F482406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 824 | 550 | 542 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0000140|Ga0500568_0000140_61944_62573 |
| Length | 209 |
| Sequence | VLQPDRDGELERLAARIRACRICVDSPAGRPLPHEPRPVVVPSATAKILIAGQAPGTKVHLSGKPFSDASGDRLRDWLGVSSEIFYDAEKIAMAGMGFCFPGQDAKGGDLRPRRECAPAWRSPLMALMPQIELVVAVGLYAQAWHIGGRARSLTDTVRDWRGILERTNGPKIIPLPHSSWRNTGWIRMNPWFETDLLPRLKTEIALRLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 8 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 9 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 10 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 11 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 12 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 13 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 14 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 15 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 16 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 17 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 18 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 19 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 20 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 21 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 22 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 23 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 24 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 25 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 26 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 27 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 28 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 29 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 30 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 31 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 32 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 33 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 34 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 35 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 36 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 37 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 38 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 39 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 40 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 41 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 42 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 43 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 44 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 45 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 46 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 47 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 48 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 49 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 50 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 51 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 52 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 53 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 54 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 55 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 56 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 57 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 58 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 59 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 60 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 61 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 62 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 63 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 64 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 65 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 66 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 67 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 68 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 69 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 70 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 71 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 72 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 73 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 74 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 75 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 76 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 77 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 78 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 79 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 80 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 81 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 82 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 83 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 84 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 85 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 86 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 87 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 88 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 89 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 90 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 91 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 92 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 93 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 94 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 95 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 96 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 97 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 98 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 99 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 100 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 101 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 102 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 103 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 104 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 105 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 106 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 107 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 108 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 109 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 110 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 111 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 112 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 113 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 114 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 115 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 116 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 117 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 118 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 119 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 120 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 121 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 122 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 123 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 124 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 125 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 126 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 127 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 128 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 129 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 130 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 131 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 132 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 133 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 134 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 135 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 136 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 137 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 138 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 139 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 140 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 141 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 142 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 143 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 144 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 145 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 146 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 147 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 148 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 149 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 150 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 151 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 152 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 153 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 154 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 155 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 156 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 157 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 158 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 159 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 160 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 161 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 162 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 163 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 164 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 165 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 166 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 167 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 168 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 169 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 170 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 171 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 172 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 173 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 174 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 175 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 176 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 177 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 178 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 179 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 180 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 181 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 182 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 183 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 184 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 185 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 186 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 187 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 188 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 189 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 190 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 191 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 192 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 193 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 194 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 195 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 196 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 197 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 198 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 199 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 200 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 201 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 202 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 203 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 204 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 205 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 206 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 207 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 208 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 209 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 210 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 211 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 212 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 213 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 214 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 215 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 216 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 217 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 218 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 219 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 220 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 221 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 222 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 223 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 224 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 225 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 226 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 227 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 228 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 229 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 230 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 231 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 232 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 233 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 234 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 235 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 236 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 237 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 238 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 239 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 240 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 241 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 242 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 243 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 244 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 245 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 246 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 247 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 248 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 249 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 250 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 251 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 252 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 253 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 254 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 255 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 256 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 257 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 258 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 259 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 260 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 261 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 262 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 263 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 264 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 265 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 266 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 267 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 268 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 269 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 270 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 271 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 272 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 273 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 274 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 275 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 276 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 277 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 278 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 279 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 283 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 286 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 289 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 291 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 292 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 293 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 294 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 295 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 297 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 298 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 299 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 300 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 301 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 302 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 303 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 304 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 305 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 306 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 307 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 308 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 309 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 310 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 312 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 313 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 314 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 315 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 316 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 330 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 331 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 338 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 341 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 342 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 343 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 344 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 345 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 346 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 349 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 350 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 353 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 356 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 358 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 389 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 390 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 393 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 394 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 395 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 396 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 397 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 398 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 399 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 400 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 401 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 402 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 403 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 404 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 405 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 406 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 407 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 408 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 409 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 410 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 411 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 412 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 444 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 445 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 446 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 447 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 448 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 449 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 452 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 453 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 454 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 455 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 456 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 457 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 458 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 459 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 460 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 461 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 462 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 463 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 464 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 465 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 466 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 467 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 468 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 502 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 503 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 504 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 505 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 506 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 507 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 508 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 514 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 515 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 516 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 517 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 518 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 519 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 520 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 521 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 522 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 523 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 524 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 525 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 526 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 527 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 529 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 532 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 533 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 534 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 535 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 536 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 537 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 538 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 539 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 540 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 541 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 542 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 543 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 544 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 545 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 546 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 547 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 548 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 549 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 550 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 65.78 |
| Metatranscriptomes | 0 |
| Isolates | 34.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 13.23 |
| Nodule | 27.06 |
| Rhizoplane | 5.1 |
| Rhizosphere | 45.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10018881 | 3300001989 | Bacteria | 2473 |
| 2 | JGI24739J22299_10041069 | 3300001989 | Bacteria | 1541 |
| 3 | JGI24735J21928_10017647 | 3300002067 | Bacteria | 2206 |
| 4 | JGI25152J39213_1001161 | 3300002773 | Bacteria | 12171 |
| 5 | JGI25152J39213_1003234 | 3300002773 | Bacteria | 5662 |
| 6 | JGI25152J39213_1008147 | 3300002773 | Bacteria | 2628 |
| 7 | JGI25152J39213_1008149 | 3300002773 | Bacteria | 2628 |
| 8 | JGI25150J39212_1000160 | 3300002774 | Bacteria | 38064 |
| 9 | JGI25159J45721_1002671 | 3300002987 | Bacteria | 6639 |
| 10 | JGI25151J46595_10000083 | 3300003187 | Bacteria | 130658 |
| 11 | JGI25151J46595_10054262 | 3300003187 | Bacteria | 1331 |
| 12 | JGI25153J46596_10000965 | 3300003215 | Bacteria | 17426 |
| 13 | JGI25153J46596_10005509 | 3300003215 | Bacteria | 6626 |
| 14 | JGI25153J46596_10019173 | 3300003215 | Bacteria | 2628 |
| 15 | JGI25153J46596_10019175 | 3300003215 | Bacteria | 2628 |
| 16 | JGI25160J50197_1013793 | 3300003354 | Bacteria | 2736 |
| 17 | JGI25161J50226_1000414 | 3300003374 | Bacteria | 20639 |
| 18 | Ga0055542_1000709 | 3300003762 | Bacteria | 26239 |
| 19 | Ga0055526_1001540 | 3300003771 | Bacteria | 16308 |
| 20 | Ga0055524_1009863 | 3300003775 | Bacteria | 3845 |
| 21 | Ga0055528_1022222 | 3300003790 | Bacteria | 1982 |
| 22 | Ga0055540_1014360 | 3300003792 | Bacteria | 2360 |
| 23 | Ga0055543_1000219 | 3300004625 | Bacteria | 45978 |
| 24 | Ga0070658_10169662 | 3300005327 | Bacteria | 1833 |
| 25 | Ga0070666_10504762 | 3300005335 | Bacteria | 877 |
| 26 | Ga0070660_100217678 | 3300005339 | Bacteria | 1552 |
| 27 | Ga0070689_100302016 | 3300005340 | Bacteria | 1333 |
| 28 | Ga0070674_100136550 | 3300005356 | Bacteria | 1835 |
| 29 | Ga0070673_100145380 | 3300005364 | Bacteria | 2004 |
| 30 | Ga0070688_100189615 | 3300005365 | Bacteria | 1431 |
| 31 | Ga0070688_100497805 | 3300005365 | Bacteria | 919 |
| 32 | Ga0070688_100855855 | 3300005365 | Bacteria | 714 |
| 33 | Ga0070667_101117083 | 3300005367 | Bacteria | 737 |
| 34 | Ga0070711_100110767 | 3300005439 | Bacteria | 2015 |
| 35 | Ga0070700_100306757 | 3300005441 | Bacteria | 1161 |
| 36 | Ga0070708_101088606 | 3300005445 | Bacteria | 749 |
| 37 | Ga0068867_100086622 | 3300005459 | Bacteria | 2370 |
| 38 | Ga0070684_100916166 | 3300005535 | Bacteria | 821 |
| 39 | Ga0070697_100918069 | 3300005536 | Bacteria | 777 |
| 40 | Ga0068853_100077411 | 3300005539 | Bacteria | 2905 |
| 41 | Ga0068853_100103070 | 3300005539 | Bacteria | 2525 |
| 42 | Ga0070665_100105659 | 3300005548 | Bacteria | 2818 |
| 43 | Ga0070665_100114636 | 3300005548 | Bacteria | 2698 |
| 44 | Ga0070665_100182460 | 3300005548 | Bacteria | 2100 |
| 45 | Ga0070665_100380116 | 3300005548 | Bacteria | 1419 |
| 46 | Ga0070665_100808426 | 3300005548 | Bacteria | 950 |
| 47 | Ga0070664_100474056 | 3300005564 | Bacteria | 1151 |
| 48 | Ga0068857_100848818 | 3300005577 | Bacteria | 874 |
| 49 | Ga0068854_100215787 | 3300005578 | Bacteria | 1516 |
| 50 | Ga0068859_100017558 | 3300005617 | Bacteria | 7194 |
| 51 | Ga0068866_10050358 | 3300005718 | Bacteria | 2115 |
| 52 | Ga0068858_100035950 | 3300005842 | Bacteria | 4594 |
| 53 | Ga0068858_100413743 | 3300005842 | Bacteria | 1296 |
| 54 | Ga0081540_1008997 | 3300005983 | Bacteria | 6908 |
| 55 | Ga0081539_10003985 | 3300005985 | Bacteria | 17045 |
| 56 | Ga0081539_10021439 | 3300005985 | Bacteria | 4318 |
| 57 | Ga0075365_10014999 | 3300006038 | Bacteria | 4675 |
| 58 | Ga0075365_10027101 | 3300006038 | Bacteria | 3642 |
| 59 | Ga0075365_10091312 | 3300006038 | Bacteria | 2075 |
| 60 | Ga0075365_10193096 | 3300006038 | Bacteria | 1425 |
| 61 | Ga0075365_10349904 | 3300006038 | Bacteria | 1042 |
| 62 | Ga0075365_10352199 | 3300006038 | Bacteria | 1038 |
| 63 | Ga0075368_10012900 | 3300006042 | Bacteria | 3061 |
| 64 | Ga0075368_10014251 | 3300006042 | Bacteria | 2934 |
| 65 | Ga0075363_100110039 | 3300006048 | Bacteria | 1531 |
| 66 | Ga0075364_10000062 | 3300006051 | Bacteria | 40697 |
| 67 | Ga0075364_10013107 | 3300006051 | Bacteria | 5087 |
| 68 | Ga0075364_10211377 | 3300006051 | Bacteria | 1316 |
| 69 | Ga0075362_10081134 | 3300006177 | Bacteria | 1495 |
| 70 | Ga0075362_10215162 | 3300006177 | Bacteria | 938 |
| 71 | Ga0075367_10080105 | 3300006178 | Bacteria | 1975 |
| 72 | Ga0075367_10090395 | 3300006178 | Bacteria | 1862 |
| 73 | Ga0075369_10021398 | 3300006186 | Bacteria | 2658 |
| 74 | Ga0075369_10045442 | 3300006186 | Bacteria | 1889 |
| 75 | Ga0097621_100313580 | 3300006237 | Bacteria | 1388 |
| 76 | Ga0075370_10023686 | 3300006353 | Bacteria | 3384 |
| 77 | Ga0075370_10137672 | 3300006353 | Bacteria | 1427 |
| 78 | Ga0075370_10185657 | 3300006353 | Bacteria | 1224 |
| 79 | Ga0075428_100137737 | 3300006844 | Bacteria | 2654 |
| 80 | Ga0075428_100186959 | 3300006844 | Bacteria | 2241 |
| 81 | Ga0075428_100349710 | 3300006844 | Bacteria | 1586 |
| 82 | Ga0075430_100114035 | 3300006846 | Bacteria | 2252 |
| 83 | Ga0075430_100275110 | 3300006846 | Bacteria | 1393 |
| 84 | Ga0075431_100163193 | 3300006847 | Bacteria | 2290 |
| 85 | Ga0075429_100119139 | 3300006880 | Bacteria | 2306 |
| 86 | Ga0097620_100017559 | 3300006931 | Bacteria | 7194 |
| 87 | Ga0105240_10129075 | 3300009093 | Bacteria | 3034 |
| 88 | Ga0105240_10738840 | 3300009093 | Bacteria | 1071 |
| 89 | Ga0111539_10031929 | 3300009094 | Bacteria | 6397 |
| 90 | Ga0111539_10504970 | 3300009094 | Bacteria | 1408 |
| 91 | Ga0105245_11128131 | 3300009098 | Bacteria | 831 |
| 92 | Ga0105247_10003673 | 3300009101 | Bacteria | 9968 |
| 93 | Ga0105243_10108387 | 3300009148 | Bacteria | 2318 |
| 94 | Ga0105243_10287991 | 3300009148 | Bacteria | 1483 |
| 95 | Ga0105241_10102121 | 3300009174 | Bacteria | 2281 |
| 96 | Ga0105248_10099697 | 3300009177 | Bacteria | 3273 |
| 97 | Ga0105237_10118005 | 3300009545 | Bacteria | 2647 |
| 98 | Ga0105237_10122860 | 3300009545 | Bacteria | 2590 |
| 99 | Ga0105237_10148857 | 3300009545 | Bacteria | 2337 |
| 100 | Ga0105238_10001891 | 3300009551 | Bacteria | 21002 |
| 101 | Ga0105238_10671985 | 3300009551 | Bacteria | 1047 |
| 102 | Ga0105249_11033699 | 3300009553 | Bacteria | 891 |
| 103 | Ga0105239_10038780 | 3300010375 | Bacteria | 5220 |
| 104 | Ga0105239_10067789 | 3300010375 | Bacteria | 3920 |
| 105 | Ga0105239_10269759 | 3300010375 | Bacteria | 1914 |
| 106 | Ga0105239_10402337 | 3300010375 | Bacteria | 1549 |
| 107 | Ga0105239_10415438 | 3300010375 | Bacteria | 1523 |
| 108 | Ga0105246_10029897 | 3300011119 | Bacteria | 3593 |
| 109 | Ga0105246_11104067 | 3300011119 | Bacteria | 724 |
| 110 | Ga0157321_1007870 | 3300012487 | Bacteria | 761 |
| 111 | Ga0157315_1002326 | 3300012508 | Bacteria | 1177 |
| 112 | Ga0157370_10178323 | 3300013104 | Bacteria | 1975 |
| 113 | Ga0157369_10134081 | 3300013105 | Bacteria | 2623 |
| 114 | Ga0157369_10262250 | 3300013105 | Bacteria | 1802 |
| 115 | Ga0157374_10370978 | 3300013296 | Bacteria | 1424 |
| 116 | Ga0157374_10575989 | 3300013296 | Bacteria | 1135 |
| 117 | Ga0157372_10696416 | 3300013307 | Bacteria | 1182 |
| 118 | Ga0157375_10006048 | 3300013308 | Bacteria | 10553 |
| 119 | Ga0157375_10789118 | 3300013308 | Bacteria | 1099 |
| 120 | Ga0163163_10094507 | 3300014325 | Bacteria | 3008 |
| 121 | Ga0182008_10060664 | 3300014497 | Bacteria | 1864 |
| 122 | Ga0157379_10123932 | 3300014968 | Bacteria | 2325 |
| 123 | Ga0157376_10035430 | 3300014969 | Bacteria | 4037 |
| 124 | Ga0182006_1069305 | 3300015261 | Bacteria | 1312 |
| 125 | Ga0182007_10029650 | 3300015262 | Bacteria | 1873 |
| 126 | Ga0182005_1028972 | 3300015265 | Bacteria | 1510 |
| 127 | Ga0209436_100020 | 3300025208 | Bacteria | 104602 |
| 128 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 129 | Ga0207425_1008008 | 3300025245 | Bacteria | 2739 |
| 130 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 131 | Ga0209677_111155 | 3300025253 | Bacteria | 1426 |
| 132 | Ga0209148_1000072 | 3300025254 | Bacteria | 325292 |
| 133 | Ga0209148_1009801 | 3300025254 | Bacteria | 1846 |
| 134 | Ga0209759_1000146 | 3300025256 | Bacteria | 121497 |
| 135 | Ga0209129_1000184 | 3300025258 | Bacteria | 87102 |
| 136 | Ga0209129_1006281 | 3300025258 | Bacteria | 3903 |
| 137 | Ga0209129_1006407 | 3300025258 | Bacteria | 3811 |
| 138 | Ga0209129_1009808 | 3300025258 | Bacteria | 2467 |
| 139 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 140 | Ga0209455_1000153 | 3300025272 | Bacteria | 124411 |
| 141 | Ga0209673_1005268 | 3300025273 | Bacteria | 6568 |
| 142 | Ga0209673_1005745 | 3300025273 | Bacteria | 6179 |
| 143 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 144 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 145 | Ga0209025_1003187 | 3300025294 | Bacteria | 15914 |
| 146 | Ga0209025_1042481 | 3300025294 | Bacteria | 1931 |
| 147 | Ga0209564_1000362 | 3300025295 | Bacteria | 84376 |
| 148 | Ga0209758_1000083 | 3300025297 | Bacteria | 257283 |
| 149 | Ga0209758_1000540 | 3300025297 | Bacteria | 60103 |
| 150 | Ga0209758_1000564 | 3300025297 | Bacteria | 58328 |
| 151 | Ga0209758_1003996 | 3300025297 | Bacteria | 12765 |
| 152 | Ga0209758_1005023 | 3300025297 | Bacteria | 10539 |
| 153 | Ga0209256_1000383 | 3300025299 | Bacteria | 70773 |
| 154 | Ga0209256_1006317 | 3300025299 | Bacteria | 6338 |
| 155 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 156 | Ga0209051_1001845 | 3300025303 | Bacteria | 16708 |
| 157 | Ga0209051_1004341 | 3300025303 | Bacteria | 8795 |
| 158 | Ga0207642_10053532 | 3300025899 | Bacteria | 1836 |
| 159 | Ga0207710_10026346 | 3300025900 | Bacteria | 2512 |
| 160 | Ga0207710_10133801 | 3300025900 | Bacteria | 1192 |
| 161 | Ga0207647_10013583 | 3300025904 | Bacteria | 5639 |
| 162 | Ga0207647_10150832 | 3300025904 | Bacteria | 1359 |
| 163 | Ga0207647_10238100 | 3300025904 | Bacteria | 1046 |
| 164 | Ga0207645_10366041 | 3300025907 | Bacteria | 966 |
| 165 | Ga0207705_10257032 | 3300025909 | Bacteria | 1333 |
| 166 | Ga0207654_10283590 | 3300025911 | Bacteria | 1121 |
| 167 | Ga0207695_10169295 | 3300025913 | Bacteria | 2111 |
| 168 | Ga0207671_10074585 | 3300025914 | Bacteria | 2536 |
| 169 | Ga0207671_10364726 | 3300025914 | Bacteria | 1147 |
| 170 | Ga0207663_10113354 | 3300025916 | Bacteria | 1844 |
| 171 | Ga0207663_10165687 | 3300025916 | Bacteria | 1565 |
| 172 | Ga0207657_10172967 | 3300025919 | Bacteria | 1749 |
| 173 | Ga0207649_10376537 | 3300025920 | Bacteria | 1057 |
| 174 | Ga0207690_10450295 | 3300025932 | Bacteria | 1035 |
| 175 | Ga0207690_10841420 | 3300025932 | Unclassified | 759 |
| 176 | Ga0207670_10145945 | 3300025936 | Bacteria | 1750 |
| 177 | Ga0207704_10083845 | 3300025938 | Bacteria | 2069 |
| 178 | Ga0207711_10096136 | 3300025941 | Bacteria | 2614 |
| 179 | Ga0207667_10354717 | 3300025949 | Bacteria | 1495 |
| 180 | Ga0207651_10199005 | 3300025960 | Bacteria | 1604 |
| 181 | Ga0207712_10817146 | 3300025961 | Bacteria | 820 |
| 182 | Ga0207668_10429349 | 3300025972 | Bacteria | 1123 |
| 183 | Ga0207658_10297764 | 3300025986 | Bacteria | 1389 |
| 184 | Ga0207703_10113317 | 3300026035 | Bacteria | 2317 |
| 185 | Ga0207703_10209918 | 3300026035 | Bacteria | 1735 |
| 186 | Ga0207639_10062734 | 3300026041 | Bacteria | 2875 |
| 187 | Ga0207639_10453860 | 3300026041 | Bacteria | 1164 |
| 188 | Ga0207678_10033030 | 3300026067 | Bacteria | 4509 |
| 189 | Ga0207708_10148393 | 3300026075 | Bacteria | 1844 |
| 190 | Ga0207674_10023876 | 3300026116 | Bacteria | 6540 |
| 191 | Ga0207674_10297808 | 3300026116 | Bacteria | 1562 |
| 192 | Ga0207675_100062687 | 3300026118 | Bacteria | 3473 |
| 193 | Ga0207675_100478715 | 3300026118 | Bacteria | 1237 |
| 194 | Ga0207683_10243403 | 3300026121 | Bacteria | 1641 |
| 195 | Ga0207698_10174110 | 3300026142 | Bacteria | 1898 |
| 196 | Ga0207698_11115947 | 3300026142 | Bacteria | 802 |
| 197 | Ga0209813_10004378 | 3300027866 | Bacteria | 3373 |
| 198 | Ga0209813_10047150 | 3300027866 | Bacteria | 1333 |
| 199 | Ga0207428_10023808 | 3300027907 | Bacteria | 5144 |
| 200 | Ga0268266_10034806 | 3300028379 | Bacteria | 4285 |
| 201 | Ga0268266_10057364 | 3300028379 | Bacteria | 3351 |
| 202 | Ga0268266_10058320 | 3300028379 | Bacteria | 3324 |
| 203 | Ga0268266_10156687 | 3300028379 | Bacteria | 2058 |
| 204 | Ga0268266_10190330 | 3300028379 | Bacteria | 1873 |
| 205 | Ga0268266_10312154 | 3300028379 | Bacteria | 1469 |
| 206 | Ga0268266_10492430 | 3300028379 | Bacteria | 1170 |
| 207 | Ga0268264_10194798 | 3300028381 | Bacteria | 1850 |
| 208 | Ga0268264_11120963 | 3300028381 | Bacteria | 795 |
| 209 | Ga0307408_100222905 | 3300031548 | Bacteria | 1540 |
| 210 | Ga0307405_10002270 | 3300031731 | Bacteria | 8416 |
| 211 | Ga0316577_10168792 | 3300031733 | Bacteria | 1234 |
| 212 | Ga0316577_10243815 | 3300031733 | Bacteria | 1016 |
| 213 | Ga0307412_10001552 | 3300031911 | Bacteria | 12679 |
| 214 | Ga0307416_100263980 | 3300032002 | Bacteria | 1685 |
| 215 | Ga0316585_10099936 | 3300032137 | Bacteria | 951 |
| 216 | Ga0373960_0046026 | 3300035121 | Bacteria | 1279 |
| 217 | Ga0316574_0089728 | 3300035398 | Bacteria | 1958 |
| 218 | Ga0373931_0019173 | 3300035691 | Bacteria | 3411 |
| 219 | Ga0316582_0029995 | 3300036647 | Bacteria | 3308 |
| 220 | Ga0316582_0222899 | 3300036647 | Bacteria | 1289 |
| 221 | Ga0316584_0383742 | 3300036712 | Bacteria | 1003 |
| 222 | Ga0395899_0000130 | 3300037312 | Bacteria | 117976 |
| 223 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 224 | Ga0395900_0063098 | 3300037418 | Bacteria | 3809 |
| 225 | Ga0395900_0189461 | 3300037418 | Bacteria | 2087 |
| 226 | Ga0395900_0484345 | 3300037418 | Bacteria | 1189 |
| 227 | Ga0395898_0000104 | 3300037466 | Bacteria | 223462 |
| 228 | Ga0395898_0082399 | 3300037466 | Bacteria | 3101 |
| 229 | Ga0395898_0593280 | 3300037466 | Bacteria | 1050 |
| 230 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 231 | Ga0395905_0013264 | 3300037471 | Bacteria | 7905 |
| 232 | Ga0395905_0259547 | 3300037471 | Bacteria | 1622 |
| 233 | Ga0395905_0291790 | 3300037471 | Bacteria | 1518 |
| 234 | Ga0395905_0325403 | 3300037471 | Bacteria | 1427 |
| 235 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 236 | Ga0395901_0072706 | 3300038443 | Bacteria | 3585 |
| 237 | Ga0395901_0197977 | 3300038443 | Bacteria | 2106 |
| 238 | Ga0395901_0360121 | 3300038443 | Bacteria | 1500 |
| 239 | Ga0395901_0550412 | 3300038443 | Bacteria | 1169 |
| 240 | Ga0395901_0601542 | 3300038443 | Bacteria | 1109 |
| 241 | Ga0395901_0631794 | 3300038443 | Bacteria | 1076 |
| 242 | Ga0439465_0013562 | 3300041413 | Bacteria | 2539 |
| 243 | Ga0451853_1125249 | 3300041512 | Bacteria | 1012 |
| 244 | Ga0466972_0015679 | 3300044658 | Bacteria | 3789 |
| 245 | Ga0466972_0050436 | 3300044658 | Bacteria | 2009 |
| 246 | Ga0466960_0017406 | 3300044901 | Bacteria | 3133 |
| 247 | Ga0495627_087496 | 3300046453 | Bacteria | 898 |
| 248 | Ga0495592_0150150 | 3300046454 | Bacteria | 1612 |
| 249 | Ga0495638_0063514 | 3300046460 | Bacteria | 2276 |
| 250 | Ga0495638_0110086 | 3300046460 | Bacteria | 1637 |
| 251 | Ga0495650_0165222 | 3300046471 | Bacteria | 786 |
| 252 | Ga0495584_0055155 | 3300046491 | Bacteria | 2000 |
| 253 | Ga0495596_0047199 | 3300046500 | Bacteria | 1690 |
| 254 | Ga0495607_0024169 | 3300046501 | Bacteria | 3792 |
| 255 | Ga0495583_0039963 | 3300046506 | Bacteria | 2206 |
| 256 | Ga0495610_0046741 | 3300046512 | Bacteria | 2133 |
| 257 | Ga0495610_0069620 | 3300046512 | Bacteria | 1646 |
| 258 | Ga0495632_0121825 | 3300046519 | Bacteria | 1219 |
| 259 | Ga0495643_0003338 | 3300046522 | Bacteria | 11827 |
| 260 | Ga0495643_0020809 | 3300046522 | Bacteria | 3775 |
| 261 | Ga0495643_0075461 | 3300046522 | Bacteria | 1764 |
| 262 | Ga0495652_0514347 | 3300046529 | Bacteria | 828 |
| 263 | Ga0495597_0010723 | 3300046542 | Bacteria | 4467 |
| 264 | Ga0495597_0022344 | 3300046542 | Bacteria | 2935 |
| 265 | Ga0495622_0081107 | 3300046557 | Bacteria | 1492 |
| 266 | Ga0495656_0356199 | 3300046615 | Bacteria | 759 |
| 267 | Ga0495668_0091293 | 3300046616 | Bacteria | 1669 |
| 268 | Ga0495668_0173265 | 3300046616 | Bacteria | 1182 |
| 269 | Ga0495625_0195480 | 3300046660 | Bacteria | 1338 |
| 270 | Ga0495625_0221508 | 3300046660 | Bacteria | 1239 |
| 271 | Ga0495625_0229691 | 3300046660 | Bacteria | 1212 |
| 272 | Ga0495649_0027292 | 3300046694 | Bacteria | 3169 |
| 273 | Ga0495600_0006725 | 3300046809 | Bacteria | 7009 |
| 274 | Ga0495660_0033393 | 3300046810 | Bacteria | 2885 |
| 275 | Ga0495604_0059509 | 3300047317 | Bacteria | 2927 |
| 276 | Ga0495672_0154252 | 3300047320 | Bacteria | 1188 |
| 277 | Ga0495683_0110752 | 3300047323 | Bacteria | 1311 |
| 278 | Ga0495687_023368 | 3300047443 | Bacteria | 2953 |
| 279 | Ga0495687_051359 | 3300047443 | Bacteria | 1750 |
| 280 | Ga0495677_0178026 | 3300047445 | Bacteria | 824 |
| 281 | Ga0495673_0057222 | 3300047469 | Bacteria | 1684 |
| 282 | Ga0495686_0043882 | 3300047472 | Bacteria | 2832 |
| 283 | Ga0495686_0242374 | 3300047472 | Bacteria | 1016 |
| 284 | Ga0495602_0512096 | 3300048088 | Bacteria | 837 |
| 285 | Ga0495626_0119284 | 3300048091 | Bacteria | 1136 |
| 286 | Ga0496100_0042786 | 3300048903 | Bacteria | 2894 |
| 287 | Ga0496101_0024156 | 3300048904 | Bacteria | 4204 |
| 288 | Ga0496101_0121113 | 3300048904 | Bacteria | 1978 |
| 289 | Ga0496101_0195603 | 3300048904 | Bacteria | 1562 |
| 290 | Ga0496102_0012754 | 3300048905 | Bacteria | 7277 |
| 291 | Ga0496102_0073490 | 3300048905 | Bacteria | 3142 |
| 292 | Ga0496102_0078314 | 3300048905 | Bacteria | 3043 |
| 293 | Ga0496102_0241989 | 3300048905 | Bacteria | 1701 |
| 294 | Ga0496102_0286409 | 3300048905 | Bacteria | 1553 |
| 295 | Ga0496102_0816474 | 3300048905 | Bacteria | 855 |
| 296 | Ga0496103_0089799 | 3300048906 | Bacteria | 1938 |
| 297 | Ga0496104_0003490 | 3300048907 | Bacteria | 13560 |
| 298 | Ga0496104_0013865 | 3300048907 | Bacteria | 7271 |
| 299 | Ga0496105_0008593 | 3300048908 | Bacteria | 7935 |
| 300 | Ga0496105_0061772 | 3300048908 | Bacteria | 3092 |
| 301 | Ga0496105_0773586 | 3300048908 | Bacteria | 732 |
| 302 | Ga0496106_0004483 | 3300048909 | Bacteria | 10356 |
| 303 | Ga0496106_0235767 | 3300048909 | Bacteria | 1461 |
| 304 | Ga0496106_0264761 | 3300048909 | Bacteria | 1376 |
| 305 | Ga0496106_0542304 | 3300048909 | Bacteria | 933 |
| 306 | Ga0496107_0003137 | 3300048910 | Bacteria | 10993 |
| 307 | Ga0496107_0153283 | 3300048910 | Bacteria | 1705 |
| 308 | Ga0496108_0043855 | 3300048911 | Bacteria | 3736 |
| 309 | Ga0496108_0167653 | 3300048911 | Bacteria | 1899 |
| 310 | Ga0496109_0008718 | 3300048912 | Bacteria | 8635 |
| 311 | Ga0496109_0029960 | 3300048912 | Bacteria | 4877 |
| 312 | Ga0496109_0178176 | 3300048912 | Bacteria | 1996 |
| 313 | Ga0496109_0293262 | 3300048912 | Bacteria | 1533 |
| 314 | Ga0496110_0074846 | 3300048913 | Bacteria | 3008 |
| 315 | Ga0496110_0786980 | 3300048913 | Bacteria | 855 |
| 316 | Ga0496111_0125368 | 3300048914 | Bacteria | 1898 |
| 317 | Ga0496111_0416213 | 3300048914 | Bacteria | 993 |
| 318 | Ga0496112_0014397 | 3300048915 | Bacteria | 7335 |
| 319 | Ga0496112_0055798 | 3300048915 | Bacteria | 3886 |
| 320 | Ga0496112_0426904 | 3300048915 | Bacteria | 1264 |
| 321 | Ga0496113_0022191 | 3300048916 | Bacteria | 4486 |
| 322 | Ga0496113_0510636 | 3300048916 | Bacteria | 965 |
| 323 | Ga0496114_0003619 | 3300048917 | Bacteria | 11881 |
| 324 | Ga0496114_0019558 | 3300048917 | Bacteria | 5487 |
| 325 | Ga0496115_0006559 | 3300048918 | Bacteria | 8532 |
| 326 | Ga0496115_0041346 | 3300048918 | Bacteria | 3668 |
| 327 | Ga0496115_0136319 | 3300048918 | Bacteria | 2024 |
| 328 | Ga0496116_0001253 | 3300048919 | Bacteria | 29488 |
| 329 | Ga0496116_0005379 | 3300048919 | Bacteria | 11916 |
| 330 | Ga0496116_0026038 | 3300048919 | Bacteria | 4286 |
| 331 | Ga0496116_0134978 | 3300048919 | Bacteria | 1399 |
| 332 | Ga0496116_0144724 | 3300048919 | Bacteria | 1330 |
| 333 | Ga0496117_0006763 | 3300048920 | Bacteria | 11452 |
| 334 | Ga0496117_0119188 | 3300048920 | Bacteria | 1625 |
| 335 | Ga0496118_0009778 | 3300048921 | Bacteria | 9615 |
| 336 | Ga0496118_0135320 | 3300048921 | Bacteria | 1574 |
| 337 | Ga0496118_0140714 | 3300048921 | Bacteria | 1530 |
| 338 | Ga0496119_0026981 | 3300048922 | Bacteria | 3965 |
| 339 | Ga0496119_0178653 | 3300048922 | Bacteria | 1115 |
| 340 | Ga0496120_0001570 | 3300048923 | Bacteria | 26727 |
| 341 | Ga0496121_0018899 | 3300048924 | Bacteria | 6917 |
| 342 | Ga0496121_0040712 | 3300048924 | Bacteria | 4071 |
| 343 | Ga0496122_0011480 | 3300048925 | Bacteria | 8962 |
| 344 | Ga0496122_0022378 | 3300048925 | Bacteria | 5620 |
| 345 | Ga0496122_0032443 | 3300048925 | Bacteria | 4318 |
| 346 | Ga0496122_0048321 | 3300048925 | Bacteria | 3274 |
| 347 | Ga0496122_0088520 | 3300048925 | Bacteria | 2121 |
| 348 | Ga0496122_0164325 | 3300048925 | Bacteria | 1348 |
| 349 | Ga0496123_0020989 | 3300048926 | Bacteria | 5090 |
| 350 | Ga0496123_0058781 | 3300048926 | Bacteria | 2491 |
| 351 | Ga0496123_0113413 | 3300048926 | Bacteria | 1543 |
| 352 | Ga0496123_0131238 | 3300048926 | Bacteria | 1387 |
| 353 | Ga0496124_0003917 | 3300048927 | Bacteria | 17784 |
| 354 | Ga0496124_0004950 | 3300048927 | Bacteria | 15269 |
| 355 | Ga0496124_0084022 | 3300048927 | Bacteria | 2611 |
| 356 | Ga0496124_0193123 | 3300048927 | Bacteria | 1556 |
| 357 | Ga0496125_0008039 | 3300048928 | Bacteria | 11135 |
| 358 | Ga0496125_0032793 | 3300048928 | Bacteria | 4608 |
| 359 | Ga0496126_0000824 | 3300048929 | Bacteria | 55178 |
| 360 | Ga0496126_0049161 | 3300048929 | Bacteria | 3851 |
| 361 | Ga0496126_0150033 | 3300048929 | Bacteria | 1999 |
| 362 | Ga0496126_0247957 | 3300048929 | Bacteria | 1485 |
| 363 | Ga0496126_0506216 | 3300048929 | Bacteria | 964 |
| 364 | Ga0501031_0000561 | 3300049568 | Bacteria | 21728 |
| 365 | Ga0501031_0046582 | 3300049568 | Bacteria | 2827 |
| 366 | Ga0501031_0125145 | 3300049568 | Bacteria | 1679 |
| 367 | Ga0501032_0000022 | 3300049569 | Bacteria | 146790 |
| 368 | Ga0501032_0000786 | 3300049569 | Bacteria | 25679 |
| 369 | Ga0501032_0026619 | 3300049569 | Bacteria | 3975 |
| 370 | Ga0501032_0044629 | 3300049569 | Bacteria | 3000 |
| 371 | Ga0501033_0000037 | 3300049570 | Bacteria | 146582 |
| 372 | Ga0501033_0000197 | 3300049570 | Bacteria | 57691 |
| 373 | Ga0501033_0020370 | 3300049570 | Bacteria | 5009 |
| 374 | Ga0501033_0342938 | 3300049570 | Bacteria | 1047 |
| 375 | Ga0501033_0439683 | 3300049570 | Bacteria | 907 |
| 376 | Ga0501033_0614192 | 3300049570 | Bacteria | 745 |
| 377 | Ga0501034_0000901 | 3300049571 | Bacteria | 43252 |
| 378 | Ga0501034_0000960 | 3300049571 | Bacteria | 41575 |
| 379 | Ga0501034_0006623 | 3300049571 | Bacteria | 12429 |
| 380 | Ga0501034_0045975 | 3300049571 | Bacteria | 4410 |
| 381 | Ga0501034_0087179 | 3300049571 | Bacteria | 3121 |
| 382 | Ga0501034_0710203 | 3300049571 | Bacteria | 903 |
| 383 | Ga0501034_0904398 | 3300049571 | Unclassified | 770 |
| 384 | Ga0501036_0001200 | 3300049572 | Bacteria | 19770 |
| 385 | Ga0501036_0018522 | 3300049572 | Bacteria | 5835 |
| 386 | Ga0501036_0032407 | 3300049572 | Bacteria | 4415 |
| 387 | Ga0501036_0040737 | 3300049572 | Bacteria | 3929 |
| 388 | Ga0501036_0307900 | 3300049572 | Bacteria | 1325 |
| 389 | Ga0501037_0000016 | 3300049573 | Bacteria | 161027 |
| 390 | Ga0501037_0000067 | 3300049573 | Bacteria | 96388 |
| 391 | Ga0501037_0100302 | 3300049573 | Bacteria | 2090 |
| 392 | Ga0501038_0000013 | 3300049574 | Bacteria | 167219 |
| 393 | Ga0501038_0000015 | 3300049574 | Bacteria | 161983 |
| 394 | Ga0501038_0082955 | 3300049574 | Bacteria | 2698 |
| 395 | Ga0501039_0000010 | 3300049575 | Bacteria | 247832 |
| 396 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 397 | Ga0501039_0098384 | 3300049575 | Bacteria | 2282 |
| 398 | Ga0501039_0223390 | 3300049575 | Bacteria | 1480 |
| 399 | Ga0501039_0238480 | 3300049575 | Bacteria | 1430 |
| 400 | Ga0501039_0619956 | 3300049575 | Bacteria | 847 |
| 401 | Ga0501039_0783997 | 3300049575 | Bacteria | 744 |
| 402 | Ga0501040_0028998 | 3300049576 | Bacteria | 3734 |
| 403 | Ga0501040_0043688 | 3300049576 | Bacteria | 3055 |
| 404 | Ga0501040_0066538 | 3300049576 | Bacteria | 2483 |
| 405 | Ga0501040_0072292 | 3300049576 | Bacteria | 2382 |
| 406 | Ga0501040_0624934 | 3300049576 | Bacteria | 778 |
| 407 | Ga0501041_0361667 | 3300049577 | Bacteria | 917 |
| 408 | Ga0501042_0060858 | 3300049578 | Bacteria | 2697 |
| 409 | Ga0501042_0132816 | 3300049578 | Bacteria | 1794 |
| 410 | Ga0501042_0583877 | 3300049578 | Bacteria | 812 |
| 411 | Ga0501043_0000056 | 3300049579 | Bacteria | 104302 |
| 412 | Ga0501043_0001689 | 3300049579 | Bacteria | 19157 |
| 413 | Ga0501043_0293523 | 3300049579 | Bacteria | 1244 |
| 414 | Ga0501043_0687824 | 3300049579 | Bacteria | 748 |
| 415 | Ga0501046_0000029 | 3300049580 | Bacteria | 194168 |
| 416 | Ga0501046_0063035 | 3300049580 | Bacteria | 2895 |
| 417 | Ga0501046_0216363 | 3300049580 | Bacteria | 1420 |
| 418 | Ga0501046_0664101 | 3300049580 | Unclassified | 736 |
| 419 | Ga0501047_0039969 | 3300049581 | Bacteria | 4536 |
| 420 | Ga0501047_0076770 | 3300049581 | Bacteria | 3215 |
| 421 | Ga0501047_0101519 | 3300049581 | Bacteria | 2756 |
| 422 | Ga0501047_0114089 | 3300049581 | Bacteria | 2584 |
| 423 | Ga0501047_0851872 | 3300049581 | Unclassified | 725 |
| 424 | Ga0501048_0067827 | 3300049582 | Bacteria | 2521 |
| 425 | Ga0501048_0109138 | 3300049582 | Bacteria | 1954 |
| 426 | Ga0501048_0153872 | 3300049582 | Bacteria | 1626 |
| 427 | Ga0501067_0114155 | 3300049583 | Bacteria | 1502 |
| 428 | Ga0501067_0418675 | 3300049583 | Unclassified | 747 |
| 429 | Ga0501068_0006137 | 3300049584 | Bacteria | 6608 |
| 430 | Ga0501069_0137818 | 3300049585 | Unclassified | 1399 |
| 431 | Ga0501070_0036389 | 3300049586 | Bacteria | 4110 |
| 432 | Ga0501070_0068371 | 3300049586 | Bacteria | 2940 |
| 433 | Ga0501070_0071851 | 3300049586 | Bacteria | 2865 |
| 434 | Ga0501070_0142969 | 3300049586 | Bacteria | 1975 |
| 435 | Ga0501070_0621505 | 3300049586 | Bacteria | 860 |
| 436 | Ga0501071_0057893 | 3300049587 | Bacteria | 2801 |
| 437 | Ga0501071_0098627 | 3300049587 | Bacteria | 2152 |
| 438 | Ga0501071_0133286 | 3300049587 | Bacteria | 1847 |
| 439 | Ga0501071_0720243 | 3300049587 | Bacteria | 768 |
| 440 | Ga0501072_0052680 | 3300049588 | Bacteria | 3204 |
| 441 | Ga0501072_0087455 | 3300049588 | Bacteria | 2473 |
| 442 | Ga0501072_0104530 | 3300049588 | Bacteria | 2252 |
| 443 | Ga0501073_0001144 | 3300049589 | Bacteria | 19318 |
| 444 | Ga0501073_0034560 | 3300049589 | Bacteria | 3597 |
| 445 | Ga0501073_0076946 | 3300049589 | Bacteria | 2322 |
| 446 | Ga0501073_0594910 | 3300049589 | Bacteria | 764 |
| 447 | Ga0501074_0092177 | 3300049590 | Bacteria | 2170 |
| 448 | Ga0501074_0117551 | 3300049590 | Bacteria | 1902 |
| 449 | Ga0501074_0144933 | 3300049590 | Bacteria | 1698 |
| 450 | Ga0501074_0554233 | 3300049590 | Bacteria | 814 |
| 451 | Ga0501074_0609984 | 3300049590 | Bacteria | 772 |
| 452 | Ga0501075_0085894 | 3300049591 | Bacteria | 2384 |
| 453 | Ga0501075_0100523 | 3300049591 | Bacteria | 2196 |
| 454 | Ga0501075_0900786 | 3300049591 | Bacteria | 673 |
| 455 | Ga0501076_0070720 | 3300049592 | Bacteria | 2790 |
| 456 | Ga0501076_0317841 | 3300049592 | Bacteria | 1277 |
| 457 | Ga0501077_0017557 | 3300049593 | Bacteria | 4519 |
| 458 | Ga0501077_0120409 | 3300049593 | Bacteria | 1663 |
| 459 | Ga0501077_0222177 | 3300049593 | Bacteria | 1201 |
| 460 | Ga0501079_0048036 | 3300049741 | Bacteria | 3293 |
| 461 | Ga0501079_0936123 | 3300049741 | Bacteria | 682 |
| 462 | Ga0501080_0046328 | 3300049742 | Bacteria | 4048 |
| 463 | Ga0501080_0768021 | 3300049742 | Bacteria | 847 |
| 464 | Ga0501080_1068324 | 3300049742 | Bacteria | 698 |
| 465 | Ga0501081_0038161 | 3300049743 | Bacteria | 3280 |
| 466 | Ga0501081_0427394 | 3300049743 | Bacteria | 982 |
| 467 | Ga0501081_0759228 | 3300049743 | Bacteria | 729 |
| 468 | Ga0501083_0041591 | 3300049744 | Bacteria | 3116 |
| 469 | Ga0501083_0078681 | 3300049744 | Bacteria | 2187 |
| 470 | Ga0501035_0000046 | 3300049822 | Bacteria | 146599 |
| 471 | Ga0501035_0000063 | 3300049822 | Bacteria | 131515 |
| 472 | Ga0501035_0016341 | 3300049822 | Bacteria | 6845 |
| 473 | Ga0501035_0054393 | 3300049822 | Bacteria | 3577 |
| 474 | Ga0501035_0117867 | 3300049822 | Bacteria | 2323 |
| 475 | Ga0501035_0218563 | 3300049822 | Bacteria | 1628 |
| 476 | Ga0501035_0912729 | 3300049822 | Bacteria | 695 |
| 477 | Ga0501044_0000038 | 3300049823 | Bacteria | 161027 |
| 478 | Ga0501044_0008677 | 3300049823 | Bacteria | 11126 |
| 479 | Ga0501044_0152236 | 3300049823 | Bacteria | 2295 |
| 480 | Ga0501044_0155184 | 3300049823 | Bacteria | 2269 |
| 481 | Ga0501044_0194859 | 3300049823 | Bacteria | 1987 |
| 482 | Ga0501044_0488664 | 3300049823 | Bacteria | 1133 |
| 483 | Ga0501045_0114464 | 3300049824 | Bacteria | 2000 |
| 484 | Ga0501045_0132995 | 3300049824 | Bacteria | 1849 |
| 485 | Ga0501045_0320467 | 3300049824 | Bacteria | 1153 |
| 486 | nmdc:mga03683_65469_c1 | 3300050489 | Bacteria | 1543 |
| 487 | nmdc:mga03683_78309_c1 | 3300050489 | Bacteria | 1423 |
| 488 | nmdc:mga03n38_49826_c1 | 3300050490 | Bacteria | 1864 |
| 489 | nmdc:mga00v17_15298_c1 | 3300050491 | Bacteria | 4305 |
| 490 | nmdc:mga00v17_24846_c1 | 3300050491 | Bacteria | 3478 |
| 491 | nmdc:mga00v17_548532_c1 | 3300050491 | Bacteria | 747 |
| 492 | nmdc:mga0yw44_107498_c1 | 3300050492 | Bacteria | 1784 |
| 493 | nmdc:mga0yw44_393848_c1 | 3300050492 | Bacteria | 936 |
| 494 | nmdc:mga0yw44_539577_c1 | 3300050492 | Bacteria | 792 |
| 495 | nmdc:mga0yw44_70272_c1 | 3300050492 | Bacteria | 2171 |
| 496 | nmdc:mga0yw44_7495_c1 | 3300050492 | Bacteria | 5374 |
| 497 | nmdc:mga06z11_14332_c1 | 3300050494 | Bacteria | 3509 |
| 498 | nmdc:mga06z11_36544_c1 | 3300050494 | Bacteria | 2425 |
| 499 | nmdc:mga06z11_37380_c1 | 3300050494 | Bacteria | 2404 |
| 500 | nmdc:mga06z11_953_c1 | 3300050494 | Bacteria | 10536 |
| 501 | nmdc:mga04h51_3158_c1 | 3300050495 | Bacteria | 3976 |
| 502 | nmdc:mga04h51_49544_c1 | 3300050495 | Bacteria | 1404 |
| 503 | nmdc:mga07m45_90489_c1 | 3300050496 | Bacteria | 1753 |
| 504 | nmdc:mga05p37_318228_c1 | 3300050507 | Bacteria | 1842 |
| 505 | nmdc:mga05p37_645475_c1 | 3300050507 | Bacteria | 1186 |
| 506 | nmdc:mga09592_110807_c1 | 3300050508 | Bacteria | 2355 |
| 507 | nmdc:mga09592_38371_c1 | 3300050508 | Bacteria | 4021 |
| 508 | nmdc:mga0qj67_108903_c1 | 3300050509 | Bacteria | 2236 |
| 509 | nmdc:mga0qj67_165435_c1 | 3300050509 | Bacteria | 1796 |
| 510 | nmdc:mga06r32_105020_c1 | 3300050510 | Bacteria | 2775 |
| 511 | nmdc:mga06r32_400751_c2 | 3300050510 | Bacteria | 938 |
| 512 | nmdc:mga06r32_548924_c1 | 3300050510 | Bacteria | 1130 |
| 513 | nmdc:mga0a205_530248_c1 | 3300050515 | Bacteria | 1033 |
| 514 | nmdc:mga0sz30_19195_c2 | 3300050516 | Bacteria | 2200 |
| 515 | nmdc:mga0sz30_220647_c1 | 3300050516 | Bacteria | 843 |
| 516 | Ga0500610_0198005 | 3300053079 | Bacteria | 970 |
| 517 | Ga0500578_0015228 | 3300053086 | Bacteria | 4942 |
| 518 | Ga0500643_036920 | 3300053087 | Bacteria | 1458 |
| 519 | Ga0500651_0177387 | 3300053093 | Bacteria | 1267 |
| 520 | Ga0500562_048723 | 3300053108 | Bacteria | 1132 |
| 521 | Ga0500594_0125362 | 3300053118 | Bacteria | 809 |
| 522 | Ga0500595_026555 | 3300053119 | Bacteria | 1994 |
| 523 | Ga0500607_106366 | 3300053121 | Bacteria | 1384 |
| 524 | Ga0500658_0003930 | 3300053134 | Bacteria | 5583 |
| 525 | Ga0500658_0190284 | 3300053134 | Bacteria | 936 |
| 526 | Ga0500568_0000140 | 3300053139 | Bacteria | 65109 |
| 527 | Ga0500590_004361 | 3300053148 | Bacteria | 6670 |
| 528 | Ga0500604_0144891 | 3300053151 | Bacteria | 804 |
| 529 | Ga0500622_0000275 | 3300053156 | Bacteria | 52724 |
| 530 | Ga0500627_0102756 | 3300053158 | Bacteria | 1283 |
| 531 | Ga0500627_0186305 | 3300053158 | Bacteria | 933 |
| 532 | Ga0500636_0059334 | 3300053177 | Bacteria | 2236 |
| 533 | Ga0501084_0227769 | 3300054114 | Bacteria | 1573 |
| 534 | Ga0501084_0396353 | 3300054114 | Bacteria | 1166 |
| 535 | Ga0501084_0531818 | 3300054114 | Bacteria | 994 |
| 536 | Ga0501082_0049338 | 3300060353 | Bacteria | 3630 |
| 537 | Ga0501082_0093043 | 3300060353 | Bacteria | 2604 |
| 538 | Ga0501082_0104451 | 3300060353 | Bacteria | 2451 |
| 539 | Ga0501082_0274087 | 3300060353 | Bacteria | 1469 |
| 540 | Ga0501082_0652129 | 3300060353 | Unclassified | 921 |
| 541 | Ga0530510_0016551 | 3300061734 | Bacteria | 5221 |
| 542 | Ga0530510_0038121 | 3300061734 | Bacteria | 3469 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8004312739 | 8004318636 | 184 |
| 2 | 3300025986 | Ga0207658_10297764 | Ga0207658_102977642 | 188 |
| 3 | 3300046460 | Ga0495638_0063514 | Ga0495638_0063514_371_1012 | 192 |
| 4 | 3300006844 | Ga0075428_100137737 | Ga0075428_1001377373 | 196 |
| 5 | 3300009098 | Ga0105245_11128131 | Ga0105245_111281311 | 196 |
| 6 | 3300014325 | Ga0163163_10094507 | Ga0163163_100945072 | 196 |
| 7 | 3300014968 | Ga0157379_10123932 | Ga0157379_101239323 | 196 |
| 8 | 3300027907 | Ga0207428_10023808 | Ga0207428_100238085 | 196 |
| 9 | 3300048905 | Ga0496102_0073490 | Ga0496102_0073490_1648_2238 | 196 |
| 10 | 3300048907 | Ga0496104_0003490 | Ga0496104_0003490_7779_8369 | 196 |
| 11 | 3300048908 | Ga0496105_0061772 | Ga0496105_0061772_1941_2531 | 196 |
| 12 | 3300048909 | Ga0496106_0235767 | Ga0496106_0235767_801_1391 | 196 |
| 13 | 3300048911 | Ga0496108_0167653 | Ga0496108_0167653_251_841 | 196 |
| 14 | 3300048912 | Ga0496109_0029960 | Ga0496109_0029960_3868_4458 | 196 |
| 15 | 3300048913 | Ga0496110_0074846 | Ga0496110_0074846_22_612 | 196 |
| 16 | 3300048914 | Ga0496111_0125368 | Ga0496111_0125368_296_886 | 196 |
| 17 | 3300048915 | Ga0496112_0426904 | Ga0496112_0426904_502_1092 | 196 |
| 18 | 3300048917 | Ga0496114_0019558 | Ga0496114_0019558_939_1529 | 196 |
| 19 | 3300048918 | Ga0496115_0006559 | Ga0496115_0006559_6809_7399 | 196 |
| 20 | 3300005365 | Ga0070688_100189615 | Ga0070688_1001896152 | 197 |
| 21 | 3300005842 | Ga0068858_100413743 | Ga0068858_1004137432 | 197 |
| 22 | 3300009094 | Ga0111539_10031929 | Ga0111539_100319297 | 197 |
| 23 | 3300049575 | Ga0501039_0098384 | Ga0501039_0098384_21_614 | 197 |
| 24 | 3300049579 | Ga0501043_0687824 | Ga0501043_0687824_134_727 | 197 |
| 25 | 3300049590 | Ga0501074_0609984 | Ga0501074_0609984_30_623 | 197 |
| 26 | 3300049741 | Ga0501079_0936123 | Ga0501079_0936123_73_666 | 197 |
| 27 | 3300049822 | Ga0501035_0117867 | Ga0501035_0117867_1281_1940 | 198 |
| 28 | 3300049823 | Ga0501044_0488664 | Ga0501044_0488664_274_903 | 198 |
| 29 | iso_pu_bacteria | 2512875024 | 2512958472 | 199 |
| 30 | iso_pu_bacteria | 2513237164 | 2514038437 | 199 |
| 31 | iso_pu_bacteria | 2894652903 | 2894656208 | 199 |
| 32 | 3300005367 | Ga0070667_101117083 | Ga0070667_1011170831 | 200 |
| 33 | 3300049580 | Ga0501046_0664101 | Ga0501046_0664101_14_616 | 200 |
| 34 | 3300005365 | Ga0070688_100855855 | Ga0070688_1008558551 | 201 |
| 35 | 3300005535 | Ga0070684_100916166 | Ga0070684_1009161661 | 201 |
| 36 | 3300010375 | Ga0105239_10269759 | Ga0105239_102697593 | 201 |
| 37 | 3300031733 | Ga0316577_10168792 | Ga0316577_101687922 | 201 |
| 38 | 3300031733 | Ga0316577_10243815 | Ga0316577_102438151 | 201 |
| 39 | 3300032137 | Ga0316585_10099936 | Ga0316585_100999362 | 201 |
| 40 | 3300035398 | Ga0316574_0089728 | Ga0316574_0089728_1319_1930 | 201 |
| 41 | 3300036647 | Ga0316582_0029995 | Ga0316582_0029995_2399_3010 | 201 |
| 42 | 3300036647 | Ga0316582_0222899 | Ga0316582_0222899_440_1051 | 201 |
| 43 | 3300036712 | Ga0316584_0383742 | Ga0316584_0383742_29_640 | 201 |
| 44 | 3300048905 | Ga0496102_0286409 | Ga0496102_0286409_366_977 | 201 |
| 45 | 3300049571 | Ga0501034_0710203 | Ga0501034_0710203_19_657 | 201 |
| 46 | 3300049571 | Ga0501034_0904398 | Ga0501034_0904398_31_669 | 201 |
| 47 | 3300049581 | Ga0501047_0101519 | Ga0501047_0101519_212_850 | 201 |
| 48 | 3300049581 | Ga0501047_0851872 | Ga0501047_0851872_10_684 | 201 |
| 49 | 3300049583 | Ga0501067_0418675 | Ga0501067_0418675_49_723 | 201 |
| 50 | 3300049585 | Ga0501069_0137818 | Ga0501069_0137818_526_1200 | 201 |
| 51 | 3300049586 | Ga0501070_0142969 | Ga0501070_0142969_436_1074 | 201 |
| 52 | 3300049586 | Ga0501070_0621505 | Ga0501070_0621505_48_722 | 201 |
| 53 | 3300049590 | Ga0501074_0554233 | Ga0501074_0554233_87_725 | 201 |
| 54 | 3300049742 | Ga0501080_1068324 | Ga0501080_1068324_43_681 | 201 |
| 55 | 3300049744 | Ga0501083_0041591 | Ga0501083_0041591_2297_2935 | 201 |
| 56 | 3300049822 | Ga0501035_0218563 | Ga0501035_0218563_114_752 | 201 |
| 57 | 3300049823 | Ga0501044_0152236 | Ga0501044_0152236_1188_1862 | 201 |
| 58 | 3300053139 | Ga0500568_0000140 | Ga0500568_0000140_61944_62573 | 201 |
| 59 | 3300054114 | Ga0501084_0396353 | Ga0501084_0396353_427_1065 | 201 |
| 60 | 3300060353 | Ga0501082_0652129 | Ga0501082_0652129_73_747 | 201 |
| 61 | iso_pu_bacteria | 2503198000 | 2503202495 | 201 |
| 62 | iso_pu_bacteria | 2508501127 | 2509140405 | 201 |
| 63 | iso_pu_bacteria | 2513237351 | 2514589820 | 201 |
| 64 | iso_pu_bacteria | 2588253730 | 2588516389 | 201 |
| 65 | iso_pu_bacteria | 2597489875 | 2597813882 | 201 |
| 66 | iso_pu_bacteria | 2643221550 | 2643773643 | 201 |
| 67 | iso_pu_bacteria | 2643221551 | 2643775323 | 201 |
| 68 | iso_pu_bacteria | 2643221555 | 2643793769 | 201 |
| 69 | iso_pu_bacteria | 2643221564 | 2643837391 | 201 |
| 70 | iso_pu_bacteria | 2643221623 | 2644132272 | 201 |
| 71 | iso_pu_bacteria | 2693429783 | 2694632085 | 201 |
| 72 | iso_pu_bacteria | 2693429784 | 2694634508 | 201 |
| 73 | iso_pu_bacteria | 2738543024 | 2739308091 | 201 |
| 74 | iso_pu_bacteria | 2841734538 | 2841740218 | 201 |
| 75 | iso_pu_bacteria | 2844009547 | 2844014549 | 201 |
| 76 | iso_pu_bacteria | 2847670302 | 2847670738 | 201 |
| 77 | iso_pu_bacteria | 2847686936 | 2847693078 | 201 |
| 78 | iso_pu_bacteria | 2856314179 | 2856316194 | 201 |
| 79 | iso_pu_bacteria | 2856320880 | 2856326028 | 201 |
| 80 | iso_pu_bacteria | 2856328259 | 2856329233 | 201 |
| 81 | iso_pu_bacteria | 2856334872 | 2856335524 | 201 |
| 82 | iso_pu_bacteria | 2856342000 | 2856346244 | 201 |
| 83 | iso_pu_bacteria | 2856356410 | 2856360232 | 201 |
| 84 | iso_pu_bacteria | 2857349434 | 2857355761 | 201 |
| 85 | iso_pu_bacteria | 2857367948 | 2857374865 | 201 |
| 86 | iso_pu_bacteria | 2869162929 | 2869165459 | 201 |
| 87 | iso_pu_bacteria | 2869242130 | 2869246593 | 201 |
| 88 | iso_pu_bacteria | 2869249662 | 2869250097 | 201 |
| 89 | iso_pu_bacteria | 2869256925 | 2869262607 | 201 |
| 90 | iso_pu_bacteria | 2869264136 | 2869270996 | 201 |
| 91 | iso_pu_bacteria | 2869278585 | 2869278769 | 201 |
| 92 | iso_pu_bacteria | 2871435913 | 2871442242 | 201 |
| 93 | iso_pu_bacteria | 2871444079 | 2871448484 | 201 |
| 94 | iso_pu_bacteria | 2871459585 | 2871463708 | 201 |
| 95 | iso_pu_bacteria | 2871474448 | 2871475565 | 201 |
| 96 | iso_pu_bacteria | 2871488783 | 2871495179 | 201 |
| 97 | iso_pu_bacteria | 2871495908 | 2871500621 | 201 |
| 98 | iso_pu_bacteria | 2874109183 | 2874113843 | 201 |
| 99 | iso_pu_bacteria | 2874116593 | 2874123043 | 201 |
| 100 | iso_pu_bacteria | 2874123672 | 2874125863 | 201 |
| 101 | iso_pu_bacteria | 2874131515 | 2874137609 | 201 |
| 102 | iso_pu_bacteria | 2874139085 | 2874145353 | 201 |
| 103 | iso_pu_bacteria | 2874162495 | 2874165803 | 201 |
| 104 | iso_pu_bacteria | 2876363079 | 2876367926 | 201 |
| 105 | iso_pu_bacteria | 2876369609 | 2876371819 | 201 |
| 106 | iso_pu_bacteria | 2876386047 | 2876392379 | 201 |
| 107 | iso_pu_bacteria | 2876399893 | 2876403187 | 201 |
| 108 | iso_pu_bacteria | 2876406927 | 2876411947 | 201 |
| 109 | iso_pu_bacteria | 2876420981 | 2876425279 | 201 |
| 110 | iso_pu_bacteria | 2878035449 | 2878041518 | 201 |
| 111 | iso_pu_bacteria | 2878730984 | 2878738585 | 201 |
| 112 | iso_pu_bacteria | 2878738818 | 2878743678 | 201 |
| 113 | iso_pu_bacteria | 2878753008 | 2878758155 | 201 |
| 114 | iso_pu_bacteria | 2878760144 | 2878764710 | 201 |
| 115 | iso_pu_bacteria | 2878767105 | 2878771811 | 201 |
| 116 | iso_pu_bacteria | 2878774303 | 2878774689 | 201 |
| 117 | iso_pu_bacteria | 2878781027 | 2878785802 | 201 |
| 118 | iso_pu_bacteria | 2878788777 | 2878796768 | 201 |
| 119 | iso_pu_bacteria | 2881147464 | 2881152723 | 201 |
| 120 | iso_pu_bacteria | 2881845957 | 2881852947 | 201 |
| 121 | iso_pu_bacteria | 2881861095 | 2881867226 | 201 |
| 122 | iso_pu_bacteria | 2882912400 | 2882917636 | 201 |
| 123 | iso_pu_bacteria | 2885312484 | 2885317273 | 201 |
| 124 | iso_pu_bacteria | 2885318864 | 2885322040 | 201 |
| 125 | iso_pu_bacteria | 2885342637 | 2885347882 | 201 |
| 126 | iso_pu_bacteria | 2885350715 | 2885353191 | 201 |
| 127 | iso_pu_bacteria | 2888337043 | 2888340452 | 201 |
| 128 | iso_pu_bacteria | 2888343758 | 2888347685 | 201 |
| 129 | iso_pu_bacteria | 2888350351 | 2888356731 | 201 |
| 130 | iso_pu_bacteria | 2889010040 | 2889011778 | 201 |
| 131 | iso_pu_bacteria | 2889016732 | 2889023287 | 201 |
| 132 | iso_pu_bacteria | 2903448605 | 2903449689 | 201 |
| 133 | iso_pu_bacteria | 2903492973 | 2903496113 | 201 |
| 134 | iso_pu_bacteria | 2903513507 | 2903519790 | 201 |
| 135 | iso_pu_bacteria | 2903521522 | 2903526922 | 201 |
| 136 | iso_pu_bacteria | 2903528002 | 2903533149 | 201 |
| 137 | iso_pu_bacteria | 2903540706 | 2903545434 | 201 |
| 138 | iso_pu_bacteria | 2906328253 | 2906328541 | 201 |
| 139 | iso_pu_bacteria | 2906354277 | 2906357605 | 201 |
| 140 | iso_pu_bacteria | 2906363423 | 2906365295 | 201 |
| 141 | iso_pu_bacteria | 2906386501 | 2906387352 | 201 |
| 142 | iso_pu_bacteria | 2906393657 | 2906401097 | 201 |
| 143 | iso_pu_bacteria | 2906401398 | 2906406968 | 201 |
| 144 | iso_pu_bacteria | 2906408224 | 2906412782 | 201 |
| 145 | iso_pu_bacteria | 2906414383 | 2906416331 | 201 |
| 146 | iso_pu_bacteria | 2906427513 | 2906435703 | 201 |
| 147 | iso_pu_bacteria | 2922130491 | 2922138708 | 201 |
| 148 | iso_pu_bacteria | 2922151315 | 2922155434 | 201 |
| 149 | iso_pu_bacteria | 2922158528 | 2922159466 | 201 |
| 150 | iso_pu_bacteria | 2922172374 | 2922174179 | 201 |
| 151 | iso_pu_bacteria | 2922185730 | 2922189978 | 201 |
| 152 | iso_pu_bacteria | 2924710171 | 2924710916 | 201 |
| 153 | iso_pu_bacteria | 2924718760 | 2924719697 | 201 |
| 154 | iso_pu_bacteria | 2924733363 | 2924739621 | 201 |
| 155 | iso_pu_bacteria | 2924741084 | 2924747251 | 201 |
| 156 | iso_pu_bacteria | 2924762789 | 2924768845 | 201 |
| 157 | iso_pu_bacteria | 2924776078 | 2924781491 | 201 |
| 158 | iso_pu_bacteria | 2924784321 | 2924785895 | 201 |
| 159 | iso_pu_bacteria | 2937822353 | 2937827141 | 201 |
| 160 | iso_pu_bacteria | 2937836603 | 2937837653 | 201 |
| 161 | iso_pu_bacteria | 2937848649 | 2937853784 | 201 |
| 162 | iso_pu_bacteria | 2958064165 | 2958067120 | 201 |
| 163 | iso_pu_bacteria | 2958100919 | 2958105511 | 201 |
| 164 | iso_pu_bacteria | 2958115193 | 2958122670 | 201 |
| 165 | iso_pu_bacteria | 2958172287 | 2958175191 | 201 |
| 166 | iso_pu_bacteria | 2961170736 | 2961174786 | 201 |
| 167 | iso_pu_bacteria | 2965119406 | 2965126973 | 201 |
| 168 | iso_pu_bacteria | 2967996073 | 2968000721 | 201 |
| 169 | iso_pu_bacteria | 2968003550 | 2968009907 | 201 |
| 170 | iso_pu_bacteria | 2968097103 | 2968099384 | 201 |
| 171 | iso_pu_bacteria | 2968117919 | 2968122978 | 201 |
| 172 | iso_pu_bacteria | 2970489779 | 2970489926 | 201 |
| 173 | iso_pu_bacteria | 2970503327 | 2970507372 | 201 |
| 174 | iso_pu_bacteria | 2970510686 | 2970516487 | 201 |
| 175 | iso_pu_bacteria | 2970524798 | 2970530190 | 201 |
| 176 | iso_pu_bacteria | 2970540015 | 2970545815 | 201 |
| 177 | iso_pu_bacteria | 2977821940 | 2977828771 | 201 |
| 178 | iso_pu_bacteria | 2977828996 | 2977834087 | 201 |
| 179 | iso_pu_bacteria | 2977922695 | 2977929057 | 201 |
| 180 | iso_pu_bacteria | 2977942078 | 2977944418 | 201 |
| 181 | iso_pu_bacteria | 2977971508 | 2977975273 | 201 |
| 182 | iso_pu_bacteria | 2977986579 | 2977990343 | 201 |
| 183 | iso_pu_bacteria | 2979710463 | 2979716038 | 201 |
| 184 | iso_pu_bacteria | 2979742915 | 2979744469 | 201 |
| 185 | iso_pu_bacteria | 2979779861 | 2979786124 | 201 |
| 186 | iso_pu_bacteria | 2979808191 | 2979812568 | 201 |
| 187 | iso_pu_bacteria | 2987636660 | 2987640895 | 201 |
| 188 | iso_pu_bacteria | 2987652177 | 2987656360 | 201 |
| 189 | iso_pu_bacteria | 2987666974 | 2987670523 | 201 |
| 190 | iso_pu_bacteria | 2996310559 | 2996310664 | 201 |
| 191 | iso_pu_bacteria | 2996336353 | 2996337959 | 201 |
| 192 | iso_pu_bacteria | 2996386984 | 2996392724 | 201 |
| 193 | iso_pu_bacteria | 3004211236 | 3004212595 | 201 |
| 194 | iso_pu_bacteria | 3004218560 | 3004221659 | 201 |
| 195 | iso_pu_bacteria | 3004232784 | 3004235820 | 201 |
| 196 | iso_pu_bacteria | 3004268573 | 3004275333 | 201 |
| 197 | iso_pu_bacteria | 8002285264 | 8002286302 | 201 |
| 198 | iso_pu_bacteria | 8004374579 | 8004379667 | 201 |
| 199 | iso_pu_bacteria | 8004395343 | 8004395512 | 201 |
| 200 | iso_pu_bacteria | 8004633249 | 8004635948 | 201 |
| 201 | iso_pu_bacteria | 8004703790 | 8004714606 | 201 |
| 202 | iso_pu_bacteria | 8055617313 | 8055621758 | 201 |
| 203 | 3300025299 | Ga0209256_1000383 | Ga0209256_100038371 | 202 |
| 204 | 3300046471 | Ga0495650_0165222 | Ga0495650_0165222_13_630 | 202 |
| 205 | 3300046500 | Ga0495596_0047199 | Ga0495596_0047199_973_1605 | 202 |
| 206 | 3300046501 | Ga0495607_0024169 | Ga0495607_0024169_1945_2577 | 202 |
| 207 | 3300046512 | Ga0495610_0046741 | Ga0495610_0046741_722_1354 | 202 |
| 208 | 3300046522 | Ga0495643_0003338 | Ga0495643_0003338_2281_2913 | 202 |
| 209 | 3300046542 | Ga0495597_0010723 | Ga0495597_0010723_3145_3777 | 202 |
| 210 | 3300046660 | Ga0495625_0221508 | Ga0495625_0221508_588_1220 | 202 |
| 211 | 3300046694 | Ga0495649_0027292 | Ga0495649_0027292_1949_2581 | 202 |
| 212 | 3300046810 | Ga0495660_0033393 | Ga0495660_0033393_282_914 | 202 |
| 213 | 3300047443 | Ga0495687_051359 | Ga0495687_051359_849_1481 | 202 |
| 214 | 3300048929 | Ga0496126_0000824 | Ga0496126_0000824_20208_20849 | 202 |
| 215 | 3300049580 | Ga0501046_0000029 | Ga0501046_0000029_72969_73607 | 202 |
| 216 | 3300049593 | Ga0501077_0222177 | Ga0501077_0222177_42_713 | 202 |
| 217 | 3300053086 | Ga0500578_0015228 | Ga0500578_0015228_43_675 | 202 |
| 218 | 3300053118 | Ga0500594_0125362 | Ga0500594_0125362_16_648 | 202 |
| 219 | 3300053134 | Ga0500658_0003930 | Ga0500658_0003930_684_1316 | 202 |
| 220 | iso_pu_bacteria | 2510917030 | 2511195410 | 202 |
| 221 | iso_pu_bacteria | 2513237144 | 2513912483 | 202 |
| 222 | iso_pu_bacteria | 2515154134 | 2515740338 | 202 |
| 223 | iso_pu_bacteria | 2582581298 | 2585224486 | 202 |
| 224 | iso_pu_bacteria | 2582581299 | 2585229931 | 202 |
| 225 | iso_pu_bacteria | 2585427529 | 2585546607 | 202 |
| 226 | iso_pu_bacteria | 2585427594 | 2585846789 | 202 |
| 227 | iso_pu_bacteria | 2643221568 | 2643857786 | 202 |
| 228 | iso_pu_bacteria | 2718217927 | 2719385894 | 202 |
| 229 | iso_pu_bacteria | 2718218423 | 2721399673 | 202 |
| 230 | iso_pu_bacteria | 2721755809 | 2724038486 | 202 |
| 231 | iso_pu_bacteria | 2791355266 | 2793361059 | 202 |
| 232 | iso_pu_bacteria | 2838022645 | 2838026311 | 202 |
| 233 | iso_pu_bacteria | 2842163707 | 2842167955 | 202 |
| 234 | iso_pu_bacteria | 2842198810 | 2842201756 | 202 |
| 235 | iso_pu_bacteria | 2842304105 | 2842304414 | 202 |
| 236 | iso_pu_bacteria | 2842395702 | 2842398792 | 202 |
| 237 | iso_pu_bacteria | 2854896431 | 2854899131 | 202 |
| 238 | iso_pu_bacteria | 2874168670 | 2874172735 | 202 |
| 239 | iso_pu_bacteria | 2899792073 | 2899795107 | 202 |
| 240 | iso_pu_bacteria | 2919100787 | 2919106771 | 202 |
| 241 | iso_pu_bacteria | 2933570622 | 2933571688 | 202 |
| 242 | iso_pu_bacteria | 2935901341 | 2935905564 | 202 |
| 243 | iso_pu_bacteria | 2984587000 | 2984589746 | 202 |
| 244 | iso_pu_bacteria | 8005275841 | 8005280675 | 202 |
| 245 | iso_pu_bacteria | 8005289223 | 8005293198 | 202 |
| 246 | iso_pu_bacteria | 8005307578 | 8005309843 | 202 |
| 247 | iso_pu_bacteria | 8005695170 | 8005699901 | 202 |
| 248 | iso_pu_bacteria | 8018176218 | 8018179728 | 202 |
| 249 | 3300002773 | JGI25152J39213_1001161 | JGI25152J39213_10011611 | 203 |
| 250 | 3300002774 | JGI25150J39212_1000160 | JGI25150J39212_100016027 | 203 |
| 251 | 3300003187 | JGI25151J46595_10000083 | JGI25151J46595_10000083118 | 203 |
| 252 | 3300003215 | JGI25153J46596_10000965 | JGI25153J46596_1000096514 | 203 |
| 253 | 3300003762 | Ga0055542_1000709 | Ga0055542_100070926 | 203 |
| 254 | 3300005335 | Ga0070666_10504762 | Ga0070666_105047621 | 203 |
| 255 | 3300025245 | Ga0207425_1000024 | Ga0207425_1000024132 | 203 |
| 256 | 3300025258 | Ga0209129_1000184 | Ga0209129_100018420 | 203 |
| 257 | 3300025273 | Ga0209673_1005268 | Ga0209673_10052686 | 203 |
| 258 | 3300025294 | Ga0209025_1000050 | Ga0209025_1000050195 | 203 |
| 259 | 3300025297 | Ga0209758_1000083 | Ga0209758_100008362 | 203 |
| 260 | 3300025904 | Ga0207647_10238100 | Ga0207647_102381001 | 203 |
| 261 | 3300025932 | Ga0207690_10841420 | Ga0207690_108414201 | 203 |
| 262 | 3300026067 | Ga0207678_10033030 | Ga0207678_100330304 | 203 |
| 263 | 3300026116 | Ga0207674_10297808 | Ga0207674_102978081 | 203 |
| 264 | 3300031731 | Ga0307405_10002270 | Ga0307405_100022707 | 203 |
| 265 | 3300031911 | Ga0307412_10001552 | Ga0307412_100015521 | 203 |
| 266 | 3300046522 | Ga0495643_0020809 | Ga0495643_0020809_1429_2058 | 203 |
| 267 | 3300047469 | Ga0495673_0057222 | Ga0495673_0057222_182_811 | 203 |
| 268 | 3300048904 | Ga0496101_0121113 | Ga0496101_0121113_1281_1916 | 203 |
| 269 | 3300048912 | Ga0496109_0178176 | Ga0496109_0178176_778_1440 | 203 |
| 270 | 3300048915 | Ga0496112_0055798 | Ga0496112_0055798_1328_1939 | 203 |
| 271 | 3300048916 | Ga0496113_0510636 | Ga0496113_0510636_31_642 | 203 |
| 272 | 3300048919 | Ga0496116_0001253 | Ga0496116_0001253_11340_11975 | 203 |
| 273 | 3300048919 | Ga0496116_0005379 | Ga0496116_0005379_10927_11562 | 203 |
| 274 | 3300048919 | Ga0496116_0026038 | Ga0496116_0026038_1902_2537 | 203 |
| 275 | 3300048919 | Ga0496116_0134978 | Ga0496116_0134978_619_1254 | 203 |
| 276 | 3300048919 | Ga0496116_0144724 | Ga0496116_0144724_98_733 | 203 |
| 277 | 3300048920 | Ga0496117_0006763 | Ga0496117_0006763_7729_8364 | 203 |
| 278 | 3300048920 | Ga0496117_0119188 | Ga0496117_0119188_230_865 | 203 |
| 279 | 3300048921 | Ga0496118_0009778 | Ga0496118_0009778_6611_7246 | 203 |
| 280 | 3300048921 | Ga0496118_0135320 | Ga0496118_0135320_253_864 | 203 |
| 281 | 3300048921 | Ga0496118_0140714 | Ga0496118_0140714_594_1229 | 203 |
| 282 | 3300048922 | Ga0496119_0026981 | Ga0496119_0026981_845_1456 | 203 |
| 283 | 3300048922 | Ga0496119_0178653 | Ga0496119_0178653_244_879 | 203 |
| 284 | 3300048924 | Ga0496121_0018899 | Ga0496121_0018899_3114_3749 | 203 |
| 285 | 3300048924 | Ga0496121_0040712 | Ga0496121_0040712_1166_1801 | 203 |
| 286 | 3300048925 | Ga0496122_0022378 | Ga0496122_0022378_3418_4053 | 203 |
| 287 | 3300048925 | Ga0496122_0032443 | Ga0496122_0032443_620_1255 | 203 |
| 288 | 3300048925 | Ga0496122_0088520 | Ga0496122_0088520_620_1255 | 203 |
| 289 | 3300048925 | Ga0496122_0164325 | Ga0496122_0164325_616_1251 | 203 |
| 290 | 3300048926 | Ga0496123_0020989 | Ga0496123_0020989_2747_3382 | 203 |
| 291 | 3300048926 | Ga0496123_0113413 | Ga0496123_0113413_761_1396 | 203 |
| 292 | 3300048926 | Ga0496123_0131238 | Ga0496123_0131238_605_1240 | 203 |
| 293 | 3300048927 | Ga0496124_0003917 | Ga0496124_0003917_7621_8256 | 203 |
| 294 | 3300048927 | Ga0496124_0004950 | Ga0496124_0004950_11984_12619 | 203 |
| 295 | 3300048927 | Ga0496124_0084022 | Ga0496124_0084022_1358_1993 | 203 |
| 296 | 3300048928 | Ga0496125_0032793 | Ga0496125_0032793_2189_2824 | 203 |
| 297 | 3300048929 | Ga0496126_0049161 | Ga0496126_0049161_510_1145 | 203 |
| 298 | 3300048929 | Ga0496126_0247957 | Ga0496126_0247957_681_1292 | 203 |
| 299 | 3300048929 | Ga0496126_0506216 | Ga0496126_0506216_263_898 | 203 |
| 300 | 3300049589 | Ga0501073_0034560 | Ga0501073_0034560_1445_2110 | 203 |
| 301 | 3300053119 | Ga0500595_026555 | Ga0500595_026555_847_1458 | 203 |
| 302 | iso_pu_bacteria | 2510917022 | 2511135187 | 203 |
| 303 | iso_pu_bacteria | 2582581294 | 2585200239 | 203 |
| 304 | iso_pu_bacteria | 2582581307 | 2585270928 | 203 |
| 305 | iso_pu_bacteria | 2585427531 | 2585558652 | 203 |
| 306 | iso_pu_bacteria | 2585427609 | 2585904378 | 203 |
| 307 | iso_pu_bacteria | 2585428125 | 2587980505 | 203 |
| 308 | 3300003187 | JGI25151J46595_10054262 | JGI25151J46595_100542622 | 204 |
| 309 | 3300005340 | Ga0070689_100302016 | Ga0070689_1003020162 | 204 |
| 310 | 3300005356 | Ga0070674_100136550 | Ga0070674_1001365502 | 204 |
| 311 | 3300005364 | Ga0070673_100145380 | Ga0070673_1001453803 | 204 |
| 312 | 3300005365 | Ga0070688_100497805 | Ga0070688_1004978052 | 204 |
| 313 | 3300005439 | Ga0070711_100110767 | Ga0070711_1001107672 | 204 |
| 314 | 3300005441 | Ga0070700_100306757 | Ga0070700_1003067572 | 204 |
| 315 | 3300005445 | Ga0070708_101088606 | Ga0070708_1010886061 | 204 |
| 316 | 3300005459 | Ga0068867_100086622 | Ga0068867_1000866223 | 204 |
| 317 | 3300005536 | Ga0070697_100918069 | Ga0070697_1009180692 | 204 |
| 318 | 3300005548 | Ga0070665_100105659 | Ga0070665_1001056593 | 204 |
| 319 | 3300005548 | Ga0070665_100182460 | Ga0070665_1001824603 | 204 |
| 320 | 3300005564 | Ga0070664_100474056 | Ga0070664_1004740562 | 204 |
| 321 | 3300005617 | Ga0068859_100017558 | Ga0068859_1000175586 | 204 |
| 322 | 3300005718 | Ga0068866_10050358 | Ga0068866_100503582 | 204 |
| 323 | 3300005842 | Ga0068858_100035950 | Ga0068858_1000359504 | 204 |
| 324 | 3300005985 | Ga0081539_10021439 | Ga0081539_100214394 | 204 |
| 325 | 3300006042 | Ga0075368_10014251 | Ga0075368_100142512 | 204 |
| 326 | 3300006051 | Ga0075364_10211377 | Ga0075364_102113772 | 204 |
| 327 | 3300006237 | Ga0097621_100313580 | Ga0097621_1003135802 | 204 |
| 328 | 3300006353 | Ga0075370_10023686 | Ga0075370_100236864 | 204 |
| 329 | 3300006844 | Ga0075428_100186959 | Ga0075428_1001869593 | 204 |
| 330 | 3300006844 | Ga0075428_100349710 | Ga0075428_1003497102 | 204 |
| 331 | 3300006846 | Ga0075430_100114035 | Ga0075430_1001140352 | 204 |
| 332 | 3300006846 | Ga0075430_100275110 | Ga0075430_1002751102 | 204 |
| 333 | 3300006847 | Ga0075431_100163193 | Ga0075431_1001631931 | 204 |
| 334 | 3300006880 | Ga0075429_100119139 | Ga0075429_1001191393 | 204 |
| 335 | 3300006931 | Ga0097620_100017559 | Ga0097620_1000175596 | 204 |
| 336 | 3300009094 | Ga0111539_10504970 | Ga0111539_105049702 | 204 |
| 337 | 3300009101 | Ga0105247_10003673 | Ga0105247_100036734 | 204 |
| 338 | 3300009148 | Ga0105243_10108387 | Ga0105243_101083871 | 204 |
| 339 | 3300009177 | Ga0105248_10099697 | Ga0105248_100996973 | 204 |
| 340 | 3300011119 | Ga0105246_10029897 | Ga0105246_100298974 | 204 |
| 341 | 3300012487 | Ga0157321_1007870 | Ga0157321_10078701 | 204 |
| 342 | 3300012508 | Ga0157315_1002326 | Ga0157315_10023262 | 204 |
| 343 | 3300013296 | Ga0157374_10370978 | Ga0157374_103709781 | 204 |
| 344 | 3300013308 | Ga0157375_10006048 | Ga0157375_100060485 | 204 |
| 345 | 3300013308 | Ga0157375_10789118 | Ga0157375_107891182 | 204 |
| 346 | 3300014969 | Ga0157376_10035430 | Ga0157376_100354306 | 204 |
| 347 | 3300015265 | Ga0182005_1028972 | Ga0182005_10289722 | 204 |
| 348 | 3300025245 | Ga0207425_1008008 | Ga0207425_10080082 | 204 |
| 349 | 3300025899 | Ga0207642_10053532 | Ga0207642_100535321 | 204 |
| 350 | 3300025900 | Ga0207710_10026346 | Ga0207710_100263462 | 204 |
| 351 | 3300025916 | Ga0207663_10113354 | Ga0207663_101133541 | 204 |
| 352 | 3300025916 | Ga0207663_10165687 | Ga0207663_101656872 | 204 |
| 353 | 3300025920 | Ga0207649_10376537 | Ga0207649_103765372 | 204 |
| 354 | 3300025932 | Ga0207690_10450295 | Ga0207690_104502952 | 204 |
| 355 | 3300025936 | Ga0207670_10145945 | Ga0207670_101459452 | 204 |
| 356 | 3300025938 | Ga0207704_10083845 | Ga0207704_100838453 | 204 |
| 357 | 3300025941 | Ga0207711_10096136 | Ga0207711_100961362 | 204 |
| 358 | 3300025960 | Ga0207651_10199005 | Ga0207651_101990052 | 204 |
| 359 | 3300025972 | Ga0207668_10429349 | Ga0207668_104293492 | 204 |
| 360 | 3300026035 | Ga0207703_10113317 | Ga0207703_101133174 | 204 |
| 361 | 3300026035 | Ga0207703_10209918 | Ga0207703_102099183 | 204 |
| 362 | 3300026075 | Ga0207708_10148393 | Ga0207708_101483932 | 204 |
| 363 | 3300026118 | Ga0207675_100062687 | Ga0207675_1000626876 | 204 |
| 364 | 3300026118 | Ga0207675_100478715 | Ga0207675_1004787152 | 204 |
| 365 | 3300027866 | Ga0209813_10004378 | Ga0209813_100043782 | 204 |
| 366 | 3300028379 | Ga0268266_10034806 | Ga0268266_100348062 | 204 |
| 367 | 3300028379 | Ga0268266_10190330 | Ga0268266_101903302 | 204 |
| 368 | 3300028381 | Ga0268264_10194798 | Ga0268264_101947982 | 204 |
| 369 | 3300028381 | Ga0268264_11120963 | Ga0268264_111209631 | 204 |
| 370 | 3300035121 | Ga0373960_0046026 | Ga0373960_0046026_168_791 | 204 |
| 371 | 3300035691 | Ga0373931_0019173 | Ga0373931_0019173_1510_2133 | 204 |
| 372 | 3300046491 | Ga0495584_0055155 | Ga0495584_0055155_1316_1939 | 204 |
| 373 | 3300046506 | Ga0495583_0039963 | Ga0495583_0039963_234_875 | 204 |
| 374 | 3300047320 | Ga0495672_0154252 | Ga0495672_0154252_153_776 | 204 |
| 375 | 3300047445 | Ga0495677_0178026 | Ga0495677_0178026_74_697 | 204 |
| 376 | 3300048903 | Ga0496100_0042786 | Ga0496100_0042786_34_663 | 204 |
| 377 | 3300048904 | Ga0496101_0024156 | Ga0496101_0024156_2699_3328 | 204 |
| 378 | 3300048904 | Ga0496101_0195603 | Ga0496101_0195603_560_1183 | 204 |
| 379 | 3300048905 | Ga0496102_0012754 | Ga0496102_0012754_2147_2776 | 204 |
| 380 | 3300048905 | Ga0496102_0241989 | Ga0496102_0241989_1001_1630 | 204 |
| 381 | 3300048906 | Ga0496103_0089799 | Ga0496103_0089799_92_721 | 204 |
| 382 | 3300048907 | Ga0496104_0013865 | Ga0496104_0013865_4845_5474 | 204 |
| 383 | 3300048908 | Ga0496105_0008593 | Ga0496105_0008593_1795_2424 | 204 |
| 384 | 3300048908 | Ga0496105_0773586 | Ga0496105_0773586_46_675 | 204 |
| 385 | 3300048909 | Ga0496106_0004483 | Ga0496106_0004483_5281_5910 | 204 |
| 386 | 3300048909 | Ga0496106_0542304 | Ga0496106_0542304_69_692 | 204 |
| 387 | 3300048910 | Ga0496107_0003137 | Ga0496107_0003137_5782_6411 | 204 |
| 388 | 3300048910 | Ga0496107_0153283 | Ga0496107_0153283_348_971 | 204 |
| 389 | 3300048911 | Ga0496108_0043855 | Ga0496108_0043855_1359_1988 | 204 |
| 390 | 3300048912 | Ga0496109_0008718 | Ga0496109_0008718_6870_7499 | 204 |
| 391 | 3300048912 | Ga0496109_0293262 | Ga0496109_0293262_202_831 | 204 |
| 392 | 3300048913 | Ga0496110_0786980 | Ga0496110_0786980_34_666 | 204 |
| 393 | 3300048914 | Ga0496111_0416213 | Ga0496111_0416213_203_832 | 204 |
| 394 | 3300048915 | Ga0496112_0014397 | Ga0496112_0014397_4168_4797 | 204 |
| 395 | 3300048916 | Ga0496113_0022191 | Ga0496113_0022191_3410_4039 | 204 |
| 396 | 3300048917 | Ga0496114_0003619 | Ga0496114_0003619_7167_7796 | 204 |
| 397 | 3300048918 | Ga0496115_0041346 | Ga0496115_0041346_175_804 | 204 |
| 398 | 3300048927 | Ga0496124_0193123 | Ga0496124_0193123_450_1103 | 204 |
| 399 | 3300049568 | Ga0501031_0125145 | Ga0501031_0125145_400_1023 | 204 |
| 400 | 3300049570 | Ga0501033_0439683 | Ga0501033_0439683_71_694 | 204 |
| 401 | 3300049570 | Ga0501033_0614192 | Ga0501033_0614192_53_700 | 204 |
| 402 | 3300049571 | Ga0501034_0000960 | Ga0501034_0000960_13154_13783 | 204 |
| 403 | 3300049571 | Ga0501034_0087179 | Ga0501034_0087179_2373_3050 | 204 |
| 404 | 3300049572 | Ga0501036_0032407 | Ga0501036_0032407_1130_1753 | 204 |
| 405 | 3300049572 | Ga0501036_0307900 | Ga0501036_0307900_644_1267 | 204 |
| 406 | 3300049575 | Ga0501039_0223390 | Ga0501039_0223390_64_687 | 204 |
| 407 | 3300049575 | Ga0501039_0238480 | Ga0501039_0238480_739_1368 | 204 |
| 408 | 3300049576 | Ga0501040_0028998 | Ga0501040_0028998_1629_2252 | 204 |
| 409 | 3300049576 | Ga0501040_0072292 | Ga0501040_0072292_17_640 | 204 |
| 410 | 3300049576 | Ga0501040_0624934 | Ga0501040_0624934_77_706 | 204 |
| 411 | 3300049577 | Ga0501041_0361667 | Ga0501041_0361667_100_723 | 204 |
| 412 | 3300049578 | Ga0501042_0132816 | Ga0501042_0132816_720_1343 | 204 |
| 413 | 3300049578 | Ga0501042_0583877 | Ga0501042_0583877_160_786 | 204 |
| 414 | 3300049579 | Ga0501043_0293523 | Ga0501043_0293523_565_1188 | 204 |
| 415 | 3300049581 | Ga0501047_0114089 | Ga0501047_0114089_1283_1960 | 204 |
| 416 | 3300049582 | Ga0501048_0067827 | Ga0501048_0067827_1747_2370 | 204 |
| 417 | 3300049582 | Ga0501048_0109138 | Ga0501048_0109138_297_920 | 204 |
| 418 | 3300049587 | Ga0501071_0098627 | Ga0501071_0098627_123_746 | 204 |
| 419 | 3300049588 | Ga0501072_0052680 | Ga0501072_0052680_1570_2193 | 204 |
| 420 | 3300049588 | Ga0501072_0087455 | Ga0501072_0087455_528_1151 | 204 |
| 421 | 3300049589 | Ga0501073_0001144 | Ga0501073_0001144_2594_3286 | 204 |
| 422 | 3300049589 | Ga0501073_0594910 | Ga0501073_0594910_113_736 | 204 |
| 423 | 3300049590 | Ga0501074_0092177 | Ga0501074_0092177_935_1558 | 204 |
| 424 | 3300049590 | Ga0501074_0117551 | Ga0501074_0117551_84_707 | 204 |
| 425 | 3300049591 | Ga0501075_0085894 | Ga0501075_0085894_1718_2347 | 204 |
| 426 | 3300049591 | Ga0501075_0100523 | Ga0501075_0100523_1375_1998 | 204 |
| 427 | 3300049592 | Ga0501076_0070720 | Ga0501076_0070720_1828_2451 | 204 |
| 428 | 3300049592 | Ga0501076_0317841 | Ga0501076_0317841_169_795 | 204 |
| 429 | 3300049593 | Ga0501077_0017557 | Ga0501077_0017557_3614_4237 | 204 |
| 430 | 3300049741 | Ga0501079_0048036 | Ga0501079_0048036_794_1417 | 204 |
| 431 | 3300049742 | Ga0501080_0768021 | Ga0501080_0768021_166_789 | 204 |
| 432 | 3300049743 | Ga0501081_0038161 | Ga0501081_0038161_2322_2945 | 204 |
| 433 | 3300049743 | Ga0501081_0427394 | Ga0501081_0427394_132_755 | 204 |
| 434 | 3300049743 | Ga0501081_0759228 | Ga0501081_0759228_24_653 | 204 |
| 435 | 3300049822 | Ga0501035_0912729 | Ga0501035_0912729_10_636 | 204 |
| 436 | 3300050491 | nmdc:mga00v17_24846_c1 | nmdc:mga00v17_24846_c1_2543_3166 | 204 |
| 437 | 3300050494 | nmdc:mga06z11_14332_c1 | nmdc:mga06z11_14332_c1_2568_3191 | 204 |
| 438 | 3300050494 | nmdc:mga06z11_953_c1 | nmdc:mga06z11_953_c1_652_1275 | 204 |
| 439 | 3300050495 | nmdc:mga04h51_3158_c1 | nmdc:mga04h51_3158_c1_2931_3554 | 204 |
| 440 | 3300050507 | nmdc:mga05p37_318228_c1 | nmdc:mga05p37_318228_c1_273_896 | 204 |
| 441 | 3300050507 | nmdc:mga05p37_645475_c1 | nmdc:mga05p37_645475_c1_154_783 | 204 |
| 442 | 3300050508 | nmdc:mga09592_110807_c1 | nmdc:mga09592_110807_c1_562_1185 | 204 |
| 443 | 3300050508 | nmdc:mga09592_38371_c1 | nmdc:mga09592_38371_c1_2001_2624 | 204 |
| 444 | 3300050509 | nmdc:mga0qj67_108903_c1 | nmdc:mga0qj67_108903_c1_1043_1666 | 204 |
| 445 | 3300050509 | nmdc:mga0qj67_165435_c1 | nmdc:mga0qj67_165435_c1_617_1240 | 204 |
| 446 | 3300050510 | nmdc:mga06r32_105020_c1 | nmdc:mga06r32_105020_c1_411_1034 | 204 |
| 447 | 3300050510 | nmdc:mga06r32_400751_c2 | nmdc:mga06r32_400751_c2_158_781 | 204 |
| 448 | 3300050510 | nmdc:mga06r32_548924_c1 | nmdc:mga06r32_548924_c1_379_1002 | 204 |
| 449 | 3300050515 | nmdc:mga0a205_530248_c1 | nmdc:mga0a205_530248_c1_365_994 | 204 |
| 450 | 3300053108 | Ga0500562_048723 | Ga0500562_048723_228_869 | 204 |
| 451 | 3300053156 | Ga0500622_0000275 | Ga0500622_0000275_4943_5584 | 204 |
| 452 | 3300054114 | Ga0501084_0227769 | Ga0501084_0227769_91_720 | 204 |
| 453 | 3300060353 | Ga0501082_0093043 | Ga0501082_0093043_797_1420 | 204 |
| 454 | 3300060353 | Ga0501082_0104451 | Ga0501082_0104451_612_1238 | 204 |
| 455 | 3300060353 | Ga0501082_0274087 | Ga0501082_0274087_64_687 | 204 |
| 456 | 3300061734 | Ga0530510_0016551 | Ga0530510_0016551_2322_2945 | 204 |
| 457 | 3300061734 | Ga0530510_0038121 | Ga0530510_0038121_1044_1667 | 204 |
| 458 | iso_pu_bacteria | 2513237138 | 2513864716 | 204 |
| 459 | iso_pu_bacteria | 2513237305 | 2514421837 | 204 |
| 460 | iso_pu_bacteria | 2721755686 | 2723576244 | 204 |
| 461 | iso_pu_bacteria | 2923556063 | 2923558000 | 204 |
| 462 | iso_pu_bacteria | 2937843397 | 2937847446 | 204 |
| 463 | iso_pu_bacteria | 2939669807 | 2939670650 | 204 |
| 464 | iso_pu_bacteria | 2978969890 | 2978974407 | 204 |
| 465 | iso_pu_bacteria | 8056875544 | 8056877485 | 204 |
| 466 | 3300001989 | JGI24739J22299_10018881 | JGI24739J22299_100188812 | 205 |
| 467 | 3300001989 | JGI24739J22299_10041069 | JGI24739J22299_100410692 | 205 |
| 468 | 3300002067 | JGI24735J21928_10017647 | JGI24735J21928_100176473 | 205 |
| 469 | 3300002773 | JGI25152J39213_1003234 | JGI25152J39213_10032344 | 205 |
| 470 | 3300002773 | JGI25152J39213_1008147 | JGI25152J39213_10081473 | 205 |
| 471 | 3300002773 | JGI25152J39213_1008149 | JGI25152J39213_10081492 | 205 |
| 472 | 3300002987 | JGI25159J45721_1002671 | JGI25159J45721_10026715 | 205 |
| 473 | 3300003215 | JGI25153J46596_10005509 | JGI25153J46596_100055092 | 205 |
| 474 | 3300003215 | JGI25153J46596_10019173 | JGI25153J46596_100191732 | 205 |
| 475 | 3300003215 | JGI25153J46596_10019175 | JGI25153J46596_100191752 | 205 |
| 476 | 3300003354 | JGI25160J50197_1013793 | JGI25160J50197_10137932 | 205 |
| 477 | 3300003374 | JGI25161J50226_1000414 | JGI25161J50226_10004143 | 205 |
| 478 | 3300003771 | Ga0055526_1001540 | Ga0055526_100154011 | 205 |
| 479 | 3300003775 | Ga0055524_1009863 | Ga0055524_10098633 | 205 |
| 480 | 3300003790 | Ga0055528_1022222 | Ga0055528_10222222 | 205 |
| 481 | 3300003792 | Ga0055540_1014360 | Ga0055540_10143601 | 205 |
| 482 | 3300004625 | Ga0055543_1000219 | Ga0055543_100021950 | 205 |
| 483 | 3300005327 | Ga0070658_10169662 | Ga0070658_101696622 | 205 |
| 484 | 3300005339 | Ga0070660_100217678 | Ga0070660_1002176782 | 205 |
| 485 | 3300005539 | Ga0068853_100077411 | Ga0068853_1000774112 | 205 |
| 486 | 3300005539 | Ga0068853_100103070 | Ga0068853_1001030703 | 205 |
| 487 | 3300005548 | Ga0070665_100114636 | Ga0070665_1001146363 | 205 |
| 488 | 3300005548 | Ga0070665_100380116 | Ga0070665_1003801163 | 205 |
| 489 | 3300005548 | Ga0070665_100808426 | Ga0070665_1008084262 | 205 |
| 490 | 3300005577 | Ga0068857_100848818 | Ga0068857_1008488182 | 205 |
| 491 | 3300005578 | Ga0068854_100215787 | Ga0068854_1002157872 | 205 |
| 492 | 3300005983 | Ga0081540_1008997 | Ga0081540_10089978 | 205 |
| 493 | 3300005985 | Ga0081539_10003985 | Ga0081539_1000398519 | 205 |
| 494 | 3300006038 | Ga0075365_10014999 | Ga0075365_100149992 | 205 |
| 495 | 3300006038 | Ga0075365_10027101 | Ga0075365_100271014 | 205 |
| 496 | 3300006038 | Ga0075365_10091312 | Ga0075365_100913122 | 205 |
| 497 | 3300006038 | Ga0075365_10193096 | Ga0075365_101930962 | 205 |
| 498 | 3300006038 | Ga0075365_10349904 | Ga0075365_103499042 | 205 |
| 499 | 3300006038 | Ga0075365_10352199 | Ga0075365_103521992 | 205 |
| 500 | 3300006042 | Ga0075368_10012900 | Ga0075368_100129002 | 205 |
| 501 | 3300006048 | Ga0075363_100110039 | Ga0075363_1001100392 | 205 |
| 502 | 3300006051 | Ga0075364_10000062 | Ga0075364_1000006226 | 205 |
| 503 | 3300006051 | Ga0075364_10013107 | Ga0075364_100131076 | 205 |
| 504 | 3300006177 | Ga0075362_10081134 | Ga0075362_100811342 | 205 |
| 505 | 3300006177 | Ga0075362_10215162 | Ga0075362_102151622 | 205 |
| 506 | 3300006178 | Ga0075367_10080105 | Ga0075367_100801052 | 205 |
| 507 | 3300006178 | Ga0075367_10090395 | Ga0075367_100903953 | 205 |
| 508 | 3300006186 | Ga0075369_10021398 | Ga0075369_100213985 | 205 |
| 509 | 3300006186 | Ga0075369_10045442 | Ga0075369_100454423 | 205 |
| 510 | 3300006353 | Ga0075370_10137672 | Ga0075370_101376722 | 205 |
| 511 | 3300006353 | Ga0075370_10185657 | Ga0075370_101856572 | 205 |
| 512 | 3300009093 | Ga0105240_10129075 | Ga0105240_101290754 | 205 |
| 513 | 3300009093 | Ga0105240_10738840 | Ga0105240_107388402 | 205 |
| 514 | 3300009148 | Ga0105243_10287991 | Ga0105243_102879912 | 205 |
| 515 | 3300009174 | Ga0105241_10102121 | Ga0105241_101021213 | 205 |
| 516 | 3300009545 | Ga0105237_10118005 | Ga0105237_101180052 | 205 |
| 517 | 3300009545 | Ga0105237_10122860 | Ga0105237_101228604 | 205 |
| 518 | 3300009545 | Ga0105237_10148857 | Ga0105237_101488573 | 205 |
| 519 | 3300009551 | Ga0105238_10001891 | Ga0105238_1000189112 | 205 |
| 520 | 3300009551 | Ga0105238_10671985 | Ga0105238_106719852 | 205 |
| 521 | 3300009553 | Ga0105249_11033699 | Ga0105249_110336991 | 205 |
| 522 | 3300010375 | Ga0105239_10038780 | Ga0105239_100387804 | 205 |
| 523 | 3300010375 | Ga0105239_10067789 | Ga0105239_100677893 | 205 |
| 524 | 3300010375 | Ga0105239_10402337 | Ga0105239_104023372 | 205 |
| 525 | 3300010375 | Ga0105239_10415438 | Ga0105239_104154381 | 205 |
| 526 | 3300011119 | Ga0105246_11104067 | Ga0105246_111040671 | 205 |
| 527 | 3300013104 | Ga0157370_10178323 | Ga0157370_101783233 | 205 |
| 528 | 3300013105 | Ga0157369_10134081 | Ga0157369_101340812 | 205 |
| 529 | 3300013105 | Ga0157369_10262250 | Ga0157369_102622503 | 205 |
| 530 | 3300013296 | Ga0157374_10575989 | Ga0157374_105759892 | 205 |
| 531 | 3300013307 | Ga0157372_10696416 | Ga0157372_106964162 | 205 |
| 532 | 3300014497 | Ga0182008_10060664 | Ga0182008_100606643 | 205 |
| 533 | 3300015261 | Ga0182006_1069305 | Ga0182006_10693052 | 205 |
| 534 | 3300015262 | Ga0182007_10029650 | Ga0182007_100296503 | 205 |
| 535 | 3300025208 | Ga0209436_100020 | Ga0209436_10002090 | 205 |
| 536 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002694 | 205 |
| 537 | 3300025253 | Ga0209677_111155 | Ga0209677_1111552 | 205 |
| 538 | 3300025254 | Ga0209148_1000072 | Ga0209148_100007288 | 205 |
| 539 | 3300025254 | Ga0209148_1009801 | Ga0209148_10098013 | 205 |
| 540 | 3300025256 | Ga0209759_1000146 | Ga0209759_100014656 | 205 |
| 541 | 3300025258 | Ga0209129_1006281 | Ga0209129_10062813 | 205 |
| 542 | 3300025258 | Ga0209129_1006407 | Ga0209129_10064073 | 205 |
| 543 | 3300025258 | Ga0209129_1009808 | Ga0209129_10098083 | 205 |
| 544 | 3300025261 | Ga0209233_1000027 | Ga0209233_1000027498 | 205 |
| 545 | 3300025272 | Ga0209455_1000153 | Ga0209455_100015341 | 205 |
| 546 | 3300025273 | Ga0209673_1005745 | Ga0209673_10057452 | 205 |
| 547 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004335 | 205 |
| 548 | 3300025294 | Ga0209025_1003187 | Ga0209025_10031872 | 205 |
| 549 | 3300025294 | Ga0209025_1042481 | Ga0209025_10424812 | 205 |
| 550 | 3300025295 | Ga0209564_1000362 | Ga0209564_100036284 | 205 |
| 551 | 3300025297 | Ga0209758_1000540 | Ga0209758_100054055 | 205 |
| 552 | 3300025297 | Ga0209758_1000564 | Ga0209758_100056410 | 205 |
| 553 | 3300025297 | Ga0209758_1003996 | Ga0209758_100399611 | 205 |
| 554 | 3300025297 | Ga0209758_1005023 | Ga0209758_10050233 | 205 |
| 555 | 3300025299 | Ga0209256_1006317 | Ga0209256_10063172 | 205 |
| 556 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003392 | 205 |
| 557 | 3300025303 | Ga0209051_1001845 | Ga0209051_10018453 | 205 |
| 558 | 3300025303 | Ga0209051_1004341 | Ga0209051_10043414 | 205 |
| 559 | 3300025900 | Ga0207710_10133801 | Ga0207710_101338012 | 205 |
| 560 | 3300025904 | Ga0207647_10013583 | Ga0207647_100135834 | 205 |
| 561 | 3300025904 | Ga0207647_10150832 | Ga0207647_101508321 | 205 |
| 562 | 3300025907 | Ga0207645_10366041 | Ga0207645_103660412 | 205 |
| 563 | 3300025909 | Ga0207705_10257032 | Ga0207705_102570322 | 205 |
| 564 | 3300025911 | Ga0207654_10283590 | Ga0207654_102835902 | 205 |
| 565 | 3300025913 | Ga0207695_10169295 | Ga0207695_101692953 | 205 |
| 566 | 3300025914 | Ga0207671_10074585 | Ga0207671_100745853 | 205 |
| 567 | 3300025914 | Ga0207671_10364726 | Ga0207671_103647263 | 205 |
| 568 | 3300025919 | Ga0207657_10172967 | Ga0207657_101729673 | 205 |
| 569 | 3300025949 | Ga0207667_10354717 | Ga0207667_103547172 | 205 |
| 570 | 3300025961 | Ga0207712_10817146 | Ga0207712_108171462 | 205 |
| 571 | 3300026041 | Ga0207639_10062734 | Ga0207639_100627345 | 205 |
| 572 | 3300026041 | Ga0207639_10453860 | Ga0207639_104538602 | 205 |
| 573 | 3300026116 | Ga0207674_10023876 | Ga0207674_100238767 | 205 |
| 574 | 3300026121 | Ga0207683_10243403 | Ga0207683_102434032 | 205 |
| 575 | 3300026142 | Ga0207698_10174110 | Ga0207698_101741102 | 205 |
| 576 | 3300026142 | Ga0207698_11115947 | Ga0207698_111159471 | 205 |
| 577 | 3300027866 | Ga0209813_10047150 | Ga0209813_100471501 | 205 |
| 578 | 3300028379 | Ga0268266_10057364 | Ga0268266_100573643 | 205 |
| 579 | 3300028379 | Ga0268266_10058320 | Ga0268266_100583203 | 205 |
| 580 | 3300028379 | Ga0268266_10156687 | Ga0268266_101566872 | 205 |
| 581 | 3300028379 | Ga0268266_10312154 | Ga0268266_103121542 | 205 |
| 582 | 3300028379 | Ga0268266_10492430 | Ga0268266_104924301 | 205 |
| 583 | 3300031548 | Ga0307408_100222905 | Ga0307408_1002229052 | 205 |
| 584 | 3300032002 | Ga0307416_100263980 | Ga0307416_1002639802 | 205 |
| 585 | 3300037312 | Ga0395899_0000130 | Ga0395899_0000130_20044_20688 | 205 |
| 586 | 3300037418 | Ga0395900_0000020 | Ga0395900_0000020_332813_333457 | 205 |
| 587 | 3300037418 | Ga0395900_0063098 | Ga0395900_0063098_1482_2099 | 205 |
| 588 | 3300037418 | Ga0395900_0189461 | Ga0395900_0189461_750_1385 | 205 |
| 589 | 3300037418 | Ga0395900_0484345 | Ga0395900_0484345_21_638 | 205 |
| 590 | 3300037466 | Ga0395898_0000104 | Ga0395898_0000104_20044_20688 | 205 |
| 591 | 3300037466 | Ga0395898_0082399 | Ga0395898_0082399_2271_2888 | 205 |
| 592 | 3300037466 | Ga0395898_0593280 | Ga0395898_0593280_366_983 | 205 |
| 593 | 3300037471 | Ga0395905_0000019 | Ga0395905_0000019_20044_20688 | 205 |
| 594 | 3300037471 | Ga0395905_0013264 | Ga0395905_0013264_744_1361 | 205 |
| 595 | 3300037471 | Ga0395905_0259547 | Ga0395905_0259547_667_1302 | 205 |
| 596 | 3300037471 | Ga0395905_0291790 | Ga0395905_0291790_610_1227 | 205 |
| 597 | 3300037471 | Ga0395905_0325403 | Ga0395905_0325403_261_878 | 205 |
| 598 | 3300038443 | Ga0395901_0000016 | Ga0395901_0000016_333321_333965 | 205 |
| 599 | 3300038443 | Ga0395901_0072706 | Ga0395901_0072706_895_1512 | 205 |
| 600 | 3300038443 | Ga0395901_0197977 | Ga0395901_0197977_1117_1734 | 205 |
| 601 | 3300038443 | Ga0395901_0360121 | Ga0395901_0360121_47_682 | 205 |
| 602 | 3300038443 | Ga0395901_0550412 | Ga0395901_0550412_410_1027 | 205 |
| 603 | 3300038443 | Ga0395901_0601542 | Ga0395901_0601542_472_1089 | 205 |
| 604 | 3300038443 | Ga0395901_0631794 | Ga0395901_0631794_372_989 | 205 |
| 605 | 3300041413 | Ga0439465_0013562 | Ga0439465_0013562_252_908 | 205 |
| 606 | 3300041512 | Ga0451853_1125249 | Ga0451853_1125249_58_675 | 205 |
| 607 | 3300044658 | Ga0466972_0015679 | Ga0466972_0015679_3138_3755 | 205 |
| 608 | 3300044658 | Ga0466972_0050436 | Ga0466972_0050436_1106_1741 | 205 |
| 609 | 3300044901 | Ga0466960_0017406 | Ga0466960_0017406_1860_2477 | 205 |
| 610 | 3300046453 | Ga0495627_087496 | Ga0495627_087496_125_769 | 205 |
| 611 | 3300046454 | Ga0495592_0150150 | Ga0495592_0150150_806_1453 | 205 |
| 612 | 3300046460 | Ga0495638_0110086 | Ga0495638_0110086_709_1434 | 205 |
| 613 | 3300046512 | Ga0495610_0069620 | Ga0495610_0069620_808_1464 | 205 |
| 614 | 3300046519 | Ga0495632_0121825 | Ga0495632_0121825_442_1059 | 205 |
| 615 | 3300046522 | Ga0495643_0075461 | Ga0495643_0075461_1102_1719 | 205 |
| 616 | 3300046529 | Ga0495652_0514347 | Ga0495652_0514347_40_687 | 205 |
| 617 | 3300046542 | Ga0495597_0022344 | Ga0495597_0022344_316_933 | 205 |
| 618 | 3300046557 | Ga0495622_0081107 | Ga0495622_0081107_375_1022 | 205 |
| 619 | 3300046615 | Ga0495656_0356199 | Ga0495656_0356199_21_665 | 205 |
| 620 | 3300046616 | Ga0495668_0091293 | Ga0495668_0091293_887_1504 | 205 |
| 621 | 3300046616 | Ga0495668_0173265 | Ga0495668_0173265_60_677 | 205 |
| 622 | 3300046660 | Ga0495625_0195480 | Ga0495625_0195480_492_1121 | 205 |
| 623 | 3300046660 | Ga0495625_0229691 | Ga0495625_0229691_243_860 | 205 |
| 624 | 3300046809 | Ga0495600_0006725 | Ga0495600_0006725_3721_4368 | 205 |
| 625 | 3300047317 | Ga0495604_0059509 | Ga0495604_0059509_2059_2706 | 205 |
| 626 | 3300047323 | Ga0495683_0110752 | Ga0495683_0110752_637_1284 | 205 |
| 627 | 3300047443 | Ga0495687_023368 | Ga0495687_023368_49_666 | 205 |
| 628 | 3300047472 | Ga0495686_0043882 | Ga0495686_0043882_2118_2762 | 205 |
| 629 | 3300047472 | Ga0495686_0242374 | Ga0495686_0242374_180_797 | 205 |
| 630 | 3300048088 | Ga0495602_0512096 | Ga0495602_0512096_178_825 | 205 |
| 631 | 3300048091 | Ga0495626_0119284 | Ga0495626_0119284_86_703 | 205 |
| 632 | 3300048905 | Ga0496102_0078314 | Ga0496102_0078314_2409_3026 | 205 |
| 633 | 3300048905 | Ga0496102_0816474 | Ga0496102_0816474_95_712 | 205 |
| 634 | 3300048909 | Ga0496106_0264761 | Ga0496106_0264761_673_1290 | 205 |
| 635 | 3300048918 | Ga0496115_0136319 | Ga0496115_0136319_911_1585 | 205 |
| 636 | 3300048923 | Ga0496120_0001570 | Ga0496120_0001570_10127_10744 | 205 |
| 637 | 3300048925 | Ga0496122_0011480 | Ga0496122_0011480_5409_6056 | 205 |
| 638 | 3300048925 | Ga0496122_0048321 | Ga0496122_0048321_1634_2290 | 205 |
| 639 | 3300048926 | Ga0496123_0058781 | Ga0496123_0058781_307_978 | 205 |
| 640 | 3300048928 | Ga0496125_0008039 | Ga0496125_0008039_7437_8093 | 205 |
| 641 | 3300048929 | Ga0496126_0150033 | Ga0496126_0150033_544_1161 | 205 |
| 642 | 3300049568 | Ga0501031_0000561 | Ga0501031_0000561_124_741 | 205 |
| 643 | 3300049568 | Ga0501031_0046582 | Ga0501031_0046582_1620_2237 | 205 |
| 644 | 3300049569 | Ga0501032_0000022 | Ga0501032_0000022_146050_146667 | 205 |
| 645 | 3300049569 | Ga0501032_0000786 | Ga0501032_0000786_12848_13465 | 205 |
| 646 | 3300049569 | Ga0501032_0026619 | Ga0501032_0026619_724_1341 | 205 |
| 647 | 3300049569 | Ga0501032_0044629 | Ga0501032_0044629_83_739 | 205 |
| 648 | 3300049570 | Ga0501033_0000037 | Ga0501033_0000037_107_724 | 205 |
| 649 | 3300049570 | Ga0501033_0000197 | Ga0501033_0000197_30382_30999 | 205 |
| 650 | 3300049570 | Ga0501033_0020370 | Ga0501033_0020370_3669_4286 | 205 |
| 651 | 3300049570 | Ga0501033_0342938 | Ga0501033_0342938_132_749 | 205 |
| 652 | 3300049571 | Ga0501034_0000901 | Ga0501034_0000901_12343_12960 | 205 |
| 653 | 3300049571 | Ga0501034_0006623 | Ga0501034_0006623_11689_12306 | 205 |
| 654 | 3300049571 | Ga0501034_0045975 | Ga0501034_0045975_3070_3687 | 205 |
| 655 | 3300049572 | Ga0501036_0001200 | Ga0501036_0001200_1526_2143 | 205 |
| 656 | 3300049572 | Ga0501036_0018522 | Ga0501036_0018522_124_741 | 205 |
| 657 | 3300049572 | Ga0501036_0040737 | Ga0501036_0040737_843_1460 | 205 |
| 658 | 3300049573 | Ga0501037_0000016 | Ga0501037_0000016_160287_160904 | 205 |
| 659 | 3300049573 | Ga0501037_0000067 | Ga0501037_0000067_72296_72913 | 205 |
| 660 | 3300049573 | Ga0501037_0100302 | Ga0501037_0100302_631_1248 | 205 |
| 661 | 3300049574 | Ga0501038_0000013 | Ga0501038_0000013_155736_156353 | 205 |
| 662 | 3300049574 | Ga0501038_0000015 | Ga0501038_0000015_124_741 | 205 |
| 663 | 3300049574 | Ga0501038_0082955 | Ga0501038_0082955_1451_2068 | 205 |
| 664 | 3300049575 | Ga0501039_0000010 | Ga0501039_0000010_152152_152769 | 205 |
| 665 | 3300049575 | Ga0501039_0000013 | Ga0501039_0000013_233678_234295 | 205 |
| 666 | 3300049575 | Ga0501039_0619956 | Ga0501039_0619956_18_635 | 205 |
| 667 | 3300049575 | Ga0501039_0783997 | Ga0501039_0783997_77_703 | 205 |
| 668 | 3300049576 | Ga0501040_0043688 | Ga0501040_0043688_2363_2980 | 205 |
| 669 | 3300049576 | Ga0501040_0066538 | Ga0501040_0066538_1013_1630 | 205 |
| 670 | 3300049578 | Ga0501042_0060858 | Ga0501042_0060858_1395_2012 | 205 |
| 671 | 3300049579 | Ga0501043_0000056 | Ga0501043_0000056_12976_13593 | 205 |
| 672 | 3300049579 | Ga0501043_0001689 | Ga0501043_0001689_17665_18282 | 205 |
| 673 | 3300049580 | Ga0501046_0063035 | Ga0501046_0063035_1395_2012 | 205 |
| 674 | 3300049580 | Ga0501046_0216363 | Ga0501046_0216363_693_1310 | 205 |
| 675 | 3300049581 | Ga0501047_0039969 | Ga0501047_0039969_3796_4413 | 205 |
| 676 | 3300049581 | Ga0501047_0076770 | Ga0501047_0076770_505_1122 | 205 |
| 677 | 3300049582 | Ga0501048_0153872 | Ga0501048_0153872_333_950 | 205 |
| 678 | 3300049583 | Ga0501067_0114155 | Ga0501067_0114155_553_1170 | 205 |
| 679 | 3300049584 | Ga0501068_0006137 | Ga0501068_0006137_4486_5103 | 205 |
| 680 | 3300049586 | Ga0501070_0036389 | Ga0501070_0036389_2578_3195 | 205 |
| 681 | 3300049586 | Ga0501070_0068371 | Ga0501070_0068371_113_730 | 205 |
| 682 | 3300049586 | Ga0501070_0071851 | Ga0501070_0071851_1967_2683 | 205 |
| 683 | 3300049587 | Ga0501071_0057893 | Ga0501071_0057893_1149_1766 | 205 |
| 684 | 3300049587 | Ga0501071_0133286 | Ga0501071_0133286_1170_1796 | 205 |
| 685 | 3300049587 | Ga0501071_0720243 | Ga0501071_0720243_28_744 | 205 |
| 686 | 3300049588 | Ga0501072_0104530 | Ga0501072_0104530_412_1038 | 205 |
| 687 | 3300049589 | Ga0501073_0076946 | Ga0501073_0076946_1076_1693 | 205 |
| 688 | 3300049590 | Ga0501074_0144933 | Ga0501074_0144933_845_1462 | 205 |
| 689 | 3300049591 | Ga0501075_0900786 | Ga0501075_0900786_16_642 | 205 |
| 690 | 3300049593 | Ga0501077_0120409 | Ga0501077_0120409_851_1477 | 205 |
| 691 | 3300049742 | Ga0501080_0046328 | Ga0501080_0046328_1396_2013 | 205 |
| 692 | 3300049744 | Ga0501083_0078681 | Ga0501083_0078681_145_762 | 205 |
| 693 | 3300049822 | Ga0501035_0000046 | Ga0501035_0000046_145859_146476 | 205 |
| 694 | 3300049822 | Ga0501035_0000063 | Ga0501035_0000063_49978_50595 | 205 |
| 695 | 3300049822 | Ga0501035_0016341 | Ga0501035_0016341_4940_5557 | 205 |
| 696 | 3300049822 | Ga0501035_0054393 | Ga0501035_0054393_838_1455 | 205 |
| 697 | 3300049823 | Ga0501044_0000038 | Ga0501044_0000038_124_741 | 205 |
| 698 | 3300049823 | Ga0501044_0008677 | Ga0501044_0008677_5570_6187 | 205 |
| 699 | 3300049823 | Ga0501044_0155184 | Ga0501044_0155184_1538_2155 | 205 |
| 700 | 3300049823 | Ga0501044_0194859 | Ga0501044_0194859_270_986 | 205 |
| 701 | 3300049824 | Ga0501045_0114464 | Ga0501045_0114464_735_1352 | 205 |
| 702 | 3300049824 | Ga0501045_0132995 | Ga0501045_0132995_1178_1795 | 205 |
| 703 | 3300049824 | Ga0501045_0320467 | Ga0501045_0320467_111_728 | 205 |
| 704 | 3300050489 | nmdc:mga03683_65469_c1 | nmdc:mga03683_65469_c1_93_710 | 205 |
| 705 | 3300050489 | nmdc:mga03683_78309_c1 | nmdc:mga03683_78309_c1_746_1372 | 205 |
| 706 | 3300050490 | nmdc:mga03n38_49826_c1 | nmdc:mga03n38_49826_c1_1057_1674 | 205 |
| 707 | 3300050491 | nmdc:mga00v17_15298_c1 | nmdc:mga00v17_15298_c1_951_1568 | 205 |
| 708 | 3300050491 | nmdc:mga00v17_548532_c1 | nmdc:mga00v17_548532_c1_59_676 | 205 |
| 709 | 3300050492 | nmdc:mga0yw44_107498_c1 | nmdc:mga0yw44_107498_c1_674_1300 | 205 |
| 710 | 3300050492 | nmdc:mga0yw44_393848_c1 | nmdc:mga0yw44_393848_c1_260_877 | 205 |
| 711 | 3300050492 | nmdc:mga0yw44_539577_c1 | nmdc:mga0yw44_539577_c1_19_660 | 205 |
| 712 | 3300050492 | nmdc:mga0yw44_70272_c1 | nmdc:mga0yw44_70272_c1_807_1424 | 205 |
| 713 | 3300050492 | nmdc:mga0yw44_7495_c1 | nmdc:mga0yw44_7495_c1_2208_2825 | 205 |
| 714 | 3300050494 | nmdc:mga06z11_36544_c1 | nmdc:mga06z11_36544_c1_748_1365 | 205 |
| 715 | 3300050494 | nmdc:mga06z11_37380_c1 | nmdc:mga06z11_37380_c1_337_954 | 205 |
| 716 | 3300050495 | nmdc:mga04h51_49544_c1 | nmdc:mga04h51_49544_c1_145_762 | 205 |
| 717 | 3300050496 | nmdc:mga07m45_90489_c1 | nmdc:mga07m45_90489_c1_1105_1722 | 205 |
| 718 | 3300050516 | nmdc:mga0sz30_19195_c2 | nmdc:mga0sz30_19195_c2_222_839 | 205 |
| 719 | 3300050516 | nmdc:mga0sz30_220647_c1 | nmdc:mga0sz30_220647_c1_14_670 | 205 |
| 720 | 3300053079 | Ga0500610_0198005 | Ga0500610_0198005_106_723 | 205 |
| 721 | 3300053087 | Ga0500643_036920 | Ga0500643_036920_174_821 | 205 |
| 722 | 3300053093 | Ga0500651_0177387 | Ga0500651_0177387_535_1152 | 205 |
| 723 | 3300053121 | Ga0500607_106366 | Ga0500607_106366_270_917 | 205 |
| 724 | 3300053134 | Ga0500658_0190284 | Ga0500658_0190284_149_766 | 205 |
| 725 | 3300053148 | Ga0500590_004361 | Ga0500590_004361_2933_3580 | 205 |
| 726 | 3300053151 | Ga0500604_0144891 | Ga0500604_0144891_74_691 | 205 |
| 727 | 3300053158 | Ga0500627_0102756 | Ga0500627_0102756_574_1191 | 205 |
| 728 | 3300053158 | Ga0500627_0186305 | Ga0500627_0186305_234_851 | 205 |
| 729 | 3300053177 | Ga0500636_0059334 | Ga0500636_0059334_643_1290 | 205 |
| 730 | 3300054114 | Ga0501084_0531818 | Ga0501084_0531818_66_722 | 205 |
| 731 | 3300060353 | Ga0501082_0049338 | Ga0501082_0049338_2013_2669 | 205 |
| 732 | iso_pu_bacteria | 2508501123 | 2509114291 | 205 |
| 733 | iso_pu_bacteria | 2509276018 | 2509370405 | 205 |
| 734 | iso_pu_bacteria | 2509276022 | 2509397015 | 205 |
| 735 | iso_pu_bacteria | 2510065059 | 2510317374 | 205 |
| 736 | iso_pu_bacteria | 2512875016 | 2512930726 | 205 |
| 737 | iso_pu_bacteria | 2513237090 | 2513613569 | 205 |
| 738 | iso_pu_bacteria | 2643221595 | 2643986711 | 205 |
| 739 | iso_pu_bacteria | 2643221627 | 2644155297 | 205 |
| 740 | iso_pu_bacteria | 2687453392 | 2688599285 | 205 |
| 741 | iso_pu_bacteria | 2756170246 | 2756676872 | 205 |
| 742 | iso_pu_bacteria | 2791355123 | 2792752821 | 205 |
| 743 | iso_pu_bacteria | 2844002411 | 2844006618 | 205 |
| 744 | iso_pu_bacteria | 2871451962 | 2871459163 | 205 |
| 745 | iso_pu_bacteria | 2871466892 | 2871470595 | 205 |
| 746 | iso_pu_bacteria | 2876392853 | 2876395098 | 205 |
| 747 | iso_pu_bacteria | 2881161766 | 2881168466 | 205 |
| 748 | iso_pu_bacteria | 2882632389 | 2882634000 | 205 |
| 749 | iso_pu_bacteria | 2885305155 | 2885310441 | 205 |
| 750 | iso_pu_bacteria | 2885334103 | 2885339410 | 205 |
| 751 | iso_pu_bacteria | 2904659560 | 2904661729 | 205 |
| 752 | iso_pu_bacteria | 2906378014 | 2906384549 | 205 |
| 753 | iso_pu_bacteria | 2937861824 | 2937864787 | 205 |
| 754 | iso_pu_bacteria | 2937877337 | 2937879128 | 205 |
| 755 | iso_pu_bacteria | 2937891427 | 2937893418 | 205 |
| 756 | iso_pu_bacteria | 2937972304 | 2937975126 | 205 |
| 757 | iso_pu_bacteria | 2937980651 | 2937984422 | 205 |
| 758 | iso_pu_bacteria | 2958034702 | 2958034885 | 205 |
| 759 | iso_pu_bacteria | 2958041894 | 2958042986 | 205 |
| 760 | iso_pu_bacteria | 2958071322 | 2958074129 | 205 |
| 761 | iso_pu_bacteria | 2958084443 | 2958086302 | 205 |
| 762 | iso_pu_bacteria | 2958108152 | 2958110212 | 205 |
| 763 | iso_pu_bacteria | 2958122699 | 2958129431 | 205 |
| 764 | iso_pu_bacteria | 2958137437 | 2958143368 | 205 |
| 765 | iso_pu_bacteria | 2958144490 | 2958144834 | 205 |
| 766 | iso_pu_bacteria | 2958158011 | 2958161964 | 205 |
| 767 | iso_pu_bacteria | 2958165035 | 2958169758 | 205 |
| 768 | iso_pu_bacteria | 2961114664 | 2961116882 | 205 |
| 769 | iso_pu_bacteria | 2961127735 | 2961135050 | 205 |
| 770 | iso_pu_bacteria | 2961136820 | 2961143056 | 205 |
| 771 | iso_pu_bacteria | 2961163497 | 2961168218 | 205 |
| 772 | iso_pu_bacteria | 2961183825 | 2961184569 | 205 |
| 773 | iso_pu_bacteria | 2963644680 | 2963648499 | 205 |
| 774 | iso_pu_bacteria | 2965018300 | 2965023037 | 205 |
| 775 | iso_pu_bacteria | 2965025482 | 2965029386 | 205 |
| 776 | iso_pu_bacteria | 2965032056 | 2965038529 | 205 |
| 777 | iso_pu_bacteria | 2965040258 | 2965042332 | 205 |
| 778 | iso_pu_bacteria | 2965047637 | 2965051240 | 205 |
| 779 | iso_pu_bacteria | 2965062239 | 2965068179 | 205 |
| 780 | iso_pu_bacteria | 2965089291 | 2965094745 | 205 |
| 781 | iso_pu_bacteria | 2965102966 | 2965108817 | 205 |
| 782 | iso_pu_bacteria | 2968016561 | 2968017692 | 205 |
| 783 | iso_pu_bacteria | 2968083720 | 2968083729 | 205 |
| 784 | iso_pu_bacteria | 2968091066 | 2968091924 | 205 |
| 785 | iso_pu_bacteria | 2968110612 | 2968112789 | 205 |
| 786 | iso_pu_bacteria | 2968128360 | 2968129985 | 205 |
| 787 | iso_pu_bacteria | 2968171901 | 2968176618 | 205 |
| 788 | iso_pu_bacteria | 2970469710 | 2970472133 | 205 |
| 789 | iso_pu_bacteria | 2970547951 | 2970548186 | 205 |
| 790 | iso_pu_bacteria | 2970554993 | 2970559557 | 205 |
| 791 | iso_pu_bacteria | 2970593180 | 2970593365 | 205 |
| 792 | iso_pu_bacteria | 2970619444 | 2970624884 | 205 |
| 793 | iso_pu_bacteria | 2970627176 | 2970631591 | 205 |
| 794 | iso_pu_bacteria | 2977851361 | 2977852009 | 205 |
| 795 | iso_pu_bacteria | 2977858184 | 2977860324 | 205 |
| 796 | iso_pu_bacteria | 2977864932 | 2977872136 | 205 |
| 797 | iso_pu_bacteria | 2977872689 | 2977873185 | 205 |
| 798 | iso_pu_bacteria | 2977907340 | 2977909290 | 205 |
| 799 | iso_pu_bacteria | 2977915119 | 2977922536 | 205 |
| 800 | iso_pu_bacteria | 2977935797 | 2977941545 | 205 |
| 801 | iso_pu_bacteria | 2977950692 | 2977955747 | 205 |
| 802 | iso_pu_bacteria | 2977957713 | 2977963707 | 205 |
| 803 | iso_pu_bacteria | 2979764755 | 2979770354 | 205 |
| 804 | iso_pu_bacteria | 2979772303 | 2979778909 | 205 |
| 805 | iso_pu_bacteria | 2979793036 | 2979793478 | 205 |
| 806 | iso_pu_bacteria | 2987645492 | 2987647048 | 205 |
| 807 | iso_pu_bacteria | 2987659509 | 2987664232 | 205 |
| 808 | iso_pu_bacteria | 2987673487 | 2987680747 | 205 |
| 809 | iso_pu_bacteria | 2996341866 | 2996342841 | 205 |
| 810 | iso_pu_bacteria | 2996348954 | 2996351050 | 205 |
| 811 | iso_pu_bacteria | 3000135777 | 3000138343 | 205 |
| 812 | iso_pu_bacteria | 3004167301 | 3004170010 | 205 |
| 813 | iso_pu_bacteria | 3004188549 | 3004193287 | 205 |
| 814 | iso_pu_bacteria | 3004239961 | 3004247367 | 205 |
| 815 | iso_pu_bacteria | 3004248173 | 3004251739 | 205 |
| 816 | iso_pu_bacteria | 3004275668 | 3004277748 | 205 |
| 817 | iso_pu_bacteria | 3004289098 | 3004296890 | 205 |
| 818 | iso_pu_bacteria | 3004334049 | 3004340528 | 205 |
| 819 | iso_pu_bacteria | 637000159 | 637073771 | 205 |
| 820 | iso_pu_bacteria | 649633066 | 649873792 | 205 |
| 821 | iso_pu_bacteria | 8004300914 | 8004301443 | 205 |
| 822 | iso_pu_bacteria | 8004361976 | 8004364092 | 205 |
| 823 | iso_pu_bacteria | 8004640170 | 8004643294 | 205 |
| 824 | iso_pu_bacteria | 8004727605 | 8004729966 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ikb-assembly2.cif.gz_B | the structure of a conserved protein from streptococcus mutans ua159. | 0.8928 | 5 | 204 |
| 3ikb-assembly2.cif.gz_B | the structure of a conserved protein from streptococcus mutans ua159. | 0.8541 | 5 | 204 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.7024 | 2 | 205 |
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.7012 | 5 | 202 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.6961 | 2 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ikbB00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.87 | 2 | 204 | 3.40.470.10 |
| 3ikbB00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7959 | 2 | 204 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.6956 | 5 | 202 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.6935 | 2 | 205 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.6872 | 2 | 205 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1DXY3-F1-model_v4 | Uracil-DNA glycosylase family protein | 0.9963 | 118 | 205 |
|
| AF-A0A527HG90-F1-model_v4 | Uracil-DNA glycosylase family protein | 0.9871 | 126 | 205 |
|
| AF-I5C0B7-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.9866 | 29 | 204 |
|
| AF-A0A349QE44-F1-model_v4 | deleted | 0.9844 | 4 | 135 |
|
| AF-A0A530NB69-F1-model_v4 | deleted | 0.9836 | 1 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar