F482452

General Info

Members Datasets Scaffolds Average Seq Length
825 288 1650 146

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0036749|Ga0501033_0036749_79_621
Length 180
Sequence LEKNINFKKVVYLLKEELFNNRLKKPTTMRGVNKVILIGNLGRDPDVQFLEGNIAVAKFSLATTETFKDRAGKLISQTEWHTVVLWRGLAELAQKYLHKGSLVYIEGRLRTRSWEDKEGNKKFATEVVGDNLVMLDKRMDLNNQDHPIPHHSSSGSGSGENFPGMEIPPSMNEPADDLPF

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
222 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
223 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
247 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
248 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
255 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
258 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
259 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
260 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
261 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
274 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
277 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
278 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
279 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
280 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
281 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
282 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
283 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
284 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
285 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
286 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
287 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
288 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 0
Rhizoplane 0.48
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 14.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0036749 3300049570 Bacteria 3669
2 SwRhRL2b_contig_3499586 2162886007 Bacteria 1914
3 ARcpr5oldR_c011424 3300000041 Bacteria 759
4 JGI24740J21852_10008814 3300001979 Bacteria 3998
5 JGI24740J21852_10018339 3300001979 Bacteria 2485
6 JGI24740J21852_10043551 3300001979 Bacteria 1337
7 JGI24739J22299_10000984 3300001989 Bacteria 10629
8 JGI24739J22299_10008832 3300001989 Bacteria 3757
9 JGI24739J22299_10046236 3300001989 Bacteria 1425
10 JGI24739J22299_10095945 3300001989 Bacteria 898
11 JGI24737J22298_10158016 3300001990 Bacteria 669
12 JGI24744J21845_10013704 3300002077 Unclassified 1634
13 JGI25154J39366_1000003 3300002738 Bacteria 397627
14 JGI25406J46586_10001483 3300003203 Bacteria 11059
15 JGI25153J46596_10002053 3300003215 Bacteria 11866
16 rootH1_10041421 3300003316 Bacteria 4512
17 rootH2_10006602 3300003320 Bacteria 39003
18 rootH2_10017546 3300003320 Bacteria 2388
19 rootH2_10039830 3300003320 Bacteria 9770
20 rootH2_10067937 3300003320 Bacteria 6588
21 rootH2_10075934 3300003320 Bacteria 19112
22 rootH2_10144541 3300003320 Bacteria 1501
23 rootH2_10239721 3300003320 Bacteria 1491
24 rootL2_10043769 3300003322 Bacteria 2439
25 rootL2_10118604 3300003322 Bacteria 6241
26 rootL2_10155182 3300003322 Bacteria 1652
27 rootL2_10249723 3300003322 Unclassified 2239
28 rootH1_10013627 3300003323 Bacteria 14889
29 rootH1_10020100 3300003323 Bacteria 1987
30 rootH1_10044373 3300003323 Unclassified 2618
31 rootH1_10048804 3300003323 Bacteria 7543
32 JGI25160J50197_1000629 3300003354 Bacteria 19720
33 JGI25160J50197_1003603 3300003354 Bacteria 6875
34 Ga0055535_1002732 3300003761 Bacteria 5685
35 Ga0055542_1002793 3300003762 Bacteria 5267
36 Ga0055526_1046523 3300003771 Bacteria 1027
37 Ga0055528_1002770 3300003790 Bacteria 9188
38 Ga0055528_1010212 3300003790 Bacteria 3841
39 Ga0055530_10002043 3300003791 Bacteria 13614
40 Ga0065165_1000794 3300005262 Bacteria 42164
41 Ga0065165_1016230 3300005262 Bacteria 2798
42 Ga0065714_10195999 3300005288 Bacteria 902
43 Ga0065704_10084167 3300005289 Bacteria 3369
44 Ga0065704_10135560 3300005289 Bacteria 1575
45 Ga0065704_10219316 3300005289 Bacteria 1080
46 Ga0065712_10331430 3300005290 Bacteria 813
47 Ga0065715_10157159 3300005293 Bacteria 1665
48 Ga0065715_10169686 3300005293 Bacteria 1557
49 Ga0065715_10523123 3300005293 Bacteria 762
50 Ga0065715_10698001 3300005293 Bacteria 653
51 Ga0065707_10105112 3300005295 Unclassified 2661
52 Ga0065707_10374416 3300005295 Bacteria 885
53 Ga0065707_10557798 3300005295 Bacteria 712
54 Ga0065707_10631919 3300005295 Bacteria 673
55 Ga0070658_10111052 3300005327 Bacteria 2271
56 Ga0070658_10121781 3300005327 Bacteria 2168
57 Ga0070658_10426728 3300005327 Bacteria 1141
58 Ga0070658_10644294 3300005327 Unclassified 919
59 Ga0070658_11198888 3300005327 Bacteria 660
60 Ga0070676_10001354 3300005328 Bacteria 12323
61 Ga0070676_10006927 3300005328 Bacteria 6071
62 Ga0070676_10010874 3300005328 Bacteria 4941
63 Ga0070676_10013514 3300005328 Bacteria 4474
64 Ga0070676_10236512 3300005328 Bacteria 1213
65 Ga0070676_10548189 3300005328 Bacteria 827
66 Ga0070683_100005727 3300005329 Bacteria 10386
67 Ga0070683_101550649 3300005329 Bacteria 637
68 Ga0070683_101763922 3300005329 Bacteria 595
69 Ga0070683_102032503 3300005329 Unclassified 552
70 Ga0070690_100013844 3300005330 Bacteria 4779
71 Ga0070690_100079502 3300005330 Unclassified 2144
72 Ga0070670_100008061 3300005331 Bacteria 8960
73 Ga0070670_100031019 3300005331 Bacteria 4603
74 Ga0070670_100044143 3300005331 Unclassified 3833
75 Ga0070670_100246840 3300005331 Bacteria 1555
76 Ga0070677_10020874 3300005333 Unclassified 2394
77 Ga0068869_100002827 3300005334 Bacteria 10519
78 Ga0068869_100031991 3300005334 Bacteria 3704
79 Ga0068869_100057957 3300005334 Bacteria 2830
80 Ga0068869_100064491 3300005334 Bacteria 2695
81 Ga0068869_100164585 3300005334 Unclassified 1729
82 Ga0068869_100215579 3300005334 Bacteria 1519
83 Ga0068869_100438880 3300005334 Unclassified 1080
84 Ga0068869_100959834 3300005334 Bacteria 742
85 Ga0068869_101061797 3300005334 Bacteria 707
86 Ga0068869_101144533 3300005334 Bacteria 682
87 Ga0070666_10000039 3300005335 Bacteria 115360
88 Ga0070666_10000452 3300005335 Bacteria 24971
89 Ga0070666_10006599 3300005335 Bacteria 7134
90 Ga0070666_10013217 3300005335 Bacteria 5233
91 Ga0070666_10484769 3300005335 Unclassified 895
92 Ga0070680_100002499 3300005336 Bacteria 13629
93 Ga0070682_100000300 3300005337 Bacteria 34454
94 Ga0070682_100028311 3300005337 Bacteria 3369
95 Ga0070682_100236346 3300005337 Bacteria 1309
96 Ga0068868_100000280 3300005338 Bacteria 34319
97 Ga0068868_100007213 3300005338 Bacteria 7899
98 Ga0068868_100024984 3300005338 Bacteria 4538
99 Ga0068868_100027020 3300005338 Bacteria 4376
100 Ga0068868_100073205 3300005338 Bacteria 2735
101 Ga0068868_100165968 3300005338 Bacteria 1826
102 Ga0070660_100010731 3300005339 Bacteria 6483
103 Ga0070660_100278893 3300005339 Bacteria 1367
104 Ga0070660_100371268 3300005339 Bacteria 1180
105 Ga0070660_100584513 3300005339 Unclassified 933
106 Ga0070689_100006897 3300005340 Bacteria 7904
107 Ga0070689_100126134 3300005340 Bacteria 2048
108 Ga0070689_100274248 3300005340 Bacteria 1397
109 Ga0070689_100947616 3300005340 Bacteria 763
110 Ga0070689_101606810 3300005340 Unclassified 590
111 Ga0070691_10000080 3300005341 Bacteria 26663
112 Ga0070691_10271740 3300005341 Bacteria 916
113 Ga0070687_100003457 3300005343 Bacteria 6135
114 Ga0070687_100091206 3300005343 Unclassified 1686
115 Ga0070687_100509271 3300005343 Bacteria 812
116 Ga0070661_100016222 3300005344 Bacteria 5262
117 Ga0070661_100093644 3300005344 Unclassified 2226
118 Ga0070661_100251318 3300005344 Bacteria 1364
119 Ga0070661_100373908 3300005344 Unclassified 1122
120 Ga0070661_100688257 3300005344 Unclassified 832
121 Ga0070661_101003766 3300005344 Unclassified 692
122 Ga0070668_100000267 3300005347 Bacteria 34430
123 Ga0070668_100021559 3300005347 Bacteria 4868
124 Ga0070668_100050559 3300005347 Bacteria 3200
125 Ga0070668_100324750 3300005347 Unclassified 1296
126 Ga0070668_100929259 3300005347 Bacteria 779
127 Ga0070669_100001604 3300005353 Bacteria 16344
128 Ga0070669_100017067 3300005353 Bacteria 5179
129 Ga0070669_100067755 3300005353 Bacteria 2634
130 Ga0070669_100074731 3300005353 Bacteria 2512
131 Ga0070669_100158935 3300005353 Bacteria 1755
132 Ga0070669_100415576 3300005353 Bacteria 1103
133 Ga0070669_100429754 3300005353 Bacteria 1085
134 Ga0070669_100435013 3300005353 Bacteria 1079
135 Ga0070675_100004009 3300005354 Bacteria 11177
136 Ga0070675_100029574 3300005354 Bacteria 4420
137 Ga0070675_100031468 3300005354 Bacteria 4290
138 Ga0070675_100035088 3300005354 Bacteria 4074
139 Ga0070675_100070016 3300005354 Bacteria 2907
140 Ga0070675_100108134 3300005354 Bacteria 2349
141 Ga0070675_100943713 3300005354 Bacteria 791
142 Ga0070675_101195021 3300005354 Bacteria 700
143 Ga0070675_102213439 3300005354 Unclassified 506
144 Ga0070671_100004724 3300005355 Bacteria 10818
145 Ga0070671_100014782 3300005355 Bacteria 6307
146 Ga0070671_100045190 3300005355 Bacteria 3661
147 Ga0070671_100122563 3300005355 Bacteria 2188
148 Ga0070671_100171218 3300005355 Bacteria 1836
149 Ga0070671_100215197 3300005355 Unclassified 1630
150 Ga0070671_100389318 3300005355 Unclassified 1192
151 Ga0070671_100439779 3300005355 Unclassified 1118
152 Ga0070671_100452723 3300005355 Bacteria 1101
153 Ga0070671_101699088 3300005355 Bacteria 560
154 Ga0070674_100001880 3300005356 Bacteria 11400
155 Ga0070674_100011350 3300005356 Bacteria 5423
156 Ga0070674_100054587 3300005356 Bacteria 2764
157 Ga0070674_100131708 3300005356 Bacteria 1865
158 Ga0070674_100346401 3300005356 Unclassified 1199
159 Ga0070674_101087370 3300005356 Bacteria 706
160 Ga0070674_101572796 3300005356 Unclassified 592
161 Ga0070673_100005984 3300005364 Bacteria 7869
162 Ga0070673_100018578 3300005364 Bacteria 4970
163 Ga0070673_100023077 3300005364 Bacteria 4541
164 Ga0070673_100070665 3300005364 Unclassified 2802
165 Ga0070673_100166404 3300005364 Bacteria 1879
166 Ga0070673_100192379 3300005364 Bacteria 1753
167 Ga0070673_100288842 3300005364 Bacteria 1441
168 Ga0070688_100017479 3300005365 Unclassified 4116
169 Ga0070688_100244422 3300005365 Bacteria 1275
170 Ga0070688_100377549 3300005365 Bacteria 1044
171 Ga0070688_101074649 3300005365 Bacteria 642
172 Ga0070659_100006597 3300005366 Bacteria 8383
173 Ga0070659_100058608 3300005366 Bacteria 3039
174 Ga0070659_100576477 3300005366 Bacteria 965
175 Ga0070659_100612375 3300005366 Unclassified 937
176 Ga0070659_101169920 3300005366 Unclassified 679
177 Ga0070667_100000827 3300005367 Bacteria 28762
178 Ga0070667_100012012 3300005367 Bacteria 7170
179 Ga0070667_100016036 3300005367 Bacteria 6198
180 Ga0070667_100026868 3300005367 Bacteria 4790
181 Ga0070667_100027844 3300005367 Bacteria 4703
182 Ga0070667_100106249 3300005367 Bacteria 2430
183 Ga0070667_100235076 3300005367 Unclassified 1635
184 Ga0070667_100284886 3300005367 Bacteria 1485
185 Ga0070667_100377448 3300005367 Bacteria 1287
186 Ga0070667_100514916 3300005367 Bacteria 1097
187 Ga0070667_100635519 3300005367 Bacteria 985
188 Ga0070667_100963325 3300005367 Bacteria 795
189 Ga0070701_10029988 3300005438 Bacteria 2687
190 Ga0070701_10578445 3300005438 Bacteria 741
191 Ga0070700_100053783 3300005441 Unclassified 2514
192 Ga0070694_100083765 3300005444 Bacteria 2223
193 Ga0070694_100289046 3300005444 Bacteria 1252
194 Ga0070663_100616270 3300005455 Bacteria 914
195 Ga0070678_100056697 3300005456 Bacteria 2867
196 Ga0070678_100213190 3300005456 Bacteria 1601
197 Ga0070678_100221177 3300005456 Unclassified 1574
198 Ga0070678_100712256 3300005456 Bacteria 905
199 Ga0070662_100006870 3300005457 Bacteria 7363
200 Ga0070662_100037572 3300005457 Unclassified 3434
201 Ga0070662_100368956 3300005457 Unclassified 1179
202 Ga0070681_10040977 3300005458 Bacteria 4640
203 Ga0068867_100007549 3300005459 Bacteria 7693
204 Ga0068867_100014244 3300005459 Bacteria 5633
205 Ga0068867_100043031 3300005459 Bacteria 3306
206 Ga0068867_100051352 3300005459 Bacteria 3041
207 Ga0068867_100052295 3300005459 Bacteria 3014
208 Ga0068867_100096651 3300005459 Bacteria 2249
209 Ga0068867_100134849 3300005459 Bacteria 1923
210 Ga0070685_10025493 3300005466 Bacteria 3256
211 Ga0070685_10049189 3300005466 Unclassified 2431
212 Ga0070685_10253177 3300005466 Bacteria 1167
213 Ga0070685_10411816 3300005466 Unclassified 938
214 Ga0070685_10892191 3300005466 Bacteria 661
215 Ga0070698_100009173 3300005471 Bacteria 10619
216 Ga0070698_100023341 3300005471 Bacteria 6466
217 Ga0070698_100168552 3300005471 Bacteria 2131
218 Ga0070698_100281580 3300005471 Unclassified 1594
219 Ga0070699_100240131 3300005518 Bacteria 1617
220 Ga0070679_100005618 3300005530 Bacteria 11613
221 Ga0070679_100874712 3300005530 Bacteria 842
222 Ga0070679_100897794 3300005530 Bacteria 830
223 Ga0070684_100010799 3300005535 Bacteria 7252
224 Ga0068853_100001211 3300005539 Bacteria 18396
225 Ga0068853_100010842 3300005539 Bacteria 7384
226 Ga0068853_100029117 3300005539 Bacteria 4652
227 Ga0068853_100095252 3300005539 Bacteria 2625
228 Ga0068853_100123242 3300005539 Bacteria 2314
229 Ga0068853_100209474 3300005539 Unclassified 1776
230 Ga0068853_100356823 3300005539 Bacteria 1361
231 Ga0070672_100003158 3300005543 Bacteria 10647
232 Ga0070672_100005060 3300005543 Bacteria 8694
233 Ga0070672_100006757 3300005543 Bacteria 7740
234 Ga0070672_100019139 3300005543 Unclassified 4964
235 Ga0070672_100064029 3300005543 Bacteria 2905
236 Ga0070672_100505951 3300005543 Bacteria 1045
237 Ga0070672_100543047 3300005543 Bacteria 1008
238 Ga0070672_100742541 3300005543 Bacteria 861
239 Ga0070672_100856922 3300005543 Bacteria 801
240 Ga0070686_100003048 3300005544 Bacteria 9181
241 Ga0070686_100048743 3300005544 Bacteria 2684
242 Ga0070686_100841557 3300005544 Bacteria 742
243 Ga0070696_100288857 3300005546 Bacteria 1252
244 Ga0070693_100012076 3300005547 Bacteria 4362
245 Ga0070693_100041450 3300005547 Bacteria 2590
246 Ga0070665_100000916 3300005548 Bacteria 37835
247 Ga0070665_100050076 3300005548 Bacteria 4191
248 Ga0070704_100196989 3300005549 Unclassified 1623
249 Ga0070704_101234182 3300005549 Unclassified 682
250 Ga0068855_100000303 3300005563 Bacteria 61260
251 Ga0068855_100021099 3300005563 Bacteria 7810
252 Ga0068855_100031956 3300005563 Bacteria 6284
253 Ga0068855_100032035 3300005563 Bacteria 6277
254 Ga0068855_100247205 3300005563 Unclassified 1991
255 Ga0068855_100473995 3300005563 Bacteria 1363
256 Ga0070664_100018188 3300005564 Bacteria 5769
257 Ga0070664_100028328 3300005564 Bacteria 4659
258 Ga0070664_100237002 3300005564 Bacteria 1637
259 Ga0070664_100751219 3300005564 Unclassified 910
260 Ga0070664_101505386 3300005564 Unclassified 637
261 Ga0068857_100003544 3300005577 Bacteria 13049
262 Ga0068857_100036683 3300005577 Bacteria 4344
263 Ga0068857_100068103 3300005577 Bacteria 3169
264 Ga0068857_100252065 3300005577 Bacteria 1618
265 Ga0068857_100894757 3300005577 Bacteria 851
266 Ga0068857_101344185 3300005577 Bacteria 694
267 Ga0068857_101398628 3300005577 Unclassified 680
268 Ga0068857_101924052 3300005577 Unclassified 579
269 Ga0068854_100012366 3300005578 Bacteria 5588
270 Ga0068854_100014601 3300005578 Bacteria 5182
271 Ga0068854_100027978 3300005578 Bacteria 3891
272 Ga0068854_100106165 3300005578 Unclassified 2112
273 Ga0068854_100176286 3300005578 Bacteria 1667
274 Ga0068854_100212817 3300005578 Bacteria 1526
275 Ga0068854_100555456 3300005578 Bacteria 974
276 Ga0068856_100010761 3300005614 Bacteria 8884
277 Ga0068856_100019682 3300005614 Bacteria 6551
278 Ga0068856_100037969 3300005614 Bacteria 4727
279 Ga0070702_100041307 3300005615 Bacteria 2586
280 Ga0068852_100001479 3300005616 Bacteria 15899
281 Ga0068852_100006499 3300005616 Bacteria 8451
282 Ga0068852_100011761 3300005616 Bacteria 6607
283 Ga0068852_100024082 3300005616 Bacteria 4914
284 Ga0068852_100086688 3300005616 Unclassified 2792
285 Ga0068852_100095028 3300005616 Bacteria 2676
286 Ga0068852_100109668 3300005616 Unclassified 2507
287 Ga0068852_100215491 3300005616 Bacteria 1824
288 Ga0068852_100747074 3300005616 Bacteria 990
289 Ga0068852_100804324 3300005616 Bacteria 954
290 Ga0068852_100826664 3300005616 Unclassified 941
291 Ga0068859_100000006 3300005617 Bacteria 421509
292 Ga0068859_100012229 3300005617 Bacteria 8632
293 Ga0068859_100067831 3300005617 Bacteria 3603
294 Ga0068859_100082248 3300005617 Bacteria 3263
295 Ga0068859_100167046 3300005617 Unclassified 2280
296 Ga0068859_100258373 3300005617 Bacteria 1833
297 Ga0068859_100783887 3300005617 Bacteria 1041
298 Ga0068859_101457718 3300005617 Bacteria 755
299 Ga0068859_101890520 3300005617 Bacteria 659
300 Ga0068859_102200182 3300005617 Unclassified 608
301 Ga0068864_100000239 3300005618 Bacteria 49175
302 Ga0068864_100009898 3300005618 Bacteria 7863
303 Ga0068864_100069416 3300005618 Bacteria 3064
304 Ga0068864_100103448 3300005618 Bacteria 2528
305 Ga0068864_100116594 3300005618 Bacteria 2383
306 Ga0068864_100148752 3300005618 Bacteria 2119
307 Ga0068864_100284422 3300005618 Bacteria 1544
308 Ga0068866_10029147 3300005718 Bacteria 2637
309 Ga0068866_10030243 3300005718 Bacteria 2597
310 Ga0068866_10214134 3300005718 Bacteria 1158
311 Ga0068866_10339871 3300005718 Unclassified 950
312 Ga0068866_11006521 3300005718 Bacteria 592
313 Ga0068861_100003393 3300005719 Bacteria 10570
314 Ga0068861_100003670 3300005719 Bacteria 10241
315 Ga0068861_100033589 3300005719 Bacteria 3786
316 Ga0068861_100123926 3300005719 Bacteria 2088
317 Ga0068861_100175178 3300005719 Bacteria 1781
318 Ga0068861_100307510 3300005719 Bacteria 1376
319 Ga0068861_100382939 3300005719 Bacteria 1243
320 Ga0068861_101524301 3300005719 Bacteria 656
321 Ga0068851_10000724 3300005834 Bacteria 14097
322 Ga0068851_10020383 3300005834 Bacteria 3211
323 Ga0068851_10094404 3300005834 Unclassified 1579
324 Ga0068851_10106759 3300005834 Bacteria 1491
325 Ga0068851_10160064 3300005834 Bacteria 1236
326 Ga0068870_10012712 3300005840 Bacteria 3940
327 Ga0068863_100000808 3300005841 Bacteria 31389
328 Ga0068863_100002445 3300005841 Bacteria 18454
329 Ga0068863_100019691 3300005841 Bacteria 6455
330 Ga0068863_100115517 3300005841 Bacteria 2557
331 Ga0068858_100000453 3300005842 Bacteria 42983
332 Ga0068858_100007148 3300005842 Bacteria 10835
333 Ga0068858_100380293 3300005842 Unclassified 1355
334 Ga0068858_100565366 3300005842 Bacteria 1101
335 Ga0068858_101178621 3300005842 Bacteria 753
336 Ga0068858_101411002 3300005842 Bacteria 686
337 Ga0068858_101648981 3300005842 Unclassified 633
338 Ga0068860_100000003 3300005843 Bacteria 575741
339 Ga0068860_100002063 3300005843 Bacteria 21160
340 Ga0068860_100002984 3300005843 Bacteria 17484
341 Ga0068860_100012912 3300005843 Bacteria 8205
342 Ga0068860_100044805 3300005843 Bacteria 4216
343 Ga0068860_100178940 3300005843 Bacteria 2050
344 Ga0068862_100101788 3300005844 Bacteria 2513
345 Ga0068862_100285933 3300005844 Bacteria 1513
346 Ga0068862_100310304 3300005844 Bacteria 1454
347 Ga0068862_100704707 3300005844 Bacteria 978
348 Ga0081540_1004973 3300005983 Bacteria 9997
349 Ga0081539_10000223 3300005985 Bacteria 133106
350 Ga0070715_10017463 3300006163 Unclassified 2717
351 Ga0075366_10016919 3300006195 Bacteria 4190
352 Ga0075366_10052395 3300006195 Bacteria 2424
353 Ga0075366_10079219 3300006195 Bacteria 1961
354 Ga0097621_100000199 3300006237 Bacteria 38904
355 Ga0097621_100000788 3300006237 Bacteria 22264
356 Ga0097621_100002337 3300006237 Bacteria 12996
357 Ga0097621_100015604 3300006237 Bacteria 5723
358 Ga0097621_100016643 3300006237 Bacteria 5564
359 Ga0097621_100048947 3300006237 Bacteria 3432
360 Ga0097621_100059896 3300006237 Unclassified 3119
361 Ga0097621_100107381 3300006237 Unclassified 2355
362 Ga0097621_100233547 3300006237 Bacteria 1606
363 Ga0075370_10079241 3300006353 Bacteria 1887
364 Ga0068871_100000319 3300006358 Bacteria 33457
365 Ga0068871_100001579 3300006358 Bacteria 15313
366 Ga0068871_100003257 3300006358 Bacteria 11137
367 Ga0068871_100010507 3300006358 Bacteria 6761
368 Ga0068871_100026260 3300006358 Bacteria 4542
369 Ga0068871_100059161 3300006358 Unclassified 3122
370 Ga0068871_100093413 3300006358 Bacteria 2510
371 Ga0068871_100954337 3300006358 Bacteria 797
372 Ga0068871_100976258 3300006358 Bacteria 788
373 Ga0068871_101016486 3300006358 Unclassified 772
374 Ga0068871_101038186 3300006358 Bacteria 765
375 Ga0068871_101050397 3300006358 Bacteria 760
376 Ga0068871_101365405 3300006358 Bacteria 667
377 Ga0075428_100056938 3300006844 Bacteria 4280
378 Ga0075428_100837809 3300006844 Bacteria 977
379 Ga0075433_10293703 3300006852 Unclassified 1439
380 Ga0075434_100877867 3300006871 Bacteria 912
381 Ga0075429_100002069 3300006880 Bacteria 16736
382 Ga0075429_100297064 3300006880 Unclassified 1414
383 Ga0068865_100005349 3300006881 Bacteria 7775
384 Ga0068865_100010178 3300006881 Bacteria 5846
385 Ga0068865_100049422 3300006881 Bacteria 2899
386 Ga0068865_101031638 3300006881 Bacteria 721
387 Ga0097620_100000006 3300006931 Bacteria 421509
388 Ga0097620_100012229 3300006931 Bacteria 8632
389 Ga0097620_100067824 3300006931 Bacteria 3603
390 Ga0097620_100082253 3300006931 Bacteria 3263
391 Ga0097620_100167038 3300006931 Unclassified 2280
392 Ga0097620_100258379 3300006931 Bacteria 1833
393 Ga0097620_100783917 3300006931 Bacteria 1041
394 Ga0097620_101458087 3300006931 Bacteria 755
395 Ga0097620_101889851 3300006931 Bacteria 659
396 Ga0097620_102200165 3300006931 Unclassified 608
397 Ga0105240_10021604 3300009093 Bacteria 8559
398 Ga0105240_10094371 3300009093 Unclassified 3650
399 Ga0105240_10344451 3300009093 Bacteria 1692
400 Ga0105240_10391369 3300009093 Unclassified 1568
401 Ga0111539_10000962 3300009094 Bacteria 37802
402 Ga0105245_10749198 3300009098 Unclassified 1012
403 Ga0105245_10759124 3300009098 Bacteria 1006
404 Ga0105245_10808776 3300009098 Bacteria 976
405 Ga0105247_10003742 3300009101 Bacteria 9867
406 Ga0105247_10005694 3300009101 Bacteria 7808
407 Ga0105247_10082555 3300009101 Unclassified 2028
408 Ga0105247_10129759 3300009101 Unclassified 1642
409 Ga0105241_10044903 3300009174 Bacteria 3350
410 Ga0105241_10093720 3300009174 Bacteria 2374
411 Ga0105241_10843291 3300009174 Bacteria 847
412 Ga0105242_10013689 3300009176 Bacteria 6276
413 Ga0105242_10025051 3300009176 Bacteria 4716
414 Ga0105242_10042319 3300009176 Bacteria 3678
415 Ga0105242_10074344 3300009176 Bacteria 2828
416 Ga0105242_10447017 3300009176 Bacteria 1217
417 Ga0105248_10028685 3300009177 Bacteria 6202
418 Ga0105248_11741016 3300009177 Bacteria 707
419 Ga0105237_10001982 3300009545 Bacteria 26058
420 Ga0105237_10018657 3300009545 Bacteria 7172
421 Ga0105237_10021343 3300009545 Bacteria 6658
422 Ga0105237_10085381 3300009545 Unclassified 3146
423 Ga0105237_10143716 3300009545 Bacteria 2380
424 Ga0105237_10264345 3300009545 Bacteria 1723
425 Ga0105237_10666883 3300009545 Bacteria 1047
426 Ga0105238_10377844 3300009551 Bacteria 1408
427 Ga0105238_10512566 3300009551 Bacteria 1201
428 Ga0105238_10651810 3300009551 Bacteria 1063
429 Ga0105249_10001537 3300009553 Bacteria 20259
430 Ga0105249_10008988 3300009553 Bacteria 8729
431 Ga0105249_10201155 3300009553 Bacteria 1949
432 Ga0105249_12157013 3300009553 Unclassified 630
433 Ga0105239_10019843 3300010375 Bacteria 7418
434 Ga0105239_10068551 3300010375 Bacteria 3898
435 Ga0105239_10072111 3300010375 Unclassified 3796
436 Ga0105239_10327607 3300010375 Bacteria 1727
437 Ga0105239_10717449 3300010375 Bacteria 1144
438 Ga0105246_10006786 3300011119 Bacteria 7000
439 Ga0105246_10051676 3300011119 Bacteria 2823
440 Ga0105246_10274227 3300011119 Bacteria 1350
441 Ga0105246_10482591 3300011119 Bacteria 1049
442 Ga0105246_11170744 3300011119 Bacteria 706
443 Ga0157373_10067815 3300013100 Bacteria 2522
444 Ga0157371_10007008 3300013102 Bacteria 9170
445 Ga0157371_10231024 3300013102 Bacteria 1329
446 Ga0157371_10321262 3300013102 Bacteria 1123
447 Ga0157370_10830144 3300013104 Bacteria 840
448 Ga0157369_10170178 3300013105 Bacteria 2296
449 Ga0157369_10280792 3300013105 Unclassified 1734
450 Ga0157369_10494963 3300013105 Bacteria 1265
451 Ga0157374_10000168 3300013296 Bacteria 60649
452 Ga0157374_10034554 3300013296 Bacteria 4619
453 Ga0157374_10086358 3300013296 Bacteria 2985
454 Ga0157374_10913790 3300013296 Bacteria 896
455 Ga0157378_10002295 3300013297 Bacteria 16997
456 Ga0157378_10005820 3300013297 Bacteria 10808
457 Ga0157378_10008685 3300013297 Bacteria 8840
458 Ga0157378_10025276 3300013297 Bacteria 5230
459 Ga0157378_10085511 3300013297 Bacteria 2857
460 Ga0157378_10209801 3300013297 Bacteria 1846
461 Ga0157378_10359579 3300013297 Bacteria 1424
462 Ga0157378_10555968 3300013297 Bacteria 1153
463 Ga0157378_10679491 3300013297 Bacteria 1047
464 Ga0157378_10797348 3300013297 Bacteria 970
465 Ga0163162_10000171 3300013306 Bacteria 59945
466 Ga0163162_10000504 3300013306 Bacteria 36390
467 Ga0163162_10005998 3300013306 Bacteria 11763
468 Ga0163162_10062085 3300013306 Bacteria 3776
469 Ga0163162_10127568 3300013306 Bacteria 2651
470 Ga0163162_10156581 3300013306 Bacteria 2398
471 Ga0163162_10227041 3300013306 Bacteria 1997
472 Ga0163162_10239181 3300013306 Bacteria 1946
473 Ga0157372_10013228 3300013307 Bacteria 8807
474 Ga0157372_10022050 3300013307 Bacteria 6887
475 Ga0157372_10024024 3300013307 Bacteria 6614
476 Ga0157372_10077990 3300013307 Unclassified 3743
477 Ga0157372_10180209 3300013307 Bacteria 2445
478 Ga0157372_10194238 3300013307 Unclassified 2351
479 Ga0157372_10613103 3300013307 Bacteria 1268
480 Ga0157375_10000098 3300013308 Bacteria 88130
481 Ga0157375_10006257 3300013308 Bacteria 10369
482 Ga0157375_10016610 3300013308 Bacteria 6618
483 Ga0157375_10029421 3300013308 Bacteria 5166
484 Ga0157375_10030623 3300013308 Bacteria 5076
485 Ga0157375_10031284 3300013308 Bacteria 5027
486 Ga0157375_10034938 3300013308 Bacteria 4794
487 Ga0157375_10238291 3300013308 Bacteria 1979
488 Ga0157375_10343952 3300013308 Unclassified 1657
489 Ga0157375_13457679 3300013308 Unclassified 526
490 Ga0163163_10000271 3300014325 Bacteria 52036
491 Ga0163163_10001158 3300014325 Bacteria 22414
492 Ga0163163_10087194 3300014325 Bacteria 3131
493 Ga0163163_10147871 3300014325 Bacteria 2394
494 Ga0163163_10344075 3300014325 Bacteria 1547
495 Ga0163163_10347582 3300014325 Unclassified 1539
496 Ga0163163_10796968 3300014325 Unclassified 1008
497 Ga0157380_10001179 3300014326 Bacteria 16931
498 Ga0157380_10004406 3300014326 Bacteria 9758
499 Ga0157380_10022376 3300014326 Bacteria 4757
500 Ga0157380_10288610 3300014326 Bacteria 1505
501 Ga0157380_10762204 3300014326 Bacteria 980
502 Ga0157377_10001079 3300014745 Bacteria 11553
503 Ga0157377_10512339 3300014745 Bacteria 841
504 Ga0157379_10002303 3300014968 Bacteria 15919
505 Ga0157379_10027927 3300014968 Bacteria 5022
506 Ga0157379_10042242 3300014968 Bacteria 4070
507 Ga0157379_10054987 3300014968 Bacteria 3557
508 Ga0157379_10199835 3300014968 Unclassified 1808
509 Ga0157376_10000444 3300014969 Bacteria 26696
510 Ga0157376_10002197 3300014969 Bacteria 13158
511 Ga0157376_10005420 3300014969 Bacteria 8919
512 Ga0157376_10030411 3300014969 Bacteria 4312
513 Ga0157376_10046908 3300014969 Bacteria 3565
514 Ga0157376_10078410 3300014969 Unclassified 2829
515 Ga0157376_10258779 3300014969 Bacteria 1629
516 Ga0157376_10439281 3300014969 Bacteria 1270
517 Ga0182005_1000043 3300015265 Bacteria 140285
518 Ga0163161_10001929 3300017792 Bacteria 15128
519 Ga0163161_10007014 3300017792 Bacteria 7792
520 Ga0163161_10096754 3300017792 Bacteria 2192
521 Ga0163161_10104782 3300017792 Bacteria 2109
522 Ga0163161_10810689 3300017792 Bacteria 787
523 Ga0213876_10022180 3300021384 Bacteria 3358
524 Ga0209436_100943 3300025208 Bacteria 11470
525 Ga0209258_100032 3300025242 Bacteria 452764
526 Ga0207425_1026048 3300025245 Bacteria 1202
527 Ga0209646_1000004 3300025246 Bacteria 786587
528 Ga0209646_1021587 3300025246 Bacteria 923
529 Ga0209026_1000156 3300025250 Bacteria 107193
530 Ga0209148_1000339 3300025254 Bacteria 62786
531 Ga0209673_1000078 3300025273 Bacteria 227727
532 Ga0209130_1001642 3300025284 Bacteria 13725
533 Ga0209675_1024218 3300025291 Bacteria 1555
534 Ga0209564_1007098 3300025295 Bacteria 5856
535 Ga0209758_1006680 3300025297 Bacteria 8147
536 Ga0209758_1009520 3300025297 Bacteria 6017
537 Ga0209050_1000097 3300025298 Bacteria 239919
538 Ga0207426_1000033 3300025302 Bacteria 455976
539 Ga0207426_1000059 3300025302 Bacteria 363842
540 Ga0207426_1000472 3300025302 Bacteria 61715
541 Ga0207426_1001380 3300025302 Bacteria 20557
542 Ga0207426_1022941 3300025302 Bacteria 2135
543 Ga0209257_1000717 3300025304 Bacteria 50888
544 Ga0207697_10051958 3300025315 Bacteria 1695
545 Ga0207697_10221870 3300025315 Unclassified 834
546 Ga0207656_10003743 3300025321 Bacteria 5268
547 Ga0207656_10018323 3300025321 Bacteria 2755
548 Ga0207656_10175413 3300025321 Bacteria 1026
549 Ga0207656_10182515 3300025321 Bacteria 1008
550 Ga0207656_10341202 3300025321 Bacteria 747
551 Ga0207682_10005197 3300025893 Bacteria 5328
552 Ga0207682_10021884 3300025893 Bacteria 2516
553 Ga0207642_10226238 3300025899 Unclassified 1048
554 Ga0207642_10500698 3300025899 Bacteria 744
555 Ga0207710_10173800 3300025900 Unclassified 1054
556 Ga0207688_10007956 3300025901 Bacteria 5767
557 Ga0207680_10000037 3300025903 Bacteria 72773
558 Ga0207680_10002060 3300025903 Bacteria 9416
559 Ga0207680_10016273 3300025903 Bacteria 3901
560 Ga0207680_10136576 3300025903 Bacteria 1621
561 Ga0207647_10000222 3300025904 Bacteria 46878
562 Ga0207647_10010106 3300025904 Bacteria 6674
563 Ga0207647_10069186 3300025904 Bacteria 2134
564 Ga0207647_10212866 3300025904 Bacteria 1115
565 Ga0207645_10000733 3300025907 Bacteria 27302
566 Ga0207645_10001928 3300025907 Bacteria 16746
567 Ga0207645_10474190 3300025907 Bacteria 846
568 Ga0207643_10008733 3300025908 Bacteria 5436
569 Ga0207643_10591672 3300025908 Bacteria 714
570 Ga0207705_10042294 3300025909 Bacteria 3271
571 Ga0207705_10086377 3300025909 Unclassified 2293
572 Ga0207705_10276499 3300025909 Bacteria 1285
573 Ga0207705_10514580 3300025909 Unclassified 930
574 Ga0207654_10001560 3300025911 Bacteria 12034
575 Ga0207654_10019285 3300025911 Bacteria 3597
576 Ga0207654_10087445 3300025911 Bacteria 1891
577 Ga0207707_10000353 3300025912 Bacteria 48229
578 Ga0207695_10000051 3300025913 Bacteria 399641
579 Ga0207695_10000056 3300025913 Bacteria 382433
580 Ga0207695_10000081 3300025913 Bacteria 284797
581 Ga0207695_10000156 3300025913 Bacteria 204576
582 Ga0207695_10004658 3300025913 Bacteria 18588
583 Ga0207695_10027728 3300025913 Bacteria 6302
584 Ga0207695_10037494 3300025913 Bacteria 5230
585 Ga0207695_10652828 3300025913 Bacteria 933
586 Ga0207671_10000030 3300025914 Bacteria 248197
587 Ga0207671_10005234 3300025914 Bacteria 12049
588 Ga0207671_10011061 3300025914 Bacteria 7386
589 Ga0207671_10014684 3300025914 Bacteria 6177
590 Ga0207671_10033891 3300025914 Bacteria 3797
591 Ga0207671_10348880 3300025914 Bacteria 1173
592 Ga0207693_10911770 3300025915 Bacteria 674
593 Ga0207660_10001630 3300025917 Bacteria 15047
594 Ga0207662_10251455 3300025918 Bacteria 1160
595 Ga0207662_10491711 3300025918 Bacteria 844
596 Ga0207657_10007579 3300025919 Bacteria 11123
597 Ga0207657_10554016 3300025919 Unclassified 899
598 Ga0207649_10121246 3300025920 Bacteria 1763
599 Ga0207649_10162875 3300025920 Bacteria 1547
600 Ga0207652_10000925 3300025921 Bacteria 27608
601 Ga0207652_10630014 3300025921 Bacteria 960
602 Ga0207652_11459381 3300025921 Bacteria 588
603 Ga0207681_10038406 3300025923 Bacteria 3172
604 Ga0207681_10106715 3300025923 Bacteria 2030
605 Ga0207681_10121625 3300025923 Bacteria 1915
606 Ga0207681_11255160 3300025923 Bacteria 622
607 Ga0207694_10112133 3300025924 Bacteria 2170
608 Ga0207694_10134932 3300025924 Bacteria 1981
609 Ga0207650_10744872 3300025925 Bacteria 829
610 Ga0207650_10829586 3300025925 Unclassified 784
611 Ga0207650_11480986 3300025925 Unclassified 577
612 Ga0207659_10403814 3300025926 Unclassified 1143
613 Ga0207659_10704666 3300025926 Bacteria 864
614 Ga0207687_10761762 3300025927 Bacteria 824
615 Ga0207644_10030033 3300025931 Bacteria 3774
616 Ga0207644_10216180 3300025931 Bacteria 1517
617 Ga0207690_10012964 3300025932 Bacteria 4997
618 Ga0207690_10571474 3300025932 Unclassified 921
619 Ga0207706_10005992 3300025933 Bacteria 11304
620 Ga0207706_10007003 3300025933 Bacteria 10421
621 Ga0207706_10363098 3300025933 Unclassified 1258
622 Ga0207686_10087614 3300025934 Unclassified 2048
623 Ga0207686_10092284 3300025934 Bacteria 2002
624 Ga0207686_10153743 3300025934 Bacteria 1605
625 Ga0207686_10155388 3300025934 Bacteria 1597
626 Ga0207670_10632626 3300025936 Bacteria 881
627 Ga0207669_10044633 3300025937 Bacteria 2606
628 Ga0207669_10210937 3300025937 Unclassified 1417
629 Ga0207704_10004308 3300025938 Bacteria 6502
630 Ga0207704_10046270 3300025938 Bacteria 2592
631 Ga0207704_10099213 3300025938 Bacteria 1937
632 Ga0207704_10190309 3300025938 Unclassified 1492
633 Ga0207704_10238226 3300025938 Bacteria 1358
634 Ga0207704_10643395 3300025938 Bacteria 873
635 Ga0207665_10674833 3300025939 Bacteria 811
636 Ga0207691_10000234 3300025940 Bacteria 54055
637 Ga0207691_10009264 3300025940 Bacteria 9447
638 Ga0207691_10013394 3300025940 Bacteria 7850
639 Ga0207691_10102286 3300025940 Bacteria 2556
640 Ga0207691_10635116 3300025940 Bacteria 903
641 Ga0207711_10962525 3300025941 Bacteria 793
642 Ga0207711_11365410 3300025941 Bacteria 651
643 Ga0207689_10001184 3300025942 Bacteria 25069
644 Ga0207689_10005600 3300025942 Bacteria 11190
645 Ga0207689_10006499 3300025942 Bacteria 10325
646 Ga0207689_10012109 3300025942 Bacteria 7384
647 Ga0207661_10053214 3300025944 Unclassified 3238
648 Ga0207679_10195721 3300025945 Bacteria 1685
649 Ga0207679_10292533 3300025945 Unclassified 1401
650 Ga0207679_10791350 3300025945 Bacteria 864
651 Ga0207679_11149693 3300025945 Bacteria 712
652 Ga0207679_11610189 3300025945 Unclassified 595
653 Ga0207667_10000713 3300025949 Bacteria 43129
654 Ga0207667_10021120 3300025949 Bacteria 7221
655 Ga0207667_10149672 3300025949 Bacteria 2403
656 Ga0207667_10371113 3300025949 Bacteria 1458
657 Ga0207667_10445163 3300025949 Bacteria 1317
658 Ga0207667_10796486 3300025949 Bacteria 942
659 Ga0207651_10025812 3300025960 Bacteria 3658
660 Ga0207651_10473547 3300025960 Bacteria 1078
661 Ga0207712_10138938 3300025961 Unclassified 1861
662 Ga0207712_10248757 3300025961 Bacteria 1436
663 Ga0207712_10692948 3300025961 Unclassified 889
664 Ga0207668_10013925 3300025972 Unclassified 4967
665 Ga0207668_10065897 3300025972 Bacteria 2565
666 Ga0207668_10077857 3300025972 Unclassified 2392
667 Ga0207668_10126805 3300025972 Bacteria 1942
668 Ga0207668_10242662 3300025972 Bacteria 1458
669 Ga0207640_10139100 3300025981 Bacteria 1767
670 Ga0207640_10175937 3300025981 Bacteria 1600
671 Ga0207640_10913614 3300025981 Unclassified 767
672 Ga0207658_10000950 3300025986 Bacteria 23916
673 Ga0207658_10018569 3300025986 Bacteria 4804
674 Ga0207658_10062825 3300025986 Bacteria 2781
675 Ga0207658_10307829 3300025986 Unclassified 1367
676 Ga0207658_10620663 3300025986 Bacteria 972
677 Ga0207658_11004439 3300025986 Bacteria 761
678 Ga0207677_10001355 3300026023 Bacteria 13116
679 Ga0207677_10059727 3300026023 Bacteria 2631
680 Ga0207677_10077179 3300026023 Bacteria 2375
681 Ga0207677_10082668 3300026023 Unclassified 2309
682 Ga0207703_10003242 3300026035 Bacteria 13674
683 Ga0207703_11582479 3300026035 Bacteria 630
684 Ga0207639_10002981 3300026041 Bacteria 11397
685 Ga0207639_10021089 3300026041 Bacteria 4674
686 Ga0207639_10084625 3300026041 Bacteria 2520
687 Ga0207639_10385571 3300026041 Unclassified 1259
688 Ga0207678_10393471 3300026067 Bacteria 1199
689 Ga0207678_10533790 3300026067 Bacteria 1025
690 Ga0207708_10344816 3300026075 Bacteria 1221
691 Ga0207702_10023587 3300026078 Bacteria 5104
692 Ga0207702_10590185 3300026078 Bacteria 1089
693 Ga0207641_10000186 3300026088 Bacteria 86601
694 Ga0207641_10001042 3300026088 Bacteria 28066
695 Ga0207641_10612278 3300026088 Unclassified 1067
696 Ga0207648_10002569 3300026089 Bacteria 19457
697 Ga0207648_10003727 3300026089 Bacteria 15940
698 Ga0207648_10021117 3300026089 Bacteria 5854
699 Ga0207648_10082235 3300026089 Bacteria 2808
700 Ga0207648_10155545 3300026089 Bacteria 2018
701 Ga0207676_10003530 3300026095 Bacteria 11067
702 Ga0207676_10006774 3300026095 Bacteria 8110
703 Ga0207676_10331854 3300026095 Unclassified 1400
704 Ga0207676_10387031 3300026095 Bacteria 1303
705 Ga0207674_10091158 3300026116 Bacteria 3038
706 Ga0207674_10450584 3300026116 Bacteria 1244
707 Ga0207674_10567347 3300026116 Bacteria 1096
708 Ga0207675_100029163 3300026118 Bacteria 5143
709 Ga0207675_100102912 3300026118 Unclassified 2691
710 Ga0207675_100237002 3300026118 Bacteria 1762
711 Ga0207675_100416070 3300026118 Bacteria 1327
712 Ga0207675_100497923 3300026118 Bacteria 1213
713 Ga0207675_101390187 3300026118 Bacteria 723
714 Ga0207675_101535392 3300026118 Bacteria 687
715 Ga0207683_10084346 3300026121 Bacteria 2824
716 Ga0207683_10105466 3300026121 Bacteria 2519
717 Ga0207683_10107208 3300026121 Bacteria 2499
718 Ga0207683_10179252 3300026121 Bacteria 1921
719 Ga0207698_10005151 3300026142 Bacteria 8037
720 Ga0207698_10100518 3300026142 Bacteria 2396
721 Ga0207698_10121929 3300026142 Bacteria 2208
722 Ga0207698_10470356 3300026142 Bacteria 1217
723 Ga0207698_10779772 3300026142 Bacteria 957
724 Ga0209969_1012802 3300027360 Bacteria 1211
725 Ga0209984_1020807 3300027424 Bacteria 898
726 Ga0209995_1016821 3300027471 Bacteria 1202
727 Ga0268266_10002778 3300028379 Bacteria 18278
728 Ga0268266_10102343 3300028379 Bacteria 2526
729 Ga0268265_10040332 3300028380 Bacteria 3448
730 Ga0268265_10253177 3300028380 Unclassified 1561
731 Ga0268264_10004017 3300028381 Bacteria 12601
732 Ga0268264_10151213 3300028381 Bacteria 2081
733 Ga0268264_10285048 3300028381 Bacteria 1549
734 Ga0268264_11025383 3300028381 Bacteria 832
735 Ga0268264_11619709 3300028381 Bacteria 658
736 Ga0307515_10411635 3300028794 Bacteria 975
737 Ga0316177_1005071 3300030731 Unclassified 625
738 Ga0265327_10000259 3300031251 Bacteria 104677
739 Ga0265327_10005302 3300031251 Bacteria 10818
740 Ga0265313_10164516 3300031595 Bacteria 941
741 Ga0307516_10000675 3300031730 Bacteria 46218
742 Ga0307410_11734902 3300031852 Bacteria 554
743 Ga0307407_10903775 3300031903 Unclassified 678
744 Ga0307414_10597740 3300032004 Bacteria 989
745 Ga0307414_11347483 3300032004 Bacteria 663
746 Ga0307411_10625459 3300032005 Bacteria 929
747 Ga0307415_100540055 3300032126 Bacteria 1027
748 Ga0307510_10000637 3300033180 Bacteria 35581
749 Ga0307510_10429466 3300033180 Bacteria 763
750 Ga0451789_1054658 3300041443 Bacteria 1081
751 Ga0451793_1918688 3300041452 Unclassified 511
752 Ga0451841_0362851 3300041498 Bacteria 634
753 Ga0451843_0758176 3300041509 Bacteria 744
754 Ga0439431_0004568 3300041997 Bacteria 3043
755 Ga0439445_0002131 3300042004 Bacteria 4379
756 Ga0466969_0003268 3300044656 Bacteria 8613
757 Ga0466972_0077116 3300044658 Bacteria 1587
758 Ga0466966_0000022 3300044684 Bacteria 112729
759 Ga0466971_0224568 3300044719 Bacteria 891
760 Ga0466970_0116661 3300044765 Bacteria 1460
761 Ga0466957_0483166 3300044842 Bacteria 857
762 Ga0466960_0803909 3300044901 Bacteria 569
763 Ga0466959_0000055 3300045049 Bacteria 78801
764 Ga0466959_0001777 3300045049 Bacteria 13453
765 Ga0466967_1448438 3300045976 Bacteria 684
766 Ga0495627_001750 3300046453 Bacteria 11703
767 Ga0495622_0246760 3300046557 Bacteria 786
768 Ga0495633_0000374 3300046558 Bacteria 47750
769 Ga0495668_0000451 3300046616 Bacteria 52539
770 Ga0495625_0383781 3300046660 Bacteria 881
771 Ga0495625_0441855 3300046660 Bacteria 805
772 Ga0496108_0390814 3300048911 Unclassified 1215
773 Ga0496109_0046409 3300048912 Unclassified 3946
774 Ga0496121_0000086 3300048924 Bacteria 223703
775 Ga0501032_0838416 3300049569 Bacteria 580
776 Ga0501043_0814432 3300049579 Bacteria 675
777 Ga0501047_0045332 3300049581 Bacteria 4252
778 Ga0501047_0117454 3300049581 Bacteria 2541
779 Ga0501238_024190 3300049671 Unclassified 867
780 Ga0501238_034616 3300049671 Bacteria 735
781 Ga0501241_001671 3300049758 Bacteria 4434
782 Ga0501269_001839 3300049766 Bacteria 2688
783 Ga0501035_0263960 3300049822 Bacteria 1459
784 Ga0501044_0077666 3300049823 Bacteria 3367
785 Ga0501044_0287505 3300049823 Bacteria 1576
786 Ga0501044_0845771 3300049823 Bacteria 792
787 nmdc:mga0k408_111005_c1 3300050493 Bacteria 1621
788 nmdc:mga07m45_160697_c1 3300050496 Bacteria 1304
789 Ga0500644_0000408 3300053088 Bacteria 20337
790 Ga0500581_068798 3300053089 Bacteria 1784
791 Ga0500646_0000898 3300053090 Bacteria 8211
792 Ga0500651_0044106 3300053093 Bacteria 2809
793 Ga0500651_0159057 3300053093 Bacteria 1352
794 Ga0500557_115982 3300053105 Bacteria 889
795 Ga0500569_000033 3300053109 Bacteria 28357
796 Ga0500607_037177 3300053121 Bacteria 2655
797 Ga0500642_0020611 3300053130 Bacteria 2594
798 Ga0500652_001057 3300053131 Bacteria 8937
799 Ga0500658_0040908 3300053134 Bacteria 1857
800 Ga0500559_0020212 3300053136 Bacteria 2815
801 Ga0500561_0207730 3300053137 Bacteria 620
802 Ga0500577_0006911 3300053142 Bacteria 3153
803 Ga0500590_013651 3300053148 Bacteria 4173
804 Ga0500604_0001579 3300053151 Bacteria 6395
805 Ga0500616_0001032 3300053153 Bacteria 29487
806 Ga0500622_0001091 3300053156 Bacteria 22577
807 Ga0500627_0008543 3300053158 Bacteria 3645
808 Ga0500633_0008942 3300053160 Bacteria 2608
809 Ga0500636_0085431 3300053177 Bacteria 1813
810 Ga0500656_011550 3300053732 Bacteria 984
811 Ga0500661_001699 3300055283 Bacteria 4142
812 Ga0466962_0106561 3300061719 Bacteria 1348
813 2819574771 2818991442 Bacteria 8318214
814 2819676677 2818991460 Bacteria 7595395
815 2821140867 2821136567 Bacteria 8080116
816 2883070333 2883068021 Bacteria 6192739
817 2884796540 2884791551 Bacteria 8511252
818 2896086806 2896085136 Bacteria 6129793
819 2904471368 2904467357 Bacteria 8057758
820 2929177944 2929177148 Bacteria 7883697
821 2929240277 2929239360 Bacteria 7745570
822 2929922017 2929921140 Bacteria 8649150
823 2945980297 2945977869 Bacteria 7777518
824 2946013837 2946013367 Bacteria 7766675
825 8003155762 8003151029 Bacteria 8187759
826 Ga0501033_0036749
827 SwRhRL2b_contig_3499586
828 ARcpr5oldR_c011424
829 JGI24740J21852_10008814
830 JGI24740J21852_10018339
831 JGI24740J21852_10043551
832 JGI24739J22299_10000984
833 JGI24739J22299_10008832
834 JGI24739J22299_10046236
835 JGI24739J22299_10095945
836 JGI24737J22298_10158016
837 JGI24744J21845_10013704
838 JGI25154J39366_1000003
839 JGI25406J46586_10001483
840 JGI25153J46596_10002053
841 rootH1_10041421
842 rootH2_10006602
843 rootH2_10017546
844 rootH2_10039830
845 rootH2_10067937
846 rootH2_10075934
847 rootH2_10144541
848 rootH2_10239721
849 rootL2_10043769
850 rootL2_10118604
851 rootL2_10155182
852 rootL2_10249723
853 rootH1_10013627
854 rootH1_10020100
855 rootH1_10044373
856 rootH1_10048804
857 JGI25160J50197_1000629
858 JGI25160J50197_1003603
859 Ga0055535_1002732
860 Ga0055542_1002793
861 Ga0055526_1046523
862 Ga0055528_1002770
863 Ga0055528_1010212
864 Ga0055530_10002043
865 Ga0065165_1000794
866 Ga0065165_1016230
867 Ga0065714_10195999
868 Ga0065704_10084167
869 Ga0065704_10135560
870 Ga0065704_10219316
871 Ga0065712_10331430
872 Ga0065715_10157159
873 Ga0065715_10169686
874 Ga0065715_10523123
875 Ga0065715_10698001
876 Ga0065707_10105112
877 Ga0065707_10374416
878 Ga0065707_10557798
879 Ga0065707_10631919
880 Ga0070658_10111052
881 Ga0070658_10121781
882 Ga0070658_10426728
883 Ga0070658_10644294
884 Ga0070658_11198888
885 Ga0070676_10001354
886 Ga0070676_10006927
887 Ga0070676_10010874
888 Ga0070676_10013514
889 Ga0070676_10236512
890 Ga0070676_10548189
891 Ga0070683_100005727
892 Ga0070683_101550649
893 Ga0070683_101763922
894 Ga0070683_102032503
895 Ga0070690_100013844
896 Ga0070690_100079502
897 Ga0070670_100008061
898 Ga0070670_100031019
899 Ga0070670_100044143
900 Ga0070670_100246840
901 Ga0070677_10020874
902 Ga0068869_100002827
903 Ga0068869_100031991
904 Ga0068869_100057957
905 Ga0068869_100064491
906 Ga0068869_100164585
907 Ga0068869_100215579
908 Ga0068869_100438880
909 Ga0068869_100959834
910 Ga0068869_101061797
911 Ga0068869_101144533
912 Ga0070666_10000039
913 Ga0070666_10000452
914 Ga0070666_10006599
915 Ga0070666_10013217
916 Ga0070666_10484769
917 Ga0070680_100002499
918 Ga0070682_100000300
919 Ga0070682_100028311
920 Ga0070682_100236346
921 Ga0068868_100000280
922 Ga0068868_100007213
923 Ga0068868_100024984
924 Ga0068868_100027020
925 Ga0068868_100073205
926 Ga0068868_100165968
927 Ga0070660_100010731
928 Ga0070660_100278893
929 Ga0070660_100371268
930 Ga0070660_100584513
931 Ga0070689_100006897
932 Ga0070689_100126134
933 Ga0070689_100274248
934 Ga0070689_100947616
935 Ga0070689_101606810
936 Ga0070691_10000080
937 Ga0070691_10271740
938 Ga0070687_100003457
939 Ga0070687_100091206
940 Ga0070687_100509271
941 Ga0070661_100016222
942 Ga0070661_100093644
943 Ga0070661_100251318
944 Ga0070661_100373908
945 Ga0070661_100688257
946 Ga0070661_101003766
947 Ga0070668_100000267
948 Ga0070668_100021559
949 Ga0070668_100050559
950 Ga0070668_100324750
951 Ga0070668_100929259
952 Ga0070669_100001604
953 Ga0070669_100017067
954 Ga0070669_100067755
955 Ga0070669_100074731
956 Ga0070669_100158935
957 Ga0070669_100415576
958 Ga0070669_100429754
959 Ga0070669_100435013
960 Ga0070675_100004009
961 Ga0070675_100029574
962 Ga0070675_100031468
963 Ga0070675_100035088
964 Ga0070675_100070016
965 Ga0070675_100108134
966 Ga0070675_100943713
967 Ga0070675_101195021
968 Ga0070675_102213439
969 Ga0070671_100004724
970 Ga0070671_100014782
971 Ga0070671_100045190
972 Ga0070671_100122563
973 Ga0070671_100171218
974 Ga0070671_100215197
975 Ga0070671_100389318
976 Ga0070671_100439779
977 Ga0070671_100452723
978 Ga0070671_101699088
979 Ga0070674_100001880
980 Ga0070674_100011350
981 Ga0070674_100054587
982 Ga0070674_100131708
983 Ga0070674_100346401
984 Ga0070674_101087370
985 Ga0070674_101572796
986 Ga0070673_100005984
987 Ga0070673_100018578
988 Ga0070673_100023077
989 Ga0070673_100070665
990 Ga0070673_100166404
991 Ga0070673_100192379
992 Ga0070673_100288842
993 Ga0070688_100017479
994 Ga0070688_100244422
995 Ga0070688_100377549
996 Ga0070688_101074649
997 Ga0070659_100006597
998 Ga0070659_100058608
999 Ga0070659_100576477
1000 Ga0070659_100612375
1001 Ga0070659_101169920
1002 Ga0070667_100000827
1003 Ga0070667_100012012
1004 Ga0070667_100016036
1005 Ga0070667_100026868
1006 Ga0070667_100027844
1007 Ga0070667_100106249
1008 Ga0070667_100235076
1009 Ga0070667_100284886
1010 Ga0070667_100377448
1011 Ga0070667_100514916
1012 Ga0070667_100635519
1013 Ga0070667_100963325
1014 Ga0070701_10029988
1015 Ga0070701_10578445
1016 Ga0070700_100053783
1017 Ga0070694_100083765
1018 Ga0070694_100289046
1019 Ga0070663_100616270
1020 Ga0070678_100056697
1021 Ga0070678_100213190
1022 Ga0070678_100221177
1023 Ga0070678_100712256
1024 Ga0070662_100006870
1025 Ga0070662_100037572
1026 Ga0070662_100368956
1027 Ga0070681_10040977
1028 Ga0068867_100007549
1029 Ga0068867_100014244
1030 Ga0068867_100043031
1031 Ga0068867_100051352
1032 Ga0068867_100052295
1033 Ga0068867_100096651
1034 Ga0068867_100134849
1035 Ga0070685_10025493
1036 Ga0070685_10049189
1037 Ga0070685_10253177
1038 Ga0070685_10411816
1039 Ga0070685_10892191
1040 Ga0070698_100009173
1041 Ga0070698_100023341
1042 Ga0070698_100168552
1043 Ga0070698_100281580
1044 Ga0070699_100240131
1045 Ga0070679_100005618
1046 Ga0070679_100874712
1047 Ga0070679_100897794
1048 Ga0070684_100010799
1049 Ga0068853_100001211
1050 Ga0068853_100010842
1051 Ga0068853_100029117
1052 Ga0068853_100095252
1053 Ga0068853_100123242
1054 Ga0068853_100209474
1055 Ga0068853_100356823
1056 Ga0070672_100003158
1057 Ga0070672_100005060
1058 Ga0070672_100006757
1059 Ga0070672_100019139
1060 Ga0070672_100064029
1061 Ga0070672_100505951
1062 Ga0070672_100543047
1063 Ga0070672_100742541
1064 Ga0070672_100856922
1065 Ga0070686_100003048
1066 Ga0070686_100048743
1067 Ga0070686_100841557
1068 Ga0070696_100288857
1069 Ga0070693_100012076
1070 Ga0070693_100041450
1071 Ga0070665_100000916
1072 Ga0070665_100050076
1073 Ga0070704_100196989
1074 Ga0070704_101234182
1075 Ga0068855_100000303
1076 Ga0068855_100021099
1077 Ga0068855_100031956
1078 Ga0068855_100032035
1079 Ga0068855_100247205
1080 Ga0068855_100473995
1081 Ga0070664_100018188
1082 Ga0070664_100028328
1083 Ga0070664_100237002
1084 Ga0070664_100751219
1085 Ga0070664_101505386
1086 Ga0068857_100003544
1087 Ga0068857_100036683
1088 Ga0068857_100068103
1089 Ga0068857_100252065
1090 Ga0068857_100894757
1091 Ga0068857_101344185
1092 Ga0068857_101398628
1093 Ga0068857_101924052
1094 Ga0068854_100012366
1095 Ga0068854_100014601
1096 Ga0068854_100027978
1097 Ga0068854_100106165
1098 Ga0068854_100176286
1099 Ga0068854_100212817
1100 Ga0068854_100555456
1101 Ga0068856_100010761
1102 Ga0068856_100019682
1103 Ga0068856_100037969
1104 Ga0070702_100041307
1105 Ga0068852_100001479
1106 Ga0068852_100006499
1107 Ga0068852_100011761
1108 Ga0068852_100024082
1109 Ga0068852_100086688
1110 Ga0068852_100095028
1111 Ga0068852_100109668
1112 Ga0068852_100215491
1113 Ga0068852_100747074
1114 Ga0068852_100804324
1115 Ga0068852_100826664
1116 Ga0068859_100000006
1117 Ga0068859_100012229
1118 Ga0068859_100067831
1119 Ga0068859_100082248
1120 Ga0068859_100167046
1121 Ga0068859_100258373
1122 Ga0068859_100783887
1123 Ga0068859_101457718
1124 Ga0068859_101890520
1125 Ga0068859_102200182
1126 Ga0068864_100000239
1127 Ga0068864_100009898
1128 Ga0068864_100069416
1129 Ga0068864_100103448
1130 Ga0068864_100116594
1131 Ga0068864_100148752
1132 Ga0068864_100284422
1133 Ga0068866_10029147
1134 Ga0068866_10030243
1135 Ga0068866_10214134
1136 Ga0068866_10339871
1137 Ga0068866_11006521
1138 Ga0068861_100003393
1139 Ga0068861_100003670
1140 Ga0068861_100033589
1141 Ga0068861_100123926
1142 Ga0068861_100175178
1143 Ga0068861_100307510
1144 Ga0068861_100382939
1145 Ga0068861_101524301
1146 Ga0068851_10000724
1147 Ga0068851_10020383
1148 Ga0068851_10094404
1149 Ga0068851_10106759
1150 Ga0068851_10160064
1151 Ga0068870_10012712
1152 Ga0068863_100000808
1153 Ga0068863_100002445
1154 Ga0068863_100019691
1155 Ga0068863_100115517
1156 Ga0068858_100000453
1157 Ga0068858_100007148
1158 Ga0068858_100380293
1159 Ga0068858_100565366
1160 Ga0068858_101178621
1161 Ga0068858_101411002
1162 Ga0068858_101648981
1163 Ga0068860_100000003
1164 Ga0068860_100002063
1165 Ga0068860_100002984
1166 Ga0068860_100012912
1167 Ga0068860_100044805
1168 Ga0068860_100178940
1169 Ga0068862_100101788
1170 Ga0068862_100285933
1171 Ga0068862_100310304
1172 Ga0068862_100704707
1173 Ga0081540_1004973
1174 Ga0081539_10000223
1175 Ga0070715_10017463
1176 Ga0075366_10016919
1177 Ga0075366_10052395
1178 Ga0075366_10079219
1179 Ga0097621_100000199
1180 Ga0097621_100000788
1181 Ga0097621_100002337
1182 Ga0097621_100015604
1183 Ga0097621_100016643
1184 Ga0097621_100048947
1185 Ga0097621_100059896
1186 Ga0097621_100107381
1187 Ga0097621_100233547
1188 Ga0075370_10079241
1189 Ga0068871_100000319
1190 Ga0068871_100001579
1191 Ga0068871_100003257
1192 Ga0068871_100010507
1193 Ga0068871_100026260
1194 Ga0068871_100059161
1195 Ga0068871_100093413
1196 Ga0068871_100954337
1197 Ga0068871_100976258
1198 Ga0068871_101016486
1199 Ga0068871_101038186
1200 Ga0068871_101050397
1201 Ga0068871_101365405
1202 Ga0075428_100056938
1203 Ga0075428_100837809
1204 Ga0075433_10293703
1205 Ga0075434_100877867
1206 Ga0075429_100002069
1207 Ga0075429_100297064
1208 Ga0068865_100005349
1209 Ga0068865_100010178
1210 Ga0068865_100049422
1211 Ga0068865_101031638
1212 Ga0097620_100000006
1213 Ga0097620_100012229
1214 Ga0097620_100067824
1215 Ga0097620_100082253
1216 Ga0097620_100167038
1217 Ga0097620_100258379
1218 Ga0097620_100783917
1219 Ga0097620_101458087
1220 Ga0097620_101889851
1221 Ga0097620_102200165
1222 Ga0105240_10021604
1223 Ga0105240_10094371
1224 Ga0105240_10344451
1225 Ga0105240_10391369
1226 Ga0111539_10000962
1227 Ga0105245_10749198
1228 Ga0105245_10759124
1229 Ga0105245_10808776
1230 Ga0105247_10003742
1231 Ga0105247_10005694
1232 Ga0105247_10082555
1233 Ga0105247_10129759
1234 Ga0105241_10044903
1235 Ga0105241_10093720
1236 Ga0105241_10843291
1237 Ga0105242_10013689
1238 Ga0105242_10025051
1239 Ga0105242_10042319
1240 Ga0105242_10074344
1241 Ga0105242_10447017
1242 Ga0105248_10028685
1243 Ga0105248_11741016
1244 Ga0105237_10001982
1245 Ga0105237_10018657
1246 Ga0105237_10021343
1247 Ga0105237_10085381
1248 Ga0105237_10143716
1249 Ga0105237_10264345
1250 Ga0105237_10666883
1251 Ga0105238_10377844
1252 Ga0105238_10512566
1253 Ga0105238_10651810
1254 Ga0105249_10001537
1255 Ga0105249_10008988
1256 Ga0105249_10201155
1257 Ga0105249_12157013
1258 Ga0105239_10019843
1259 Ga0105239_10068551
1260 Ga0105239_10072111
1261 Ga0105239_10327607
1262 Ga0105239_10717449
1263 Ga0105246_10006786
1264 Ga0105246_10051676
1265 Ga0105246_10274227
1266 Ga0105246_10482591
1267 Ga0105246_11170744
1268 Ga0157373_10067815
1269 Ga0157371_10007008
1270 Ga0157371_10231024
1271 Ga0157371_10321262
1272 Ga0157370_10830144
1273 Ga0157369_10170178
1274 Ga0157369_10280792
1275 Ga0157369_10494963
1276 Ga0157374_10000168
1277 Ga0157374_10034554
1278 Ga0157374_10086358
1279 Ga0157374_10913790
1280 Ga0157378_10002295
1281 Ga0157378_10005820
1282 Ga0157378_10008685
1283 Ga0157378_10025276
1284 Ga0157378_10085511
1285 Ga0157378_10209801
1286 Ga0157378_10359579
1287 Ga0157378_10555968
1288 Ga0157378_10679491
1289 Ga0157378_10797348
1290 Ga0163162_10000171
1291 Ga0163162_10000504
1292 Ga0163162_10005998
1293 Ga0163162_10062085
1294 Ga0163162_10127568
1295 Ga0163162_10156581
1296 Ga0163162_10227041
1297 Ga0163162_10239181
1298 Ga0157372_10013228
1299 Ga0157372_10022050
1300 Ga0157372_10024024
1301 Ga0157372_10077990
1302 Ga0157372_10180209
1303 Ga0157372_10194238
1304 Ga0157372_10613103
1305 Ga0157375_10000098
1306 Ga0157375_10006257
1307 Ga0157375_10016610
1308 Ga0157375_10029421
1309 Ga0157375_10030623
1310 Ga0157375_10031284
1311 Ga0157375_10034938
1312 Ga0157375_10238291
1313 Ga0157375_10343952
1314 Ga0157375_13457679
1315 Ga0163163_10000271
1316 Ga0163163_10001158
1317 Ga0163163_10087194
1318 Ga0163163_10147871
1319 Ga0163163_10344075
1320 Ga0163163_10347582
1321 Ga0163163_10796968
1322 Ga0157380_10001179
1323 Ga0157380_10004406
1324 Ga0157380_10022376
1325 Ga0157380_10288610
1326 Ga0157380_10762204
1327 Ga0157377_10001079
1328 Ga0157377_10512339
1329 Ga0157379_10002303
1330 Ga0157379_10027927
1331 Ga0157379_10042242
1332 Ga0157379_10054987
1333 Ga0157379_10199835
1334 Ga0157376_10000444
1335 Ga0157376_10002197
1336 Ga0157376_10005420
1337 Ga0157376_10030411
1338 Ga0157376_10046908
1339 Ga0157376_10078410
1340 Ga0157376_10258779
1341 Ga0157376_10439281
1342 Ga0182005_1000043
1343 Ga0163161_10001929
1344 Ga0163161_10007014
1345 Ga0163161_10096754
1346 Ga0163161_10104782
1347 Ga0163161_10810689
1348 Ga0213876_10022180
1349 Ga0209436_100943
1350 Ga0209258_100032
1351 Ga0207425_1026048
1352 Ga0209646_1000004
1353 Ga0209646_1021587
1354 Ga0209026_1000156
1355 Ga0209148_1000339
1356 Ga0209673_1000078
1357 Ga0209130_1001642
1358 Ga0209675_1024218
1359 Ga0209564_1007098
1360 Ga0209758_1006680
1361 Ga0209758_1009520
1362 Ga0209050_1000097
1363 Ga0207426_1000033
1364 Ga0207426_1000059
1365 Ga0207426_1000472
1366 Ga0207426_1001380
1367 Ga0207426_1022941
1368 Ga0209257_1000717
1369 Ga0207697_10051958
1370 Ga0207697_10221870
1371 Ga0207656_10003743
1372 Ga0207656_10018323
1373 Ga0207656_10175413
1374 Ga0207656_10182515
1375 Ga0207656_10341202
1376 Ga0207682_10005197
1377 Ga0207682_10021884
1378 Ga0207642_10226238
1379 Ga0207642_10500698
1380 Ga0207710_10173800
1381 Ga0207688_10007956
1382 Ga0207680_10000037
1383 Ga0207680_10002060
1384 Ga0207680_10016273
1385 Ga0207680_10136576
1386 Ga0207647_10000222
1387 Ga0207647_10010106
1388 Ga0207647_10069186
1389 Ga0207647_10212866
1390 Ga0207645_10000733
1391 Ga0207645_10001928
1392 Ga0207645_10474190
1393 Ga0207643_10008733
1394 Ga0207643_10591672
1395 Ga0207705_10042294
1396 Ga0207705_10086377
1397 Ga0207705_10276499
1398 Ga0207705_10514580
1399 Ga0207654_10001560
1400 Ga0207654_10019285
1401 Ga0207654_10087445
1402 Ga0207707_10000353
1403 Ga0207695_10000051
1404 Ga0207695_10000056
1405 Ga0207695_10000081
1406 Ga0207695_10000156
1407 Ga0207695_10004658
1408 Ga0207695_10027728
1409 Ga0207695_10037494
1410 Ga0207695_10652828
1411 Ga0207671_10000030
1412 Ga0207671_10005234
1413 Ga0207671_10011061
1414 Ga0207671_10014684
1415 Ga0207671_10033891
1416 Ga0207671_10348880
1417 Ga0207693_10911770
1418 Ga0207660_10001630
1419 Ga0207662_10251455
1420 Ga0207662_10491711
1421 Ga0207657_10007579
1422 Ga0207657_10554016
1423 Ga0207649_10121246
1424 Ga0207649_10162875
1425 Ga0207652_10000925
1426 Ga0207652_10630014
1427 Ga0207652_11459381
1428 Ga0207681_10038406
1429 Ga0207681_10106715
1430 Ga0207681_10121625
1431 Ga0207681_11255160
1432 Ga0207694_10112133
1433 Ga0207694_10134932
1434 Ga0207650_10744872
1435 Ga0207650_10829586
1436 Ga0207650_11480986
1437 Ga0207659_10403814
1438 Ga0207659_10704666
1439 Ga0207687_10761762
1440 Ga0207644_10030033
1441 Ga0207644_10216180
1442 Ga0207690_10012964
1443 Ga0207690_10571474
1444 Ga0207706_10005992
1445 Ga0207706_10007003
1446 Ga0207706_10363098
1447 Ga0207686_10087614
1448 Ga0207686_10092284
1449 Ga0207686_10153743
1450 Ga0207686_10155388
1451 Ga0207670_10632626
1452 Ga0207669_10044633
1453 Ga0207669_10210937
1454 Ga0207704_10004308
1455 Ga0207704_10046270
1456 Ga0207704_10099213
1457 Ga0207704_10190309
1458 Ga0207704_10238226
1459 Ga0207704_10643395
1460 Ga0207665_10674833
1461 Ga0207691_10000234
1462 Ga0207691_10009264
1463 Ga0207691_10013394
1464 Ga0207691_10102286
1465 Ga0207691_10635116
1466 Ga0207711_10962525
1467 Ga0207711_11365410
1468 Ga0207689_10001184
1469 Ga0207689_10005600
1470 Ga0207689_10006499
1471 Ga0207689_10012109
1472 Ga0207661_10053214
1473 Ga0207679_10195721
1474 Ga0207679_10292533
1475 Ga0207679_10791350
1476 Ga0207679_11149693
1477 Ga0207679_11610189
1478 Ga0207667_10000713
1479 Ga0207667_10021120
1480 Ga0207667_10149672
1481 Ga0207667_10371113
1482 Ga0207667_10445163
1483 Ga0207667_10796486
1484 Ga0207651_10025812
1485 Ga0207651_10473547
1486 Ga0207712_10138938
1487 Ga0207712_10248757
1488 Ga0207712_10692948
1489 Ga0207668_10013925
1490 Ga0207668_10065897
1491 Ga0207668_10077857
1492 Ga0207668_10126805
1493 Ga0207668_10242662
1494 Ga0207640_10139100
1495 Ga0207640_10175937
1496 Ga0207640_10913614
1497 Ga0207658_10000950
1498 Ga0207658_10018569
1499 Ga0207658_10062825
1500 Ga0207658_10307829
1501 Ga0207658_10620663
1502 Ga0207658_11004439
1503 Ga0207677_10001355
1504 Ga0207677_10059727
1505 Ga0207677_10077179
1506 Ga0207677_10082668
1507 Ga0207703_10003242
1508 Ga0207703_11582479
1509 Ga0207639_10002981
1510 Ga0207639_10021089
1511 Ga0207639_10084625
1512 Ga0207639_10385571
1513 Ga0207678_10393471
1514 Ga0207678_10533790
1515 Ga0207708_10344816
1516 Ga0207702_10023587
1517 Ga0207702_10590185
1518 Ga0207641_10000186
1519 Ga0207641_10001042
1520 Ga0207641_10612278
1521 Ga0207648_10002569
1522 Ga0207648_10003727
1523 Ga0207648_10021117
1524 Ga0207648_10082235
1525 Ga0207648_10155545
1526 Ga0207676_10003530
1527 Ga0207676_10006774
1528 Ga0207676_10331854
1529 Ga0207676_10387031
1530 Ga0207674_10091158
1531 Ga0207674_10450584
1532 Ga0207674_10567347
1533 Ga0207675_100029163
1534 Ga0207675_100102912
1535 Ga0207675_100237002
1536 Ga0207675_100416070
1537 Ga0207675_100497923
1538 Ga0207675_101390187
1539 Ga0207675_101535392
1540 Ga0207683_10084346
1541 Ga0207683_10105466
1542 Ga0207683_10107208
1543 Ga0207683_10179252
1544 Ga0207698_10005151
1545 Ga0207698_10100518
1546 Ga0207698_10121929
1547 Ga0207698_10470356
1548 Ga0207698_10779772
1549 Ga0209969_1012802
1550 Ga0209984_1020807
1551 Ga0209995_1016821
1552 Ga0268266_10002778
1553 Ga0268266_10102343
1554 Ga0268265_10040332
1555 Ga0268265_10253177
1556 Ga0268264_10004017
1557 Ga0268264_10151213
1558 Ga0268264_10285048
1559 Ga0268264_11025383
1560 Ga0268264_11619709
1561 Ga0307515_10411635
1562 Ga0316177_1005071
1563 Ga0265327_10000259
1564 Ga0265327_10005302
1565 Ga0265313_10164516
1566 Ga0307516_10000675
1567 Ga0307410_11734902
1568 Ga0307407_10903775
1569 Ga0307414_10597740
1570 Ga0307414_11347483
1571 Ga0307411_10625459
1572 Ga0307415_100540055
1573 Ga0307510_10000637
1574 Ga0307510_10429466
1575 Ga0451789_1054658
1576 Ga0451793_1918688
1577 Ga0451841_0362851
1578 Ga0451843_0758176
1579 Ga0439431_0004568
1580 Ga0439445_0002131
1581 Ga0466969_0003268
1582 Ga0466972_0077116
1583 Ga0466966_0000022
1584 Ga0466971_0224568
1585 Ga0466970_0116661
1586 Ga0466957_0483166
1587 Ga0466960_0803909
1588 Ga0466959_0000055
1589 Ga0466959_0001777
1590 Ga0466967_1448438
1591 Ga0495627_001750
1592 Ga0495622_0246760
1593 Ga0495633_0000374
1594 Ga0495668_0000451
1595 Ga0495625_0383781
1596 Ga0495625_0441855
1597 Ga0496108_0390814
1598 Ga0496109_0046409
1599 Ga0496121_0000086
1600 Ga0501032_0838416
1601 Ga0501043_0814432
1602 Ga0501047_0045332
1603 Ga0501047_0117454
1604 Ga0501238_024190
1605 Ga0501238_034616
1606 Ga0501241_001671
1607 Ga0501269_001839
1608 Ga0501035_0263960
1609 Ga0501044_0077666
1610 Ga0501044_0287505
1611 Ga0501044_0845771
1612 nmdc:mga0k408_111005_c1
1613 nmdc:mga07m45_160697_c1
1614 Ga0500644_0000408
1615 Ga0500581_068798
1616 Ga0500646_0000898
1617 Ga0500651_0044106
1618 Ga0500651_0159057
1619 Ga0500557_115982
1620 Ga0500569_000033
1621 Ga0500607_037177
1622 Ga0500642_0020611
1623 Ga0500652_001057
1624 Ga0500658_0040908
1625 Ga0500559_0020212
1626 Ga0500561_0207730
1627 Ga0500577_0006911
1628 Ga0500590_013651
1629 Ga0500604_0001579
1630 Ga0500616_0001032
1631 Ga0500622_0001091
1632 Ga0500627_0008543
1633 Ga0500633_0008942
1634 Ga0500636_0085431
1635 Ga0500656_011550
1636 Ga0500661_001699
1637 Ga0466962_0106561
1638 2819574771
1639 2819676677
1640 2821140867
1641 2883070333
1642 2884796540
1643 2896086806
1644 2904471368
1645 2929177944
1646 2929240277
1647 2929922017
1648 2945980297
1649 2946013837
1650 8003155762

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

32

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odn-assembly1.cif.gz_C salinibacter ruber single-strand binding protein 0.957 1 107
2vw9-assembly1.cif.gz_B-2 single stranded dna binding protein complex from helicobacter pylori 0.9541 5 107
6bhw-assembly1.cif.gz_A b. subtilis ssba 0.946 4 109
6bhw-assembly2.cif.gz_E b. subtilis ssba 0.9433 4 107
6bhx-assembly1.cif.gz_C b. subtilis ssba with dna 0.9393 4 109
ID Description Score Start End Superfamily
2vw9B00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9453 5 108 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9349 1 107 2.40.50.140
2vw9B00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9197 5 108 2.40.50.140
3ulpC00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9187 1 108 2.40.50.140
5gqoA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9144 5 107 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7C5BEN0-F1-model_v4 Single-stranded DNA-binding protein 0.9781 5 100 GO:0003697
GO:0006260
GO:0009295
AF-A0A0G1IEC5-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9695 5 115 GO:0003697
GO:0006260
GO:0009295
AF-A0A316KG36-F1-model_v4 Single-stranded DNA-binding protein 0.9569 4 107 GO:0003697
GO:0006260
GO:0009295
AF-A0A7X6UMB0-F1-model_v4 Single-stranded DNA-binding protein 0.9559 1 105 GO:0003697
GO:0006260
GO:0009295
AF-A0A1G1Z5X2-F1-model_v4 Single-stranded DNA-binding protein 0.955 3 111 GO:0003697
GO:0006260
GO:0009295

Map