bacteria 2847686936 2847693078 201
78 iso_pu_bacteria 2856314179 2856316194 201
79 iso_pu_bacteria 2856320880 2856326028 201
80 iso_pu_bacteria 2856328259 2856329233 201
81 iso_pu_bacteria 2856334872 2856335524 201
82 iso_pu_bacteria 2856342000 2856346244 201
83 iso_pu_bacteria 2856356410 2856360232 201
84 iso_pu_bacteria 2857349434 2857355761 201
85 iso_pu_bacteria 2857367948 2857374865 201
86 iso_pu_bacteria 2869162929 2869165459 201
87 iso_pu_bacteria 2869242130 2869246593 201
88 iso_pu_bacteria 2869249662 2869250097 201
89 iso_pu_bacteria 2869256925 2869262607 201
90 iso_pu_bacteria 2869264136 2869270996 201
91 iso_pu_bacteria 2869278585 2869278769 201
92 iso_pu_bacteria 2871435913 2871442242 201
93 iso_pu_bacteria 2871444079 2871448484 201
94 iso_pu_bacteria 2871459585 2871463708 201
95 iso_pu_bacteria 2871474448 2871475565 201
96 iso_pu_bacteria 2871488783 2871495179 201
97 iso_pu_bacteria 2871495908 2871500621 201
98 iso_pu_bacteria 2874109183 2874113843 201
99 iso_pu_bacteria 2874116593 2874123043 201
100 iso_pu_bacteria 2874123672 2874125863 201
101 iso_pu_bacteria 2874131515 2874137609 201
102 iso_pu_bacteria 2874139085 2874145353 201
103 iso_pu_bacteria 2874162495 2874165803 201
104 iso_pu_bacteria 2876363079 2876367926 201
105 iso_pu_bacteria 2876369609 2876371819 201
106 iso_pu_bacteria 2876386047 2876392379 201
107 iso_pu_bacteria 2876399893 2876403187 201
108 iso_pu_bacteria 2876406927 2876411947 201
109 iso_pu_bacteria 2876420981 2876425279 201
110 iso_pu_bacteria 2878035449 2878041518 201
111 iso_pu_bacteria 2878730984 2878738585 201
112 iso_pu_bacteria 2878738818 2878743678 201
113 iso_pu_bacteria 2878753008 2878758155 201
114 iso_pu_bacteria 2878760144 2878764710 201
115 iso_pu_bacteria 2878767105 2878771811 201
116 iso_pu_bacteria 2878774303 2878774689 201
117 iso_pu_bacteria 2878781027 2878785802 201
118 iso_pu_bacteria 2878788777 2878796768 201
119 iso_pu_bacteria 2881147464 2881152723 201
120 iso_pu_bacteria 2881845957 2881852947 201
121 iso_pu_bacteria 2881861095 2881867226 201
122 iso_pu_bacteria 2882912400 2882917636 201
123 iso_pu_bacteria 2885312484 2885317273 201
124 iso_pu_bacteria 2885318864 2885322040 201
125 iso_pu_bacteria 2885342637 2885347882 201
126 iso_pu_bacteria 2885350715 2885353191 201
127 iso_pu_bacteria 2888337043 2888340452 201
128 iso_pu_bacteria 2888343758 2888347685 201
129 iso_pu_bacteria 2888350351 2888356731 201
130 iso_pu_bacteria 2889010040 2889011778 201
131 iso_pu_bacteria 2889016732 2889023287 201
132 iso_pu_bacteria 2903448605 2903449689 201
133 iso_pu_bacteria 2903492973 2903496113 201
134 iso_pu_bacteria 2903513507 2903519790 201
135 iso_pu_bacteria 2903521522 2903526922 201
136 iso_pu_bacteria 2903528002 2903533149 201
137 iso_pu_bacteria 2903540706 2903545434 201
138 iso_pu_bacteria 2906328253 2906328541 201
139 iso_pu_bacteria 2906354277 2906357605 201
140 iso_pu_bacteria 2906363423 2906365295 201
141 iso_pu_bacteria 2906386501 2906387352 201
142 iso_pu_bacteria 2906393657 2906401097 201
143 iso_pu_bacteria 2906401398 2906406968 201
144 iso_pu_bacteria 2906408224 2906412782 201
145 iso_pu_bacteria 2906414383 2906416331 201
146 iso_pu_bacteria 2906427513 2906435703 201
147 iso_pu_bacteria 2922130491 2922138708 201
148 iso_pu_bacteria 2922151315 2922155434 201
149 iso_pu_bacteria 2922158528 2922159466 201
150 iso_pu_bacteria 2922172374 2922174179 201
151 iso_pu_bacteria 2922185730 2922189978 201
152 iso_pu_bacteria 2924710171 2924710916 201
153 iso_pu_bacteria 2924718760 2924719697 201
154 iso_pu_bacteria 2924733363 2924739621 201
155 iso_pu_bacteria 2924741084 2924747251 201
156 iso_pu_bacteria 2924762789 2924768845 201
157 iso_pu_bacteria 2924776078 2924781491 201
158 iso_pu_bacteria 2924784321 2924785895 201
159 iso_pu_bacteria 2937822353 2937827141 201
160 iso_pu_bacteria 2937836603 2937837653 201
161 iso_pu_bacteria 2937848649 2937853784 201
162 iso_pu_bacteria 2958064165 2958067120 201
163 iso_pu_bacteria 2958100919 2958105511 201
164 iso_pu_bacteria 2958115193 2958122670 201
165 iso_pu_bacteria 2958172287 2958175191 201
166 iso_pu_bacteria 2961170736 2961174786 201
167 iso_pu_bacteria 2965119406 2965126973 201
168 iso_pu_bacteria 2967996073 2968000721 201
169 iso_pu_bacteria 2968003550 2968009907 201
170 iso_pu_bacteria 2968097103 2968099384 201
171 iso_pu_bacteria 2968117919 2968122978 201
172 iso_pu_bacteria 2970489779 2970489926 201
173 iso_pu_bacteria 2970503327 2970507372 201
174 iso_pu_bacteria 2970510686 2970516487 201
175 iso_pu_bacteria 2970524798 2970530190 201
176 iso_pu_bacteria 2970540015 2970545815 201
177 iso_pu_bacteria 2977821940 2977828771 201
178 iso_pu_bacteria 2977828996 2977834087 201
179 iso_pu_bacteria 2977922695 2977929057 201
180 iso_pu_bacteria 2977942078 2977944418 201
181 iso_pu_bacteria 2977971508 2977975273 201
182 iso_pu_bacteria 2977986579 2977990343 201
183 iso_pu_bacteria 2979710463 2979716038 201
184 iso_pu_bacteria 2979742915 2979744469 201
185 iso_pu_bacteria 2979779861 2979786124 201
186 iso_pu_bacteria 2979808191 2979812568 201
187 iso_pu_bacteria 2987636660 2987640895 201
188 iso_pu_bacteria 2987652177 2987656360 201
189 iso_pu_bacteria 2987666974 2987670523 201
190 iso_pu_bacteria 2996310559 2996310664 201
191 iso_pu_bacteria 2996336353 2996337959 201
192 iso_pu_bacteria 2996386984 2996392724 201
193 iso_pu_bacteria 3004211236 3004212595 201
194 iso_pu_bacteria 3004218560 3004221659 201
195 iso_pu_bacteria 3004232784 3004235820 201
196 iso_pu_bacteria 3004268573 3004275333 201
197 iso_pu_bacteria 8002285264 8002286302 201
198 iso_pu_bacteria 8004374579 8004379667 201
199 iso_pu_bacteria 8004395343 8004395512 201
200 iso_pu_bacteria 8004633249 8004635948 201
201 iso_pu_bacteria 8004703790 8004714606 201
202 iso_pu_bacteria 8055617313 8055621758 201
203 3300025299 Ga0209256_1000383 Ga0209256_100038371 202
204 3300046471 Ga0495650_0165222 Ga0495650_0165222_13_630 202
205 3300046500 Ga0495596_0047199 Ga0495596_0047199_973_1605 202
206 3300046501 Ga0495607_0024169 Ga0495607_0024169_1945_2577 202
207 3300046512 Ga0495610_0046741 Ga0495610_0046741_722_1354 202
208 3300046522 Ga0495643_0003338 Ga0495643_0003338_2281_2913 202
209 3300046542 Ga0495597_0010723 Ga0495597_0010723_3145_3777 202
210 3300046660 Ga0495625_0221508 Ga0495625_0221508_588_1220 202
211 3300046694 Ga0495649_0027292 Ga0495649_0027292_1949_2581 202
212 3300046810 Ga0495660_0033393 Ga0495660_0033393_282_914 202
213 3300047443 Ga0495687_051359 Ga0495687_051359_849_1481 202
214 3300048929 Ga0496126_0000824 Ga0496126_0000824_20208_20849 202
215 3300049580 Ga0501046_0000029 Ga0501046_0000029_72969_73607 202
216 3300049593 Ga0501077_0222177 Ga0501077_0222177_42_713 202
217 3300053086 Ga0500578_0015228 Ga0500578_0015228_43_675 202
218 3300053118 Ga0500594_0125362 Ga0500594_0125362_16_648 202
219 3300053134 Ga0500658_0003930 Ga0500658_0003930_684_1316 202
220 iso_pu_bacteria 2510917030 2511195410 202
221 iso_pu_bacteria 2513237144 2513912483 202
222 iso_pu_bacteria 2515154134 2515740338 202
223 iso_pu_bacteria 2582581298 2585224486 202
224 iso_pu_bacteria 2582581299 2585229931 202
225 iso_pu_bacteria 2585427529 2585546607 202
226 iso_pu_bacteria 2585427594 2585846789 202
227 iso_pu_bacteria 2643221568 2643857786 202
228 iso_pu_bacteria 2718217927 2719385894 202
229 iso_pu_bacteria 2718218423 2721399673 202
230 iso_pu_bacteria 2721755809 2724038486 202
231 iso_pu_bacteria 2791355266 2793361059 202
232 iso_pu_bacteria 2838022645 2838026311 202
233 iso_pu_bacteria 2842163707 2842167955 202
234 iso_pu_bacteria 2842198810 2842201756 202
235 iso_pu_bacteria 2842304105 2842304414 202
236 iso_pu_bacteria 2842395702 2842398792 202
237 iso_pu_bacteria 2854896431 2854899131 202
238 iso_pu_bacteria 2874168670 2874172735 202
239 iso_pu_bacteria 2899792073 2899795107 202
240 iso_pu_bacteria 2919100787 2919106771 202
241 iso_pu_bacteria 2933570622 2933571688 202
242 iso_pu_bacteria 2935901341 2935905564 202
243 iso_pu_bacteria 2984587000 2984589746 202
244 iso_pu_bacteria 8005275841 8005280675 202
245 iso_pu_bacteria 8005289223 8005293198 202
246 iso_pu_bacteria 8005307578 8005309843 202
247 iso_pu_bacteria 8005695170 8005699901 202
248 iso_pu_bacteria 8018176218 8018179728 202
249 3300002773 JGI25152J39213_1001161 JGI25152J39213_10011611 203
250 3300002774 JGI25150J39212_1000160 JGI25150J39212_100016027 203
251 3300003187 JGI25151J46595_10000083 JGI25151J46595_10000083118 203
252 3300003215 JGI25153J46596_10000965 JGI25153J46596_1000096514 203
253 3300003762 Ga0055542_1000709 Ga0055542_100070926 203
254 3300005335 Ga0070666_10504762 Ga0070666_105047621 203
255 3300025245 Ga0207425_1000024 Ga0207425_1000024132 203
256 3300025258 Ga0209129_1000184 Ga0209129_100018420 203
257 3300025273 Ga0209673_1005268 Ga0209673_10052686 203
258 3300025294 Ga0209025_1000050 Ga0209025_1000050195 203
259 3300025297 Ga0209758_1000083 Ga0209758_100008362 203
260 3300025904 Ga0207647_10238100 Ga0207647_102381001 203
261 3300025932 Ga0207690_10841420 Ga0207690_108414201 203
262 3300026067 Ga0207678_10033030 Ga0207678_100330304 203
263 3300026116 Ga0207674_10297808 Ga0207674_102978081 203
264 3300031731 Ga0307405_10002270 Ga0307405_100022707 203
265 3300031911 Ga0307412_10001552 Ga0307412_100015521 203
266 3300046522 Ga0495643_0020809 Ga0495643_0020809_1429_2058 203
267 3300047469 Ga0495673_0057222 Ga0495673_0057222_182_811 203
268 3300048904 Ga0496101_0121113 Ga0496101_0121113_1281_1916 203
269 3300048912 Ga0496109_0178176 Ga0496109_0178176_778_1440 203
270 3300048915 Ga0496112_0055798 Ga0496112_0055798_1328_1939 203
271 3300048916 Ga0496113_0510636 Ga0496113_0510636_31_642 203
272 3300048919 Ga0496116_0001253 Ga0496116_0001253_11340_11975 203
273 3300048919 Ga0496116_0005379 Ga0496116_0005379_10927_11562 203
274 3300048919 Ga0496116_0026038 Ga0496116_0026038_1902_2537 203
275 3300048919 Ga0496116_0134978 Ga0496116_0134978_619_1254 203
276 3300048919 Ga0496116_0144724 Ga0496116_0144724_98_733 203
277 3300048920 Ga0496117_0006763 Ga0496117_0006763_7729_8364 203
278 3300048920 Ga0496117_0119188 Ga0496117_0119188_230_865 203
279 3300048921 Ga0496118_0009778 Ga0496118_0009778_6611_7246 203
280 3300048921 Ga0496118_0135320 Ga0496118_0135320_253_864 203
281 3300048921 Ga0496118_0140714 Ga0496118_0140714_594_1229 203
282 3300048922 Ga0496119_0026981 Ga0496119_0026981_845_1456 203
283 3300048922 Ga0496119_0178653 Ga0496119_0178653_244_879 203
284 3300048924 Ga0496121_0018899 Ga0496121_0018899_3114_3749 203
285 3300048924 Ga0496121_0040712 Ga0496121_0040712_1166_1801 203
286 3300048925 Ga0496122_0022378 Ga0496122_0022378_3418_4053 203
287 3300048925 Ga0496122_0032443 Ga0496122_0032443_620_1255 203
288 3300048925 Ga0496122_0088520 Ga0496122_0088520_620_1255 203
289 3300048925 Ga0496122_0164325 Ga0496122_0164325_616_1251 203
290 3300048926 Ga0496123_0020989 Ga0496123_0020989_2747_3382 203
291 3300048926 Ga0496123_0113413 Ga0496123_0113413_761_1396 203
292 3300048926 Ga0496123_0131238 Ga0496123_0131238_605_1240 203
293 3300048927 Ga0496124_0003917 Ga0496124_0003917_7621_8256 203
294 3300048927 Ga0496124_0004950 Ga0496124_0004950_11984_12619 203
295 3300048927 Ga0496124_0084022 Ga0496124_0084022_1358_1993 203
296 3300048928 Ga0496125_0032793 Ga0496125_0032793_2189_2824 203
297 3300048929 Ga0496126_0049161 Ga0496126_0049161_510_1145 203
298 3300048929 Ga0496126_0247957 Ga0496126_0247957_681_1292 203
299 3300048929 Ga0496126_0506216 Ga0496126_0506216_263_898 203
300 3300049589 Ga0501073_0034560 Ga0501073_0034560_1445_2110 203
301 3300053119 Ga0500595_026555 Ga0500595_026555_847_1458 203
302 iso_pu_bacteria 2510917022 2511135187 203
303 iso_pu_bacteria 2582581294 2585200239 203
304 iso_pu_bacteria 2582581307 2585270928 203
305 iso_pu_bacteria 2585427531 2585558652 203
306 iso_pu_bacteria 2585427609 2585904378 203
307 iso_pu_bacteria 2585428125 2587980505 203
308 3300003187 JGI25151J46595_10054262 JGI25151J46595_100542622 204
309 3300005340 Ga0070689_100302016 Ga0070689_1003020162 204
310 3300005356 Ga0070674_100136550 Ga0070674_1001365502 204
311 3300005364 Ga0070673_100145380 Ga0070673_1001453803 204
312 3300005365 Ga0070688_100497805 Ga0070688_1004978052 204
313 3300005439 Ga0070711_100110767 Ga0070711_1001107672 204
314 3300005441 Ga0070700_100306757 Ga0070700_1003067572 204
315 3300005445 Ga0070708_101088606 Ga0070708_1010886061 204
316 3300005459 Ga0068867_100086622 Ga0068867_1000866223 204
317 3300005536 Ga0070697_100918069 Ga0070697_1009180692 204
318 3300005548 Ga0070665_100105659 Ga0070665_1001056593 204
319 3300005548 Ga0070665_100182460 Ga0070665_1001824603 204
320 3300005564 Ga0070664_100474056 Ga0070664_1004740562 204
321 3300005617 Ga0068859_100017558 Ga0068859_1000175586 204
322 3300005718 Ga0068866_10050358 Ga0068866_100503582 204
323 3300005842 Ga0068858_100035950 Ga0068858_1000359504 204
324 3300005985 Ga0081539_10021439 Ga0081539_100214394 204
325 3300006042 Ga0075368_10014251 Ga0075368_100142512 204
326 3300006051 Ga0075364_10211377 Ga0075364_102113772 204
327 3300006237 Ga0097621_100313580 Ga0097621_1003135802 204
328 3300006353 Ga0075370_10023686 Ga0075370_100236864 204
329 3300006844 Ga0075428_100186959 Ga0075428_1001869593 204
330 3300006844 Ga0075428_100349710 Ga0075428_1003497102 204
331 3300006846 Ga0075430_100114035 Ga0075430_1001140352 204
332 3300006846 Ga0075430_100275110 Ga0075430_1002751102 204
333 3300006847 Ga0075431_100163193 Ga0075431_1001631931 204
334 3300006880 Ga0075429_100119139 Ga0075429_1001191393 204
335 3300006931 Ga0097620_100017559 Ga0097620_1000175596 204
336 3300009094 Ga0111539_10504970 Ga0111539_105049702 204
337 3300009101 Ga0105247_10003673 Ga0105247_100036734 204
338 3300009148 Ga0105243_10108387 Ga0105243_101083871 204
339 3300009177 Ga0105248_10099697 Ga0105248_100996973 204
340 3300011119 Ga0105246_10029897 Ga0105246_100298974 204
341 3300012487 Ga0157321_1007870 Ga0157321_10078701 204
342 3300012508 Ga0157315_1002326 Ga0157315_10023262 204
343 3300013296 Ga0157374_10370978 Ga0157374_103709781 204
344 3300013308 Ga0157375_10006048 Ga0157375_100060485 204
345 3300013308 Ga0157375_10789118 Ga0157375_107891182 204
346 3300014969 Ga0157376_10035430 Ga0157376_100354306 204
347 3300015265 Ga0182005_1028972 Ga0182005_10289722 204
348 3300025245 Ga0207425_1008008 Ga0207425_10080082 204
349 3300025899 Ga0207642_10053532 Ga0207642_100535321 204
350 3300025900 Ga0207710_10026346 Ga0207710_100263462 204
351 3300025916 Ga0207663_10113354 Ga0207663_101133541 204
352 3300025916 Ga0207663_10165687 Ga0207663_101656872 204
353 3300025920 Ga0207649_10376537 Ga0207649_103765372 204
354 3300025932 Ga0207690_10450295 Ga0207690_104502952 204
355 3300025936 Ga0207670_10145945 Ga0207670_101459452 204
356 3300025938 Ga0207704_10083845 Ga0207704_100838453 204
357 3300025941 Ga0207711_10096136 Ga0207711_100961362 204
358 3300025960 Ga0207651_10199005 Ga0207651_101990052 204
359 3300025972 Ga0207668_10429349 Ga0207668_104293492 204
360 3300026035 Ga0207703_10113317 Ga0207703_101133174 204
361 3300026035 Ga0207703_10209918 Ga0207703_102099183 204
362 3300026075 Ga0207708_10148393 Ga0207708_101483932 204
363 3300026118 Ga0207675_100062687 Ga0207675_1000626876 204
364 3300026118 Ga0207675_100478715 Ga0207675_1004787152 204
365 3300027866 Ga0209813_10004378 Ga0209813_100043782 204
366 3300028379 Ga0268266_10034806 Ga0268266_100348062 204
367 3300028379 Ga0268266_10190330 Ga0268266_101903302 204
368 3300028381 Ga0268264_10194798 Ga0268264_101947982 204
369 3300028381 Ga0268264_11120963 Ga0268264_111209631 204
370 3300035121 Ga0373960_0046026 Ga0373960_0046026_168_791 204
371 3300035691 Ga0373931_0019173 Ga0373931_0019173_1510_2133 204
372 3300046491 Ga0495584_0055155 Ga0495584_0055155_1316_1939 204
373 3300046506 Ga0495583_0039963 Ga0495583_0039963_234_875 204
374 3300047320 Ga0495672_0154252 Ga0495672_0154252_153_776 204
375 3300047445 Ga0495677_0178026 Ga0495677_0178026_74_697 204
376 3300048903 Ga0496100_0042786 Ga0496100_0042786_34_663 204
377 3300048904 Ga0496101_0024156 Ga0496101_0024156_2699_3328 204
378 3300048904 Ga0496101_0195603 Ga0496101_0195603_560_1183 204
379 3300048905 Ga0496102_0012754 Ga0496102_0012754_2147_2776 204
380 3300048905 Ga0496102_0241989 Ga0496102_0241989_1001_1630 204
381 3300048906 Ga0496103_0089799 Ga0496103_0089799_92_721 204
382 3300048907 Ga0496104_0013865 Ga0496104_0013865_4845_5474 204
383 3300048908 Ga0496105_0008593 Ga0496105_0008593_1795_2424 204
384 3300048908 Ga0496105_0773586 Ga0496105_0773586_46_675 204
385 3300048909 Ga0496106_0004483 Ga0496106_0004483_5281_5910 204
386 3300048909 Ga0496106_0542304 Ga0496106_0542304_69_692 204
387 3300048910 Ga0496107_0003137 Ga0496107_0003137_5782_6411 204
388 3300048910 Ga0496107_0153283 Ga0496107_0153283_348_971 204
389 3300048911 Ga0496108_0043855 Ga0496108_0043855_1359_1988 204
390 3300048912 Ga0496109_0008718 Ga0496109_0008718_6870_7499 204
391 3300048912 Ga0496109_0293262 Ga0496109_0293262_202_831 204
392 3300048913 Ga0496110_0786980 Ga0496110_0786980_34_666 204
393 3300048914 Ga0496111_0416213 Ga0496111_0416213_203_832 204
394 3300048915 Ga0496112_0014397 Ga0496112_0014397_4168_4797 204
395 3300048916 Ga0496113_0022191 Ga0496113_0022191_3410_4039 204
396 3300048917 Ga0496114_0003619 Ga0496114_0003619_7167_7796 204
397 3300048918 Ga0496115_0041346 Ga0496115_0041346_175_804 204
398 3300048927 Ga0496124_0193123 Ga0496124_0193123_450_1103 204
399 3300049568 Ga0501031_0125145 Ga0501031_0125145_400_1023 204
400 3300049570 Ga0501033_0439683 Ga0501033_0439683_71_694 204
401 3300049570 Ga0501033_0614192 Ga0501033_0614192_53_700 204
402 3300049571 Ga0501034_0000960 Ga0501034_0000960_13154_13783 204
403 3300049571 Ga0501034_0087179 Ga0501034_0087179_2373_3050 204
404 3300049572 Ga0501036_0032407 Ga0501036_0032407_1130_1753 204
405 3300049572 Ga0501036_0307900 Ga0501036_0307900_644_1267 204
406 3300049575 Ga0501039_0223390 Ga0501039_0223390_64_687 204
407 3300049575 Ga0501039_0238480 Ga0501039_0238480_739_1368 204
408 3300049576 Ga0501040_0028998 Ga0501040_0028998_1629_2252 204
409 3300049576 Ga0501040_0072292 Ga0501040_0072292_17_640 204
410 3300049576 Ga0501040_0624934 Ga0501040_0624934_77_706 204
411 3300049577 Ga0501041_0361667 Ga0501041_0361667_100_723 204
412 3300049578 Ga0501042_0132816 Ga0501042_0132816_720_1343 204
413 3300049578 Ga0501042_0583877 Ga0501042_0583877_160_786 204
414 3300049579 Ga0501043_0293523 Ga0501043_0293523_565_1188 204
415 3300049581 Ga0501047_0114089 Ga0501047_0114089_1283_1960 204
416 3300049582 Ga0501048_0067827 Ga0501048_0067827_1747_2370 204
417 3300049582 Ga0501048_0109138 Ga0501048_0109138_297_920 204
418 3300049587 Ga0501071_0098627 Ga0501071_0098627_123_746 204
419 3300049588 Ga0501072_0052680 Ga0501072_0052680_1570_2193 204
420 3300049588 Ga0501072_0087455 Ga0501072_0087455_528_1151 204
421 3300049589 Ga0501073_0001144 Ga0501073_0001144_2594_3286 204
422 3300049589 Ga0501073_0594910 Ga0501073_0594910_113_736 204
423 3300049590 Ga0501074_0092177 Ga0501074_0092177_935_1558 204
424 3300049590 Ga0501074_0117551 Ga0501074_0117551_84_707 204
425 3300049591 Ga0501075_0085894 Ga0501075_0085894_1718_2347 204
426 3300049591 Ga0501075_0100523 Ga0501075_0100523_1375_1998 204
427 3300049592 Ga0501076_0070720 Ga0501076_0070720_1828_2451 204
428 3300049592 Ga0501076_0317841 Ga0501076_0317841_169_795 204
429 3300049593 Ga0501077_0017557 Ga0501077_0017557_3614_4237 204
430 3300049741 Ga0501079_0048036 Ga0501079_0048036_794_1417 204
431 3300049742 Ga0501080_0768021 Ga0501080_0768021_166_789 204
432 3300049743 Ga0501081_0038161 Ga0501081_0038161_2322_2945 204
433 3300049743 Ga0501081_0427394 Ga0501081_0427394_132_755 204
434 3300049743 Ga0501081_0759228 Ga0501081_0759228_24_653 204
435 3300049822 Ga0501035_0912729 Ga0501035_0912729_10_636 204
436 3300050491 nmdc:mga00v17_24846_c1 nmdc:mga00v17_24846_c1_2543_3166 204
437 3300050494 nmdc:mga06z11_14332_c1 nmdc:mga06z11_14332_c1_2568_3191 204
438 3300050494 nmdc:mga06z11_953_c1 nmdc:mga06z11_953_c1_652_1275 204
439 3300050495 nmdc:mga04h51_3158_c1 nmdc:mga04h51_3158_c1_2931_3554 204
440 3300050507 nmdc:mga05p37_318228_c1 nmdc:mga05p37_318228_c1_273_896 204
441 3300050507 nmdc:mga05p37_645475_c1 nmdc:mga05p37_645475_c1_154_783 204
442 3300050508 nmdc:mga09592_110807_c1 nmdc:mga09592_110807_c1_562_1185 204
443 3300050508 nmdc:mga09592_38371_c1 nmdc:mga09592_38371_c1_2001_2624 204
444 3300050509 nmdc:mga0qj67_108903_c1 nmdc:mga0qj67_108903_c1_1043_1666 204
445 3300050509 nmdc:mga0qj67_165435_c1 nmdc:mga0qj67_165435_c1_617_1240 204
446 3300050510 nmdc:mga06r32_105020_c1 nmdc:mga06r32_105020_c1_411_1034 204
447 3300050510 nmdc:mga06r32_400751_c2 nmdc:mga06r32_400751_c2_158_781 204
448 3300050510 nmdc:mga06r32_548924_c1 nmdc:mga06r32_548924_c1_379_1002 204
449 3300050515 nmdc:mga0a205_530248_c1 nmdc:mga0a205_530248_c1_365_994 204
450 3300053108 Ga0500562_048723 Ga0500562_048723_228_869 204
451 3300053156 Ga0500622_0000275 Ga0500622_0000275_4943_5584 204
452 3300054114 Ga0501084_0227769 Ga0501084_0227769_91_720 204
453 3300060353 Ga0501082_0093043 Ga0501082_0093043_797_1420 204
454 3300060353 Ga0501082_0104451 Ga0501082_0104451_612_1238 204
455 3300060353 Ga0501082_0274087 Ga0501082_0274087_64_687 204
456 3300061734 Ga0530510_0016551 Ga0530510_0016551_2322_2945 204
457 3300061734 Ga0530510_0038121 Ga0530510_0038121_1044_1667 204
458 iso_pu_bacteria 2513237138 2513864716 204
459 iso_pu_bacteria 2513237305 2514421837 204
460 iso_pu_bacteria 2721755686 2723576244 204
461 iso_pu_bacteria 2923556063 2923558000 204
462 iso_pu_bacteria 2937843397 2937847446 204
463 iso_pu_bacteria 2939669807 2939670650 204
464 iso_pu_bacteria 2978969890 2978974407 204
465 iso_pu_bacteria 8056875544 8056877485 204
466 3300001989 JGI24739J22299_10018881 JGI24739J22299_100188812 205
467 3300001989 JGI24739J22299_10041069 JGI24739J22299_100410692 205
468 3300002067 JGI24735J21928_10017647 JGI24735J21928_100176473 205
469 3300002773 JGI25152J39213_1003234 JGI25152J39213_10032344 205
470 3300002773 JGI25152J39213_1008147 JGI25152J39213_10081473 205
471 3300002773 JGI25152J39213_1008149 JGI25152J39213_10081492 205
472 3300002987 JGI25159J45721_1002671 JGI25159J45721_10026715 205
473 3300003215 JGI25153J46596_10005509 JGI25153J46596_100055092 205
474 3300003215 JGI25153J46596_10019173 JGI25153J46596_100191732 205
475 3300003215 JGI25153J46596_10019175 JGI25153J46596_100191752 205
476 3300003354 JGI25160J50197_1013793 JGI25160J50197_10137932 205
477 3300003374 JGI25161J50226_1000414 JGI25161J50226_10004143 205
478 3300003771 Ga0055526_1001540 Ga0055526_100154011 205
479 3300003775 Ga0055524_1009863 Ga0055524_10098633 205
480 3300003790 Ga0055528_1022222 Ga0055528_10222222 205
481 3300003792 Ga0055540_1014360 Ga0055540_10143601 205
482 3300004625 Ga0055543_1000219 Ga0055543_100021950 205
483 3300005327 Ga0070658_10169662 Ga0070658_101696622 205
484 3300005339 Ga0070660_100217678 Ga0070660_1002176782 205
485 3300005539 Ga0068853_100077411 Ga0068853_1000774112 205
486 3300005539 Ga0068853_100103070 Ga0068853_1001030703 205
487 3300005548 Ga0070665_100114636 Ga0070665_1001146363 205
488 3300005548 Ga0070665_100380116 Ga0070665_1003801163 205
489 3300005548 Ga0070665_100808426 Ga0070665_1008084262 205
490 3300005577 Ga0068857_100848818 Ga0068857_1008488182 205
491 3300005578 Ga0068854_100215787 Ga0068854_1002157872 205
492 3300005983 Ga0081540_1008997 Ga0081540_10089978 205
493 3300005985 Ga0081539_10003985 Ga0081539_1000398519 205
494 3300006038 Ga0075365_10014999 Ga0075365_100149992 205
495 3300006038 Ga0075365_10027101 Ga0075365_100271014 205
496 3300006038 Ga0075365_10091312 Ga0075365_100913122 205
497 3300006038 Ga0075365_10193096 Ga0075365_101930962 205
498 3300006038 Ga0075365_10349904 Ga0075365_103499042 205
499 3300006038 Ga0075365_10352199 Ga0075365_103521992 205
500 3300006042 Ga0075368_10012900 Ga0075368_100129002 205
501 3300006048 Ga0075363_100110039 Ga0075363_1001100392 205
502 3300006051 Ga0075364_10000062 Ga0075364_1000006226 205
503 3300006051 Ga0075364_10013107 Ga0075364_100131076 205
504 3300006177 Ga0075362_10081134 Ga0075362_100811342 205
505 3300006177 Ga0075362_10215162 Ga0075362_102151622 205
506 3300006178 Ga0075367_10080105 Ga0075367_100801052 205
507 3300006178 Ga0075367_10090395 Ga0075367_100903953 205
508 3300006186 Ga0075369_10021398 Ga0075369_100213985 205
509 3300006186 Ga0075369_10045442 Ga0075369_100454423 205
510 3300006353 Ga0075370_10137672 Ga0075370_101376722 205
511 3300006353 Ga0075370_10185657 Ga0075370_101856572 205
512 3300009093 Ga0105240_10129075 Ga0105240_101290754 205
513 3300009093 Ga0105240_10738840 Ga0105240_107388402 205
514 3300009148 Ga0105243_10287991 Ga0105243_102879912 205
515 3300009174 Ga0105241_10102121 Ga0105241_101021213 205
516 3300009545 Ga0105237_10118005 Ga0105237_101180052 205
517 3300009545 Ga0105237_10122860 Ga0105237_101228604 205
518 3300009545 Ga0105237_10148857 Ga0105237_101488573 205
519 3300009551 Ga0105238_10001891 Ga0105238_1000189112 205
520 3300009551 Ga0105238_10671985 Ga0105238_106719852 205
521 3300009553 Ga0105249_11033699 Ga0105249_110336991 205
522 3300010375 Ga0105239_10038780 Ga0105239_100387804 205
523 3300010375 Ga0105239_10067789 Ga0105239_100677893 205
524 3300010375 Ga0105239_10402337 Ga0105239_104023372 205
525 3300010375 Ga0105239_10415438 Ga0105239_104154381 205
526 3300011119 Ga0105246_11104067 Ga0105246_111040671 205
527 3300013104 Ga0157370_10178323 Ga0157370_101783233 205
528 3300013105 Ga0157369_10134081 Ga0157369_101340812 205
529 3300013105 Ga0157369_10262250 Ga0157369_102622503 205
530 3300013296 Ga0157374_10575989 Ga0157374_105759892 205
531 3300013307 Ga0157372_10696416 Ga0157372_106964162 205
532 3300014497 Ga0182008_10060664 Ga0182008_100606643 205
533 3300015261 Ga0182006_1069305 Ga0182006_10693052 205
534 3300015262 Ga0182007_10029650 Ga0182007_100296503 205
535 3300025208 Ga0209436_100020 Ga0209436_10002090 205
536 3300025250 Ga0209026_1000002 Ga0209026_1000002694 205
537 3300025253 Ga0209677_111155 Ga0209677_1111552 205
538 3300025254 Ga0209148_1000072 Ga0209148_100007288 205
539 3300025254 Ga0209148_1009801 Ga0209148_10098013 205
540 3300025256 Ga0209759_1000146 Ga0209759_100014656 205
541 3300025258 Ga0209129_1006281 Ga0209129_10062813 205
542 3300025258 Ga0209129_1006407 Ga0209129_10064073 205
543 3300025258 Ga0209129_1009808 Ga0209129_10098083 205
544 3300025261 Ga0209233_1000027 Ga0209233_1000027498 205
545 3300025272 Ga0209455_1000153 Ga0209455_100015341 205
546 3300025273 Ga0209673_1005745 Ga0209673_10057452 205
547 3300025284 Ga0209130_1000004 Ga0209130_1000004335 205
548 3300025294 Ga0209025_1003187 Ga0209025_10031872 205
549 3300025294 Ga0209025_1042481 Ga0209025_10424812 205
550 3300025295 Ga0209564_1000362 Ga0209564_100036284 205
551 3300025297 Ga0209758_1000540 Ga0209758_100054055 205
552 3300025297 Ga0209758_1000564 Ga0209758_100056410 205
553 3300025297 Ga0209758_1003996 Ga0209758_100399611 205
554 3300025297 Ga0209758_1005023 Ga0209758_10050233 205
555 3300025299 Ga0209256_1006317 Ga0209256_10063172 205
556 3300025302 Ga0207426_1000003 Ga0207426_1000003392 205
557 3300025303 Ga0209051_1001845 Ga0209051_10018453 205
558 3300025303 Ga0209051_1004341 Ga0209051_10043414 205
559 3300025900 Ga0207710_10133801 Ga0207710_101338012 205
560 3300025904 Ga0207647_10013583 Ga0207647_100135834 205
561 3300025904 Ga0207647_10150832 Ga0207647_101508321 205
562 3300025907 Ga0207645_10366041 Ga0207645_103660412 205
563 3300025909 Ga0207705_10257032 Ga0207705_102570322 205
564 3300025911 Ga0207654_10283590 Ga0207654_102835902 205
565 3300025913 Ga0207695_10169295 Ga0207695_101692953 205
566 3300025914 Ga0207671_10074585 Ga0207671_100745853 205
567 3300025914 Ga0207671_10364726 Ga0207671_103647263 205
568 3300025919 Ga0207657_10172967 Ga0207657_101729673 205
569 3300025949 Ga0207667_10354717 Ga0207667_103547172 205
570 3300025961 Ga0207712_10817146 Ga0207712_108171462 205
571 3300026041 Ga0207639_10062734 Ga0207639_100627345 205
572 3300026041 Ga0207639_10453860 Ga0207639_104538602 205
573 3300026116 Ga0207674_10023876 Ga0207674_100238767 205
574 3300026121 Ga0207683_10243403 Ga0207683_102434032 205
575 3300026142 Ga0207698_10174110 Ga0207698_101741102 205
576 3300026142 Ga0207698_11115947 Ga0207698_111159471 205
577 3300027866 Ga0209813_10047150 Ga0209813_100471501 205
578 3300028379 Ga0268266_10057364 Ga0268266_100573643 205
579 3300028379 Ga0268266_10058320 Ga0268266_100583203 205
580 3300028379 Ga0268266_10156687 Ga0268266_101566872 205
581 3300028379 Ga0268266_10312154 Ga0268266_103121542 205
582 3300028379 Ga0268266_10492430 Ga0268266_104924301 205
583 3300031548 Ga0307408_100222905 Ga0307408_1002229052 205
584 3300032002 Ga0307416_100263980 Ga0307416_1002639802 205
585 3300037312 Ga0395899_0000130 Ga0395899_0000130_20044_20688 205
586 3300037418 Ga0395900_0000020 Ga0395900_0000020_332813_333457 205
587 3300037418 Ga0395900_0063098 Ga0395900_0063098_1482_2099 205
588 3300037418 Ga0395900_0189461 Ga0395900_0189461_750_1385 205
589 3300037418 Ga0395900_0484345 Ga0395900_0484345_21_638 205
590 3300037466 Ga0395898_0000104 Ga0395898_0000104_20044_20688 205
591 3300037466 Ga0395898_0082399 Ga0395898_0082399_2271_2888 205
592 3300037466 Ga0395898_0593280 Ga0395898_0593280_366_983 205
593 3300037471 Ga0395905_0000019 Ga0395905_0000019_20044_20688 205
594 3300037471 Ga0395905_0013264 Ga0395905_0013264_744_1361 205
595 3300037471 Ga0395905_0259547 Ga0395905_0259547_667_1302 205
596 3300037471 Ga0395905_0291790 Ga0395905_0291790_610_1227 205
597 3300037471 Ga0395905_0325403 Ga0395905_0325403_261_878 205
598 3300038443 Ga0395901_0000016 Ga0395901_0000016_333321_333965 205
599 3300038443 Ga0395901_0072706 Ga0395901_0072706_895_1512 205
600 3300038443 Ga0395901_0197977 Ga0395901_0197977_1117_1734 205
601 3300038443 Ga0395901_0360121 Ga0395901_0360121_47_682 205
602 3300038443 Ga0395901_0550412 Ga0395901_0550412_410_1027 205
603 3300038443 Ga0395901_0601542 Ga0395901_0601542_472_1089 205
604 3300038443 Ga0395901_0631794 Ga0395901_0631794_372_989 205
605 3300041413 Ga0439465_0013562 Ga0439465_0013562_252_908 205
606 3300041512 Ga0451853_1125249 Ga0451853_1125249_58_675 205
607 3300044658 Ga0466972_0015679 Ga0466972_0015679_3138_3755 205
608 3300044658 Ga0466972_0050436 Ga0466972_0050436_1106_1741 205
609 3300044901 Ga0466960_0017406 Ga0466960_0017406_1860_2477 205
610 3300046453 Ga0495627_087496 Ga0495627_087496_125_769 205
611 3300046454 Ga0495592_0150150 Ga0495592_0150150_806_1453 205
612 3300046460 Ga0495638_0110086 Ga0495638_0110086_709_1434 205
613 3300046512 Ga0495610_0069620 Ga0495610_0069620_808_1464 205
614 3300046519 Ga0495632_0121825 Ga0495632_0121825_442_1059 205
615 3300046522 Ga0495643_0075461 Ga0495643_0075461_1102_1719 205
616 3300046529 Ga0495652_0514347 Ga0495652_0514347_40_687 205
617 3300046542 Ga0495597_0022344 Ga0495597_0022344_316_933 205
618 3300046557 Ga0495622_0081107 Ga0495622_0081107_375_1022 205
619 3300046615 Ga0495656_0356199 Ga0495656_0356199_21_665 205
620 3300046616 Ga0495668_0091293 Ga0495668_0091293_887_1504 205
621 3300046616 Ga0495668_0173265 Ga0495668_0173265_60_677 205
622 3300046660 Ga0495625_0195480 Ga0495625_0195480_492_1121 205
623 3300046660 Ga0495625_0229691 Ga0495625_0229691_243_860 205
624 3300046809 Ga0495600_0006725 Ga0495600_0006725_3721_4368 205
625 3300047317 Ga0495604_0059509 Ga0495604_0059509_2059_2706 205
626 3300047323 Ga0495683_0110752 Ga0495683_0110752_637_1284 205
627 3300047443 Ga0495687_023368 Ga0495687_023368_49_666 205
628 3300047472 Ga0495686_0043882 Ga0495686_0043882_2118_2762 205
629 3300047472 Ga0495686_0242374 Ga0495686_0242374_180_797 205
630 3300048088 Ga0495602_0512096 Ga0495602_0512096_178_825 205
631 3300048091 Ga0495626_0119284 Ga0495626_0119284_86_703 205
632 3300048905 Ga0496102_0078314 Ga0496102_0078314_2409_3026 205
633 3300048905 Ga0496102_0816474 Ga0496102_0816474_95_712 205
634 3300048909 Ga0496106_0264761 Ga0496106_0264761_673_1290 205
635 3300048918 Ga0496115_0136319 Ga0496115_0136319_911_1585 205
636 3300048923 Ga0496120_0001570 Ga0496120_0001570_10127_10744 205
637 3300048925 Ga0496122_0011480 Ga0496122_0011480_5409_6056 205
638 3300048925 Ga0496122_0048321 Ga0496122_0048321_1634_2290 205
639 3300048926 Ga0496123_0058781 Ga0496123_0058781_307_978 205
640 3300048928 Ga0496125_0008039 Ga0496125_0008039_7437_8093 205
641 3300048929 Ga0496126_0150033 Ga0496126_0150033_544_1161 205
642 3300049568 Ga0501031_0000561 Ga0501031_0000561_124_741 205
643 3300049568 Ga0501031_0046582 Ga0501031_0046582_1620_2237 205
644 3300049569 Ga0501032_0000022 Ga0501032_0000022_146050_146667 205
645 3300049569 Ga0501032_0000786 Ga0501032_0000786_12848_13465 205
646 3300049569 Ga0501032_0026619 Ga0501032_0026619_724_1341 205
647 3300049569 Ga0501032_0044629 Ga0501032_0044629_83_739 205
648 3300049570 Ga0501033_0000037 Ga0501033_0000037_107_724 205
649 3300049570 Ga0501033_0000197 Ga0501033_0000197_30382_30999 205
650 3300049570 Ga0501033_0020370 Ga0501033_0020370_3669_4286 205
651 3300049570 Ga0501033_0342938 Ga0501033_0342938_132_749 205
652 3300049571 Ga0501034_0000901 Ga0501034_0000901_12343_12960 205
653 3300049571 Ga0501034_0006623 Ga0501034_0006623_11689_12306 205
654 3300049571 Ga0501034_0045975 Ga0501034_0045975_3070_3687 205
655 3300049572 Ga0501036_0001200 Ga0501036_0001200_1526_2143 205
656 3300049572 Ga0501036_0018522 Ga0501036_0018522_124_741 205
657 3300049572 Ga0501036_0040737 Ga0501036_0040737_843_1460 205
658 3300049573 Ga0501037_0000016 Ga0501037_0000016_160287_160904 205
659 3300049573 Ga0501037_0000067 Ga0501037_0000067_72296_72913 205
660 3300049573 Ga0501037_0100302 Ga0501037_0100302_631_1248 205
661 3300049574 Ga0501038_0000013 Ga0501038_0000013_155736_156353 205
662 3300049574 Ga0501038_0000015 Ga0501038_0000015_124_741 205
663 3300049574 Ga0501038_0082955 Ga0501038_0082955_1451_2068 205
664 3300049575 Ga0501039_0000010 Ga0501039_0000010_152152_152769 205
665 3300049575 Ga0501039_0000013 Ga0501039_0000013_233678_234295 205
666 3300049575 Ga0501039_0619956 Ga0501039_0619956_18_635 205
667 3300049575 Ga0501039_0783997 Ga0501039_0783997_77_703 205
668 3300049576 Ga0501040_0043688 Ga0501040_0043688_2363_2980 205
669 3300049576 Ga0501040_0066538 Ga0501040_0066538_1013_1630 205
670 3300049578 Ga0501042_0060858 Ga0501042_0060858_1395_2012 205
671 3300049579 Ga0501043_0000056 Ga0501043_0000056_12976_13593 205
672 3300049579 Ga0501043_0001689 Ga0501043_0001689_17665_18282 205
673 3300049580 Ga0501046_0063035 Ga0501046_0063035_1395_2012 205
674 3300049580 Ga0501046_0216363 Ga0501046_0216363_693_1310 205
675 3300049581 Ga0501047_0039969 Ga0501047_0039969_3796_4413 205
676 3300049581 Ga0501047_0076770 Ga0501047_0076770_505_1122 205
677 3300049582 Ga0501048_0153872 Ga0501048_0153872_333_950 205
678 3300049583 Ga0501067_0114155 Ga0501067_0114155_553_1170 205
679 3300049584 Ga0501068_0006137 Ga0501068_0006137_4486_5103 205
680 3300049586 Ga0501070_0036389 Ga0501070_0036389_2578_3195 205
681 3300049586 Ga0501070_0068371 Ga0501070_0068371_113_730 205
682 3300049586 Ga0501070_0071851 Ga0501070_0071851_1967_2683 205
683 3300049587 Ga0501071_0057893 Ga0501071_0057893_1149_1766 205
684 3300049587 Ga0501071_0133286 Ga0501071_0133286_1170_1796 205
685 3300049587 Ga0501071_0720243 Ga0501071_0720243_28_744 205
686 3300049588 Ga0501072_0104530 Ga0501072_0104530_412_1038 205
687 3300049589 Ga0501073_0076946 Ga0501073_0076946_1076_1693 205
688 3300049590 Ga0501074_0144933 Ga0501074_0144933_845_1462 205
689 3300049591 Ga0501075_0900786 Ga0501075_0900786_16_642 205
690 3300049593 Ga0501077_0120409 Ga0501077_0120409_851_1477 205
691 3300049742 Ga0501080_0046328 Ga0501080_0046328_1396_2013 205
692 3300049744 Ga0501083_0078681 Ga0501083_0078681_145_762 205
693 3300049822 Ga0501035_0000046 Ga0501035_0000046_145859_146476 205
694 3300049822 Ga0501035_0000063 Ga0501035_0000063_49978_50595 205
695 3300049822 Ga0501035_0016341 Ga0501035_0016341_4940_5557 205
696 3300049822 Ga0501035_0054393 Ga0501035_0054393_838_1455 205
697 3300049823 Ga0501044_0000038 Ga0501044_0000038_124_741 205
698 3300049823 Ga0501044_0008677 Ga0501044_0008677_5570_6187 205
699 3300049823 Ga0501044_0155184 Ga0501044_0155184_1538_2155 205
700 3300049823 Ga0501044_0194859 Ga0501044_0194859_270_986 205
701 3300049824 Ga0501045_0114464 Ga0501045_0114464_735_1352 205
702 3300049824 Ga0501045_0132995 Ga0501045_0132995_1178_1795 205
703 3300049824 Ga0501045_0320467 Ga0501045_0320467_111_728 205
704 3300050489 nmdc:mga03683_65469_c1 nmdc:mga03683_65469_c1_93_710 205
705 3300050489 nmdc:mga03683_78309_c1 nmdc:mga03683_78309_c1_746_1372 205
706 3300050490 nmdc:mga03n38_49826_c1 nmdc:mga03n38_49826_c1_1057_1674 205
707 3300050491 nmdc:mga00v17_15298_c1 nmdc:mga00v17_15298_c1_951_1568 205
708 3300050491 nmdc:mga00v17_548532_c1 nmdc:mga00v17_548532_c1_59_676 205
709 3300050492 nmdc:mga0yw44_107498_c1 nmdc:mga0yw44_107498_c1_674_1300 205
710 3300050492 nmdc:mga0yw44_393848_c1 nmdc:mga0yw44_393848_c1_260_877 205
711 3300050492 nmdc:mga0yw44_539577_c1 nmdc:mga0yw44_539577_c1_19_660 205
712 3300050492 nmdc:mga0yw44_70272_c1 nmdc:mga0yw44_70272_c1_807_1424 205
713 3300050492 nmdc:mga0yw44_7495_c1 nmdc:mga0yw44_7495_c1_2208_2825 205
714 3300050494 nmdc:mga06z11_36544_c1 nmdc:mga06z11_36544_c1_748_1365 205
715 3300050494 nmdc:mga06z11_37380_c1 nmdc:mga06z11_37380_c1_337_954 205
716 3300050495 nmdc:mga04h51_49544_c1 nmdc:mga04h51_49544_c1_145_762 205
717 3300050496 nmdc:mga07m45_90489_c1 nmdc:mga07m45_90489_c1_1105_1722 205
718 3300050516 nmdc:mga0sz30_19195_c2 nmdc:mga0sz30_19195_c2_222_839 205
719 3300050516 nmdc:mga0sz30_220647_c1 nmdc:mga0sz30_220647_c1_14_670 205
720 3300053079 Ga0500610_0198005 Ga0500610_0198005_106_723 205
721 3300053087 Ga0500643_036920 Ga0500643_036920_174_821 205
722 3300053093 Ga0500651_0177387 Ga0500651_0177387_535_1152 205
723 3300053121 Ga0500607_106366 Ga0500607_106366_270_917 205
724 3300053134 Ga0500658_0190284 Ga0500658_0190284_149_766 205
725 3300053148 Ga0500590_004361 Ga0500590_004361_2933_3580 205
726 3300053151 Ga0500604_0144891 Ga0500604_0144891_74_691 205
727 3300053158 Ga0500627_0102756 Ga0500627_0102756_574_1191 205
728 3300053158 Ga0500627_0186305 Ga0500627_0186305_234_851 205
729 3300053177 Ga0500636_0059334 Ga0500636_0059334_643_1290 205
730 3300054114 Ga0501084_0531818 Ga0501084_0531818_66_722 205
731 3300060353 Ga0501082_0049338 Ga0501082_0049338_2013_2669 205
732 iso_pu_bacteria 2508501123 2509114291 205
733 iso_pu_bacteria 2509276018 2509370405 205
734 iso_pu_bacteria 2509276022 2509397015 205
735 iso_pu_bacteria 2510065059 2510317374 205
736 iso_pu_bacteria 2512875016 2512930726 205
737 iso_pu_bacteria 2513237090 2513613569 205
738 iso_pu_bacteria 2643221595 2643986711 205
739 iso_pu_bacteria 2643221627 2644155297 205
740 iso_pu_bacteria 2687453392 2688599285 205
741 iso_pu_bacteria 2756170246 2756676872 205
742 iso_pu_bacteria 2791355123 2792752821 205
743 iso_pu_bacteria 2844002411 2844006618 205
744 iso_pu_bacteria 2871451962 2871459163 205
745 iso_pu_bacteria 2871466892 2871470595 205
746 iso_pu_bacteria 2876392853 2876395098 205
747 iso_pu_bacteria 2881161766 2881168466 205
748 iso_pu_bacteria 2882632389 2882634000 205
749 iso_pu_bacteria 2885305155 2885310441 205
750 iso_pu_bacteria 2885334103 2885339410 205
751 iso_pu_bacteria 2904659560 2904661729 205
752 iso_pu_bacteria 2906378014 2906384549 205
753 iso_pu_bacteria 2937861824 2937864787 205
754 iso_pu_bacteria 2937877337 2937879128 205
755 iso_pu_bacteria 2937891427 2937893418 205
756 iso_pu_bacteria 2937972304 2937975126 205
757 iso_pu_bacteria 2937980651 2937984422 205
758 iso_pu_bacteria 2958034702 2958034885 205
759 iso_pu_bacteria 2958041894 2958042986 205
760 iso_pu_bacteria 2958071322 2958074129 205
761 iso_pu_bacteria 2958084443 2958086302 205
762 iso_pu_bacteria 2958108152 2958110212 205
763 iso_pu_bacteria 2958122699 2958129431 205
764 iso_pu_bacteria 2958137437 2958143368 205
765 iso_pu_bacteria 2958144490 2958144834 205
766 iso_pu_bacteria 2958158011 2958161964 205
767 iso_pu_bacteria 2958165035 2958169758 205
768 iso_pu_bacteria 2961114664 2961116882 205
769 iso_pu_bacteria 2961127735 2961135050 205
770 iso_pu_bacteria 2961136820 2961143056 205
771 iso_pu_bacteria 2961163497 2961168218 205
772 iso_pu_bacteria 2961183825 2961184569 205
773 iso_pu_bacteria 2963644680 2963648499 205
774 iso_pu_bacteria 2965018300 2965023037 205
775 iso_pu_bacteria 2965025482 2965029386 205
776 iso_pu_bacteria 2965032056 2965038529 205
777 iso_pu_bacteria 2965040258 2965042332 205
778 iso_pu_bacteria 2965047637 2965051240 205
779 iso_pu_bacteria 2965062239 2965068179 205
780 iso_pu_bacteria 2965089291 2965094745 205
781 iso_pu_bacteria 2965102966 2965108817 205
782 iso_pu_bacteria 2968016561 2968017692 205
783 iso_pu_bacteria 2968083720 2968083729 205
784 iso_pu_bacteria 2968091066 2968091924 205
785 iso_pu_bacteria 2968110612 2968112789 205
786 iso_pu_bacteria 2968128360 2968129985 205
787 iso_pu_bacteria 2968171901 2968176618 205
788 iso_pu_bacteria 2970469710 2970472133 205
789 iso_pu_bacteria 2970547951 2970548186 205
790 iso_pu_bacteria 2970554993 2970559557 205
791 iso_pu_bacteria 2970593180 2970593365 205
792 iso_pu_bacteria 2970619444 2970624884 205
793 iso_pu_bacteria 2970627176 2970631591 205
794 iso_pu_bacteria 2977851361 2977852009 205
795 iso_pu_bacteria 2977858184 2977860324 205
796 iso_pu_bacteria 2977864932 2977872136 205
797 iso_pu_bacteria 2977872689 2977873185 205
798 iso_pu_bacteria 2977907340 2977909290 205
799 iso_pu_bacteria 2977915119 2977922536 205
800 iso_pu_bacteria 2977935797 2977941545 205
801 iso_pu_bacteria 2977950692 2977955747 205
802 iso_pu_bacteria 2977957713 2977963707 205
803 iso_pu_bacteria 2979764755 2979770354 205
804 iso_pu_bacteria 2979772303 2979778909 205
805 iso_pu_bacteria 2979793036 2979793478 205
806 iso_pu_bacteria 2987645492 2987647048 205
807 iso_pu_bacteria 2987659509 2987664232 205
808 iso_pu_bacteria 2987673487 2987680747 205
809 iso_pu_bacteria 2996341866 2996342841 205
810 iso_pu_bacteria 2996348954 2996351050 205
811 iso_pu_bacteria 3000135777 3000138343 205
812 iso_pu_bacteria 3004167301 3004170010 205
813 iso_pu_bacteria 3004188549 3004193287 205
814 iso_pu_bacteria 3004239961 3004247367 205
815 iso_pu_bacteria 3004248173 3004251739 205
816 iso_pu_bacteria 3004275668 3004277748 205
817 iso_pu_bacteria 3004289098 3004296890 205
818 iso_pu_bacteria 3004334049 3004340528 205
819 iso_pu_bacteria 637000159 637073771 205
820 iso_pu_bacteria 649633066 649873792 205
821 iso_pu_bacteria 8004300914 8004301443 205
822 iso_pu_bacteria 8004361976 8004364092 205
823 iso_pu_bacteria 8004640170 8004643294 205
824 iso_pu_bacteria 8004727605 8004729966 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

38

201

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ikb-assembly2.cif.gz_B the structure of a conserved protein from streptococcus mutans ua159. 0.8928 5 204
3ikb-assembly2.cif.gz_B the structure of a conserved protein from streptococcus mutans ua159. 0.8541 5 204
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7024 2 205
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7012 5 202
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.6961 2 205
ID Description Score Start End Superfamily
3ikbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.87 2 204 3.40.470.10
3ikbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7959 2 204 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6956 5 202 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6935 2 205 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6872 2 205 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A3S1DXY3-F1-model_v4 Uracil-DNA glycosylase family protein 0.9963 118 205
AF-A0A527HG90-F1-model_v4 Uracil-DNA glycosylase family protein 0.9871 126 205
AF-I5C0B7-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9866 29 204
AF-A0A349QE44-F1-model_v4 deleted 0.9844 4 135
AF-A0A530NB69-F1-model_v4 deleted 0.9836 1 139

Feature Viewer

pLDDT pTM Quality
94.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map