F482452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 825 | 288 | 1650 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0036749|Ga0501033_0036749_79_621 |
| Length | 180 |
| Sequence | LEKNINFKKVVYLLKEELFNNRLKKPTTMRGVNKVILIGNLGRDPDVQFLEGNIAVAKFSLATTETFKDRAGKLISQTEWHTVVLWRGLAELAQKYLHKGSLVYIEGRLRTRSWEDKEGNKKFATEVVGDNLVMLDKRMDLNNQDHPIPHHSSSGSGSGENFPGMEIPPSMNEPADDLPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 210 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 223 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 247 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 255 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 256 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 257 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 258 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 259 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 260 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 261 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 262 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 264 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 265 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 266 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 267 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 268 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 270 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 272 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 274 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 275 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 276 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 277 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 278 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 279 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 280 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 281 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 282 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 283 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 284 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 285 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 286 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 287 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 288 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 0 |
| Isolates | 1.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.91 |
| Nodule | 0 |
| Rhizoplane | 0.48 |
| Rhizosphere | 88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501033_0036749 | 3300049570 | Bacteria | 3669 |
| 2 | SwRhRL2b_contig_3499586 | 2162886007 | Bacteria | 1914 |
| 3 | ARcpr5oldR_c011424 | 3300000041 | Bacteria | 759 |
| 4 | JGI24740J21852_10008814 | 3300001979 | Bacteria | 3998 |
| 5 | JGI24740J21852_10018339 | 3300001979 | Bacteria | 2485 |
| 6 | JGI24740J21852_10043551 | 3300001979 | Bacteria | 1337 |
| 7 | JGI24739J22299_10000984 | 3300001989 | Bacteria | 10629 |
| 8 | JGI24739J22299_10008832 | 3300001989 | Bacteria | 3757 |
| 9 | JGI24739J22299_10046236 | 3300001989 | Bacteria | 1425 |
| 10 | JGI24739J22299_10095945 | 3300001989 | Bacteria | 898 |
| 11 | JGI24737J22298_10158016 | 3300001990 | Bacteria | 669 |
| 12 | JGI24744J21845_10013704 | 3300002077 | Unclassified | 1634 |
| 13 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 14 | JGI25406J46586_10001483 | 3300003203 | Bacteria | 11059 |
| 15 | JGI25153J46596_10002053 | 3300003215 | Bacteria | 11866 |
| 16 | rootH1_10041421 | 3300003316 | Bacteria | 4512 |
| 17 | rootH2_10006602 | 3300003320 | Bacteria | 39003 |
| 18 | rootH2_10017546 | 3300003320 | Bacteria | 2388 |
| 19 | rootH2_10039830 | 3300003320 | Bacteria | 9770 |
| 20 | rootH2_10067937 | 3300003320 | Bacteria | 6588 |
| 21 | rootH2_10075934 | 3300003320 | Bacteria | 19112 |
| 22 | rootH2_10144541 | 3300003320 | Bacteria | 1501 |
| 23 | rootH2_10239721 | 3300003320 | Bacteria | 1491 |
| 24 | rootL2_10043769 | 3300003322 | Bacteria | 2439 |
| 25 | rootL2_10118604 | 3300003322 | Bacteria | 6241 |
| 26 | rootL2_10155182 | 3300003322 | Bacteria | 1652 |
| 27 | rootL2_10249723 | 3300003322 | Unclassified | 2239 |
| 28 | rootH1_10013627 | 3300003323 | Bacteria | 14889 |
| 29 | rootH1_10020100 | 3300003323 | Bacteria | 1987 |
| 30 | rootH1_10044373 | 3300003323 | Unclassified | 2618 |
| 31 | rootH1_10048804 | 3300003323 | Bacteria | 7543 |
| 32 | JGI25160J50197_1000629 | 3300003354 | Bacteria | 19720 |
| 33 | JGI25160J50197_1003603 | 3300003354 | Bacteria | 6875 |
| 34 | Ga0055535_1002732 | 3300003761 | Bacteria | 5685 |
| 35 | Ga0055542_1002793 | 3300003762 | Bacteria | 5267 |
| 36 | Ga0055526_1046523 | 3300003771 | Bacteria | 1027 |
| 37 | Ga0055528_1002770 | 3300003790 | Bacteria | 9188 |
| 38 | Ga0055528_1010212 | 3300003790 | Bacteria | 3841 |
| 39 | Ga0055530_10002043 | 3300003791 | Bacteria | 13614 |
| 40 | Ga0065165_1000794 | 3300005262 | Bacteria | 42164 |
| 41 | Ga0065165_1016230 | 3300005262 | Bacteria | 2798 |
| 42 | Ga0065714_10195999 | 3300005288 | Bacteria | 902 |
| 43 | Ga0065704_10084167 | 3300005289 | Bacteria | 3369 |
| 44 | Ga0065704_10135560 | 3300005289 | Bacteria | 1575 |
| 45 | Ga0065704_10219316 | 3300005289 | Bacteria | 1080 |
| 46 | Ga0065712_10331430 | 3300005290 | Bacteria | 813 |
| 47 | Ga0065715_10157159 | 3300005293 | Bacteria | 1665 |
| 48 | Ga0065715_10169686 | 3300005293 | Bacteria | 1557 |
| 49 | Ga0065715_10523123 | 3300005293 | Bacteria | 762 |
| 50 | Ga0065715_10698001 | 3300005293 | Bacteria | 653 |
| 51 | Ga0065707_10105112 | 3300005295 | Unclassified | 2661 |
| 52 | Ga0065707_10374416 | 3300005295 | Bacteria | 885 |
| 53 | Ga0065707_10557798 | 3300005295 | Bacteria | 712 |
| 54 | Ga0065707_10631919 | 3300005295 | Bacteria | 673 |
| 55 | Ga0070658_10111052 | 3300005327 | Bacteria | 2271 |
| 56 | Ga0070658_10121781 | 3300005327 | Bacteria | 2168 |
| 57 | Ga0070658_10426728 | 3300005327 | Bacteria | 1141 |
| 58 | Ga0070658_10644294 | 3300005327 | Unclassified | 919 |
| 59 | Ga0070658_11198888 | 3300005327 | Bacteria | 660 |
| 60 | Ga0070676_10001354 | 3300005328 | Bacteria | 12323 |
| 61 | Ga0070676_10006927 | 3300005328 | Bacteria | 6071 |
| 62 | Ga0070676_10010874 | 3300005328 | Bacteria | 4941 |
| 63 | Ga0070676_10013514 | 3300005328 | Bacteria | 4474 |
| 64 | Ga0070676_10236512 | 3300005328 | Bacteria | 1213 |
| 65 | Ga0070676_10548189 | 3300005328 | Bacteria | 827 |
| 66 | Ga0070683_100005727 | 3300005329 | Bacteria | 10386 |
| 67 | Ga0070683_101550649 | 3300005329 | Bacteria | 637 |
| 68 | Ga0070683_101763922 | 3300005329 | Bacteria | 595 |
| 69 | Ga0070683_102032503 | 3300005329 | Unclassified | 552 |
| 70 | Ga0070690_100013844 | 3300005330 | Bacteria | 4779 |
| 71 | Ga0070690_100079502 | 3300005330 | Unclassified | 2144 |
| 72 | Ga0070670_100008061 | 3300005331 | Bacteria | 8960 |
| 73 | Ga0070670_100031019 | 3300005331 | Bacteria | 4603 |
| 74 | Ga0070670_100044143 | 3300005331 | Unclassified | 3833 |
| 75 | Ga0070670_100246840 | 3300005331 | Bacteria | 1555 |
| 76 | Ga0070677_10020874 | 3300005333 | Unclassified | 2394 |
| 77 | Ga0068869_100002827 | 3300005334 | Bacteria | 10519 |
| 78 | Ga0068869_100031991 | 3300005334 | Bacteria | 3704 |
| 79 | Ga0068869_100057957 | 3300005334 | Bacteria | 2830 |
| 80 | Ga0068869_100064491 | 3300005334 | Bacteria | 2695 |
| 81 | Ga0068869_100164585 | 3300005334 | Unclassified | 1729 |
| 82 | Ga0068869_100215579 | 3300005334 | Bacteria | 1519 |
| 83 | Ga0068869_100438880 | 3300005334 | Unclassified | 1080 |
| 84 | Ga0068869_100959834 | 3300005334 | Bacteria | 742 |
| 85 | Ga0068869_101061797 | 3300005334 | Bacteria | 707 |
| 86 | Ga0068869_101144533 | 3300005334 | Bacteria | 682 |
| 87 | Ga0070666_10000039 | 3300005335 | Bacteria | 115360 |
| 88 | Ga0070666_10000452 | 3300005335 | Bacteria | 24971 |
| 89 | Ga0070666_10006599 | 3300005335 | Bacteria | 7134 |
| 90 | Ga0070666_10013217 | 3300005335 | Bacteria | 5233 |
| 91 | Ga0070666_10484769 | 3300005335 | Unclassified | 895 |
| 92 | Ga0070680_100002499 | 3300005336 | Bacteria | 13629 |
| 93 | Ga0070682_100000300 | 3300005337 | Bacteria | 34454 |
| 94 | Ga0070682_100028311 | 3300005337 | Bacteria | 3369 |
| 95 | Ga0070682_100236346 | 3300005337 | Bacteria | 1309 |
| 96 | Ga0068868_100000280 | 3300005338 | Bacteria | 34319 |
| 97 | Ga0068868_100007213 | 3300005338 | Bacteria | 7899 |
| 98 | Ga0068868_100024984 | 3300005338 | Bacteria | 4538 |
| 99 | Ga0068868_100027020 | 3300005338 | Bacteria | 4376 |
| 100 | Ga0068868_100073205 | 3300005338 | Bacteria | 2735 |
| 101 | Ga0068868_100165968 | 3300005338 | Bacteria | 1826 |
| 102 | Ga0070660_100010731 | 3300005339 | Bacteria | 6483 |
| 103 | Ga0070660_100278893 | 3300005339 | Bacteria | 1367 |
| 104 | Ga0070660_100371268 | 3300005339 | Bacteria | 1180 |
| 105 | Ga0070660_100584513 | 3300005339 | Unclassified | 933 |
| 106 | Ga0070689_100006897 | 3300005340 | Bacteria | 7904 |
| 107 | Ga0070689_100126134 | 3300005340 | Bacteria | 2048 |
| 108 | Ga0070689_100274248 | 3300005340 | Bacteria | 1397 |
| 109 | Ga0070689_100947616 | 3300005340 | Bacteria | 763 |
| 110 | Ga0070689_101606810 | 3300005340 | Unclassified | 590 |
| 111 | Ga0070691_10000080 | 3300005341 | Bacteria | 26663 |
| 112 | Ga0070691_10271740 | 3300005341 | Bacteria | 916 |
| 113 | Ga0070687_100003457 | 3300005343 | Bacteria | 6135 |
| 114 | Ga0070687_100091206 | 3300005343 | Unclassified | 1686 |
| 115 | Ga0070687_100509271 | 3300005343 | Bacteria | 812 |
| 116 | Ga0070661_100016222 | 3300005344 | Bacteria | 5262 |
| 117 | Ga0070661_100093644 | 3300005344 | Unclassified | 2226 |
| 118 | Ga0070661_100251318 | 3300005344 | Bacteria | 1364 |
| 119 | Ga0070661_100373908 | 3300005344 | Unclassified | 1122 |
| 120 | Ga0070661_100688257 | 3300005344 | Unclassified | 832 |
| 121 | Ga0070661_101003766 | 3300005344 | Unclassified | 692 |
| 122 | Ga0070668_100000267 | 3300005347 | Bacteria | 34430 |
| 123 | Ga0070668_100021559 | 3300005347 | Bacteria | 4868 |
| 124 | Ga0070668_100050559 | 3300005347 | Bacteria | 3200 |
| 125 | Ga0070668_100324750 | 3300005347 | Unclassified | 1296 |
| 126 | Ga0070668_100929259 | 3300005347 | Bacteria | 779 |
| 127 | Ga0070669_100001604 | 3300005353 | Bacteria | 16344 |
| 128 | Ga0070669_100017067 | 3300005353 | Bacteria | 5179 |
| 129 | Ga0070669_100067755 | 3300005353 | Bacteria | 2634 |
| 130 | Ga0070669_100074731 | 3300005353 | Bacteria | 2512 |
| 131 | Ga0070669_100158935 | 3300005353 | Bacteria | 1755 |
| 132 | Ga0070669_100415576 | 3300005353 | Bacteria | 1103 |
| 133 | Ga0070669_100429754 | 3300005353 | Bacteria | 1085 |
| 134 | Ga0070669_100435013 | 3300005353 | Bacteria | 1079 |
| 135 | Ga0070675_100004009 | 3300005354 | Bacteria | 11177 |
| 136 | Ga0070675_100029574 | 3300005354 | Bacteria | 4420 |
| 137 | Ga0070675_100031468 | 3300005354 | Bacteria | 4290 |
| 138 | Ga0070675_100035088 | 3300005354 | Bacteria | 4074 |
| 139 | Ga0070675_100070016 | 3300005354 | Bacteria | 2907 |
| 140 | Ga0070675_100108134 | 3300005354 | Bacteria | 2349 |
| 141 | Ga0070675_100943713 | 3300005354 | Bacteria | 791 |
| 142 | Ga0070675_101195021 | 3300005354 | Bacteria | 700 |
| 143 | Ga0070675_102213439 | 3300005354 | Unclassified | 506 |
| 144 | Ga0070671_100004724 | 3300005355 | Bacteria | 10818 |
| 145 | Ga0070671_100014782 | 3300005355 | Bacteria | 6307 |
| 146 | Ga0070671_100045190 | 3300005355 | Bacteria | 3661 |
| 147 | Ga0070671_100122563 | 3300005355 | Bacteria | 2188 |
| 148 | Ga0070671_100171218 | 3300005355 | Bacteria | 1836 |
| 149 | Ga0070671_100215197 | 3300005355 | Unclassified | 1630 |
| 150 | Ga0070671_100389318 | 3300005355 | Unclassified | 1192 |
| 151 | Ga0070671_100439779 | 3300005355 | Unclassified | 1118 |
| 152 | Ga0070671_100452723 | 3300005355 | Bacteria | 1101 |
| 153 | Ga0070671_101699088 | 3300005355 | Bacteria | 560 |
| 154 | Ga0070674_100001880 | 3300005356 | Bacteria | 11400 |
| 155 | Ga0070674_100011350 | 3300005356 | Bacteria | 5423 |
| 156 | Ga0070674_100054587 | 3300005356 | Bacteria | 2764 |
| 157 | Ga0070674_100131708 | 3300005356 | Bacteria | 1865 |
| 158 | Ga0070674_100346401 | 3300005356 | Unclassified | 1199 |
| 159 | Ga0070674_101087370 | 3300005356 | Bacteria | 706 |
| 160 | Ga0070674_101572796 | 3300005356 | Unclassified | 592 |
| 161 | Ga0070673_100005984 | 3300005364 | Bacteria | 7869 |
| 162 | Ga0070673_100018578 | 3300005364 | Bacteria | 4970 |
| 163 | Ga0070673_100023077 | 3300005364 | Bacteria | 4541 |
| 164 | Ga0070673_100070665 | 3300005364 | Unclassified | 2802 |
| 165 | Ga0070673_100166404 | 3300005364 | Bacteria | 1879 |
| 166 | Ga0070673_100192379 | 3300005364 | Bacteria | 1753 |
| 167 | Ga0070673_100288842 | 3300005364 | Bacteria | 1441 |
| 168 | Ga0070688_100017479 | 3300005365 | Unclassified | 4116 |
| 169 | Ga0070688_100244422 | 3300005365 | Bacteria | 1275 |
| 170 | Ga0070688_100377549 | 3300005365 | Bacteria | 1044 |
| 171 | Ga0070688_101074649 | 3300005365 | Bacteria | 642 |
| 172 | Ga0070659_100006597 | 3300005366 | Bacteria | 8383 |
| 173 | Ga0070659_100058608 | 3300005366 | Bacteria | 3039 |
| 174 | Ga0070659_100576477 | 3300005366 | Bacteria | 965 |
| 175 | Ga0070659_100612375 | 3300005366 | Unclassified | 937 |
| 176 | Ga0070659_101169920 | 3300005366 | Unclassified | 679 |
| 177 | Ga0070667_100000827 | 3300005367 | Bacteria | 28762 |
| 178 | Ga0070667_100012012 | 3300005367 | Bacteria | 7170 |
| 179 | Ga0070667_100016036 | 3300005367 | Bacteria | 6198 |
| 180 | Ga0070667_100026868 | 3300005367 | Bacteria | 4790 |
| 181 | Ga0070667_100027844 | 3300005367 | Bacteria | 4703 |
| 182 | Ga0070667_100106249 | 3300005367 | Bacteria | 2430 |
| 183 | Ga0070667_100235076 | 3300005367 | Unclassified | 1635 |
| 184 | Ga0070667_100284886 | 3300005367 | Bacteria | 1485 |
| 185 | Ga0070667_100377448 | 3300005367 | Bacteria | 1287 |
| 186 | Ga0070667_100514916 | 3300005367 | Bacteria | 1097 |
| 187 | Ga0070667_100635519 | 3300005367 | Bacteria | 985 |
| 188 | Ga0070667_100963325 | 3300005367 | Bacteria | 795 |
| 189 | Ga0070701_10029988 | 3300005438 | Bacteria | 2687 |
| 190 | Ga0070701_10578445 | 3300005438 | Bacteria | 741 |
| 191 | Ga0070700_100053783 | 3300005441 | Unclassified | 2514 |
| 192 | Ga0070694_100083765 | 3300005444 | Bacteria | 2223 |
| 193 | Ga0070694_100289046 | 3300005444 | Bacteria | 1252 |
| 194 | Ga0070663_100616270 | 3300005455 | Bacteria | 914 |
| 195 | Ga0070678_100056697 | 3300005456 | Bacteria | 2867 |
| 196 | Ga0070678_100213190 | 3300005456 | Bacteria | 1601 |
| 197 | Ga0070678_100221177 | 3300005456 | Unclassified | 1574 |
| 198 | Ga0070678_100712256 | 3300005456 | Bacteria | 905 |
| 199 | Ga0070662_100006870 | 3300005457 | Bacteria | 7363 |
| 200 | Ga0070662_100037572 | 3300005457 | Unclassified | 3434 |
| 201 | Ga0070662_100368956 | 3300005457 | Unclassified | 1179 |
| 202 | Ga0070681_10040977 | 3300005458 | Bacteria | 4640 |
| 203 | Ga0068867_100007549 | 3300005459 | Bacteria | 7693 |
| 204 | Ga0068867_100014244 | 3300005459 | Bacteria | 5633 |
| 205 | Ga0068867_100043031 | 3300005459 | Bacteria | 3306 |
| 206 | Ga0068867_100051352 | 3300005459 | Bacteria | 3041 |
| 207 | Ga0068867_100052295 | 3300005459 | Bacteria | 3014 |
| 208 | Ga0068867_100096651 | 3300005459 | Bacteria | 2249 |
| 209 | Ga0068867_100134849 | 3300005459 | Bacteria | 1923 |
| 210 | Ga0070685_10025493 | 3300005466 | Bacteria | 3256 |
| 211 | Ga0070685_10049189 | 3300005466 | Unclassified | 2431 |
| 212 | Ga0070685_10253177 | 3300005466 | Bacteria | 1167 |
| 213 | Ga0070685_10411816 | 3300005466 | Unclassified | 938 |
| 214 | Ga0070685_10892191 | 3300005466 | Bacteria | 661 |
| 215 | Ga0070698_100009173 | 3300005471 | Bacteria | 10619 |
| 216 | Ga0070698_100023341 | 3300005471 | Bacteria | 6466 |
| 217 | Ga0070698_100168552 | 3300005471 | Bacteria | 2131 |
| 218 | Ga0070698_100281580 | 3300005471 | Unclassified | 1594 |
| 219 | Ga0070699_100240131 | 3300005518 | Bacteria | 1617 |
| 220 | Ga0070679_100005618 | 3300005530 | Bacteria | 11613 |
| 221 | Ga0070679_100874712 | 3300005530 | Bacteria | 842 |
| 222 | Ga0070679_100897794 | 3300005530 | Bacteria | 830 |
| 223 | Ga0070684_100010799 | 3300005535 | Bacteria | 7252 |
| 224 | Ga0068853_100001211 | 3300005539 | Bacteria | 18396 |
| 225 | Ga0068853_100010842 | 3300005539 | Bacteria | 7384 |
| 226 | Ga0068853_100029117 | 3300005539 | Bacteria | 4652 |
| 227 | Ga0068853_100095252 | 3300005539 | Bacteria | 2625 |
| 228 | Ga0068853_100123242 | 3300005539 | Bacteria | 2314 |
| 229 | Ga0068853_100209474 | 3300005539 | Unclassified | 1776 |
| 230 | Ga0068853_100356823 | 3300005539 | Bacteria | 1361 |
| 231 | Ga0070672_100003158 | 3300005543 | Bacteria | 10647 |
| 232 | Ga0070672_100005060 | 3300005543 | Bacteria | 8694 |
| 233 | Ga0070672_100006757 | 3300005543 | Bacteria | 7740 |
| 234 | Ga0070672_100019139 | 3300005543 | Unclassified | 4964 |
| 235 | Ga0070672_100064029 | 3300005543 | Bacteria | 2905 |
| 236 | Ga0070672_100505951 | 3300005543 | Bacteria | 1045 |
| 237 | Ga0070672_100543047 | 3300005543 | Bacteria | 1008 |
| 238 | Ga0070672_100742541 | 3300005543 | Bacteria | 861 |
| 239 | Ga0070672_100856922 | 3300005543 | Bacteria | 801 |
| 240 | Ga0070686_100003048 | 3300005544 | Bacteria | 9181 |
| 241 | Ga0070686_100048743 | 3300005544 | Bacteria | 2684 |
| 242 | Ga0070686_100841557 | 3300005544 | Bacteria | 742 |
| 243 | Ga0070696_100288857 | 3300005546 | Bacteria | 1252 |
| 244 | Ga0070693_100012076 | 3300005547 | Bacteria | 4362 |
| 245 | Ga0070693_100041450 | 3300005547 | Bacteria | 2590 |
| 246 | Ga0070665_100000916 | 3300005548 | Bacteria | 37835 |
| 247 | Ga0070665_100050076 | 3300005548 | Bacteria | 4191 |
| 248 | Ga0070704_100196989 | 3300005549 | Unclassified | 1623 |
| 249 | Ga0070704_101234182 | 3300005549 | Unclassified | 682 |
| 250 | Ga0068855_100000303 | 3300005563 | Bacteria | 61260 |
| 251 | Ga0068855_100021099 | 3300005563 | Bacteria | 7810 |
| 252 | Ga0068855_100031956 | 3300005563 | Bacteria | 6284 |
| 253 | Ga0068855_100032035 | 3300005563 | Bacteria | 6277 |
| 254 | Ga0068855_100247205 | 3300005563 | Unclassified | 1991 |
| 255 | Ga0068855_100473995 | 3300005563 | Bacteria | 1363 |
| 256 | Ga0070664_100018188 | 3300005564 | Bacteria | 5769 |
| 257 | Ga0070664_100028328 | 3300005564 | Bacteria | 4659 |
| 258 | Ga0070664_100237002 | 3300005564 | Bacteria | 1637 |
| 259 | Ga0070664_100751219 | 3300005564 | Unclassified | 910 |
| 260 | Ga0070664_101505386 | 3300005564 | Unclassified | 637 |
| 261 | Ga0068857_100003544 | 3300005577 | Bacteria | 13049 |
| 262 | Ga0068857_100036683 | 3300005577 | Bacteria | 4344 |
| 263 | Ga0068857_100068103 | 3300005577 | Bacteria | 3169 |
| 264 | Ga0068857_100252065 | 3300005577 | Bacteria | 1618 |
| 265 | Ga0068857_100894757 | 3300005577 | Bacteria | 851 |
| 266 | Ga0068857_101344185 | 3300005577 | Bacteria | 694 |
| 267 | Ga0068857_101398628 | 3300005577 | Unclassified | 680 |
| 268 | Ga0068857_101924052 | 3300005577 | Unclassified | 579 |
| 269 | Ga0068854_100012366 | 3300005578 | Bacteria | 5588 |
| 270 | Ga0068854_100014601 | 3300005578 | Bacteria | 5182 |
| 271 | Ga0068854_100027978 | 3300005578 | Bacteria | 3891 |
| 272 | Ga0068854_100106165 | 3300005578 | Unclassified | 2112 |
| 273 | Ga0068854_100176286 | 3300005578 | Bacteria | 1667 |
| 274 | Ga0068854_100212817 | 3300005578 | Bacteria | 1526 |
| 275 | Ga0068854_100555456 | 3300005578 | Bacteria | 974 |
| 276 | Ga0068856_100010761 | 3300005614 | Bacteria | 8884 |
| 277 | Ga0068856_100019682 | 3300005614 | Bacteria | 6551 |
| 278 | Ga0068856_100037969 | 3300005614 | Bacteria | 4727 |
| 279 | Ga0070702_100041307 | 3300005615 | Bacteria | 2586 |
| 280 | Ga0068852_100001479 | 3300005616 | Bacteria | 15899 |
| 281 | Ga0068852_100006499 | 3300005616 | Bacteria | 8451 |
| 282 | Ga0068852_100011761 | 3300005616 | Bacteria | 6607 |
| 283 | Ga0068852_100024082 | 3300005616 | Bacteria | 4914 |
| 284 | Ga0068852_100086688 | 3300005616 | Unclassified | 2792 |
| 285 | Ga0068852_100095028 | 3300005616 | Bacteria | 2676 |
| 286 | Ga0068852_100109668 | 3300005616 | Unclassified | 2507 |
| 287 | Ga0068852_100215491 | 3300005616 | Bacteria | 1824 |
| 288 | Ga0068852_100747074 | 3300005616 | Bacteria | 990 |
| 289 | Ga0068852_100804324 | 3300005616 | Bacteria | 954 |
| 290 | Ga0068852_100826664 | 3300005616 | Unclassified | 941 |
| 291 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 292 | Ga0068859_100012229 | 3300005617 | Bacteria | 8632 |
| 293 | Ga0068859_100067831 | 3300005617 | Bacteria | 3603 |
| 294 | Ga0068859_100082248 | 3300005617 | Bacteria | 3263 |
| 295 | Ga0068859_100167046 | 3300005617 | Unclassified | 2280 |
| 296 | Ga0068859_100258373 | 3300005617 | Bacteria | 1833 |
| 297 | Ga0068859_100783887 | 3300005617 | Bacteria | 1041 |
| 298 | Ga0068859_101457718 | 3300005617 | Bacteria | 755 |
| 299 | Ga0068859_101890520 | 3300005617 | Bacteria | 659 |
| 300 | Ga0068859_102200182 | 3300005617 | Unclassified | 608 |
| 301 | Ga0068864_100000239 | 3300005618 | Bacteria | 49175 |
| 302 | Ga0068864_100009898 | 3300005618 | Bacteria | 7863 |
| 303 | Ga0068864_100069416 | 3300005618 | Bacteria | 3064 |
| 304 | Ga0068864_100103448 | 3300005618 | Bacteria | 2528 |
| 305 | Ga0068864_100116594 | 3300005618 | Bacteria | 2383 |
| 306 | Ga0068864_100148752 | 3300005618 | Bacteria | 2119 |
| 307 | Ga0068864_100284422 | 3300005618 | Bacteria | 1544 |
| 308 | Ga0068866_10029147 | 3300005718 | Bacteria | 2637 |
| 309 | Ga0068866_10030243 | 3300005718 | Bacteria | 2597 |
| 310 | Ga0068866_10214134 | 3300005718 | Bacteria | 1158 |
| 311 | Ga0068866_10339871 | 3300005718 | Unclassified | 950 |
| 312 | Ga0068866_11006521 | 3300005718 | Bacteria | 592 |
| 313 | Ga0068861_100003393 | 3300005719 | Bacteria | 10570 |
| 314 | Ga0068861_100003670 | 3300005719 | Bacteria | 10241 |
| 315 | Ga0068861_100033589 | 3300005719 | Bacteria | 3786 |
| 316 | Ga0068861_100123926 | 3300005719 | Bacteria | 2088 |
| 317 | Ga0068861_100175178 | 3300005719 | Bacteria | 1781 |
| 318 | Ga0068861_100307510 | 3300005719 | Bacteria | 1376 |
| 319 | Ga0068861_100382939 | 3300005719 | Bacteria | 1243 |
| 320 | Ga0068861_101524301 | 3300005719 | Bacteria | 656 |
| 321 | Ga0068851_10000724 | 3300005834 | Bacteria | 14097 |
| 322 | Ga0068851_10020383 | 3300005834 | Bacteria | 3211 |
| 323 | Ga0068851_10094404 | 3300005834 | Unclassified | 1579 |
| 324 | Ga0068851_10106759 | 3300005834 | Bacteria | 1491 |
| 325 | Ga0068851_10160064 | 3300005834 | Bacteria | 1236 |
| 326 | Ga0068870_10012712 | 3300005840 | Bacteria | 3940 |
| 327 | Ga0068863_100000808 | 3300005841 | Bacteria | 31389 |
| 328 | Ga0068863_100002445 | 3300005841 | Bacteria | 18454 |
| 329 | Ga0068863_100019691 | 3300005841 | Bacteria | 6455 |
| 330 | Ga0068863_100115517 | 3300005841 | Bacteria | 2557 |
| 331 | Ga0068858_100000453 | 3300005842 | Bacteria | 42983 |
| 332 | Ga0068858_100007148 | 3300005842 | Bacteria | 10835 |
| 333 | Ga0068858_100380293 | 3300005842 | Unclassified | 1355 |
| 334 | Ga0068858_100565366 | 3300005842 | Bacteria | 1101 |
| 335 | Ga0068858_101178621 | 3300005842 | Bacteria | 753 |
| 336 | Ga0068858_101411002 | 3300005842 | Bacteria | 686 |
| 337 | Ga0068858_101648981 | 3300005842 | Unclassified | 633 |
| 338 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 339 | Ga0068860_100002063 | 3300005843 | Bacteria | 21160 |
| 340 | Ga0068860_100002984 | 3300005843 | Bacteria | 17484 |
| 341 | Ga0068860_100012912 | 3300005843 | Bacteria | 8205 |
| 342 | Ga0068860_100044805 | 3300005843 | Bacteria | 4216 |
| 343 | Ga0068860_100178940 | 3300005843 | Bacteria | 2050 |
| 344 | Ga0068862_100101788 | 3300005844 | Bacteria | 2513 |
| 345 | Ga0068862_100285933 | 3300005844 | Bacteria | 1513 |
| 346 | Ga0068862_100310304 | 3300005844 | Bacteria | 1454 |
| 347 | Ga0068862_100704707 | 3300005844 | Bacteria | 978 |
| 348 | Ga0081540_1004973 | 3300005983 | Bacteria | 9997 |
| 349 | Ga0081539_10000223 | 3300005985 | Bacteria | 133106 |
| 350 | Ga0070715_10017463 | 3300006163 | Unclassified | 2717 |
| 351 | Ga0075366_10016919 | 3300006195 | Bacteria | 4190 |
| 352 | Ga0075366_10052395 | 3300006195 | Bacteria | 2424 |
| 353 | Ga0075366_10079219 | 3300006195 | Bacteria | 1961 |
| 354 | Ga0097621_100000199 | 3300006237 | Bacteria | 38904 |
| 355 | Ga0097621_100000788 | 3300006237 | Bacteria | 22264 |
| 356 | Ga0097621_100002337 | 3300006237 | Bacteria | 12996 |
| 357 | Ga0097621_100015604 | 3300006237 | Bacteria | 5723 |
| 358 | Ga0097621_100016643 | 3300006237 | Bacteria | 5564 |
| 359 | Ga0097621_100048947 | 3300006237 | Bacteria | 3432 |
| 360 | Ga0097621_100059896 | 3300006237 | Unclassified | 3119 |
| 361 | Ga0097621_100107381 | 3300006237 | Unclassified | 2355 |
| 362 | Ga0097621_100233547 | 3300006237 | Bacteria | 1606 |
| 363 | Ga0075370_10079241 | 3300006353 | Bacteria | 1887 |
| 364 | Ga0068871_100000319 | 3300006358 | Bacteria | 33457 |
| 365 | Ga0068871_100001579 | 3300006358 | Bacteria | 15313 |
| 366 | Ga0068871_100003257 | 3300006358 | Bacteria | 11137 |
| 367 | Ga0068871_100010507 | 3300006358 | Bacteria | 6761 |
| 368 | Ga0068871_100026260 | 3300006358 | Bacteria | 4542 |
| 369 | Ga0068871_100059161 | 3300006358 | Unclassified | 3122 |
| 370 | Ga0068871_100093413 | 3300006358 | Bacteria | 2510 |
| 371 | Ga0068871_100954337 | 3300006358 | Bacteria | 797 |
| 372 | Ga0068871_100976258 | 3300006358 | Bacteria | 788 |
| 373 | Ga0068871_101016486 | 3300006358 | Unclassified | 772 |
| 374 | Ga0068871_101038186 | 3300006358 | Bacteria | 765 |
| 375 | Ga0068871_101050397 | 3300006358 | Bacteria | 760 |
| 376 | Ga0068871_101365405 | 3300006358 | Bacteria | 667 |
| 377 | Ga0075428_100056938 | 3300006844 | Bacteria | 4280 |
| 378 | Ga0075428_100837809 | 3300006844 | Bacteria | 977 |
| 379 | Ga0075433_10293703 | 3300006852 | Unclassified | 1439 |
| 380 | Ga0075434_100877867 | 3300006871 | Bacteria | 912 |
| 381 | Ga0075429_100002069 | 3300006880 | Bacteria | 16736 |
| 382 | Ga0075429_100297064 | 3300006880 | Unclassified | 1414 |
| 383 | Ga0068865_100005349 | 3300006881 | Bacteria | 7775 |
| 384 | Ga0068865_100010178 | 3300006881 | Bacteria | 5846 |
| 385 | Ga0068865_100049422 | 3300006881 | Bacteria | 2899 |
| 386 | Ga0068865_101031638 | 3300006881 | Bacteria | 721 |
| 387 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 388 | Ga0097620_100012229 | 3300006931 | Bacteria | 8632 |
| 389 | Ga0097620_100067824 | 3300006931 | Bacteria | 3603 |
| 390 | Ga0097620_100082253 | 3300006931 | Bacteria | 3263 |
| 391 | Ga0097620_100167038 | 3300006931 | Unclassified | 2280 |
| 392 | Ga0097620_100258379 | 3300006931 | Bacteria | 1833 |
| 393 | Ga0097620_100783917 | 3300006931 | Bacteria | 1041 |
| 394 | Ga0097620_101458087 | 3300006931 | Bacteria | 755 |
| 395 | Ga0097620_101889851 | 3300006931 | Bacteria | 659 |
| 396 | Ga0097620_102200165 | 3300006931 | Unclassified | 608 |
| 397 | Ga0105240_10021604 | 3300009093 | Bacteria | 8559 |
| 398 | Ga0105240_10094371 | 3300009093 | Unclassified | 3650 |
| 399 | Ga0105240_10344451 | 3300009093 | Bacteria | 1692 |
| 400 | Ga0105240_10391369 | 3300009093 | Unclassified | 1568 |
| 401 | Ga0111539_10000962 | 3300009094 | Bacteria | 37802 |
| 402 | Ga0105245_10749198 | 3300009098 | Unclassified | 1012 |
| 403 | Ga0105245_10759124 | 3300009098 | Bacteria | 1006 |
| 404 | Ga0105245_10808776 | 3300009098 | Bacteria | 976 |
| 405 | Ga0105247_10003742 | 3300009101 | Bacteria | 9867 |
| 406 | Ga0105247_10005694 | 3300009101 | Bacteria | 7808 |
| 407 | Ga0105247_10082555 | 3300009101 | Unclassified | 2028 |
| 408 | Ga0105247_10129759 | 3300009101 | Unclassified | 1642 |
| 409 | Ga0105241_10044903 | 3300009174 | Bacteria | 3350 |
| 410 | Ga0105241_10093720 | 3300009174 | Bacteria | 2374 |
| 411 | Ga0105241_10843291 | 3300009174 | Bacteria | 847 |
| 412 | Ga0105242_10013689 | 3300009176 | Bacteria | 6276 |
| 413 | Ga0105242_10025051 | 3300009176 | Bacteria | 4716 |
| 414 | Ga0105242_10042319 | 3300009176 | Bacteria | 3678 |
| 415 | Ga0105242_10074344 | 3300009176 | Bacteria | 2828 |
| 416 | Ga0105242_10447017 | 3300009176 | Bacteria | 1217 |
| 417 | Ga0105248_10028685 | 3300009177 | Bacteria | 6202 |
| 418 | Ga0105248_11741016 | 3300009177 | Bacteria | 707 |
| 419 | Ga0105237_10001982 | 3300009545 | Bacteria | 26058 |
| 420 | Ga0105237_10018657 | 3300009545 | Bacteria | 7172 |
| 421 | Ga0105237_10021343 | 3300009545 | Bacteria | 6658 |
| 422 | Ga0105237_10085381 | 3300009545 | Unclassified | 3146 |
| 423 | Ga0105237_10143716 | 3300009545 | Bacteria | 2380 |
| 424 | Ga0105237_10264345 | 3300009545 | Bacteria | 1723 |
| 425 | Ga0105237_10666883 | 3300009545 | Bacteria | 1047 |
| 426 | Ga0105238_10377844 | 3300009551 | Bacteria | 1408 |
| 427 | Ga0105238_10512566 | 3300009551 | Bacteria | 1201 |
| 428 | Ga0105238_10651810 | 3300009551 | Bacteria | 1063 |
| 429 | Ga0105249_10001537 | 3300009553 | Bacteria | 20259 |
| 430 | Ga0105249_10008988 | 3300009553 | Bacteria | 8729 |
| 431 | Ga0105249_10201155 | 3300009553 | Bacteria | 1949 |
| 432 | Ga0105249_12157013 | 3300009553 | Unclassified | 630 |
| 433 | Ga0105239_10019843 | 3300010375 | Bacteria | 7418 |
| 434 | Ga0105239_10068551 | 3300010375 | Bacteria | 3898 |
| 435 | Ga0105239_10072111 | 3300010375 | Unclassified | 3796 |
| 436 | Ga0105239_10327607 | 3300010375 | Bacteria | 1727 |
| 437 | Ga0105239_10717449 | 3300010375 | Bacteria | 1144 |
| 438 | Ga0105246_10006786 | 3300011119 | Bacteria | 7000 |
| 439 | Ga0105246_10051676 | 3300011119 | Bacteria | 2823 |
| 440 | Ga0105246_10274227 | 3300011119 | Bacteria | 1350 |
| 441 | Ga0105246_10482591 | 3300011119 | Bacteria | 1049 |
| 442 | Ga0105246_11170744 | 3300011119 | Bacteria | 706 |
| 443 | Ga0157373_10067815 | 3300013100 | Bacteria | 2522 |
| 444 | Ga0157371_10007008 | 3300013102 | Bacteria | 9170 |
| 445 | Ga0157371_10231024 | 3300013102 | Bacteria | 1329 |
| 446 | Ga0157371_10321262 | 3300013102 | Bacteria | 1123 |
| 447 | Ga0157370_10830144 | 3300013104 | Bacteria | 840 |
| 448 | Ga0157369_10170178 | 3300013105 | Bacteria | 2296 |
| 449 | Ga0157369_10280792 | 3300013105 | Unclassified | 1734 |
| 450 | Ga0157369_10494963 | 3300013105 | Bacteria | 1265 |
| 451 | Ga0157374_10000168 | 3300013296 | Bacteria | 60649 |
| 452 | Ga0157374_10034554 | 3300013296 | Bacteria | 4619 |
| 453 | Ga0157374_10086358 | 3300013296 | Bacteria | 2985 |
| 454 | Ga0157374_10913790 | 3300013296 | Bacteria | 896 |
| 455 | Ga0157378_10002295 | 3300013297 | Bacteria | 16997 |
| 456 | Ga0157378_10005820 | 3300013297 | Bacteria | 10808 |
| 457 | Ga0157378_10008685 | 3300013297 | Bacteria | 8840 |
| 458 | Ga0157378_10025276 | 3300013297 | Bacteria | 5230 |
| 459 | Ga0157378_10085511 | 3300013297 | Bacteria | 2857 |
| 460 | Ga0157378_10209801 | 3300013297 | Bacteria | 1846 |
| 461 | Ga0157378_10359579 | 3300013297 | Bacteria | 1424 |
| 462 | Ga0157378_10555968 | 3300013297 | Bacteria | 1153 |
| 463 | Ga0157378_10679491 | 3300013297 | Bacteria | 1047 |
| 464 | Ga0157378_10797348 | 3300013297 | Bacteria | 970 |
| 465 | Ga0163162_10000171 | 3300013306 | Bacteria | 59945 |
| 466 | Ga0163162_10000504 | 3300013306 | Bacteria | 36390 |
| 467 | Ga0163162_10005998 | 3300013306 | Bacteria | 11763 |
| 468 | Ga0163162_10062085 | 3300013306 | Bacteria | 3776 |
| 469 | Ga0163162_10127568 | 3300013306 | Bacteria | 2651 |
| 470 | Ga0163162_10156581 | 3300013306 | Bacteria | 2398 |
| 471 | Ga0163162_10227041 | 3300013306 | Bacteria | 1997 |
| 472 | Ga0163162_10239181 | 3300013306 | Bacteria | 1946 |
| 473 | Ga0157372_10013228 | 3300013307 | Bacteria | 8807 |
| 474 | Ga0157372_10022050 | 3300013307 | Bacteria | 6887 |
| 475 | Ga0157372_10024024 | 3300013307 | Bacteria | 6614 |
| 476 | Ga0157372_10077990 | 3300013307 | Unclassified | 3743 |
| 477 | Ga0157372_10180209 | 3300013307 | Bacteria | 2445 |
| 478 | Ga0157372_10194238 | 3300013307 | Unclassified | 2351 |
| 479 | Ga0157372_10613103 | 3300013307 | Bacteria | 1268 |
| 480 | Ga0157375_10000098 | 3300013308 | Bacteria | 88130 |
| 481 | Ga0157375_10006257 | 3300013308 | Bacteria | 10369 |
| 482 | Ga0157375_10016610 | 3300013308 | Bacteria | 6618 |
| 483 | Ga0157375_10029421 | 3300013308 | Bacteria | 5166 |
| 484 | Ga0157375_10030623 | 3300013308 | Bacteria | 5076 |
| 485 | Ga0157375_10031284 | 3300013308 | Bacteria | 5027 |
| 486 | Ga0157375_10034938 | 3300013308 | Bacteria | 4794 |
| 487 | Ga0157375_10238291 | 3300013308 | Bacteria | 1979 |
| 488 | Ga0157375_10343952 | 3300013308 | Unclassified | 1657 |
| 489 | Ga0157375_13457679 | 3300013308 | Unclassified | 526 |
| 490 | Ga0163163_10000271 | 3300014325 | Bacteria | 52036 |
| 491 | Ga0163163_10001158 | 3300014325 | Bacteria | 22414 |
| 492 | Ga0163163_10087194 | 3300014325 | Bacteria | 3131 |
| 493 | Ga0163163_10147871 | 3300014325 | Bacteria | 2394 |
| 494 | Ga0163163_10344075 | 3300014325 | Bacteria | 1547 |
| 495 | Ga0163163_10347582 | 3300014325 | Unclassified | 1539 |
| 496 | Ga0163163_10796968 | 3300014325 | Unclassified | 1008 |
| 497 | Ga0157380_10001179 | 3300014326 | Bacteria | 16931 |
| 498 | Ga0157380_10004406 | 3300014326 | Bacteria | 9758 |
| 499 | Ga0157380_10022376 | 3300014326 | Bacteria | 4757 |
| 500 | Ga0157380_10288610 | 3300014326 | Bacteria | 1505 |
| 501 | Ga0157380_10762204 | 3300014326 | Bacteria | 980 |
| 502 | Ga0157377_10001079 | 3300014745 | Bacteria | 11553 |
| 503 | Ga0157377_10512339 | 3300014745 | Bacteria | 841 |
| 504 | Ga0157379_10002303 | 3300014968 | Bacteria | 15919 |
| 505 | Ga0157379_10027927 | 3300014968 | Bacteria | 5022 |
| 506 | Ga0157379_10042242 | 3300014968 | Bacteria | 4070 |
| 507 | Ga0157379_10054987 | 3300014968 | Bacteria | 3557 |
| 508 | Ga0157379_10199835 | 3300014968 | Unclassified | 1808 |
| 509 | Ga0157376_10000444 | 3300014969 | Bacteria | 26696 |
| 510 | Ga0157376_10002197 | 3300014969 | Bacteria | 13158 |
| 511 | Ga0157376_10005420 | 3300014969 | Bacteria | 8919 |
| 512 | Ga0157376_10030411 | 3300014969 | Bacteria | 4312 |
| 513 | Ga0157376_10046908 | 3300014969 | Bacteria | 3565 |
| 514 | Ga0157376_10078410 | 3300014969 | Unclassified | 2829 |
| 515 | Ga0157376_10258779 | 3300014969 | Bacteria | 1629 |
| 516 | Ga0157376_10439281 | 3300014969 | Bacteria | 1270 |
| 517 | Ga0182005_1000043 | 3300015265 | Bacteria | 140285 |
| 518 | Ga0163161_10001929 | 3300017792 | Bacteria | 15128 |
| 519 | Ga0163161_10007014 | 3300017792 | Bacteria | 7792 |
| 520 | Ga0163161_10096754 | 3300017792 | Bacteria | 2192 |
| 521 | Ga0163161_10104782 | 3300017792 | Bacteria | 2109 |
| 522 | Ga0163161_10810689 | 3300017792 | Bacteria | 787 |
| 523 | Ga0213876_10022180 | 3300021384 | Bacteria | 3358 |
| 524 | Ga0209436_100943 | 3300025208 | Bacteria | 11470 |
| 525 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 526 | Ga0207425_1026048 | 3300025245 | Bacteria | 1202 |
| 527 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 528 | Ga0209646_1021587 | 3300025246 | Bacteria | 923 |
| 529 | Ga0209026_1000156 | 3300025250 | Bacteria | 107193 |
| 530 | Ga0209148_1000339 | 3300025254 | Bacteria | 62786 |
| 531 | Ga0209673_1000078 | 3300025273 | Bacteria | 227727 |
| 532 | Ga0209130_1001642 | 3300025284 | Bacteria | 13725 |
| 533 | Ga0209675_1024218 | 3300025291 | Bacteria | 1555 |
| 534 | Ga0209564_1007098 | 3300025295 | Bacteria | 5856 |
| 535 | Ga0209758_1006680 | 3300025297 | Bacteria | 8147 |
| 536 | Ga0209758_1009520 | 3300025297 | Bacteria | 6017 |
| 537 | Ga0209050_1000097 | 3300025298 | Bacteria | 239919 |
| 538 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 539 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 540 | Ga0207426_1000472 | 3300025302 | Bacteria | 61715 |
| 541 | Ga0207426_1001380 | 3300025302 | Bacteria | 20557 |
| 542 | Ga0207426_1022941 | 3300025302 | Bacteria | 2135 |
| 543 | Ga0209257_1000717 | 3300025304 | Bacteria | 50888 |
| 544 | Ga0207697_10051958 | 3300025315 | Bacteria | 1695 |
| 545 | Ga0207697_10221870 | 3300025315 | Unclassified | 834 |
| 546 | Ga0207656_10003743 | 3300025321 | Bacteria | 5268 |
| 547 | Ga0207656_10018323 | 3300025321 | Bacteria | 2755 |
| 548 | Ga0207656_10175413 | 3300025321 | Bacteria | 1026 |
| 549 | Ga0207656_10182515 | 3300025321 | Bacteria | 1008 |
| 550 | Ga0207656_10341202 | 3300025321 | Bacteria | 747 |
| 551 | Ga0207682_10005197 | 3300025893 | Bacteria | 5328 |
| 552 | Ga0207682_10021884 | 3300025893 | Bacteria | 2516 |
| 553 | Ga0207642_10226238 | 3300025899 | Unclassified | 1048 |
| 554 | Ga0207642_10500698 | 3300025899 | Bacteria | 744 |
| 555 | Ga0207710_10173800 | 3300025900 | Unclassified | 1054 |
| 556 | Ga0207688_10007956 | 3300025901 | Bacteria | 5767 |
| 557 | Ga0207680_10000037 | 3300025903 | Bacteria | 72773 |
| 558 | Ga0207680_10002060 | 3300025903 | Bacteria | 9416 |
| 559 | Ga0207680_10016273 | 3300025903 | Bacteria | 3901 |
| 560 | Ga0207680_10136576 | 3300025903 | Bacteria | 1621 |
| 561 | Ga0207647_10000222 | 3300025904 | Bacteria | 46878 |
| 562 | Ga0207647_10010106 | 3300025904 | Bacteria | 6674 |
| 563 | Ga0207647_10069186 | 3300025904 | Bacteria | 2134 |
| 564 | Ga0207647_10212866 | 3300025904 | Bacteria | 1115 |
| 565 | Ga0207645_10000733 | 3300025907 | Bacteria | 27302 |
| 566 | Ga0207645_10001928 | 3300025907 | Bacteria | 16746 |
| 567 | Ga0207645_10474190 | 3300025907 | Bacteria | 846 |
| 568 | Ga0207643_10008733 | 3300025908 | Bacteria | 5436 |
| 569 | Ga0207643_10591672 | 3300025908 | Bacteria | 714 |
| 570 | Ga0207705_10042294 | 3300025909 | Bacteria | 3271 |
| 571 | Ga0207705_10086377 | 3300025909 | Unclassified | 2293 |
| 572 | Ga0207705_10276499 | 3300025909 | Bacteria | 1285 |
| 573 | Ga0207705_10514580 | 3300025909 | Unclassified | 930 |
| 574 | Ga0207654_10001560 | 3300025911 | Bacteria | 12034 |
| 575 | Ga0207654_10019285 | 3300025911 | Bacteria | 3597 |
| 576 | Ga0207654_10087445 | 3300025911 | Bacteria | 1891 |
| 577 | Ga0207707_10000353 | 3300025912 | Bacteria | 48229 |
| 578 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 579 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 580 | Ga0207695_10000081 | 3300025913 | Bacteria | 284797 |
| 581 | Ga0207695_10000156 | 3300025913 | Bacteria | 204576 |
| 582 | Ga0207695_10004658 | 3300025913 | Bacteria | 18588 |
| 583 | Ga0207695_10027728 | 3300025913 | Bacteria | 6302 |
| 584 | Ga0207695_10037494 | 3300025913 | Bacteria | 5230 |
| 585 | Ga0207695_10652828 | 3300025913 | Bacteria | 933 |
| 586 | Ga0207671_10000030 | 3300025914 | Bacteria | 248197 |
| 587 | Ga0207671_10005234 | 3300025914 | Bacteria | 12049 |
| 588 | Ga0207671_10011061 | 3300025914 | Bacteria | 7386 |
| 589 | Ga0207671_10014684 | 3300025914 | Bacteria | 6177 |
| 590 | Ga0207671_10033891 | 3300025914 | Bacteria | 3797 |
| 591 | Ga0207671_10348880 | 3300025914 | Bacteria | 1173 |
| 592 | Ga0207693_10911770 | 3300025915 | Bacteria | 674 |
| 593 | Ga0207660_10001630 | 3300025917 | Bacteria | 15047 |
| 594 | Ga0207662_10251455 | 3300025918 | Bacteria | 1160 |
| 595 | Ga0207662_10491711 | 3300025918 | Bacteria | 844 |
| 596 | Ga0207657_10007579 | 3300025919 | Bacteria | 11123 |
| 597 | Ga0207657_10554016 | 3300025919 | Unclassified | 899 |
| 598 | Ga0207649_10121246 | 3300025920 | Bacteria | 1763 |
| 599 | Ga0207649_10162875 | 3300025920 | Bacteria | 1547 |
| 600 | Ga0207652_10000925 | 3300025921 | Bacteria | 27608 |
| 601 | Ga0207652_10630014 | 3300025921 | Bacteria | 960 |
| 602 | Ga0207652_11459381 | 3300025921 | Bacteria | 588 |
| 603 | Ga0207681_10038406 | 3300025923 | Bacteria | 3172 |
| 604 | Ga0207681_10106715 | 3300025923 | Bacteria | 2030 |
| 605 | Ga0207681_10121625 | 3300025923 | Bacteria | 1915 |
| 606 | Ga0207681_11255160 | 3300025923 | Bacteria | 622 |
| 607 | Ga0207694_10112133 | 3300025924 | Bacteria | 2170 |
| 608 | Ga0207694_10134932 | 3300025924 | Bacteria | 1981 |
| 609 | Ga0207650_10744872 | 3300025925 | Bacteria | 829 |
| 610 | Ga0207650_10829586 | 3300025925 | Unclassified | 784 |
| 611 | Ga0207650_11480986 | 3300025925 | Unclassified | 577 |
| 612 | Ga0207659_10403814 | 3300025926 | Unclassified | 1143 |
| 613 | Ga0207659_10704666 | 3300025926 | Bacteria | 864 |
| 614 | Ga0207687_10761762 | 3300025927 | Bacteria | 824 |
| 615 | Ga0207644_10030033 | 3300025931 | Bacteria | 3774 |
| 616 | Ga0207644_10216180 | 3300025931 | Bacteria | 1517 |
| 617 | Ga0207690_10012964 | 3300025932 | Bacteria | 4997 |
| 618 | Ga0207690_10571474 | 3300025932 | Unclassified | 921 |
| 619 | Ga0207706_10005992 | 3300025933 | Bacteria | 11304 |
| 620 | Ga0207706_10007003 | 3300025933 | Bacteria | 10421 |
| 621 | Ga0207706_10363098 | 3300025933 | Unclassified | 1258 |
| 622 | Ga0207686_10087614 | 3300025934 | Unclassified | 2048 |
| 623 | Ga0207686_10092284 | 3300025934 | Bacteria | 2002 |
| 624 | Ga0207686_10153743 | 3300025934 | Bacteria | 1605 |
| 625 | Ga0207686_10155388 | 3300025934 | Bacteria | 1597 |
| 626 | Ga0207670_10632626 | 3300025936 | Bacteria | 881 |
| 627 | Ga0207669_10044633 | 3300025937 | Bacteria | 2606 |
| 628 | Ga0207669_10210937 | 3300025937 | Unclassified | 1417 |
| 629 | Ga0207704_10004308 | 3300025938 | Bacteria | 6502 |
| 630 | Ga0207704_10046270 | 3300025938 | Bacteria | 2592 |
| 631 | Ga0207704_10099213 | 3300025938 | Bacteria | 1937 |
| 632 | Ga0207704_10190309 | 3300025938 | Unclassified | 1492 |
| 633 | Ga0207704_10238226 | 3300025938 | Bacteria | 1358 |
| 634 | Ga0207704_10643395 | 3300025938 | Bacteria | 873 |
| 635 | Ga0207665_10674833 | 3300025939 | Bacteria | 811 |
| 636 | Ga0207691_10000234 | 3300025940 | Bacteria | 54055 |
| 637 | Ga0207691_10009264 | 3300025940 | Bacteria | 9447 |
| 638 | Ga0207691_10013394 | 3300025940 | Bacteria | 7850 |
| 639 | Ga0207691_10102286 | 3300025940 | Bacteria | 2556 |
| 640 | Ga0207691_10635116 | 3300025940 | Bacteria | 903 |
| 641 | Ga0207711_10962525 | 3300025941 | Bacteria | 793 |
| 642 | Ga0207711_11365410 | 3300025941 | Bacteria | 651 |
| 643 | Ga0207689_10001184 | 3300025942 | Bacteria | 25069 |
| 644 | Ga0207689_10005600 | 3300025942 | Bacteria | 11190 |
| 645 | Ga0207689_10006499 | 3300025942 | Bacteria | 10325 |
| 646 | Ga0207689_10012109 | 3300025942 | Bacteria | 7384 |
| 647 | Ga0207661_10053214 | 3300025944 | Unclassified | 3238 |
| 648 | Ga0207679_10195721 | 3300025945 | Bacteria | 1685 |
| 649 | Ga0207679_10292533 | 3300025945 | Unclassified | 1401 |
| 650 | Ga0207679_10791350 | 3300025945 | Bacteria | 864 |
| 651 | Ga0207679_11149693 | 3300025945 | Bacteria | 712 |
| 652 | Ga0207679_11610189 | 3300025945 | Unclassified | 595 |
| 653 | Ga0207667_10000713 | 3300025949 | Bacteria | 43129 |
| 654 | Ga0207667_10021120 | 3300025949 | Bacteria | 7221 |
| 655 | Ga0207667_10149672 | 3300025949 | Bacteria | 2403 |
| 656 | Ga0207667_10371113 | 3300025949 | Bacteria | 1458 |
| 657 | Ga0207667_10445163 | 3300025949 | Bacteria | 1317 |
| 658 | Ga0207667_10796486 | 3300025949 | Bacteria | 942 |
| 659 | Ga0207651_10025812 | 3300025960 | Bacteria | 3658 |
| 660 | Ga0207651_10473547 | 3300025960 | Bacteria | 1078 |
| 661 | Ga0207712_10138938 | 3300025961 | Unclassified | 1861 |
| 662 | Ga0207712_10248757 | 3300025961 | Bacteria | 1436 |
| 663 | Ga0207712_10692948 | 3300025961 | Unclassified | 889 |
| 664 | Ga0207668_10013925 | 3300025972 | Unclassified | 4967 |
| 665 | Ga0207668_10065897 | 3300025972 | Bacteria | 2565 |
| 666 | Ga0207668_10077857 | 3300025972 | Unclassified | 2392 |
| 667 | Ga0207668_10126805 | 3300025972 | Bacteria | 1942 |
| 668 | Ga0207668_10242662 | 3300025972 | Bacteria | 1458 |
| 669 | Ga0207640_10139100 | 3300025981 | Bacteria | 1767 |
| 670 | Ga0207640_10175937 | 3300025981 | Bacteria | 1600 |
| 671 | Ga0207640_10913614 | 3300025981 | Unclassified | 767 |
| 672 | Ga0207658_10000950 | 3300025986 | Bacteria | 23916 |
| 673 | Ga0207658_10018569 | 3300025986 | Bacteria | 4804 |
| 674 | Ga0207658_10062825 | 3300025986 | Bacteria | 2781 |
| 675 | Ga0207658_10307829 | 3300025986 | Unclassified | 1367 |
| 676 | Ga0207658_10620663 | 3300025986 | Bacteria | 972 |
| 677 | Ga0207658_11004439 | 3300025986 | Bacteria | 761 |
| 678 | Ga0207677_10001355 | 3300026023 | Bacteria | 13116 |
| 679 | Ga0207677_10059727 | 3300026023 | Bacteria | 2631 |
| 680 | Ga0207677_10077179 | 3300026023 | Bacteria | 2375 |
| 681 | Ga0207677_10082668 | 3300026023 | Unclassified | 2309 |
| 682 | Ga0207703_10003242 | 3300026035 | Bacteria | 13674 |
| 683 | Ga0207703_11582479 | 3300026035 | Bacteria | 630 |
| 684 | Ga0207639_10002981 | 3300026041 | Bacteria | 11397 |
| 685 | Ga0207639_10021089 | 3300026041 | Bacteria | 4674 |
| 686 | Ga0207639_10084625 | 3300026041 | Bacteria | 2520 |
| 687 | Ga0207639_10385571 | 3300026041 | Unclassified | 1259 |
| 688 | Ga0207678_10393471 | 3300026067 | Bacteria | 1199 |
| 689 | Ga0207678_10533790 | 3300026067 | Bacteria | 1025 |
| 690 | Ga0207708_10344816 | 3300026075 | Bacteria | 1221 |
| 691 | Ga0207702_10023587 | 3300026078 | Bacteria | 5104 |
| 692 | Ga0207702_10590185 | 3300026078 | Bacteria | 1089 |
| 693 | Ga0207641_10000186 | 3300026088 | Bacteria | 86601 |
| 694 | Ga0207641_10001042 | 3300026088 | Bacteria | 28066 |
| 695 | Ga0207641_10612278 | 3300026088 | Unclassified | 1067 |
| 696 | Ga0207648_10002569 | 3300026089 | Bacteria | 19457 |
| 697 | Ga0207648_10003727 | 3300026089 | Bacteria | 15940 |
| 698 | Ga0207648_10021117 | 3300026089 | Bacteria | 5854 |
| 699 | Ga0207648_10082235 | 3300026089 | Bacteria | 2808 |
| 700 | Ga0207648_10155545 | 3300026089 | Bacteria | 2018 |
| 701 | Ga0207676_10003530 | 3300026095 | Bacteria | 11067 |
| 702 | Ga0207676_10006774 | 3300026095 | Bacteria | 8110 |
| 703 | Ga0207676_10331854 | 3300026095 | Unclassified | 1400 |
| 704 | Ga0207676_10387031 | 3300026095 | Bacteria | 1303 |
| 705 | Ga0207674_10091158 | 3300026116 | Bacteria | 3038 |
| 706 | Ga0207674_10450584 | 3300026116 | Bacteria | 1244 |
| 707 | Ga0207674_10567347 | 3300026116 | Bacteria | 1096 |
| 708 | Ga0207675_100029163 | 3300026118 | Bacteria | 5143 |
| 709 | Ga0207675_100102912 | 3300026118 | Unclassified | 2691 |
| 710 | Ga0207675_100237002 | 3300026118 | Bacteria | 1762 |
| 711 | Ga0207675_100416070 | 3300026118 | Bacteria | 1327 |
| 712 | Ga0207675_100497923 | 3300026118 | Bacteria | 1213 |
| 713 | Ga0207675_101390187 | 3300026118 | Bacteria | 723 |
| 714 | Ga0207675_101535392 | 3300026118 | Bacteria | 687 |
| 715 | Ga0207683_10084346 | 3300026121 | Bacteria | 2824 |
| 716 | Ga0207683_10105466 | 3300026121 | Bacteria | 2519 |
| 717 | Ga0207683_10107208 | 3300026121 | Bacteria | 2499 |
| 718 | Ga0207683_10179252 | 3300026121 | Bacteria | 1921 |
| 719 | Ga0207698_10005151 | 3300026142 | Bacteria | 8037 |
| 720 | Ga0207698_10100518 | 3300026142 | Bacteria | 2396 |
| 721 | Ga0207698_10121929 | 3300026142 | Bacteria | 2208 |
| 722 | Ga0207698_10470356 | 3300026142 | Bacteria | 1217 |
| 723 | Ga0207698_10779772 | 3300026142 | Bacteria | 957 |
| 724 | Ga0209969_1012802 | 3300027360 | Bacteria | 1211 |
| 725 | Ga0209984_1020807 | 3300027424 | Bacteria | 898 |
| 726 | Ga0209995_1016821 | 3300027471 | Bacteria | 1202 |
| 727 | Ga0268266_10002778 | 3300028379 | Bacteria | 18278 |
| 728 | Ga0268266_10102343 | 3300028379 | Bacteria | 2526 |
| 729 | Ga0268265_10040332 | 3300028380 | Bacteria | 3448 |
| 730 | Ga0268265_10253177 | 3300028380 | Unclassified | 1561 |
| 731 | Ga0268264_10004017 | 3300028381 | Bacteria | 12601 |
| 732 | Ga0268264_10151213 | 3300028381 | Bacteria | 2081 |
| 733 | Ga0268264_10285048 | 3300028381 | Bacteria | 1549 |
| 734 | Ga0268264_11025383 | 3300028381 | Bacteria | 832 |
| 735 | Ga0268264_11619709 | 3300028381 | Bacteria | 658 |
| 736 | Ga0307515_10411635 | 3300028794 | Bacteria | 975 |
| 737 | Ga0316177_1005071 | 3300030731 | Unclassified | 625 |
| 738 | Ga0265327_10000259 | 3300031251 | Bacteria | 104677 |
| 739 | Ga0265327_10005302 | 3300031251 | Bacteria | 10818 |
| 740 | Ga0265313_10164516 | 3300031595 | Bacteria | 941 |
| 741 | Ga0307516_10000675 | 3300031730 | Bacteria | 46218 |
| 742 | Ga0307410_11734902 | 3300031852 | Bacteria | 554 |
| 743 | Ga0307407_10903775 | 3300031903 | Unclassified | 678 |
| 744 | Ga0307414_10597740 | 3300032004 | Bacteria | 989 |
| 745 | Ga0307414_11347483 | 3300032004 | Bacteria | 663 |
| 746 | Ga0307411_10625459 | 3300032005 | Bacteria | 929 |
| 747 | Ga0307415_100540055 | 3300032126 | Bacteria | 1027 |
| 748 | Ga0307510_10000637 | 3300033180 | Bacteria | 35581 |
| 749 | Ga0307510_10429466 | 3300033180 | Bacteria | 763 |
| 750 | Ga0451789_1054658 | 3300041443 | Bacteria | 1081 |
| 751 | Ga0451793_1918688 | 3300041452 | Unclassified | 511 |
| 752 | Ga0451841_0362851 | 3300041498 | Bacteria | 634 |
| 753 | Ga0451843_0758176 | 3300041509 | Bacteria | 744 |
| 754 | Ga0439431_0004568 | 3300041997 | Bacteria | 3043 |
| 755 | Ga0439445_0002131 | 3300042004 | Bacteria | 4379 |
| 756 | Ga0466969_0003268 | 3300044656 | Bacteria | 8613 |
| 757 | Ga0466972_0077116 | 3300044658 | Bacteria | 1587 |
| 758 | Ga0466966_0000022 | 3300044684 | Bacteria | 112729 |
| 759 | Ga0466971_0224568 | 3300044719 | Bacteria | 891 |
| 760 | Ga0466970_0116661 | 3300044765 | Bacteria | 1460 |
| 761 | Ga0466957_0483166 | 3300044842 | Bacteria | 857 |
| 762 | Ga0466960_0803909 | 3300044901 | Bacteria | 569 |
| 763 | Ga0466959_0000055 | 3300045049 | Bacteria | 78801 |
| 764 | Ga0466959_0001777 | 3300045049 | Bacteria | 13453 |
| 765 | Ga0466967_1448438 | 3300045976 | Bacteria | 684 |
| 766 | Ga0495627_001750 | 3300046453 | Bacteria | 11703 |
| 767 | Ga0495622_0246760 | 3300046557 | Bacteria | 786 |
| 768 | Ga0495633_0000374 | 3300046558 | Bacteria | 47750 |
| 769 | Ga0495668_0000451 | 3300046616 | Bacteria | 52539 |
| 770 | Ga0495625_0383781 | 3300046660 | Bacteria | 881 |
| 771 | Ga0495625_0441855 | 3300046660 | Bacteria | 805 |
| 772 | Ga0496108_0390814 | 3300048911 | Unclassified | 1215 |
| 773 | Ga0496109_0046409 | 3300048912 | Unclassified | 3946 |
| 774 | Ga0496121_0000086 | 3300048924 | Bacteria | 223703 |
| 775 | Ga0501032_0838416 | 3300049569 | Bacteria | 580 |
| 776 | Ga0501043_0814432 | 3300049579 | Bacteria | 675 |
| 777 | Ga0501047_0045332 | 3300049581 | Bacteria | 4252 |
| 778 | Ga0501047_0117454 | 3300049581 | Bacteria | 2541 |
| 779 | Ga0501238_024190 | 3300049671 | Unclassified | 867 |
| 780 | Ga0501238_034616 | 3300049671 | Bacteria | 735 |
| 781 | Ga0501241_001671 | 3300049758 | Bacteria | 4434 |
| 782 | Ga0501269_001839 | 3300049766 | Bacteria | 2688 |
| 783 | Ga0501035_0263960 | 3300049822 | Bacteria | 1459 |
| 784 | Ga0501044_0077666 | 3300049823 | Bacteria | 3367 |
| 785 | Ga0501044_0287505 | 3300049823 | Bacteria | 1576 |
| 786 | Ga0501044_0845771 | 3300049823 | Bacteria | 792 |
| 787 | nmdc:mga0k408_111005_c1 | 3300050493 | Bacteria | 1621 |
| 788 | nmdc:mga07m45_160697_c1 | 3300050496 | Bacteria | 1304 |
| 789 | Ga0500644_0000408 | 3300053088 | Bacteria | 20337 |
| 790 | Ga0500581_068798 | 3300053089 | Bacteria | 1784 |
| 791 | Ga0500646_0000898 | 3300053090 | Bacteria | 8211 |
| 792 | Ga0500651_0044106 | 3300053093 | Bacteria | 2809 |
| 793 | Ga0500651_0159057 | 3300053093 | Bacteria | 1352 |
| 794 | Ga0500557_115982 | 3300053105 | Bacteria | 889 |
| 795 | Ga0500569_000033 | 3300053109 | Bacteria | 28357 |
| 796 | Ga0500607_037177 | 3300053121 | Bacteria | 2655 |
| 797 | Ga0500642_0020611 | 3300053130 | Bacteria | 2594 |
| 798 | Ga0500652_001057 | 3300053131 | Bacteria | 8937 |
| 799 | Ga0500658_0040908 | 3300053134 | Bacteria | 1857 |
| 800 | Ga0500559_0020212 | 3300053136 | Bacteria | 2815 |
| 801 | Ga0500561_0207730 | 3300053137 | Bacteria | 620 |
| 802 | Ga0500577_0006911 | 3300053142 | Bacteria | 3153 |
| 803 | Ga0500590_013651 | 3300053148 | Bacteria | 4173 |
| 804 | Ga0500604_0001579 | 3300053151 | Bacteria | 6395 |
| 805 | Ga0500616_0001032 | 3300053153 | Bacteria | 29487 |
| 806 | Ga0500622_0001091 | 3300053156 | Bacteria | 22577 |
| 807 | Ga0500627_0008543 | 3300053158 | Bacteria | 3645 |
| 808 | Ga0500633_0008942 | 3300053160 | Bacteria | 2608 |
| 809 | Ga0500636_0085431 | 3300053177 | Bacteria | 1813 |
| 810 | Ga0500656_011550 | 3300053732 | Bacteria | 984 |
| 811 | Ga0500661_001699 | 3300055283 | Bacteria | 4142 |
| 812 | Ga0466962_0106561 | 3300061719 | Bacteria | 1348 |
| 813 | 2819574771 | 2818991442 | Bacteria | 8318214 |
| 814 | 2819676677 | 2818991460 | Bacteria | 7595395 |
| 815 | 2821140867 | 2821136567 | Bacteria | 8080116 |
| 816 | 2883070333 | 2883068021 | Bacteria | 6192739 |
| 817 | 2884796540 | 2884791551 | Bacteria | 8511252 |
| 818 | 2896086806 | 2896085136 | Bacteria | 6129793 |
| 819 | 2904471368 | 2904467357 | Bacteria | 8057758 |
| 820 | 2929177944 | 2929177148 | Bacteria | 7883697 |
| 821 | 2929240277 | 2929239360 | Bacteria | 7745570 |
| 822 | 2929922017 | 2929921140 | Bacteria | 8649150 |
| 823 | 2945980297 | 2945977869 | Bacteria | 7777518 |
| 824 | 2946013837 | 2946013367 | Bacteria | 7766675 |
| 825 | 8003155762 | 8003151029 | Bacteria | 8187759 |
| 826 | Ga0501033_0036749 | |||
| 827 | SwRhRL2b_contig_3499586 | |||
| 828 | ARcpr5oldR_c011424 | |||
| 829 | JGI24740J21852_10008814 | |||
| 830 | JGI24740J21852_10018339 | |||
| 831 | JGI24740J21852_10043551 | |||
| 832 | JGI24739J22299_10000984 | |||
| 833 | JGI24739J22299_10008832 | |||
| 834 | JGI24739J22299_10046236 | |||
| 835 | JGI24739J22299_10095945 | |||
| 836 | JGI24737J22298_10158016 | |||
| 837 | JGI24744J21845_10013704 | |||
| 838 | JGI25154J39366_1000003 | |||
| 839 | JGI25406J46586_10001483 | |||
| 840 | JGI25153J46596_10002053 | |||
| 841 | rootH1_10041421 | |||
| 842 | rootH2_10006602 | |||
| 843 | rootH2_10017546 | |||
| 844 | rootH2_10039830 | |||
| 845 | rootH2_10067937 | |||
| 846 | rootH2_10075934 | |||
| 847 | rootH2_10144541 | |||
| 848 | rootH2_10239721 | |||
| 849 | rootL2_10043769 | |||
| 850 | rootL2_10118604 | |||
| 851 | rootL2_10155182 | |||
| 852 | rootL2_10249723 | |||
| 853 | rootH1_10013627 | |||
| 854 | rootH1_10020100 | |||
| 855 | rootH1_10044373 | |||
| 856 | rootH1_10048804 | |||
| 857 | JGI25160J50197_1000629 | |||
| 858 | JGI25160J50197_1003603 | |||
| 859 | Ga0055535_1002732 | |||
| 860 | Ga0055542_1002793 | |||
| 861 | Ga0055526_1046523 | |||
| 862 | Ga0055528_1002770 | |||
| 863 | Ga0055528_1010212 | |||
| 864 | Ga0055530_10002043 | |||
| 865 | Ga0065165_1000794 | |||
| 866 | Ga0065165_1016230 | |||
| 867 | Ga0065714_10195999 | |||
| 868 | Ga0065704_10084167 | |||
| 869 | Ga0065704_10135560 | |||
| 870 | Ga0065704_10219316 | |||
| 871 | Ga0065712_10331430 | |||
| 872 | Ga0065715_10157159 | |||
| 873 | Ga0065715_10169686 | |||
| 874 | Ga0065715_10523123 | |||
| 875 | Ga0065715_10698001 | |||
| 876 | Ga0065707_10105112 | |||
| 877 | Ga0065707_10374416 | |||
| 878 | Ga0065707_10557798 | |||
| 879 | Ga0065707_10631919 | |||
| 880 | Ga0070658_10111052 | |||
| 881 | Ga0070658_10121781 | |||
| 882 | Ga0070658_10426728 | |||
| 883 | Ga0070658_10644294 | |||
| 884 | Ga0070658_11198888 | |||
| 885 | Ga0070676_10001354 | |||
| 886 | Ga0070676_10006927 | |||
| 887 | Ga0070676_10010874 | |||
| 888 | Ga0070676_10013514 | |||
| 889 | Ga0070676_10236512 | |||
| 890 | Ga0070676_10548189 | |||
| 891 | Ga0070683_100005727 | |||
| 892 | Ga0070683_101550649 | |||
| 893 | Ga0070683_101763922 | |||
| 894 | Ga0070683_102032503 | |||
| 895 | Ga0070690_100013844 | |||
| 896 | Ga0070690_100079502 | |||
| 897 | Ga0070670_100008061 | |||
| 898 | Ga0070670_100031019 | |||
| 899 | Ga0070670_100044143 | |||
| 900 | Ga0070670_100246840 | |||
| 901 | Ga0070677_10020874 | |||
| 902 | Ga0068869_100002827 | |||
| 903 | Ga0068869_100031991 | |||
| 904 | Ga0068869_100057957 | |||
| 905 | Ga0068869_100064491 | |||
| 906 | Ga0068869_100164585 | |||
| 907 | Ga0068869_100215579 | |||
| 908 | Ga0068869_100438880 | |||
| 909 | Ga0068869_100959834 | |||
| 910 | Ga0068869_101061797 | |||
| 911 | Ga0068869_101144533 | |||
| 912 | Ga0070666_10000039 | |||
| 913 | Ga0070666_10000452 | |||
| 914 | Ga0070666_10006599 | |||
| 915 | Ga0070666_10013217 | |||
| 916 | Ga0070666_10484769 | |||
| 917 | Ga0070680_100002499 | |||
| 918 | Ga0070682_100000300 | |||
| 919 | Ga0070682_100028311 | |||
| 920 | Ga0070682_100236346 | |||
| 921 | Ga0068868_100000280 | |||
| 922 | Ga0068868_100007213 | |||
| 923 | Ga0068868_100024984 | |||
| 924 | Ga0068868_100027020 | |||
| 925 | Ga0068868_100073205 | |||
| 926 | Ga0068868_100165968 | |||
| 927 | Ga0070660_100010731 | |||
| 928 | Ga0070660_100278893 | |||
| 929 | Ga0070660_100371268 | |||
| 930 | Ga0070660_100584513 | |||
| 931 | Ga0070689_100006897 | |||
| 932 | Ga0070689_100126134 | |||
| 933 | Ga0070689_100274248 | |||
| 934 | Ga0070689_100947616 | |||
| 935 | Ga0070689_101606810 | |||
| 936 | Ga0070691_10000080 | |||
| 937 | Ga0070691_10271740 | |||
| 938 | Ga0070687_100003457 | |||
| 939 | Ga0070687_100091206 | |||
| 940 | Ga0070687_100509271 | |||
| 941 | Ga0070661_100016222 | |||
| 942 | Ga0070661_100093644 | |||
| 943 | Ga0070661_100251318 | |||
| 944 | Ga0070661_100373908 | |||
| 945 | Ga0070661_100688257 | |||
| 946 | Ga0070661_101003766 | |||
| 947 | Ga0070668_100000267 | |||
| 948 | Ga0070668_100021559 | |||
| 949 | Ga0070668_100050559 | |||
| 950 | Ga0070668_100324750 | |||
| 951 | Ga0070668_100929259 | |||
| 952 | Ga0070669_100001604 | |||
| 953 | Ga0070669_100017067 | |||
| 954 | Ga0070669_100067755 | |||
| 955 | Ga0070669_100074731 | |||
| 956 | Ga0070669_100158935 | |||
| 957 | Ga0070669_100415576 | |||
| 958 | Ga0070669_100429754 | |||
| 959 | Ga0070669_100435013 | |||
| 960 | Ga0070675_100004009 | |||
| 961 | Ga0070675_100029574 | |||
| 962 | Ga0070675_100031468 | |||
| 963 | Ga0070675_100035088 | |||
| 964 | Ga0070675_100070016 | |||
| 965 | Ga0070675_100108134 | |||
| 966 | Ga0070675_100943713 | |||
| 967 | Ga0070675_101195021 | |||
| 968 | Ga0070675_102213439 | |||
| 969 | Ga0070671_100004724 | |||
| 970 | Ga0070671_100014782 | |||
| 971 | Ga0070671_100045190 | |||
| 972 | Ga0070671_100122563 | |||
| 973 | Ga0070671_100171218 | |||
| 974 | Ga0070671_100215197 | |||
| 975 | Ga0070671_100389318 | |||
| 976 | Ga0070671_100439779 | |||
| 977 | Ga0070671_100452723 | |||
| 978 | Ga0070671_101699088 | |||
| 979 | Ga0070674_100001880 | |||
| 980 | Ga0070674_100011350 | |||
| 981 | Ga0070674_100054587 | |||
| 982 | Ga0070674_100131708 | |||
| 983 | Ga0070674_100346401 | |||
| 984 | Ga0070674_101087370 | |||
| 985 | Ga0070674_101572796 | |||
| 986 | Ga0070673_100005984 | |||
| 987 | Ga0070673_100018578 | |||
| 988 | Ga0070673_100023077 | |||
| 989 | Ga0070673_100070665 | |||
| 990 | Ga0070673_100166404 | |||
| 991 | Ga0070673_100192379 | |||
| 992 | Ga0070673_100288842 | |||
| 993 | Ga0070688_100017479 | |||
| 994 | Ga0070688_100244422 | |||
| 995 | Ga0070688_100377549 | |||
| 996 | Ga0070688_101074649 | |||
| 997 | Ga0070659_100006597 | |||
| 998 | Ga0070659_100058608 | |||
| 999 | Ga0070659_100576477 | |||
| 1000 | Ga0070659_100612375 | |||
| 1001 | Ga0070659_101169920 | |||
| 1002 | Ga0070667_100000827 | |||
| 1003 | Ga0070667_100012012 | |||
| 1004 | Ga0070667_100016036 | |||
| 1005 | Ga0070667_100026868 | |||
| 1006 | Ga0070667_100027844 | |||
| 1007 | Ga0070667_100106249 | |||
| 1008 | Ga0070667_100235076 | |||
| 1009 | Ga0070667_100284886 | |||
| 1010 | Ga0070667_100377448 | |||
| 1011 | Ga0070667_100514916 | |||
| 1012 | Ga0070667_100635519 | |||
| 1013 | Ga0070667_100963325 | |||
| 1014 | Ga0070701_10029988 | |||
| 1015 | Ga0070701_10578445 | |||
| 1016 | Ga0070700_100053783 | |||
| 1017 | Ga0070694_100083765 | |||
| 1018 | Ga0070694_100289046 | |||
| 1019 | Ga0070663_100616270 | |||
| 1020 | Ga0070678_100056697 | |||
| 1021 | Ga0070678_100213190 | |||
| 1022 | Ga0070678_100221177 | |||
| 1023 | Ga0070678_100712256 | |||
| 1024 | Ga0070662_100006870 | |||
| 1025 | Ga0070662_100037572 | |||
| 1026 | Ga0070662_100368956 | |||
| 1027 | Ga0070681_10040977 | |||
| 1028 | Ga0068867_100007549 | |||
| 1029 | Ga0068867_100014244 | |||
| 1030 | Ga0068867_100043031 | |||
| 1031 | Ga0068867_100051352 | |||
| 1032 | Ga0068867_100052295 | |||
| 1033 | Ga0068867_100096651 | |||
| 1034 | Ga0068867_100134849 | |||
| 1035 | Ga0070685_10025493 | |||
| 1036 | Ga0070685_10049189 | |||
| 1037 | Ga0070685_10253177 | |||
| 1038 | Ga0070685_10411816 | |||
| 1039 | Ga0070685_10892191 | |||
| 1040 | Ga0070698_100009173 | |||
| 1041 | Ga0070698_100023341 | |||
| 1042 | Ga0070698_100168552 | |||
| 1043 | Ga0070698_100281580 | |||
| 1044 | Ga0070699_100240131 | |||
| 1045 | Ga0070679_100005618 | |||
| 1046 | Ga0070679_100874712 | |||
| 1047 | Ga0070679_100897794 | |||
| 1048 | Ga0070684_100010799 | |||
| 1049 | Ga0068853_100001211 | |||
| 1050 | Ga0068853_100010842 | |||
| 1051 | Ga0068853_100029117 | |||
| 1052 | Ga0068853_100095252 | |||
| 1053 | Ga0068853_100123242 | |||
| 1054 | Ga0068853_100209474 | |||
| 1055 | Ga0068853_100356823 | |||
| 1056 | Ga0070672_100003158 | |||
| 1057 | Ga0070672_100005060 | |||
| 1058 | Ga0070672_100006757 | |||
| 1059 | Ga0070672_100019139 | |||
| 1060 | Ga0070672_100064029 | |||
| 1061 | Ga0070672_100505951 | |||
| 1062 | Ga0070672_100543047 | |||
| 1063 | Ga0070672_100742541 | |||
| 1064 | Ga0070672_100856922 | |||
| 1065 | Ga0070686_100003048 | |||
| 1066 | Ga0070686_100048743 | |||
| 1067 | Ga0070686_100841557 | |||
| 1068 | Ga0070696_100288857 | |||
| 1069 | Ga0070693_100012076 | |||
| 1070 | Ga0070693_100041450 | |||
| 1071 | Ga0070665_100000916 | |||
| 1072 | Ga0070665_100050076 | |||
| 1073 | Ga0070704_100196989 | |||
| 1074 | Ga0070704_101234182 | |||
| 1075 | Ga0068855_100000303 | |||
| 1076 | Ga0068855_100021099 | |||
| 1077 | Ga0068855_100031956 | |||
| 1078 | Ga0068855_100032035 | |||
| 1079 | Ga0068855_100247205 | |||
| 1080 | Ga0068855_100473995 | |||
| 1081 | Ga0070664_100018188 | |||
| 1082 | Ga0070664_100028328 | |||
| 1083 | Ga0070664_100237002 | |||
| 1084 | Ga0070664_100751219 | |||
| 1085 | Ga0070664_101505386 | |||
| 1086 | Ga0068857_100003544 | |||
| 1087 | Ga0068857_100036683 | |||
| 1088 | Ga0068857_100068103 | |||
| 1089 | Ga0068857_100252065 | |||
| 1090 | Ga0068857_100894757 | |||
| 1091 | Ga0068857_101344185 | |||
| 1092 | Ga0068857_101398628 | |||
| 1093 | Ga0068857_101924052 | |||
| 1094 | Ga0068854_100012366 | |||
| 1095 | Ga0068854_100014601 | |||
| 1096 | Ga0068854_100027978 | |||
| 1097 | Ga0068854_100106165 | |||
| 1098 | Ga0068854_100176286 | |||
| 1099 | Ga0068854_100212817 | |||
| 1100 | Ga0068854_100555456 | |||
| 1101 | Ga0068856_100010761 | |||
| 1102 | Ga0068856_100019682 | |||
| 1103 | Ga0068856_100037969 | |||
| 1104 | Ga0070702_100041307 | |||
| 1105 | Ga0068852_100001479 | |||
| 1106 | Ga0068852_100006499 | |||
| 1107 | Ga0068852_100011761 | |||
| 1108 | Ga0068852_100024082 | |||
| 1109 | Ga0068852_100086688 | |||
| 1110 | Ga0068852_100095028 | |||
| 1111 | Ga0068852_100109668 | |||
| 1112 | Ga0068852_100215491 | |||
| 1113 | Ga0068852_100747074 | |||
| 1114 | Ga0068852_100804324 | |||
| 1115 | Ga0068852_100826664 | |||
| 1116 | Ga0068859_100000006 | |||
| 1117 | Ga0068859_100012229 | |||
| 1118 | Ga0068859_100067831 | |||
| 1119 | Ga0068859_100082248 | |||
| 1120 | Ga0068859_100167046 | |||
| 1121 | Ga0068859_100258373 | |||
| 1122 | Ga0068859_100783887 | |||
| 1123 | Ga0068859_101457718 | |||
| 1124 | Ga0068859_101890520 | |||
| 1125 | Ga0068859_102200182 | |||
| 1126 | Ga0068864_100000239 | |||
| 1127 | Ga0068864_100009898 | |||
| 1128 | Ga0068864_100069416 | |||
| 1129 | Ga0068864_100103448 | |||
| 1130 | Ga0068864_100116594 | |||
| 1131 | Ga0068864_100148752 | |||
| 1132 | Ga0068864_100284422 | |||
| 1133 | Ga0068866_10029147 | |||
| 1134 | Ga0068866_10030243 | |||
| 1135 | Ga0068866_10214134 | |||
| 1136 | Ga0068866_10339871 | |||
| 1137 | Ga0068866_11006521 | |||
| 1138 | Ga0068861_100003393 | |||
| 1139 | Ga0068861_100003670 | |||
| 1140 | Ga0068861_100033589 | |||
| 1141 | Ga0068861_100123926 | |||
| 1142 | Ga0068861_100175178 | |||
| 1143 | Ga0068861_100307510 | |||
| 1144 | Ga0068861_100382939 | |||
| 1145 | Ga0068861_101524301 | |||
| 1146 | Ga0068851_10000724 | |||
| 1147 | Ga0068851_10020383 | |||
| 1148 | Ga0068851_10094404 | |||
| 1149 | Ga0068851_10106759 | |||
| 1150 | Ga0068851_10160064 | |||
| 1151 | Ga0068870_10012712 | |||
| 1152 | Ga0068863_100000808 | |||
| 1153 | Ga0068863_100002445 | |||
| 1154 | Ga0068863_100019691 | |||
| 1155 | Ga0068863_100115517 | |||
| 1156 | Ga0068858_100000453 | |||
| 1157 | Ga0068858_100007148 | |||
| 1158 | Ga0068858_100380293 | |||
| 1159 | Ga0068858_100565366 | |||
| 1160 | Ga0068858_101178621 | |||
| 1161 | Ga0068858_101411002 | |||
| 1162 | Ga0068858_101648981 | |||
| 1163 | Ga0068860_100000003 | |||
| 1164 | Ga0068860_100002063 | |||
| 1165 | Ga0068860_100002984 | |||
| 1166 | Ga0068860_100012912 | |||
| 1167 | Ga0068860_100044805 | |||
| 1168 | Ga0068860_100178940 | |||
| 1169 | Ga0068862_100101788 | |||
| 1170 | Ga0068862_100285933 | |||
| 1171 | Ga0068862_100310304 | |||
| 1172 | Ga0068862_100704707 | |||
| 1173 | Ga0081540_1004973 | |||
| 1174 | Ga0081539_10000223 | |||
| 1175 | Ga0070715_10017463 | |||
| 1176 | Ga0075366_10016919 | |||
| 1177 | Ga0075366_10052395 | |||
| 1178 | Ga0075366_10079219 | |||
| 1179 | Ga0097621_100000199 | |||
| 1180 | Ga0097621_100000788 | |||
| 1181 | Ga0097621_100002337 | |||
| 1182 | Ga0097621_100015604 | |||
| 1183 | Ga0097621_100016643 | |||
| 1184 | Ga0097621_100048947 | |||
| 1185 | Ga0097621_100059896 | |||
| 1186 | Ga0097621_100107381 | |||
| 1187 | Ga0097621_100233547 | |||
| 1188 | Ga0075370_10079241 | |||
| 1189 | Ga0068871_100000319 | |||
| 1190 | Ga0068871_100001579 | |||
| 1191 | Ga0068871_100003257 | |||
| 1192 | Ga0068871_100010507 | |||
| 1193 | Ga0068871_100026260 | |||
| 1194 | Ga0068871_100059161 | |||
| 1195 | Ga0068871_100093413 | |||
| 1196 | Ga0068871_100954337 | |||
| 1197 | Ga0068871_100976258 | |||
| 1198 | Ga0068871_101016486 | |||
| 1199 | Ga0068871_101038186 | |||
| 1200 | Ga0068871_101050397 | |||
| 1201 | Ga0068871_101365405 | |||
| 1202 | Ga0075428_100056938 | |||
| 1203 | Ga0075428_100837809 | |||
| 1204 | Ga0075433_10293703 | |||
| 1205 | Ga0075434_100877867 | |||
| 1206 | Ga0075429_100002069 | |||
| 1207 | Ga0075429_100297064 | |||
| 1208 | Ga0068865_100005349 | |||
| 1209 | Ga0068865_100010178 | |||
| 1210 | Ga0068865_100049422 | |||
| 1211 | Ga0068865_101031638 | |||
| 1212 | Ga0097620_100000006 | |||
| 1213 | Ga0097620_100012229 | |||
| 1214 | Ga0097620_100067824 | |||
| 1215 | Ga0097620_100082253 | |||
| 1216 | Ga0097620_100167038 | |||
| 1217 | Ga0097620_100258379 | |||
| 1218 | Ga0097620_100783917 | |||
| 1219 | Ga0097620_101458087 | |||
| 1220 | Ga0097620_101889851 | |||
| 1221 | Ga0097620_102200165 | |||
| 1222 | Ga0105240_10021604 | |||
| 1223 | Ga0105240_10094371 | |||
| 1224 | Ga0105240_10344451 | |||
| 1225 | Ga0105240_10391369 | |||
| 1226 | Ga0111539_10000962 | |||
| 1227 | Ga0105245_10749198 | |||
| 1228 | Ga0105245_10759124 | |||
| 1229 | Ga0105245_10808776 | |||
| 1230 | Ga0105247_10003742 | |||
| 1231 | Ga0105247_10005694 | |||
| 1232 | Ga0105247_10082555 | |||
| 1233 | Ga0105247_10129759 | |||
| 1234 | Ga0105241_10044903 | |||
| 1235 | Ga0105241_10093720 | |||
| 1236 | Ga0105241_10843291 | |||
| 1237 | Ga0105242_10013689 | |||
| 1238 | Ga0105242_10025051 | |||
| 1239 | Ga0105242_10042319 | |||
| 1240 | Ga0105242_10074344 | |||
| 1241 | Ga0105242_10447017 | |||
| 1242 | Ga0105248_10028685 | |||
| 1243 | Ga0105248_11741016 | |||
| 1244 | Ga0105237_10001982 | |||
| 1245 | Ga0105237_10018657 | |||
| 1246 | Ga0105237_10021343 | |||
| 1247 | Ga0105237_10085381 | |||
| 1248 | Ga0105237_10143716 | |||
| 1249 | Ga0105237_10264345 | |||
| 1250 | Ga0105237_10666883 | |||
| 1251 | Ga0105238_10377844 | |||
| 1252 | Ga0105238_10512566 | |||
| 1253 | Ga0105238_10651810 | |||
| 1254 | Ga0105249_10001537 | |||
| 1255 | Ga0105249_10008988 | |||
| 1256 | Ga0105249_10201155 | |||
| 1257 | Ga0105249_12157013 | |||
| 1258 | Ga0105239_10019843 | |||
| 1259 | Ga0105239_10068551 | |||
| 1260 | Ga0105239_10072111 | |||
| 1261 | Ga0105239_10327607 | |||
| 1262 | Ga0105239_10717449 | |||
| 1263 | Ga0105246_10006786 | |||
| 1264 | Ga0105246_10051676 | |||
| 1265 | Ga0105246_10274227 | |||
| 1266 | Ga0105246_10482591 | |||
| 1267 | Ga0105246_11170744 | |||
| 1268 | Ga0157373_10067815 | |||
| 1269 | Ga0157371_10007008 | |||
| 1270 | Ga0157371_10231024 | |||
| 1271 | Ga0157371_10321262 | |||
| 1272 | Ga0157370_10830144 | |||
| 1273 | Ga0157369_10170178 | |||
| 1274 | Ga0157369_10280792 | |||
| 1275 | Ga0157369_10494963 | |||
| 1276 | Ga0157374_10000168 | |||
| 1277 | Ga0157374_10034554 | |||
| 1278 | Ga0157374_10086358 | |||
| 1279 | Ga0157374_10913790 | |||
| 1280 | Ga0157378_10002295 | |||
| 1281 | Ga0157378_10005820 | |||
| 1282 | Ga0157378_10008685 | |||
| 1283 | Ga0157378_10025276 | |||
| 1284 | Ga0157378_10085511 | |||
| 1285 | Ga0157378_10209801 | |||
| 1286 | Ga0157378_10359579 | |||
| 1287 | Ga0157378_10555968 | |||
| 1288 | Ga0157378_10679491 | |||
| 1289 | Ga0157378_10797348 | |||
| 1290 | Ga0163162_10000171 | |||
| 1291 | Ga0163162_10000504 | |||
| 1292 | Ga0163162_10005998 | |||
| 1293 | Ga0163162_10062085 | |||
| 1294 | Ga0163162_10127568 | |||
| 1295 | Ga0163162_10156581 | |||
| 1296 | Ga0163162_10227041 | |||
| 1297 | Ga0163162_10239181 | |||
| 1298 | Ga0157372_10013228 | |||
| 1299 | Ga0157372_10022050 | |||
| 1300 | Ga0157372_10024024 | |||
| 1301 | Ga0157372_10077990 | |||
| 1302 | Ga0157372_10180209 | |||
| 1303 | Ga0157372_10194238 | |||
| 1304 | Ga0157372_10613103 | |||
| 1305 | Ga0157375_10000098 | |||
| 1306 | Ga0157375_10006257 | |||
| 1307 | Ga0157375_10016610 | |||
| 1308 | Ga0157375_10029421 | |||
| 1309 | Ga0157375_10030623 | |||
| 1310 | Ga0157375_10031284 | |||
| 1311 | Ga0157375_10034938 | |||
| 1312 | Ga0157375_10238291 | |||
| 1313 | Ga0157375_10343952 | |||
| 1314 | Ga0157375_13457679 | |||
| 1315 | Ga0163163_10000271 | |||
| 1316 | Ga0163163_10001158 | |||
| 1317 | Ga0163163_10087194 | |||
| 1318 | Ga0163163_10147871 | |||
| 1319 | Ga0163163_10344075 | |||
| 1320 | Ga0163163_10347582 | |||
| 1321 | Ga0163163_10796968 | |||
| 1322 | Ga0157380_10001179 | |||
| 1323 | Ga0157380_10004406 | |||
| 1324 | Ga0157380_10022376 | |||
| 1325 | Ga0157380_10288610 | |||
| 1326 | Ga0157380_10762204 | |||
| 1327 | Ga0157377_10001079 | |||
| 1328 | Ga0157377_10512339 | |||
| 1329 | Ga0157379_10002303 | |||
| 1330 | Ga0157379_10027927 | |||
| 1331 | Ga0157379_10042242 | |||
| 1332 | Ga0157379_10054987 | |||
| 1333 | Ga0157379_10199835 | |||
| 1334 | Ga0157376_10000444 | |||
| 1335 | Ga0157376_10002197 | |||
| 1336 | Ga0157376_10005420 | |||
| 1337 | Ga0157376_10030411 | |||
| 1338 | Ga0157376_10046908 | |||
| 1339 | Ga0157376_10078410 | |||
| 1340 | Ga0157376_10258779 | |||
| 1341 | Ga0157376_10439281 | |||
| 1342 | Ga0182005_1000043 | |||
| 1343 | Ga0163161_10001929 | |||
| 1344 | Ga0163161_10007014 | |||
| 1345 | Ga0163161_10096754 | |||
| 1346 | Ga0163161_10104782 | |||
| 1347 | Ga0163161_10810689 | |||
| 1348 | Ga0213876_10022180 | |||
| 1349 | Ga0209436_100943 | |||
| 1350 | Ga0209258_100032 | |||
| 1351 | Ga0207425_1026048 | |||
| 1352 | Ga0209646_1000004 | |||
| 1353 | Ga0209646_1021587 | |||
| 1354 | Ga0209026_1000156 | |||
| 1355 | Ga0209148_1000339 | |||
| 1356 | Ga0209673_1000078 | |||
| 1357 | Ga0209130_1001642 | |||
| 1358 | Ga0209675_1024218 | |||
| 1359 | Ga0209564_1007098 | |||
| 1360 | Ga0209758_1006680 | |||
| 1361 | Ga0209758_1009520 | |||
| 1362 | Ga0209050_1000097 | |||
| 1363 | Ga0207426_1000033 | |||
| 1364 | Ga0207426_1000059 | |||
| 1365 | Ga0207426_1000472 | |||
| 1366 | Ga0207426_1001380 | |||
| 1367 | Ga0207426_1022941 | |||
| 1368 | Ga0209257_1000717 | |||
| 1369 | Ga0207697_10051958 | |||
| 1370 | Ga0207697_10221870 | |||
| 1371 | Ga0207656_10003743 | |||
| 1372 | Ga0207656_10018323 | |||
| 1373 | Ga0207656_10175413 | |||
| 1374 | Ga0207656_10182515 | |||
| 1375 | Ga0207656_10341202 | |||
| 1376 | Ga0207682_10005197 | |||
| 1377 | Ga0207682_10021884 | |||
| 1378 | Ga0207642_10226238 | |||
| 1379 | Ga0207642_10500698 | |||
| 1380 | Ga0207710_10173800 | |||
| 1381 | Ga0207688_10007956 | |||
| 1382 | Ga0207680_10000037 | |||
| 1383 | Ga0207680_10002060 | |||
| 1384 | Ga0207680_10016273 | |||
| 1385 | Ga0207680_10136576 | |||
| 1386 | Ga0207647_10000222 | |||
| 1387 | Ga0207647_10010106 | |||
| 1388 | Ga0207647_10069186 | |||
| 1389 | Ga0207647_10212866 | |||
| 1390 | Ga0207645_10000733 | |||
| 1391 | Ga0207645_10001928 | |||
| 1392 | Ga0207645_10474190 | |||
| 1393 | Ga0207643_10008733 | |||
| 1394 | Ga0207643_10591672 | |||
| 1395 | Ga0207705_10042294 | |||
| 1396 | Ga0207705_10086377 | |||
| 1397 | Ga0207705_10276499 | |||
| 1398 | Ga0207705_10514580 | |||
| 1399 | Ga0207654_10001560 | |||
| 1400 | Ga0207654_10019285 | |||
| 1401 | Ga0207654_10087445 | |||
| 1402 | Ga0207707_10000353 | |||
| 1403 | Ga0207695_10000051 | |||
| 1404 | Ga0207695_10000056 | |||
| 1405 | Ga0207695_10000081 | |||
| 1406 | Ga0207695_10000156 | |||
| 1407 | Ga0207695_10004658 | |||
| 1408 | Ga0207695_10027728 | |||
| 1409 | Ga0207695_10037494 | |||
| 1410 | Ga0207695_10652828 | |||
| 1411 | Ga0207671_10000030 | |||
| 1412 | Ga0207671_10005234 | |||
| 1413 | Ga0207671_10011061 | |||
| 1414 | Ga0207671_10014684 | |||
| 1415 | Ga0207671_10033891 | |||
| 1416 | Ga0207671_10348880 | |||
| 1417 | Ga0207693_10911770 | |||
| 1418 | Ga0207660_10001630 | |||
| 1419 | Ga0207662_10251455 | |||
| 1420 | Ga0207662_10491711 | |||
| 1421 | Ga0207657_10007579 | |||
| 1422 | Ga0207657_10554016 | |||
| 1423 | Ga0207649_10121246 | |||
| 1424 | Ga0207649_10162875 | |||
| 1425 | Ga0207652_10000925 | |||
| 1426 | Ga0207652_10630014 | |||
| 1427 | Ga0207652_11459381 | |||
| 1428 | Ga0207681_10038406 | |||
| 1429 | Ga0207681_10106715 | |||
| 1430 | Ga0207681_10121625 | |||
| 1431 | Ga0207681_11255160 | |||
| 1432 | Ga0207694_10112133 | |||
| 1433 | Ga0207694_10134932 | |||
| 1434 | Ga0207650_10744872 | |||
| 1435 | Ga0207650_10829586 | |||
| 1436 | Ga0207650_11480986 | |||
| 1437 | Ga0207659_10403814 | |||
| 1438 | Ga0207659_10704666 | |||
| 1439 | Ga0207687_10761762 | |||
| 1440 | Ga0207644_10030033 | |||
| 1441 | Ga0207644_10216180 | |||
| 1442 | Ga0207690_10012964 | |||
| 1443 | Ga0207690_10571474 | |||
| 1444 | Ga0207706_10005992 | |||
| 1445 | Ga0207706_10007003 | |||
| 1446 | Ga0207706_10363098 | |||
| 1447 | Ga0207686_10087614 | |||
| 1448 | Ga0207686_10092284 | |||
| 1449 | Ga0207686_10153743 | |||
| 1450 | Ga0207686_10155388 | |||
| 1451 | Ga0207670_10632626 | |||
| 1452 | Ga0207669_10044633 | |||
| 1453 | Ga0207669_10210937 | |||
| 1454 | Ga0207704_10004308 | |||
| 1455 | Ga0207704_10046270 | |||
| 1456 | Ga0207704_10099213 | |||
| 1457 | Ga0207704_10190309 | |||
| 1458 | Ga0207704_10238226 | |||
| 1459 | Ga0207704_10643395 | |||
| 1460 | Ga0207665_10674833 | |||
| 1461 | Ga0207691_10000234 | |||
| 1462 | Ga0207691_10009264 | |||
| 1463 | Ga0207691_10013394 | |||
| 1464 | Ga0207691_10102286 | |||
| 1465 | Ga0207691_10635116 | |||
| 1466 | Ga0207711_10962525 | |||
| 1467 | Ga0207711_11365410 | |||
| 1468 | Ga0207689_10001184 | |||
| 1469 | Ga0207689_10005600 | |||
| 1470 | Ga0207689_10006499 | |||
| 1471 | Ga0207689_10012109 | |||
| 1472 | Ga0207661_10053214 | |||
| 1473 | Ga0207679_10195721 | |||
| 1474 | Ga0207679_10292533 | |||
| 1475 | Ga0207679_10791350 | |||
| 1476 | Ga0207679_11149693 | |||
| 1477 | Ga0207679_11610189 | |||
| 1478 | Ga0207667_10000713 | |||
| 1479 | Ga0207667_10021120 | |||
| 1480 | Ga0207667_10149672 | |||
| 1481 | Ga0207667_10371113 | |||
| 1482 | Ga0207667_10445163 | |||
| 1483 | Ga0207667_10796486 | |||
| 1484 | Ga0207651_10025812 | |||
| 1485 | Ga0207651_10473547 | |||
| 1486 | Ga0207712_10138938 | |||
| 1487 | Ga0207712_10248757 | |||
| 1488 | Ga0207712_10692948 | |||
| 1489 | Ga0207668_10013925 | |||
| 1490 | Ga0207668_10065897 | |||
| 1491 | Ga0207668_10077857 | |||
| 1492 | Ga0207668_10126805 | |||
| 1493 | Ga0207668_10242662 | |||
| 1494 | Ga0207640_10139100 | |||
| 1495 | Ga0207640_10175937 | |||
| 1496 | Ga0207640_10913614 | |||
| 1497 | Ga0207658_10000950 | |||
| 1498 | Ga0207658_10018569 | |||
| 1499 | Ga0207658_10062825 | |||
| 1500 | Ga0207658_10307829 | |||
| 1501 | Ga0207658_10620663 | |||
| 1502 | Ga0207658_11004439 | |||
| 1503 | Ga0207677_10001355 | |||
| 1504 | Ga0207677_10059727 | |||
| 1505 | Ga0207677_10077179 | |||
| 1506 | Ga0207677_10082668 | |||
| 1507 | Ga0207703_10003242 | |||
| 1508 | Ga0207703_11582479 | |||
| 1509 | Ga0207639_10002981 | |||
| 1510 | Ga0207639_10021089 | |||
| 1511 | Ga0207639_10084625 | |||
| 1512 | Ga0207639_10385571 | |||
| 1513 | Ga0207678_10393471 | |||
| 1514 | Ga0207678_10533790 | |||
| 1515 | Ga0207708_10344816 | |||
| 1516 | Ga0207702_10023587 | |||
| 1517 | Ga0207702_10590185 | |||
| 1518 | Ga0207641_10000186 | |||
| 1519 | Ga0207641_10001042 | |||
| 1520 | Ga0207641_10612278 | |||
| 1521 | Ga0207648_10002569 | |||
| 1522 | Ga0207648_10003727 | |||
| 1523 | Ga0207648_10021117 | |||
| 1524 | Ga0207648_10082235 | |||
| 1525 | Ga0207648_10155545 | |||
| 1526 | Ga0207676_10003530 | |||
| 1527 | Ga0207676_10006774 | |||
| 1528 | Ga0207676_10331854 | |||
| 1529 | Ga0207676_10387031 | |||
| 1530 | Ga0207674_10091158 | |||
| 1531 | Ga0207674_10450584 | |||
| 1532 | Ga0207674_10567347 | |||
| 1533 | Ga0207675_100029163 | |||
| 1534 | Ga0207675_100102912 | |||
| 1535 | Ga0207675_100237002 | |||
| 1536 | Ga0207675_100416070 | |||
| 1537 | Ga0207675_100497923 | |||
| 1538 | Ga0207675_101390187 | |||
| 1539 | Ga0207675_101535392 | |||
| 1540 | Ga0207683_10084346 | |||
| 1541 | Ga0207683_10105466 | |||
| 1542 | Ga0207683_10107208 | |||
| 1543 | Ga0207683_10179252 | |||
| 1544 | Ga0207698_10005151 | |||
| 1545 | Ga0207698_10100518 | |||
| 1546 | Ga0207698_10121929 | |||
| 1547 | Ga0207698_10470356 | |||
| 1548 | Ga0207698_10779772 | |||
| 1549 | Ga0209969_1012802 | |||
| 1550 | Ga0209984_1020807 | |||
| 1551 | Ga0209995_1016821 | |||
| 1552 | Ga0268266_10002778 | |||
| 1553 | Ga0268266_10102343 | |||
| 1554 | Ga0268265_10040332 | |||
| 1555 | Ga0268265_10253177 | |||
| 1556 | Ga0268264_10004017 | |||
| 1557 | Ga0268264_10151213 | |||
| 1558 | Ga0268264_10285048 | |||
| 1559 | Ga0268264_11025383 | |||
| 1560 | Ga0268264_11619709 | |||
| 1561 | Ga0307515_10411635 | |||
| 1562 | Ga0316177_1005071 | |||
| 1563 | Ga0265327_10000259 | |||
| 1564 | Ga0265327_10005302 | |||
| 1565 | Ga0265313_10164516 | |||
| 1566 | Ga0307516_10000675 | |||
| 1567 | Ga0307410_11734902 | |||
| 1568 | Ga0307407_10903775 | |||
| 1569 | Ga0307414_10597740 | |||
| 1570 | Ga0307414_11347483 | |||
| 1571 | Ga0307411_10625459 | |||
| 1572 | Ga0307415_100540055 | |||
| 1573 | Ga0307510_10000637 | |||
| 1574 | Ga0307510_10429466 | |||
| 1575 | Ga0451789_1054658 | |||
| 1576 | Ga0451793_1918688 | |||
| 1577 | Ga0451841_0362851 | |||
| 1578 | Ga0451843_0758176 | |||
| 1579 | Ga0439431_0004568 | |||
| 1580 | Ga0439445_0002131 | |||
| 1581 | Ga0466969_0003268 | |||
| 1582 | Ga0466972_0077116 | |||
| 1583 | Ga0466966_0000022 | |||
| 1584 | Ga0466971_0224568 | |||
| 1585 | Ga0466970_0116661 | |||
| 1586 | Ga0466957_0483166 | |||
| 1587 | Ga0466960_0803909 | |||
| 1588 | Ga0466959_0000055 | |||
| 1589 | Ga0466959_0001777 | |||
| 1590 | Ga0466967_1448438 | |||
| 1591 | Ga0495627_001750 | |||
| 1592 | Ga0495622_0246760 | |||
| 1593 | Ga0495633_0000374 | |||
| 1594 | Ga0495668_0000451 | |||
| 1595 | Ga0495625_0383781 | |||
| 1596 | Ga0495625_0441855 | |||
| 1597 | Ga0496108_0390814 | |||
| 1598 | Ga0496109_0046409 | |||
| 1599 | Ga0496121_0000086 | |||
| 1600 | Ga0501032_0838416 | |||
| 1601 | Ga0501043_0814432 | |||
| 1602 | Ga0501047_0045332 | |||
| 1603 | Ga0501047_0117454 | |||
| 1604 | Ga0501238_024190 | |||
| 1605 | Ga0501238_034616 | |||
| 1606 | Ga0501241_001671 | |||
| 1607 | Ga0501269_001839 | |||
| 1608 | Ga0501035_0263960 | |||
| 1609 | Ga0501044_0077666 | |||
| 1610 | Ga0501044_0287505 | |||
| 1611 | Ga0501044_0845771 | |||
| 1612 | nmdc:mga0k408_111005_c1 | |||
| 1613 | nmdc:mga07m45_160697_c1 | |||
| 1614 | Ga0500644_0000408 | |||
| 1615 | Ga0500581_068798 | |||
| 1616 | Ga0500646_0000898 | |||
| 1617 | Ga0500651_0044106 | |||
| 1618 | Ga0500651_0159057 | |||
| 1619 | Ga0500557_115982 | |||
| 1620 | Ga0500569_000033 | |||
| 1621 | Ga0500607_037177 | |||
| 1622 | Ga0500642_0020611 | |||
| 1623 | Ga0500652_001057 | |||
| 1624 | Ga0500658_0040908 | |||
| 1625 | Ga0500559_0020212 | |||
| 1626 | Ga0500561_0207730 | |||
| 1627 | Ga0500577_0006911 | |||
| 1628 | Ga0500590_013651 | |||
| 1629 | Ga0500604_0001579 | |||
| 1630 | Ga0500616_0001032 | |||
| 1631 | Ga0500622_0001091 | |||
| 1632 | Ga0500627_0008543 | |||
| 1633 | Ga0500633_0008942 | |||
| 1634 | Ga0500636_0085431 | |||
| 1635 | Ga0500656_011550 | |||
| 1636 | Ga0500661_001699 | |||
| 1637 | Ga0466962_0106561 | |||
| 1638 | 2819574771 | |||
| 1639 | 2819676677 | |||
| 1640 | 2821140867 | |||
| 1641 | 2883070333 | |||
| 1642 | 2884796540 | |||
| 1643 | 2896086806 | |||
| 1644 | 2904471368 | |||
| 1645 | 2929177944 | |||
| 1646 | 2929240277 | |||
| 1647 | 2929922017 | |||
| 1648 | 2945980297 | |||
| 1649 | 2946013837 | |||
| 1650 | 8003155762 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5odn-assembly1.cif.gz_C | salinibacter ruber single-strand binding protein | 0.957 | 1 | 107 |
| 2vw9-assembly1.cif.gz_B-2 | single stranded dna binding protein complex from helicobacter pylori | 0.9541 | 5 | 107 |
| 6bhw-assembly1.cif.gz_A | b. subtilis ssba | 0.946 | 4 | 109 |
| 6bhw-assembly2.cif.gz_E | b. subtilis ssba | 0.9433 | 4 | 107 |
| 6bhx-assembly1.cif.gz_C | b. subtilis ssba with dna | 0.9393 | 4 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vw9B00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9453 | 5 | 108 | 2.40.50.140 |
| 5odnH00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9349 | 1 | 107 | 2.40.50.140 |
| 2vw9B00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9197 | 5 | 108 | 2.40.50.140 |
| 3ulpC00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9187 | 1 | 108 | 2.40.50.140 |
| 5gqoA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9144 | 5 | 107 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5BEN0-F1-model_v4 | Single-stranded DNA-binding protein | 0.9781 | 5 | 100 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A0G1IEC5-F1-model_v4 | Single-stranded DNA-binding protein (SSB) | 0.9695 | 5 | 115 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A316KG36-F1-model_v4 | Single-stranded DNA-binding protein | 0.9569 | 4 | 107 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A7X6UMB0-F1-model_v4 | Single-stranded DNA-binding protein | 0.9559 | 1 | 105 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A1G1Z5X2-F1-model_v4 | Single-stranded DNA-binding protein | 0.955 | 3 | 111 |
GO:0003697
GO:0006260 GO:0009295 |