F482476

General Info

Members Datasets Scaffolds Average Seq Length
826 342 708 134

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10041014|Ga0157370_100410142
Length 151
Sequence MSRAQGFALALGNVGLVSAAQLGMRWSMTRLPLPNEWLTTTIDLSALGVVILAIIAYALSMLCWLGALKHLPLGRAYSLLSISYALVYLLAASLPVFNEHFSLSKTLGVALVILGVLVINSRRASAASPRNAPCKSVYLVVVTSVWCRPPY

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231020 Pseudomonas sp. GM74 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
15 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
16 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
17 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
18 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
19 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
20 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
21 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
22 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
23 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
24 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
25 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
26 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
27 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
28 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
29 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
30 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
31 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
32 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
33 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
34 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
35 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
36 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
37 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
38 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
39 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
40 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
41 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
42 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
43 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
44 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
45 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
46 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
47 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
48 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
49 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
50 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
51 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
52 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
53 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
54 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
55 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
56 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
57 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
58 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
59 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
60 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
61 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
62 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
63 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
64 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
65 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
66 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
67 2765235841 Pseudomonas putida AA7 Isolate Unclassified
68 2773857670 Pseudomonas sp. 478 Isolate Unclassified
69 2784132072 Pseudomonas sp. 460 Isolate Unclassified
70 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
71 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
72 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
73 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
74 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
75 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
76 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
77 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
78 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
79 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
80 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
81 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
82 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
83 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
84 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
85 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
86 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
87 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
88 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
89 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
90 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
91 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
92 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
93 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
94 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
95 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
96 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
97 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
98 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
99 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
100 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
101 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
102 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
103 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
104 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
105 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
106 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
107 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
108 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
109 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
110 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
111 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
112 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
113 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
114 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
115 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
116 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
117 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
118 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
119 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
120 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
121 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
122 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
123 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
125 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
126 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
127 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
128 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
129 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
157 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
197 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
198 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
199 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
200 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
201 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
202 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
203 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
204 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
205 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
210 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
293 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
325 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
328 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
329 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
330 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
331 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
332 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
333 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
334 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
335 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
336 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
337 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
338 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
339 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
340 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
341 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
342 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.75
Nodule 1.69
Rhizoplane 6.17
Rhizosphere 72.4
Stem 0
Stem Tuber 0
Unclassified 11.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_19 2124908027 Bacteria 54562
2 MRS2a_Contig_7067 2124908027 Bacteria 5082
3 MRS2a_Contig_7878 2124908027 Bacteria 5075
4 SwRhRL2b_contig_890698 2162886007 Bacteria 829
5 JGI25162J39368_1000004 3300002737 Bacteria 441040
6 JGI25162J39368_1000065 3300002737 Bacteria 131083
7 JGI25154J39366_1006975 3300002738 Bacteria 1589
8 JGI25163J39215_1001383 3300002771 Bacteria 4083
9 JGI25163J39215_1001387 3300002771 Bacteria 4074
10 JGI25164J39214_1000031 3300002772 Bacteria 144582
11 JGI25164J39214_1000038 3300002772 Bacteria 131082
12 JGI25165J46597_1000011 3300003214 Bacteria 441040
13 JGI25165J46597_1000126 3300003214 Bacteria 131083
14 Ga0055538_1000007 3300003751 Bacteria 399715
15 Ga0055539_1000011 3300003752 Bacteria 399747
16 Ga0055533_1000014 3300003756 Bacteria 399747
17 Ga0055532_1000009 3300003758 Bacteria 399537
18 Ga0055525_1000016 3300003759 Bacteria 399724
19 Ga0055535_1008797 3300003761 Bacteria 1787
20 Ga0055536_1000025 3300003781 Bacteria 183172
21 Ga0055530_10000007 3300003791 Bacteria 183172
22 Ga0055530_10000011 3300003791 Bacteria 170218
23 Ga0055530_10007271 3300003791 Bacteria 4701
24 Ga0055540_1000034 3300003792 Bacteria 170218
25 Ga0055540_1000125 3300003792 Bacteria 79312
26 Ga0055540_1040060 3300003792 Bacteria 1017
27 Ga0055541_1000008 3300003841 Bacteria 399724
28 Ga0065714_10002770 3300005288 Bacteria 11621
29 Ga0065714_10003988 3300005288 Bacteria 6429
30 Ga0065714_10065674 3300005288 Bacteria 8904
31 Ga0065714_10066434 3300005288 Bacteria 6862
32 Ga0065714_10069400 3300005288 Bacteria 4240
33 Ga0065714_10108947 3300005288 Bacteria 1507
34 Ga0065714_10196289 3300005288 Bacteria 910
35 Ga0065704_10083380 3300005289 Bacteria 3468
36 Ga0065704_10517504 3300005289 Bacteria 656
37 Ga0065712_10001306 3300005290 Bacteria 8630
38 Ga0065712_10137593 3300005290 Bacteria 1482
39 Ga0065715_10100435 3300005293 Bacteria 3303
40 Ga0070670_100000079 3300005331 Bacteria 92916
41 Ga0070670_100034655 3300005331 Bacteria 4344
42 Ga0070661_100000024 3300005344 Bacteria 121810
43 Ga0070669_100001022 3300005353 Bacteria 20393
44 Ga0070662_100014437 3300005457 Bacteria 5279
45 Ga0070664_100000024 3300005564 Bacteria 94521
46 Ga0068851_10000552 3300005834 Bacteria 16293
47 Ga0068858_101055102 3300005842 Bacteria 797
48 Ga0075364_10009199 3300006051 Bacteria 5919
49 Ga0075364_10073990 3300006051 Bacteria 2246
50 Ga0075364_10456868 3300006051 Bacteria 873
51 Ga0075364_10469720 3300006051 Bacteria 860
52 Ga0075432_10000898 3300006058 Bacteria 9361
53 Ga0075432_10005364 3300006058 Bacteria 4370
54 Ga0075432_10005512 3300006058 Bacteria 4311
55 Ga0075432_10074182 3300006058 Bacteria 1225
56 Ga0075432_10306845 3300006058 Bacteria 660
57 Ga0075432_10314792 3300006058 Bacteria 653
58 Ga0075362_10005910 3300006177 Bacteria 4520
59 Ga0075362_10045220 3300006177 Bacteria 1955
60 Ga0075369_10158846 3300006186 Bacteria 1036
61 Ga0075370_10117743 3300006353 Bacteria 1545
62 Ga0075436_100063133 3300006914 Bacteria 2560
63 Ga0079104_1000143 3300006946 Bacteria 101361
64 Ga0105251_10000001 3300009011 Bacteria 466643
65 Ga0105251_10000571 3300009011 Bacteria 34449
66 Ga0105251_10008065 3300009011 Bacteria 6381
67 Ga0105251_10016806 3300009011 Bacteria 3939
68 Ga0105251_10109919 3300009011 Bacteria 1256
69 Ga0105244_10000277 3300009036 Bacteria 51399
70 Ga0105244_10000325 3300009036 Bacteria 45650
71 Ga0105244_10000907 3300009036 Bacteria 25017
72 Ga0105244_10006752 3300009036 Bacteria 7379
73 Ga0105244_10017693 3300009036 Bacteria 4021
74 Ga0105244_10026854 3300009036 Bacteria 3111
75 Ga0105244_10240971 3300009036 Bacteria 845
76 Ga0105244_10264095 3300009036 Bacteria 801
77 Ga0105244_10449563 3300009036 Bacteria 593
78 Ga0105244_10493238 3300009036 Bacteria 564
79 Ga0105250_10000015 3300009092 Bacteria 262683
80 Ga0105250_10001563 3300009092 Bacteria 12305
81 Ga0105250_10075282 3300009092 Bacteria 1366
82 Ga0105250_10268791 3300009092 Bacteria 732
83 Ga0105243_12155478 3300009148 Bacteria 594
84 Ga0105242_10080569 3300009176 Bacteria 2721
85 Ga0105237_10000042 3300009545 Bacteria 181280
86 Ga0105246_10000010 3300011119 Bacteria 69400
87 Ga0105246_10002448 3300011119 Bacteria 11207
88 Ga0157373_10001643 3300013100 Bacteria 17075
89 Ga0157373_10003868 3300013100 Bacteria 11315
90 Ga0157373_10005100 3300013100 Bacteria 9873
91 Ga0157373_10027029 3300013100 Bacteria 4140
92 Ga0157373_10030727 3300013100 Bacteria 3865
93 Ga0157373_10066447 3300013100 Bacteria 2551
94 Ga0157373_10352249 3300013100 Bacteria 1050
95 Ga0157373_10618456 3300013100 Bacteria 789
96 Ga0157371_10000635 3300013102 Bacteria 41753
97 Ga0157371_10022147 3300013102 Bacteria 4660
98 Ga0157371_10262662 3300013102 Bacteria 1245
99 Ga0157371_10285893 3300013102 Bacteria 1192
100 Ga0157371_10497241 3300013102 Bacteria 900
101 Ga0157371_10575990 3300013102 Bacteria 836
102 Ga0157371_11493099 3300013102 Bacteria 527
103 Ga0157370_10002554 3300013104 Bacteria 21839
104 Ga0157370_10016221 3300013104 Bacteria 7550
105 Ga0157370_10041014 3300013104 Bacteria 4468
106 Ga0157370_10114465 3300013104 Bacteria 2520
107 Ga0157370_10150643 3300013104 Bacteria 2164
108 Ga0157370_10196168 3300013104 Bacteria 1874
109 Ga0157370_10407324 3300013104 Bacteria 1251
110 Ga0157370_10801589 3300013104 Bacteria 857
111 Ga0157369_10005158 3300013105 Bacteria 15288
112 Ga0157369_10019056 3300013105 Bacteria 7683
113 Ga0157369_10094355 3300013105 Bacteria 3194
114 Ga0157369_11050136 3300013105 Bacteria 833
115 Ga0157369_11513568 3300013105 Bacteria 683
116 Ga0163162_10224161 3300013306 Bacteria 2009
117 Ga0163162_10424035 3300013306 Bacteria 1462
118 Ga0163162_10655497 3300013306 Bacteria 1173
119 Ga0163162_11136405 3300013306 Bacteria 885
120 Ga0157375_10001060 3300013308 Bacteria 23747
121 Ga0157375_10092698 3300013308 Bacteria 3085
122 Ga0157375_10283094 3300013308 Bacteria 1821
123 Ga0182008_10001212 3300014497 Bacteria 17765
124 Ga0182008_10002733 3300014497 Bacteria 10938
125 Ga0182008_10011025 3300014497 Bacteria 4820
126 Ga0182008_10016275 3300014497 Bacteria 3866
127 Ga0182008_10018977 3300014497 Bacteria 3555
128 Ga0182008_10021821 3300014497 Bacteria 3287
129 Ga0182008_10052590 3300014497 Bacteria 2018
130 Ga0182008_10202757 3300014497 Bacteria 1010
131 Ga0182006_1000165 3300015261 Bacteria 70092
132 Ga0182006_1000387 3300015261 Bacteria 36363
133 Ga0182006_1007913 3300015261 Bacteria 4837
134 Ga0182006_1018211 3300015261 Bacteria 2971
135 Ga0182006_1099077 3300015261 Bacteria 1037
136 Ga0182007_10000108 3300015262 Bacteria 57807
137 Ga0182007_10009387 3300015262 Bacteria 3948
138 Ga0182007_10090163 3300015262 Bacteria 1010
139 Ga0182005_1000470 3300015265 Bacteria 20931
140 Ga0182005_1011787 3300015265 Bacteria 2483
141 Ga0182005_1021678 3300015265 Bacteria 1761
142 Ga0182005_1029623 3300015265 Bacteria 1493
143 Ga0182005_1058769 3300015265 Bacteria 1049
144 Ga0182005_1060455 3300015265 Bacteria 1035
145 Ga0163161_10003345 3300017792 Bacteria 11243
146 Ga0163161_10004392 3300017792 Bacteria 9833
147 Ga0163161_10009162 3300017792 Bacteria 6841
148 Ga0163161_10023843 3300017792 Bacteria 4318
149 Ga0163161_10029906 3300017792 Bacteria 3873
150 Ga0163161_10053825 3300017792 Bacteria 2919
151 Ga0163161_10060568 3300017792 Bacteria 2755
152 Ga0163161_10071678 3300017792 Bacteria 2536
153 Ga0163161_10156455 3300017792 Bacteria 1735
154 Ga0163161_10291822 3300017792 Bacteria 1282
155 Ga0163161_10374442 3300017792 Bacteria 1137
156 Ga0163161_10564822 3300017792 Bacteria 934
157 Ga0209435_100687 3300025206 Bacteria 5899
158 Ga0209760_100032 3300025207 Bacteria 138015
159 Ga0209760_100036 3300025207 Bacteria 130845
160 Ga0209784_100023 3300025224 Bacteria 399841
161 Ga0209566_100019 3300025225 Bacteria 414836
162 Ga0209674_100034 3300025226 Bacteria 414903
163 Ga0209147_100027 3300025229 Bacteria 414610
164 Ga0209563_100037 3300025230 Bacteria 414903
165 Ga0207427_100003 3300025231 Bacteria 1035004
166 Ga0207427_100004 3300025231 Bacteria 939600
167 Ga0209437_100002 3300025233 Bacteria 1574801
168 Ga0209437_100025 3300025233 Bacteria 561333
169 Ga0209437_103072 3300025233 Bacteria 3081
170 Ga0209258_100166 3300025242 Bacteria 148022
171 Ga0209646_1000318 3300025246 Bacteria 37146
172 Ga0209677_100021 3300025253 Bacteria 414954
173 Ga0209759_1007773 3300025256 Bacteria 3411
174 Ga0209233_1000004 3300025261 Bacteria 1574798
175 Ga0209233_1000145 3300025261 Bacteria 188955
176 Ga0209676_1000003 3300025292 Bacteria 1454178
177 Ga0209676_1002106 3300025292 Bacteria 15320
178 Ga0209050_1000004 3300025298 Bacteria 1600040
179 Ga0209050_1000013 3300025298 Bacteria 811408
180 Ga0209050_1000763 3300025298 Bacteria 46213
181 Ga0209051_1000006 3300025303 Bacteria 1015785
182 Ga0209051_1000007 3300025303 Bacteria 811408
183 Ga0209051_1017675 3300025303 Bacteria 3180
184 Ga0209257_1009178 3300025304 Bacteria 5376
185 Ga0207656_10000769 3300025321 Bacteria 10514
186 Ga0207696_1000017 3300025711 Bacteria 491130
187 Ga0207696_1000460 3300025711 Bacteria 35536
188 Ga0207655_1000074 3300025728 Bacteria 232056
189 Ga0207655_1000410 3300025728 Bacteria 59117
190 Ga0207655_1009171 3300025728 Bacteria 6180
191 Ga0207655_1018078 3300025728 Bacteria 3762
192 Ga0207655_1047192 3300025728 Bacteria 1779
193 Ga0207655_1061384 3300025728 Bacteria 1451
194 Ga0207655_1124106 3300025728 Bacteria 851
195 Ga0207713_1000061 3300025735 Bacteria 209289
196 Ga0207713_1000117 3300025735 Bacteria 129339
197 Ga0207713_1000284 3300025735 Bacteria 58743
198 Ga0207713_1006155 3300025735 Bacteria 7368
199 Ga0207713_1008243 3300025735 Bacteria 6027
200 Ga0207713_1029046 3300025735 Bacteria 2484
201 Ga0207713_1094190 3300025735 Bacteria 1046
202 Ga0207671_10000474 3300025914 Bacteria 54456
203 Ga0207649_10000010 3300025920 Bacteria 284354
204 Ga0207681_10003542 3300025923 Bacteria 9722
205 Ga0207650_10000690 3300025925 Bacteria 26485
206 Ga0207650_10023505 3300025925 Bacteria 4372
207 Ga0207706_10002181 3300025933 Bacteria 19100
208 Ga0207686_10011018 3300025934 Bacteria 4936
209 Ga0207709_10004919 3300025935 Bacteria 7646
210 Ga0207679_10000022 3300025945 Bacteria 219036
211 Ga0207679_10182801 3300025945 Bacteria 1736
212 Ga0209281_1000063 3300027111 Bacteria 288465
213 Ga0207428_10017939 3300027907 Bacteria 6063
214 Ga0207428_10032595 3300027907 Bacteria 4284
215 Ga0207428_10051676 3300027907 Bacteria 3285
216 Ga0207428_10074309 3300027907 Bacteria 2666
217 Ga0207428_10098177 3300027907 Bacteria 2267
218 Ga0207428_10130110 3300027907 Bacteria 1927
219 Ga0207428_10516150 3300027907 Bacteria 867
220 Ga0307517_10427713 3300028786 Bacteria 692
221 Ga0265316_10553042 3300031344 Bacteria 819
222 Ga0307405_10018233 3300031731 Bacteria 3869
223 Ga0439438_023936 3300041405 Bacteria 1677
224 Ga0439447_001977 3300041407 Bacteria 7525
225 Ga0439447_006315 3300041407 Bacteria 3857
226 Ga0439466_0000260 3300041411 Bacteria 20653
227 Ga0439466_0001711 3300041411 Bacteria 8565
228 Ga0439466_0062572 3300041411 Bacteria 1196
229 Ga0451837_1739632 3300041494 Bacteria 542
230 Ga0439432_000085 3300042006 Bacteria 29181
231 Ga0439432_006726 3300042006 Bacteria 4094
232 Ga0439451_015915 3300042009 Bacteria 1516
233 Ga0439452_026371 3300042010 Bacteria 1466
234 Ga0439456_009698 3300042013 Bacteria 1988
235 Ga0439456_063144 3300042013 Bacteria 815
236 Ga0439463_000349 3300042016 Bacteria 12926
237 Ga0439463_011950 3300042016 Bacteria 2132
238 Ga0450911_000584 3300042115 Bacteria 11256
239 Ga0450919_004410 3300042121 Bacteria 1723
240 Ga0450890_002758 3300042127 Bacteria 2385
241 Ga0450902_012555 3300042137 Bacteria 1356
242 Ga0450903_002866 3300042138 Bacteria 3014
243 Ga0450903_018249 3300042138 Bacteria 1093
244 Ga0450905_003732 3300042142 Bacteria 2006
245 Ga0450906_006792 3300042145 Bacteria 2291
246 Ga0450907_001532 3300042146 Bacteria 4938
247 Ga0450907_004987 3300042146 Bacteria 2256
248 Ga0439446_0006783 3300042156 Bacteria 2997
249 Ga0450908_003608 3300042184 Bacteria 3011
250 Ga0450909_000642 3300042185 Bacteria 4617
251 Ga0439460_0151566 3300042461 Bacteria 773
252 Ga0450918_025674 3300042531 Bacteria 1033
253 Ga0451577_0023447 3300042876 Bacteria 5629
254 Ga0439440_0013309 3300042993 Bacteria 1761
255 Ga0439440_0028450 3300042993 Bacteria 1305
256 Ga0495617_000148 3300046452 Bacteria 44939
257 Ga0495617_001573 3300046452 Bacteria 9860
258 Ga0495617_007522 3300046452 Bacteria 3777
259 Ga0495617_029655 3300046452 Bacteria 1839
260 Ga0495617_041805 3300046452 Bacteria 1531
261 Ga0495617_117922 3300046452 Bacteria 856
262 Ga0495627_001436 3300046453 Bacteria 13990
263 Ga0495627_002236 3300046453 Bacteria 9589
264 Ga0495627_019540 3300046453 Bacteria 2270
265 Ga0495627_026303 3300046453 Bacteria 1877
266 Ga0495627_036370 3300046453 Bacteria 1531
267 Ga0495603_0004031 3300046455 Bacteria 8745
268 Ga0495603_0051857 3300046455 Bacteria 2436
269 Ga0495603_0101506 3300046455 Bacteria 1679
270 Ga0495603_0337025 3300046455 Bacteria 865
271 Ga0495590_0000177 3300046457 Bacteria 37380
272 Ga0495590_0001583 3300046457 Bacteria 9745
273 Ga0495590_0001764 3300046457 Bacteria 9179
274 Ga0495590_0014179 3300046457 Bacteria 2914
275 Ga0495590_0111277 3300046457 Bacteria 977
276 Ga0495591_000172 3300046458 Bacteria 67392
277 Ga0495591_001420 3300046458 Bacteria 14941
278 Ga0495591_009526 3300046458 Bacteria 3847
279 Ga0495591_016068 3300046458 Bacteria 2621
280 Ga0495591_016545 3300046458 Bacteria 2563
281 Ga0495591_039110 3300046458 Bacteria 1361
282 Ga0495591_048832 3300046458 Bacteria 1165
283 Ga0495629_0031034 3300046459 Bacteria 3785
284 Ga0495629_0403113 3300046459 Bacteria 929
285 Ga0495638_0006987 3300046460 Bacteria 8149
286 Ga0495638_0021055 3300046460 Bacteria 4301
287 Ga0495638_0035019 3300046460 Bacteria 3201
288 Ga0495638_0056127 3300046460 Bacteria 2444
289 Ga0495638_0197295 3300046460 Bacteria 1138
290 Ga0495653_0004505 3300046463 Bacteria 11249
291 Ga0495653_0019284 3300046463 Bacteria 5531
292 Ga0495653_0223232 3300046463 Bacteria 1265
293 Ga0495650_0004343 3300046471 Bacteria 9772
294 Ga0495650_0007351 3300046471 Bacteria 6636
295 Ga0495650_0009484 3300046471 Bacteria 5527
296 Ga0495650_0015582 3300046471 Bacteria 3892
297 Ga0495650_0058708 3300046471 Bacteria 1552
298 Ga0495582_0002904 3300046473 Bacteria 9580
299 Ga0495605_0000054 3300046474 Bacteria 157560
300 Ga0495605_0000778 3300046474 Bacteria 22880
301 Ga0495605_0000840 3300046474 Bacteria 21512
302 Ga0495605_0004101 3300046474 Bacteria 8596
303 Ga0495605_0009605 3300046474 Bacteria 5433
304 Ga0495605_0010382 3300046474 Bacteria 5213
305 Ga0495605_0025277 3300046474 Bacteria 3096
306 Ga0495605_0029562 3300046474 Bacteria 2818
307 Ga0495605_0078472 3300046474 Bacteria 1547
308 Ga0495605_0406241 3300046474 Bacteria 566
309 Ga0495639_0000053 3300046475 Bacteria 50537
310 Ga0495639_0028192 3300046475 Bacteria 2488
311 Ga0495639_0031856 3300046475 Bacteria 2349
312 Ga0495584_0000120 3300046491 Bacteria 54113
313 Ga0495584_0000715 3300046491 Bacteria 21886
314 Ga0495584_0002413 3300046491 Bacteria 10621
315 Ga0495584_0008390 3300046491 Bacteria 5351
316 Ga0495584_0036184 3300046491 Bacteria 2494
317 Ga0495584_0046528 3300046491 Bacteria 2188
318 Ga0495584_0053842 3300046491 Bacteria 2025
319 Ga0495584_0094159 3300046491 Bacteria 1512
320 Ga0495584_0229537 3300046491 Bacteria 943
321 Ga0495584_0587959 3300046491 Bacteria 567
322 Ga0495585_0010533 3300046492 Bacteria 5500
323 Ga0495585_0010605 3300046492 Bacteria 5477
324 Ga0495585_0090687 3300046492 Bacteria 1646
325 Ga0495585_0144035 3300046492 Bacteria 1246
326 Ga0495585_0173625 3300046492 Bacteria 1111
327 Ga0495594_0005932 3300046499 Bacteria 6279
328 Ga0495594_0020571 3300046499 Bacteria 3515
329 Ga0495594_0020880 3300046499 Bacteria 3492
330 Ga0495594_0097227 3300046499 Bacteria 1654
331 Ga0495607_0000036 3300046501 Bacteria 140259
332 Ga0495607_0000041 3300046501 Bacteria 132443
333 Ga0495607_0006048 3300046501 Bacteria 8568
334 Ga0495607_0007191 3300046501 Bacteria 7732
335 Ga0495607_0015516 3300046501 Bacteria 4935
336 Ga0495607_0019764 3300046501 Bacteria 4272
337 Ga0495607_0052365 3300046501 Bacteria 2364
338 Ga0495607_0063314 3300046501 Bacteria 2093
339 Ga0495583_0000865 3300046506 Bacteria 36805
340 Ga0495583_0005112 3300046506 Bacteria 9038
341 Ga0495583_0016921 3300046506 Bacteria 3894
342 Ga0495583_0017034 3300046506 Bacteria 3873
343 Ga0495583_0037940 3300046506 Bacteria 2280
344 Ga0495606_0000079 3300046507 Bacteria 164788
345 Ga0495606_0008267 3300046507 Bacteria 9081
346 Ga0495606_0016943 3300046507 Bacteria 5530
347 Ga0495606_0025524 3300046507 Bacteria 4229
348 Ga0495606_0026227 3300046507 Bacteria 4155
349 Ga0495606_0050167 3300046507 Bacteria 2731
350 Ga0495606_0243170 3300046507 Bacteria 1002
351 Ga0495610_0000455 3300046512 Bacteria 42440
352 Ga0495610_0005087 3300046512 Bacteria 9475
353 Ga0495610_0016320 3300046512 Bacteria 4282
354 Ga0495610_0057020 3300046512 Bacteria 1875
355 Ga0495610_0059192 3300046512 Bacteria 1829
356 Ga0495616_0000535 3300046513 Bacteria 28683
357 Ga0495616_0000695 3300046513 Bacteria 24905
358 Ga0495616_0016806 3300046513 Bacteria 4043
359 Ga0495616_0042849 3300046513 Bacteria 2301
360 Ga0495616_0126617 3300046513 Bacteria 1174
361 Ga0495616_0287572 3300046513 Bacteria 697
362 Ga0495620_0000014 3300046515 Bacteria 157890
363 Ga0495620_0000152 3300046515 Bacteria 56303
364 Ga0495620_0011843 3300046515 Bacteria 4534
365 Ga0495620_0028707 3300046515 Bacteria 2583
366 Ga0495620_0028889 3300046515 Bacteria 2572
367 Ga0495628_0427484 3300046516 Bacteria 964
368 Ga0495630_0009776 3300046517 Bacteria 6903
369 Ga0495630_0016625 3300046517 Bacteria 5380
370 Ga0495630_0064602 3300046517 Bacteria 2750
371 Ga0495631_0000175 3300046518 Bacteria 43711
372 Ga0495631_0009829 3300046518 Bacteria 4761
373 Ga0495631_0031749 3300046518 Bacteria 2385
374 Ga0495631_0050061 3300046518 Bacteria 1828
375 Ga0495631_0400780 3300046518 Bacteria 584
376 Ga0495632_0003232 3300046519 Bacteria 11690
377 Ga0495632_0006774 3300046519 Bacteria 7316
378 Ga0495632_0035959 3300046519 Bacteria 2522
379 Ga0495632_0081263 3300046519 Bacteria 1545
380 Ga0495637_0000950 3300046520 Bacteria 18520
381 Ga0495637_0001455 3300046520 Bacteria 13939
382 Ga0495637_0011047 3300046520 Bacteria 4349
383 Ga0495637_0032013 3300046520 Bacteria 2320
384 Ga0495637_0040208 3300046520 Bacteria 2014
385 Ga0495637_0040671 3300046520 Bacteria 2000
386 Ga0495637_0068382 3300046520 Bacteria 1439
387 Ga0495643_0035792 3300046522 Bacteria 2731
388 Ga0495643_0125262 3300046522 Bacteria 1294
389 Ga0495644_0031488 3300046523 Bacteria 2004
390 Ga0495644_0047237 3300046523 Bacteria 1617
391 Ga0495644_0088142 3300046523 Bacteria 1170
392 Ga0495644_0113182 3300046523 Bacteria 1030
393 Ga0495648_0000062 3300046524 Bacteria 150125
394 Ga0495648_0002500 3300046524 Bacteria 16867
395 Ga0495648_0026624 3300046524 Bacteria 3890
396 Ga0495648_0032415 3300046524 Bacteria 3428
397 Ga0495648_0044373 3300046524 Bacteria 2776
398 Ga0495648_0070184 3300046524 Bacteria 2036
399 Ga0495648_0077012 3300046524 Bacteria 1913
400 Ga0495648_0087463 3300046524 Bacteria 1754
401 Ga0495648_0108944 3300046524 Bacteria 1511
402 Ga0495648_0176561 3300046524 Bacteria 1090
403 Ga0495648_0193410 3300046524 Bacteria 1024
404 Ga0495666_0001595 3300046526 Bacteria 11162
405 Ga0495666_0016517 3300046526 Bacteria 3677
406 Ga0495666_0097056 3300046526 Bacteria 1389
407 Ga0495642_0000006 3300046528 Bacteria 172412
408 Ga0495642_0000044 3300046528 Bacteria 74850
409 Ga0495642_0001263 3300046528 Bacteria 11491
410 Ga0495652_0286483 3300046529 Bacteria 1204
411 Ga0495654_0000113 3300046530 Bacteria 91858
412 Ga0495654_0000600 3300046530 Bacteria 28665
413 Ga0495654_0013073 3300046530 Bacteria 4446
414 Ga0495654_0017811 3300046530 Bacteria 3728
415 Ga0495654_0027907 3300046530 Bacteria 2889
416 Ga0495654_0035081 3300046530 Bacteria 2528
417 Ga0495654_0038948 3300046530 Bacteria 2374
418 Ga0495654_0053823 3300046530 Bacteria 1954
419 Ga0495654_0109267 3300046530 Bacteria 1263
420 Ga0495654_0216285 3300046530 Bacteria 812
421 Ga0495654_0244260 3300046530 Bacteria 750
422 Ga0495586_0011723 3300046535 Bacteria 4662
423 Ga0495587_0003803 3300046536 Bacteria 10014
424 Ga0495587_0007630 3300046536 Bacteria 7001
425 Ga0495609_0001936 3300046538 Bacteria 13176
426 Ga0495609_0013575 3300046538 Bacteria 3845
427 Ga0495609_0097613 3300046538 Bacteria 1274
428 Ga0495609_0106617 3300046538 Bacteria 1211
429 Ga0495609_0331038 3300046538 Bacteria 616
430 Ga0495597_0000800 3300046542 Bacteria 24862
431 Ga0495597_0004988 3300046542 Bacteria 7125
432 Ga0495597_0016614 3300046542 Bacteria 3474
433 Ga0495597_0037997 3300046542 Bacteria 2159
434 Ga0495597_0085319 3300046542 Bacteria 1345
435 Ga0495597_0102766 3300046542 Bacteria 1203
436 Ga0495597_0374678 3300046542 Bacteria 544
437 Ga0495645_0118658 3300046543 Bacteria 1864
438 Ga0495645_0248746 3300046543 Bacteria 1182
439 Ga0495622_0002204 3300046557 Bacteria 9500
440 Ga0495622_0012172 3300046557 Bacteria 3979
441 Ga0495622_0041663 3300046557 Bacteria 2135
442 Ga0495622_0046353 3300046557 Bacteria 2019
443 Ga0495622_0069296 3300046557 Bacteria 1628
444 Ga0495622_0108867 3300046557 Bacteria 1269
445 Ga0495622_0141881 3300046557 Bacteria 1090
446 Ga0495633_0009087 3300046558 Bacteria 5523
447 Ga0495633_0022226 3300046558 Bacteria 3161
448 Ga0495656_0000803 3300046615 Bacteria 10182
449 Ga0495656_0011867 3300046615 Bacteria 3204
450 Ga0495656_0060624 3300046615 Bacteria 1649
451 Ga0495668_0007019 3300046616 Bacteria 7270
452 Ga0495668_0013998 3300046616 Bacteria 4716
453 Ga0495668_0247363 3300046616 Bacteria 976
454 Ga0495634_0000815 3300046642 Bacteria 30341
455 Ga0495611_0001208 3300046648 Bacteria 13357
456 Ga0495611_0067058 3300046648 Bacteria 1637
457 Ga0495611_0083051 3300046648 Bacteria 1475
458 Ga0495611_0236798 3300046648 Bacteria 847
459 Ga0495625_0029114 3300046660 Bacteria 4134
460 Ga0495625_0030599 3300046660 Bacteria 4014
461 Ga0495625_0033795 3300046660 Bacteria 3777
462 Ga0495625_0061955 3300046660 Bacteria 2645
463 Ga0495625_0107071 3300046660 Bacteria 1913
464 Ga0495625_0129009 3300046660 Bacteria 1714
465 Ga0495625_0141502 3300046660 Bacteria 1622
466 Ga0495625_0298326 3300046660 Bacteria 1032
467 Ga0495635_0000522 3300046663 Bacteria 24345
468 Ga0495635_0005853 3300046663 Bacteria 8567
469 Ga0495659_0000119 3300046664 Bacteria 34751
470 Ga0495659_0034500 3300046664 Bacteria 1779
471 Ga0495659_0091690 3300046664 Bacteria 1167
472 Ga0495661_0000051 3300046665 Bacteria 140353
473 Ga0495661_0000269 3300046665 Bacteria 59794
474 Ga0495661_0005186 3300046665 Bacteria 9285
475 Ga0495661_0025282 3300046665 Bacteria 3836
476 Ga0495661_0028776 3300046665 Bacteria 3552
477 Ga0495661_0048908 3300046665 Bacteria 2567
478 Ga0495661_0137184 3300046665 Bacteria 1334
479 Ga0495661_0190175 3300046665 Bacteria 1081
480 Ga0495661_0353665 3300046665 Bacteria 723
481 Ga0495588_0046530 3300046674 Bacteria 2225
482 Ga0495588_0055238 3300046674 Bacteria 2049
483 Ga0495588_0095680 3300046674 Bacteria 1557
484 Ga0495588_0129943 3300046674 Bacteria 1328
485 Ga0495588_0150563 3300046674 Bacteria 1230
486 Ga0495623_0009066 3300046679 Bacteria 6453
487 Ga0495646_0003353 3300046680 Bacteria 9960
488 Ga0495646_0003495 3300046680 Bacteria 9782
489 Ga0495669_0001087 3300046684 Bacteria 11253
490 Ga0495669_0006622 3300046684 Bacteria 4847
491 Ga0495613_0020085 3300046689 Bacteria 4977
492 Ga0495613_0136940 3300046689 Bacteria 1751
493 Ga0495613_0698840 3300046689 Bacteria 668
494 Ga0495670_0007044 3300046691 Bacteria 5535
495 Ga0495670_0012161 3300046691 Bacteria 4233
496 Ga0495670_0063344 3300046691 Bacteria 1861
497 Ga0495670_0088900 3300046691 Bacteria 1579
498 Ga0495670_0238853 3300046691 Bacteria 967
499 Ga0495670_0370016 3300046691 Bacteria 772
500 Ga0495671_0000210 3300046692 Bacteria 51181
501 Ga0495671_0001187 3300046692 Bacteria 17825
502 Ga0495671_0017328 3300046692 Bacteria 3835
503 Ga0495671_0023620 3300046692 Bacteria 3211
504 Ga0495671_0043243 3300046692 Bacteria 2261
505 Ga0495671_0043410 3300046692 Bacteria 2256
506 Ga0495671_0063638 3300046692 Bacteria 1816
507 Ga0495671_0123183 3300046692 Bacteria 1264
508 Ga0495671_0157659 3300046692 Bacteria 1104
509 Ga0495671_0373375 3300046692 Bacteria 683
510 Ga0495649_0000748 3300046694 Bacteria 26199
511 Ga0495649_0002964 3300046694 Bacteria 11692
512 Ga0495649_0005325 3300046694 Bacteria 8208
513 Ga0495649_0009159 3300046694 Bacteria 5903
514 Ga0495649_0012051 3300046694 Bacteria 5046
515 Ga0495649_0369863 3300046694 Bacteria 722
516 Ga0495589_0000326 3300046794 Bacteria 37321
517 Ga0495589_0001450 3300046794 Bacteria 13691
518 Ga0495589_0012195 3300046794 Bacteria 4457
519 Ga0495589_0014155 3300046794 Bacteria 4111
520 Ga0495589_0017546 3300046794 Bacteria 3672
521 Ga0495589_0038437 3300046794 Bacteria 2395
522 Ga0495600_0006261 3300046809 Bacteria 7227
523 Ga0495660_0017436 3300046810 Bacteria 4134
524 Ga0495660_0030407 3300046810 Bacteria 3042
525 Ga0495660_0043831 3300046810 Bacteria 2464
526 Ga0495660_0053342 3300046810 Bacteria 2195
527 Ga0495660_0059680 3300046810 Bacteria 2050
528 Ga0495660_0159625 3300046810 Bacteria 1107
529 Ga0495581_0008518 3300047315 Bacteria 5945
530 Ga0495604_0045394 3300047317 Bacteria 3429
531 Ga0495604_0221960 3300047317 Bacteria 1300
532 Ga0495636_0092741 3300047318 Bacteria 1312
533 Ga0495636_0093220 3300047318 Bacteria 1309
534 Ga0495674_0009374 3300047319 Bacteria 9306
535 Ga0495672_0000817 3300047320 Bacteria 33454
536 Ga0495672_0001555 3300047320 Bacteria 22465
537 Ga0495672_0002413 3300047320 Bacteria 17233
538 Ga0495672_0025473 3300047320 Bacteria 3785
539 Ga0495672_0035456 3300047320 Bacteria 3072
540 Ga0495672_0038366 3300047320 Bacteria 2922
541 Ga0495672_0055685 3300047320 Bacteria 2306
542 Ga0495672_0124329 3300047320 Bacteria 1366
543 Ga0495672_0304553 3300047320 Bacteria 753
544 Ga0495676_0001439 3300047321 Bacteria 20535
545 Ga0495680_0002029 3300047322 Bacteria 21206
546 Ga0495680_0027810 3300047322 Bacteria 4640
547 Ga0495680_0034253 3300047322 Bacteria 4104
548 Ga0495683_0000318 3300047323 Bacteria 40455
549 Ga0495683_0000356 3300047323 Bacteria 37720
550 Ga0495683_0029299 3300047323 Bacteria 2813
551 Ga0495683_0040036 3300047323 Bacteria 2368
552 Ga0495683_0082635 3300047323 Bacteria 1564
553 Ga0495687_000977 3300047443 Bacteria 28996
554 Ga0495687_006152 3300047443 Bacteria 7435
555 Ga0495687_007971 3300047443 Bacteria 6145
556 Ga0495687_014259 3300047443 Bacteria 4098
557 Ga0495675_0009385 3300047444 Bacteria 6086
558 Ga0495675_0023304 3300047444 Bacteria 3944
559 Ga0495677_0000848 3300047445 Bacteria 12364
560 Ga0495677_0258370 3300047445 Bacteria 682
561 Ga0495679_000137 3300047446 Bacteria 65769
562 Ga0495679_010574 3300047446 Bacteria 3615
563 Ga0495679_010914 3300047446 Bacteria 3538
564 Ga0495679_015261 3300047446 Bacteria 2815
565 Ga0495685_034244 3300047447 Bacteria 1745
566 Ga0495685_047041 3300047447 Bacteria 1467
567 Ga0495673_0000465 3300047469 Bacteria 43951
568 Ga0495673_0001451 3300047469 Bacteria 18852
569 Ga0495673_0005021 3300047469 Bacteria 8115
570 Ga0495673_0010214 3300047469 Bacteria 5122
571 Ga0495673_0011327 3300047469 Bacteria 4804
572 Ga0495673_0020111 3300047469 Bacteria 3329
573 Ga0495673_0024412 3300047469 Bacteria 2922
574 Ga0495673_0031442 3300047469 Bacteria 2485
575 Ga0495673_0038574 3300047469 Bacteria 2172
576 Ga0495673_0039389 3300047469 Bacteria 2144
577 Ga0495673_0061453 3300047469 Bacteria 1608
578 Ga0495681_0001797 3300047470 Bacteria 15790
579 Ga0495681_0002364 3300047470 Bacteria 13536
580 Ga0495681_0003644 3300047470 Bacteria 10695
581 Ga0495681_0005548 3300047470 Bacteria 8428
582 Ga0495681_0011741 3300047470 Bacteria 5190
583 Ga0495681_0014600 3300047470 Bacteria 4490
584 Ga0495681_0036270 3300047470 Bacteria 2440
585 Ga0495681_0052163 3300047470 Bacteria 1920
586 Ga0495686_0324568 3300047472 Bacteria 843
587 Ga0495686_0485753 3300047472 Bacteria 652
588 Ga0495593_0017983 3300047673 Bacteria 3976
589 Ga0495593_0058767 3300047673 Bacteria 2016
590 Ga0495593_0083383 3300047673 Bacteria 1651
591 Ga0495614_0390669 3300048089 Bacteria 652
592 Ga0495615_0036994 3300048090 Bacteria 1200
593 Ga0495626_0000064 3300048091 Bacteria 142060
594 Ga0495626_0000616 3300048091 Bacteria 34739
595 Ga0495626_0000958 3300048091 Bacteria 25047
596 Ga0495626_0018101 3300048091 Bacteria 3545
597 Ga0495626_0050643 3300048091 Bacteria 1918
598 Ga0495626_0073492 3300048091 Bacteria 1531
599 Ga0495626_0123318 3300048091 Bacteria 1111
600 Ga0496102_0000774 3300048905 Bacteria 31153
601 Ga0496102_0190549 3300048905 Bacteria 1932
602 Ga0496102_0424208 3300048905 Bacteria 1249
603 Ga0496102_0809598 3300048905 Bacteria 859
604 Ga0496103_0020077 3300048906 Bacteria 4012
605 Ga0496104_0693498 3300048907 Bacteria 926
606 Ga0496105_0402110 3300048908 Bacteria 1087
607 Ga0496106_0090601 3300048909 Bacteria 2360
608 Ga0496106_0222792 3300048909 Bacteria 1505
609 Ga0496110_0013875 3300048913 Bacteria 6676
610 Ga0496110_0223792 3300048913 Bacteria 1711
611 Ga0496110_0268410 3300048913 Bacteria 1553
612 Ga0496110_0578910 3300048913 Bacteria 1019
613 Ga0496111_0041086 3300048914 Bacteria 3318
614 Ga0496111_0182712 3300048914 Bacteria 1559
615 Ga0496112_0119275 3300048915 Bacteria 2608
616 Ga0496112_0243115 3300048915 Bacteria 1752
617 Ga0496113_0141233 3300048916 Bacteria 1895
618 Ga0496113_1118158 3300048916 Bacteria 617
619 Ga0496114_0448898 3300048917 Bacteria 1142
620 Ga0496116_0008609 3300048919 Bacteria 8828
621 Ga0496116_0025816 3300048919 Bacteria 4309
622 Ga0496117_0007085 3300048920 Bacteria 11081
623 Ga0496117_0030407 3300048920 Bacteria 4145
624 Ga0496117_0037708 3300048920 Bacteria 3596
625 Ga0496117_0038309 3300048920 Bacteria 3558
626 Ga0496117_0068244 3300048920 Bacteria 2401
627 Ga0496117_0122716 3300048920 Bacteria 1592
628 Ga0496118_0028878 3300048921 Bacteria 4662
629 Ga0496118_0031937 3300048921 Bacteria 4349
630 Ga0496118_0034082 3300048921 Bacteria 4163
631 Ga0496118_0042318 3300048921 Bacteria 3595
632 Ga0496118_0083049 3300048921 Bacteria 2241
633 Ga0496118_0271101 3300048921 Bacteria 951
634 Ga0496119_0140968 3300048922 Bacteria 1302
635 Ga0496119_0438441 3300048922 Bacteria 617
636 Ga0496119_0514450 3300048922 Bacteria 555
637 Ga0496120_0025586 3300048923 Bacteria 3661
638 Ga0496120_0067238 3300048923 Bacteria 1980
639 Ga0496120_0334758 3300048923 Bacteria 684
640 Ga0496121_0001708 3300048924 Bacteria 35986
641 Ga0496121_0001828 3300048924 Bacteria 34313
642 Ga0496121_0004020 3300048924 Bacteria 20222
643 Ga0496121_0036966 3300048924 Bacteria 4343
644 Ga0496121_0143931 3300048924 Bacteria 1764
645 Ga0496122_0000411 3300048925 Bacteria 90936
646 Ga0496122_0025179 3300048925 Bacteria 5178
647 Ga0496122_0032954 3300048925 Bacteria 4270
648 Ga0496122_0049865 3300048925 Bacteria 3198
649 Ga0496122_0052939 3300048925 Bacteria 3065
650 Ga0496122_0091935 3300048925 Bacteria 2064
651 Ga0496123_0000055 3300048926 Bacteria 233626
652 Ga0496123_0003979 3300048926 Bacteria 16005
653 Ga0496123_0024051 3300048926 Bacteria 4643
654 Ga0496123_0025966 3300048926 Bacteria 4401
655 Ga0496123_0031880 3300048926 Bacteria 3826
656 Ga0496123_0079871 3300048926 Bacteria 1996
657 Ga0496123_0082097 3300048926 Bacteria 1955
658 Ga0496123_0090478 3300048926 Bacteria 1819
659 Ga0496124_0001124 3300048927 Bacteria 42065
660 Ga0496124_0004348 3300048927 Bacteria 16595
661 Ga0496124_0007542 3300048927 Bacteria 11542
662 Ga0496124_0045697 3300048927 Bacteria 3753
663 Ga0496124_0147850 3300048927 Bacteria 1847
664 Ga0496124_0184645 3300048927 Bacteria 1601
665 Ga0496124_0223350 3300048927 Bacteria 1414
666 Ga0496125_0004187 3300048928 Bacteria 16817
667 Ga0496125_0022673 3300048928 Bacteria 5823
668 Ga0496125_0039387 3300048928 Bacteria 4071
669 Ga0496125_0060557 3300048928 Bacteria 3041
670 Ga0496125_0071065 3300048928 Bacteria 2721
671 Ga0496125_0072714 3300048928 Bacteria 2677
672 Ga0496125_0072984 3300048928 Bacteria 2671
673 Ga0496125_0080206 3300048928 Bacteria 2498
674 Ga0496125_0134381 3300048928 Bacteria 1733
675 Ga0496125_0634198 3300048928 Bacteria 578
676 Ga0496126_0044914 3300048929 Bacteria 4065
677 Ga0496126_0063125 3300048929 Bacteria 3321
678 Ga0496126_0226085 3300048929 Bacteria 1569
679 Ga0496126_0359912 3300048929 Bacteria 1189
680 Ga0496126_0408520 3300048929 Bacteria 1100
681 Ga0495678_000578 3300049459 Bacteria 34746
682 Ga0495678_004245 3300049459 Bacteria 8392
683 Ga0495678_011644 3300049459 Bacteria 4202
684 Ga0495678_013459 3300049459 Bacteria 3839
685 Ga0495678_168185 3300049459 Bacteria 695
686 Ga0495682_0000025 3300049460 Bacteria 147931
687 Ga0495682_0006579 3300049460 Bacteria 4697
688 Ga0495682_0007925 3300049460 Bacteria 4203
689 Ga0495682_0028070 3300049460 Bacteria 2086
690 Ga0495682_0048600 3300049460 Bacteria 1546
691 Ga0495682_0065560 3300049460 Bacteria 1309
692 Ga0495682_0075362 3300049460 Bacteria 1213
693 Ga0495682_0123154 3300049460 Bacteria 928
694 Ga0495682_0125573 3300049460 Bacteria 918
695 Ga0501031_0491400 3300049568 Bacteria 792
696 Ga0501033_0207297 3300049570 Bacteria 1399
697 Ga0501034_0355992 3300049571 Bacteria 1391
698 Ga0501035_0381926 3300049822 Bacteria 1175
699 nmdc:mga03683_12119_c1 3300050489 Bacteria 3140
700 nmdc:mga03683_45902_c1 3300050489 Bacteria 1809
701 nmdc:mga03683_7051_c1 3300050489 Bacteria 3498
702 nmdc:mga00v17_124811_c1 3300050491 Bacteria 1642
703 nmdc:mga00v17_55303_c1 3300050491 Bacteria 2424
704 nmdc:mga00v17_83857_c1 3300050491 Bacteria 1994
705 nmdc:mga08x19_185693_c1 3300050514 Bacteria 1421
706 Ga0500618_005847 3300053125 Bacteria 3683
707 Ga0500573_0029972 3300053140 Bacteria 3137
708 Ga0500634_0031016 3300053161 Bacteria 2913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10022147 Ga0157371_100221475 108
2 3300014497 Ga0182008_10001212 Ga0182008_100012125 108
3 3300025935 Ga0207709_10004919 Ga0207709_100049195 108
4 3300048919 Ga0496116_0025816 Ga0496116_0025816_3330_3743 108
5 3300048920 Ga0496117_0030407 Ga0496117_0030407_3172_3585 108
6 3300048921 Ga0496118_0031937 Ga0496118_0031937_3365_3778 108
7 3300048924 Ga0496121_0036966 Ga0496121_0036966_3355_3768 108
8 3300048925 Ga0496122_0032954 Ga0496122_0032954_3359_3772 108
9 3300048926 Ga0496123_0025966 Ga0496123_0025966_3365_3778 108
10 3300048928 Ga0496125_0634198 Ga0496125_0634198_68_481 108
11 3300048929 Ga0496126_0408520 Ga0496126_0408520_519_932 108
12 3300046524 Ga0495648_0193410 Ga0495648_0193410_16_360 110
13 3300047470 Ga0495681_0011741 Ga0495681_0011741_4819_5166 110
14 3300013104 Ga0157370_10801589 Ga0157370_108015892 113
15 3300046453 Ga0495627_001436 Ga0495627_001436_12967_13380 115
16 3300046458 Ga0495591_001420 Ga0495591_001420_12939_13352 115
17 3300046501 Ga0495607_0015516 Ga0495607_0015516_345_758 115
18 3300046519 Ga0495632_0035959 Ga0495632_0035959_1353_1766 115
19 3300046665 Ga0495661_0000269 Ga0495661_0000269_3441_3854 115
20 iso_pu_bacteria 2599185307 2599970027 118
21 3300048920 Ga0496117_0007085 Ga0496117_0007085_7327_7740 119
22 3300031344 Ga0265316_10553042 Ga0265316_105530422 122
23 3300009036 Ga0105244_10000277 Ga0105244_1000027735 123
24 3300041494 Ga0451837_1739632 Ga0451837_1739632_46_480 123
25 3300046507 Ga0495606_0000079 Ga0495606_0000079_82720_83115 123
26 3300046538 Ga0495609_0106617 Ga0495609_0106617_229_600 123
27 3300046616 Ga0495668_0013998 Ga0495668_0013998_653_1048 123
28 3300047469 Ga0495673_0031442 Ga0495673_0031442_927_1322 123
29 3300048905 Ga0496102_0190549 Ga0496102_0190549_914_1309 123
30 3300048921 Ga0496118_0271101 Ga0496118_0271101_15_410 123
31 3300048922 Ga0496119_0438441 Ga0496119_0438441_218_589 123
32 3300048924 Ga0496121_0004020 Ga0496121_0004020_18409_18804 123
33 3300048927 Ga0496124_0147850 Ga0496124_0147850_752_1156 123
34 3300048920 Ga0496117_0068244 Ga0496117_0068244_733_1134 125
35 3300046455 Ga0495603_0004031 Ga0495603_0004031_1842_2225 127
36 3300046474 Ga0495605_0029562 Ga0495605_0029562_2088_2471 127
37 2124908027 MRS2a_Contig_7878 MRS2a_00723840 128
38 3300009011 Ga0105251_10000571 Ga0105251_1000057120 129
39 3300009092 Ga0105250_10001563 Ga0105250_100015638 129
40 3300009092 Ga0105250_10075282 Ga0105250_100752823 129
41 3300025711 Ga0207696_1000460 Ga0207696_100046010 129
42 3300025735 Ga0207713_1000061 Ga0207713_100006110 129
43 3300046455 Ga0495603_0337025 Ga0495603_0337025_341_742 129
44 3300046463 Ga0495653_0004505 Ga0495653_0004505_7579_7980 129
45 3300046474 Ga0495605_0406241 Ga0495605_0406241_102_503 129
46 3300046492 Ga0495585_0010533 Ga0495585_0010533_2332_2733 129
47 3300046501 Ga0495607_0019764 Ga0495607_0019764_3214_3615 129
48 3300046507 Ga0495606_0016943 Ga0495606_0016943_1645_2046 129
49 3300046513 Ga0495616_0287572 Ga0495616_0287572_284_685 129
50 3300046520 Ga0495637_0040671 Ga0495637_0040671_704_1105 129
51 3300046520 Ga0495637_0068382 Ga0495637_0068382_673_1074 129
52 3300046665 Ga0495661_0000051 Ga0495661_0000051_88788_89189 129
53 3300046665 Ga0495661_0137184 Ga0495661_0137184_231_632 129
54 3300046692 Ga0495671_0123183 Ga0495671_0123183_172_573 129
55 3300046694 Ga0495649_0005325 Ga0495649_0005325_3421_3822 129
56 3300047321 Ga0495676_0001439 Ga0495676_0001439_207_608 129
57 3300047323 Ga0495683_0000318 Ga0495683_0000318_29321_29722 129
58 3300049459 Ga0495678_013459 Ga0495678_013459_3325_3726 129
59 3300053125 Ga0500618_005847 Ga0500618_005847_686_1087 129
60 iso_pu_bacteria 2511231004 2511255181 129
61 iso_pu_bacteria 2511231006 2511265493 129
62 iso_pu_bacteria 2511231007 2511271809 129
63 iso_pu_bacteria 2511231008 2511277936 129
64 iso_pu_bacteria 2511231012 2511301531 129
65 iso_pu_bacteria 2511231014 2511312485 129
66 iso_pu_bacteria 2511231015 2511321309 129
67 iso_pu_bacteria 2511231016 2511329405 129
68 iso_pu_bacteria 2511231017 2511334573 129
69 iso_pu_bacteria 2511231020 2511351796 129
70 iso_pu_bacteria 2511231022 2511363440 129
71 iso_pu_bacteria 2554235132 2554813759 129
72 iso_pu_bacteria 2554235341 2555670020 129
73 iso_pu_bacteria 2582580891 2583792406 129
74 iso_pu_bacteria 2597489887 2597858094 129
75 iso_pu_bacteria 2597489888 2597863934 129
76 iso_pu_bacteria 2597489889 2597869833 129
77 iso_pu_bacteria 2599185155 2599328695 129
78 iso_pu_bacteria 2599185160 2599352944 129
79 iso_pu_bacteria 2599185161 2599359296 129
80 iso_pu_bacteria 2599185162 2599365183 129
81 iso_pu_bacteria 2599185163 2599371990 129
82 iso_pu_bacteria 2599185164 2599378052 129
83 iso_pu_bacteria 2599185165 2599384571 129
84 iso_pu_bacteria 2599185166 2599390848 129
85 iso_pu_bacteria 2599185167 2599398331 129
86 iso_pu_bacteria 2599185168 2599403033 129
87 iso_pu_bacteria 2599185179 2599450353 129
88 iso_pu_bacteria 2599185181 2599459778 129
89 iso_pu_bacteria 2599185182 2599465876 129
90 iso_pu_bacteria 2599185185 2599485120 129
91 iso_pu_bacteria 2599185186 2599488799 129
92 iso_pu_bacteria 2599185189 2599507373 129
93 iso_pu_bacteria 2599185190 2599512835 129
94 iso_pu_bacteria 2599185191 2599522141 129
95 iso_pu_bacteria 2599185257 2599802732 129
96 iso_pu_bacteria 2599185288 2599881329 129
97 iso_pu_bacteria 2599185290 2599891512 129
98 iso_pu_bacteria 2599185303 2599946651 129
99 iso_pu_bacteria 2599185356 2600212385 129
100 iso_pu_bacteria 2600254931 2600363051 129
101 iso_pu_bacteria 2600255296 2601691875 129
102 iso_pu_bacteria 2600255313 2601772553 129
103 iso_pu_bacteria 2606217733 2608381085 129
104 iso_pu_bacteria 2619619299 2621299894 129
105 iso_pu_bacteria 2623620446 2624492217 129
106 iso_pu_bacteria 2643221571 2643874218 129
107 iso_pu_bacteria 2643221589 2643956785 129
108 iso_pu_bacteria 2643221602 2644024708 129
109 iso_pu_bacteria 2643221633 2644189892 129
110 iso_pu_bacteria 2643221713 2644620204 129
111 iso_pu_bacteria 2667528171 2671095472 129
112 iso_pu_bacteria 2671180172 2671769647 129
113 iso_pu_bacteria 2675903420 2677896549 129
114 iso_pu_bacteria 2721755607 2723248722 129
115 iso_pu_bacteria 2738541265 2738669891 129
116 iso_pu_bacteria 2738541282 2738748284 129
117 iso_pu_bacteria 2738541294 2738806846 129
118 iso_pu_bacteria 2738541303 2738857326 129
119 iso_pu_bacteria 2738541309 2738894206 129
120 iso_pu_bacteria 2738543004 2739197522 129
121 iso_pu_bacteria 2738543015 2739258761 129
122 iso_pu_bacteria 2740892503 2743737582 129
123 iso_pu_bacteria 2765235841 2765584023 129
124 iso_pu_bacteria 2773857670 2774122515 129
125 iso_pu_bacteria 2784132072 2784314652 129
126 iso_pu_bacteria 2808606377 2808929137 129
127 iso_pu_bacteria 2808606381 2808951258 129
128 iso_pu_bacteria 2808606382 2808958515 129
129 iso_pu_bacteria 2808606385 2808979107 129
130 iso_pu_bacteria 2808606388 2808995010 129
131 iso_pu_bacteria 2816332298 2817491187 129
132 iso_pu_bacteria 2818991464 2819701051 129
133 iso_pu_bacteria 2834028612 2834034026 129
134 iso_pu_bacteria 2842826826 2842826943 129
135 iso_pu_bacteria 2842837860 2842839286 129
136 iso_pu_bacteria 2844665904 2844670647 129
137 iso_pu_bacteria 2852612431 2852614449 129
138 iso_pu_bacteria 2852667396 2852667813 129
139 iso_pu_bacteria 2860339153 2860342761 129
140 iso_pu_bacteria 2860867994 2860870618 129
141 iso_pu_bacteria 2904550169 2904552454 129
142 iso_pu_bacteria 2908446538 2908449747 129
143 iso_pu_bacteria 2917070673 2917073843 129
144 iso_pu_bacteria 2919456309 2919460666 129
145 iso_pu_bacteria 2919697872 2919698403 129
146 iso_pu_bacteria 2923153595 2923156624 129
147 iso_pu_bacteria 2929189879 2929192613 129
148 iso_pu_bacteria 2931390751 2931394001 129
149 iso_pu_bacteria 2931396565 2931401700 129
150 iso_pu_bacteria 2935353572 2935357102 129
151 iso_pu_bacteria 2945928738 2945933467 129
152 iso_pu_bacteria 2945961074 2945963425 129
153 iso_pu_bacteria 2946006987 2946009778 129
154 iso_pu_bacteria 2946027586 2946030933 129
155 iso_pu_bacteria 2947233263 2947237746 129
156 iso_pu_bacteria 2984286254 2984289457 129
157 iso_pu_bacteria 2988728565 2988728915 129
158 iso_pu_bacteria 3007395558 3007396006 129
159 iso_pu_bacteria 3007511990 3007514405 129
160 iso_pu_bacteria 3007619802 3007620254 129
161 iso_pu_bacteria 637000220 637320388 129
162 iso_pu_bacteria 8015687852 8015690811 129
163 iso_pu_bacteria 8019769354 8019773207 129
164 iso_pu_bacteria 8019775933 8019779168 129
165 iso_pu_bacteria 8054285046 8054286655 129
166 iso_pu_bacteria 8054347763 8054352280 129
167 iso_pu_bacteria 8054503363 8054506367 129
168 iso_pu_bacteria 8054929484 8054932684 129
169 iso_pu_bacteria 8055770955 8055773951 129
170 iso_pu_bacteria 8055817908 8055821116 129
171 iso_pu_bacteria 8056131705 8056134799 129
172 iso_pu_bacteria 8056148874 8056154768 129
173 iso_pu_bacteria 8056155041 8056158792 129
174 iso_pu_bacteria 8056161164 8056166071 129
175 iso_pu_bacteria 8056172158 8056174279 129
176 iso_pu_bacteria 8057798959 8057800532 129
177 3300042876 Ga0451577_0023447 Ga0451577_0023447_1880_2293 130
178 3300013100 Ga0157373_10003868 Ga0157373_100038689 132
179 3300046474 Ga0495605_0004101 Ga0495605_0004101_1087_1530 132
180 3300046507 Ga0495606_0026227 Ga0495606_0026227_682_1125 132
181 3300046524 Ga0495648_0000062 Ga0495648_0000062_39512_39922 132
182 3300046543 Ga0495645_0248746 Ga0495645_0248746_612_1046 132
183 2124908027 MRS2a_Contig_19 MRS2a_00089390 133
184 2124908027 MRS2a_Contig_7067 MRS2a_00529720 133
185 2162886007 SwRhRL2b_contig_890698 SwRhRL2b_0775.00007380 133
186 3300002737 JGI25162J39368_1000004 JGI25162J39368_100000482 133
187 3300002737 JGI25162J39368_1000065 JGI25162J39368_100006558 133
188 3300002738 JGI25154J39366_1006975 JGI25154J39366_10069752 133
189 3300002771 JGI25163J39215_1001383 JGI25163J39215_10013832 133
190 3300002771 JGI25163J39215_1001387 JGI25163J39215_10013872 133
191 3300002772 JGI25164J39214_1000031 JGI25164J39214_100003183 133
192 3300002772 JGI25164J39214_1000038 JGI25164J39214_100003872 133
193 3300003214 JGI25165J46597_1000011 JGI25165J46597_100001182 133
194 3300003214 JGI25165J46597_1000126 JGI25165J46597_100012672 133
195 3300003751 Ga0055538_1000007 Ga0055538_1000007159 133
196 3300003752 Ga0055539_1000011 Ga0055539_1000011159 133
197 3300003756 Ga0055533_1000014 Ga0055533_1000014159 133
198 3300003758 Ga0055532_1000009 Ga0055532_1000009159 133
199 3300003759 Ga0055525_1000016 Ga0055525_1000016159 133
200 3300003761 Ga0055535_1008797 Ga0055535_10087972 133
201 3300003781 Ga0055536_1000025 Ga0055536_1000025139 133
202 3300003791 Ga0055530_10000007 Ga0055530_10000007139 133
203 3300003791 Ga0055530_10000011 Ga0055530_1000001185 133
204 3300003791 Ga0055530_10007271 Ga0055530_100072713 133
205 3300003792 Ga0055540_1000034 Ga0055540_100003485 133
206 3300003792 Ga0055540_1000125 Ga0055540_100012520 133
207 3300003792 Ga0055540_1040060 Ga0055540_10400602 133
208 3300003841 Ga0055541_1000008 Ga0055541_1000008159 133
209 3300005288 Ga0065714_10002770 Ga0065714_100027705 133
210 3300005288 Ga0065714_10003988 Ga0065714_100039884 133
211 3300005288 Ga0065714_10065674 Ga0065714_100656748 133
212 3300005288 Ga0065714_10066434 Ga0065714_100664344 133
213 3300005288 Ga0065714_10069400 Ga0065714_100694004 133
214 3300005288 Ga0065714_10108947 Ga0065714_101089473 133
215 3300005288 Ga0065714_10196289 Ga0065714_101962892 133
216 3300005289 Ga0065704_10083380 Ga0065704_100833804 133
217 3300005289 Ga0065704_10517504 Ga0065704_105175042 133
218 3300005290 Ga0065712_10001306 Ga0065712_100013067 133
219 3300005290 Ga0065712_10137593 Ga0065712_101375932 133
220 3300005293 Ga0065715_10100435 Ga0065715_101004352 133
221 3300005331 Ga0070670_100000079 Ga0070670_10000007964 133
222 3300005331 Ga0070670_100034655 Ga0070670_1000346554 133
223 3300005344 Ga0070661_100000024 Ga0070661_10000002460 133
224 3300005353 Ga0070669_100001022 Ga0070669_10000102220 133
225 3300005457 Ga0070662_100014437 Ga0070662_1000144373 133
226 3300005564 Ga0070664_100000024 Ga0070664_10000002454 133
227 3300005834 Ga0068851_10000552 Ga0068851_100005526 133
228 3300005842 Ga0068858_101055102 Ga0068858_1010551022 133
229 3300006051 Ga0075364_10009199 Ga0075364_100091993 133
230 3300006051 Ga0075364_10073990 Ga0075364_100739903 133
231 3300006051 Ga0075364_10456868 Ga0075364_104568682 133
232 3300006051 Ga0075364_10469720 Ga0075364_104697202 133
233 3300006058 Ga0075432_10000898 Ga0075432_100008986 133
234 3300006058 Ga0075432_10005364 Ga0075432_100053642 133
235 3300006058 Ga0075432_10005512 Ga0075432_100055124 133
236 3300006058 Ga0075432_10074182 Ga0075432_100741822 133
237 3300006058 Ga0075432_10306845 Ga0075432_103068452 133
238 3300006058 Ga0075432_10314792 Ga0075432_103147922 133
239 3300006177 Ga0075362_10005910 Ga0075362_100059105 133
240 3300006177 Ga0075362_10045220 Ga0075362_100452203 133
241 3300006186 Ga0075369_10158846 Ga0075369_101588462 133
242 3300006353 Ga0075370_10117743 Ga0075370_101177433 133
243 3300006914 Ga0075436_100063133 Ga0075436_1000631332 133
244 3300006946 Ga0079104_1000143 Ga0079104_100014316 133
245 3300009011 Ga0105251_10000001 Ga0105251_10000001319 133
246 3300009011 Ga0105251_10008065 Ga0105251_100080655 133
247 3300009011 Ga0105251_10016806 Ga0105251_100168065 133
248 3300009011 Ga0105251_10109919 Ga0105251_101099192 133
249 3300009036 Ga0105244_10000325 Ga0105244_1000032533 133
250 3300009036 Ga0105244_10000907 Ga0105244_1000090715 133
251 3300009036 Ga0105244_10006752 Ga0105244_100067523 133
252 3300009036 Ga0105244_10017693 Ga0105244_100176933 133
253 3300009036 Ga0105244_10026854 Ga0105244_100268544 133
254 3300009036 Ga0105244_10240971 Ga0105244_102409712 133
255 3300009036 Ga0105244_10264095 Ga0105244_102640952 133
256 3300009036 Ga0105244_10449563 Ga0105244_104495632 133
257 3300009036 Ga0105244_10493238 Ga0105244_104932382 133
258 3300009092 Ga0105250_10000015 Ga0105250_10000015199 133
259 3300009092 Ga0105250_10268791 Ga0105250_102687911 133
260 3300009148 Ga0105243_12155478 Ga0105243_121554782 133
261 3300009176 Ga0105242_10080569 Ga0105242_100805693 133
262 3300009545 Ga0105237_10000042 Ga0105237_10000042121 133
263 3300011119 Ga0105246_10000010 Ga0105246_1000001010 133
264 3300011119 Ga0105246_10002448 Ga0105246_1000244810 133
265 3300013100 Ga0157373_10001643 Ga0157373_100016433 133
266 3300013100 Ga0157373_10005100 Ga0157373_100051004 133
267 3300013100 Ga0157373_10027029 Ga0157373_100270294 133
268 3300013100 Ga0157373_10030727 Ga0157373_100307272 133
269 3300013100 Ga0157373_10066447 Ga0157373_100664471 133
270 3300013100 Ga0157373_10352249 Ga0157373_103522492 133
271 3300013100 Ga0157373_10618456 Ga0157373_106184562 133
272 3300013102 Ga0157371_10000635 Ga0157371_100006356 133
273 3300013102 Ga0157371_10262662 Ga0157371_102626621 133
274 3300013102 Ga0157371_10285893 Ga0157371_102858932 133
275 3300013102 Ga0157371_10497241 Ga0157371_104972412 133
276 3300013102 Ga0157371_10575990 Ga0157371_105759902 133
277 3300013102 Ga0157371_11493099 Ga0157371_114930992 133
278 3300013104 Ga0157370_10002554 Ga0157370_1000255418 133
279 3300013104 Ga0157370_10016221 Ga0157370_100162217 133
280 3300013104 Ga0157370_10041014 Ga0157370_100410142 133
281 3300013104 Ga0157370_10114465 Ga0157370_101144652 133
282 3300013104 Ga0157370_10150643 Ga0157370_101506432 133
283 3300013104 Ga0157370_10196168 Ga0157370_101961682 133
284 3300013104 Ga0157370_10407324 Ga0157370_104073243 133
285 3300013105 Ga0157369_10005158 Ga0157369_1000515814 133
286 3300013105 Ga0157369_10019056 Ga0157369_100190565 133
287 3300013105 Ga0157369_10094355 Ga0157369_100943554 133
288 3300013105 Ga0157369_11050136 Ga0157369_110501362 133
289 3300013105 Ga0157369_11513568 Ga0157369_115135682 133
290 3300013306 Ga0163162_10224161 Ga0163162_102241613 133
291 3300013306 Ga0163162_10424035 Ga0163162_104240353 133
292 3300013306 Ga0163162_10655497 Ga0163162_106554972 133
293 3300013306 Ga0163162_11136405 Ga0163162_111364052 133
294 3300013308 Ga0157375_10001060 Ga0157375_1000106018 133
295 3300013308 Ga0157375_10092698 Ga0157375_100926984 133
296 3300013308 Ga0157375_10283094 Ga0157375_102830942 133
297 3300014497 Ga0182008_10002733 Ga0182008_100027338 133
298 3300014497 Ga0182008_10011025 Ga0182008_100110253 133
299 3300014497 Ga0182008_10016275 Ga0182008_100162755 133
300 3300014497 Ga0182008_10018977 Ga0182008_100189773 133
301 3300014497 Ga0182008_10021821 Ga0182008_100218214 133
302 3300014497 Ga0182008_10052590 Ga0182008_100525902 133
303 3300014497 Ga0182008_10202757 Ga0182008_102027571 133
304 3300015261 Ga0182006_1000165 Ga0182006_100016555 133
305 3300015261 Ga0182006_1000387 Ga0182006_10003877 133
306 3300015261 Ga0182006_1007913 Ga0182006_10079132 133
307 3300015261 Ga0182006_1018211 Ga0182006_10182113 133
308 3300015261 Ga0182006_1099077 Ga0182006_10990772 133
309 3300015262 Ga0182007_10000108 Ga0182007_1000010842 133
310 3300015262 Ga0182007_10009387 Ga0182007_100093871 133
311 3300015262 Ga0182007_10090163 Ga0182007_100901631 133
312 3300015265 Ga0182005_1000470 Ga0182005_100047015 133
313 3300015265 Ga0182005_1011787 Ga0182005_10117872 133
314 3300015265 Ga0182005_1021678 Ga0182005_10216783 133
315 3300015265 Ga0182005_1029623 Ga0182005_10296232 133
316 3300015265 Ga0182005_1058769 Ga0182005_10587691 133
317 3300015265 Ga0182005_1060455 Ga0182005_10604552 133
318 3300017792 Ga0163161_10003345 Ga0163161_100033457 133
319 3300017792 Ga0163161_10004392 Ga0163161_100043927 133
320 3300017792 Ga0163161_10009162 Ga0163161_100091625 133
321 3300017792 Ga0163161_10023843 Ga0163161_100238435 133
322 3300017792 Ga0163161_10029906 Ga0163161_100299065 133
323 3300017792 Ga0163161_10053825 Ga0163161_100538251 133
324 3300017792 Ga0163161_10060568 Ga0163161_100605682 133
325 3300017792 Ga0163161_10071678 Ga0163161_100716783 133
326 3300017792 Ga0163161_10156455 Ga0163161_101564552 133
327 3300017792 Ga0163161_10291822 Ga0163161_102918222 133
328 3300017792 Ga0163161_10374442 Ga0163161_103744422 133
329 3300017792 Ga0163161_10564822 Ga0163161_105648222 133
330 3300025206 Ga0209435_100687 Ga0209435_1006872 133
331 3300025207 Ga0209760_100032 Ga0209760_10003254 133
332 3300025207 Ga0209760_100036 Ga0209760_10003668 133
333 3300025224 Ga0209784_100023 Ga0209784_100023157 133
334 3300025225 Ga0209566_100019 Ga0209566_100019170 133
335 3300025226 Ga0209674_100034 Ga0209674_100034170 133
336 3300025229 Ga0209147_100027 Ga0209147_100027172 133
337 3300025230 Ga0209563_100037 Ga0209563_100037170 133
338 3300025231 Ga0207427_100003 Ga0207427_10000382 133
339 3300025231 Ga0207427_100004 Ga0207427_10000496 133
340 3300025233 Ga0209437_100002 Ga0209437_100002931 133
341 3300025233 Ga0209437_100025 Ga0209437_100025387 133
342 3300025233 Ga0209437_103072 Ga0209437_1030723 133
343 3300025242 Ga0209258_100166 Ga0209258_1001663 133
344 3300025246 Ga0209646_1000318 Ga0209646_100031827 133
345 3300025253 Ga0209677_100021 Ga0209677_100021170 133
346 3300025256 Ga0209759_1007773 Ga0209759_10077733 133
347 3300025261 Ga0209233_1000004 Ga0209233_1000004494 133
348 3300025261 Ga0209233_1000145 Ga0209233_100014596 133
349 3300025292 Ga0209676_1000003 Ga0209676_1000003678 133
350 3300025292 Ga0209676_1002106 Ga0209676_10021064 133
351 3300025298 Ga0209050_1000004 Ga0209050_1000004660 133
352 3300025298 Ga0209050_1000013 Ga0209050_1000013307 133
353 3300025298 Ga0209050_1000763 Ga0209050_10007633 133
354 3300025303 Ga0209051_1000006 Ga0209051_1000006315 133
355 3300025303 Ga0209051_1000007 Ga0209051_1000007307 133
356 3300025303 Ga0209051_1017675 Ga0209051_10176752 133
357 3300025304 Ga0209257_1009178 Ga0209257_10091785 133
358 3300025321 Ga0207656_10000769 Ga0207656_100007693 133
359 3300025711 Ga0207696_1000017 Ga0207696_1000017160 133
360 3300025728 Ga0207655_1000074 Ga0207655_100007436 133
361 3300025728 Ga0207655_1000410 Ga0207655_100041033 133
362 3300025728 Ga0207655_1009171 Ga0207655_10091716 133
363 3300025728 Ga0207655_1018078 Ga0207655_10180783 133
364 3300025728 Ga0207655_1047192 Ga0207655_10471922 133
365 3300025728 Ga0207655_1061384 Ga0207655_10613842 133
366 3300025728 Ga0207655_1124106 Ga0207655_11241062 133
367 3300025735 Ga0207713_1000117 Ga0207713_10001173 133
368 3300025735 Ga0207713_1000284 Ga0207713_100028445 133
369 3300025735 Ga0207713_1006155 Ga0207713_10061555 133
370 3300025735 Ga0207713_1008243 Ga0207713_10082435 133
371 3300025735 Ga0207713_1029046 Ga0207713_10290462 133
372 3300025735 Ga0207713_1094190 Ga0207713_10941902 133
373 3300025914 Ga0207671_10000474 Ga0207671_1000047441 133
374 3300025920 Ga0207649_10000010 Ga0207649_10000010224 133
375 3300025923 Ga0207681_10003542 Ga0207681_100035424 133
376 3300025925 Ga0207650_10000690 Ga0207650_1000069012 133
377 3300025925 Ga0207650_10023505 Ga0207650_100235053 133
378 3300025933 Ga0207706_10002181 Ga0207706_1000218117 133
379 3300025934 Ga0207686_10011018 Ga0207686_100110182 133
380 3300025945 Ga0207679_10000022 Ga0207679_10000022140 133
381 3300025945 Ga0207679_10182801 Ga0207679_101828012 133
382 3300027111 Ga0209281_1000063 Ga0209281_1000063225 133
383 3300027907 Ga0207428_10017939 Ga0207428_100179394 133
384 3300027907 Ga0207428_10032595 Ga0207428_100325953 133
385 3300027907 Ga0207428_10051676 Ga0207428_100516763 133
386 3300027907 Ga0207428_10074309 Ga0207428_100743093 133
387 3300027907 Ga0207428_10098177 Ga0207428_100981771 133
388 3300027907 Ga0207428_10130110 Ga0207428_101301102 133
389 3300027907 Ga0207428_10516150 Ga0207428_105161501 133
390 3300028786 Ga0307517_10427713 Ga0307517_104277132 133
391 3300031731 Ga0307405_10018233 Ga0307405_100182332 133
392 3300041405 Ga0439438_023936 Ga0439438_023936_830_1243 133
393 3300041407 Ga0439447_001977 Ga0439447_001977_3722_4123 133
394 3300041407 Ga0439447_006315 Ga0439447_006315_1661_2074 133
395 3300041411 Ga0439466_0000260 Ga0439466_0000260_2057_2470 133
396 3300041411 Ga0439466_0001711 Ga0439466_0001711_2601_3014 133
397 3300041411 Ga0439466_0062572 Ga0439466_0062572_272_673 133
398 3300042006 Ga0439432_000085 Ga0439432_000085_25281_25682 133
399 3300042006 Ga0439432_006726 Ga0439432_006726_1783_2196 133
400 3300042009 Ga0439451_015915 Ga0439451_015915_311_724 133
401 3300042010 Ga0439452_026371 Ga0439452_026371_110_523 133
402 3300042013 Ga0439456_009698 Ga0439456_009698_1367_1780 133
403 3300042013 Ga0439456_063144 Ga0439456_063144_209_622 133
404 3300042016 Ga0439463_000349 Ga0439463_000349_9917_10330 133
405 3300042016 Ga0439463_011950 Ga0439463_011950_17_430 133
406 3300042115 Ga0450911_000584 Ga0450911_000584_1698_2111 133
407 3300042121 Ga0450919_004410 Ga0450919_004410_671_1084 133
408 3300042127 Ga0450890_002758 Ga0450890_002758_376_789 133
409 3300042137 Ga0450902_012555 Ga0450902_012555_305_706 133
410 3300042138 Ga0450903_002866 Ga0450903_002866_875_1288 133
411 3300042138 Ga0450903_018249 Ga0450903_018249_405_806 133
412 3300042142 Ga0450905_003732 Ga0450905_003732_1035_1436 133
413 3300042145 Ga0450906_006792 Ga0450906_006792_1067_1480 133
414 3300042146 Ga0450907_001532 Ga0450907_001532_1905_2318 133
415 3300042146 Ga0450907_004987 Ga0450907_004987_416_817 133
416 3300042156 Ga0439446_0006783 Ga0439446_0006783_697_1110 133
417 3300042184 Ga0450908_003608 Ga0450908_003608_783_1196 133
418 3300042185 Ga0450909_000642 Ga0450909_000642_1367_1780 133
419 3300042461 Ga0439460_0151566 Ga0439460_0151566_81_494 133
420 3300042531 Ga0450918_025674 Ga0450918_025674_412_825 133
421 3300042993 Ga0439440_0013309 Ga0439440_0013309_938_1351 133
422 3300042993 Ga0439440_0028450 Ga0439440_0028450_876_1289 133
423 3300046452 Ga0495617_000148 Ga0495617_000148_38047_38460 133
424 3300046452 Ga0495617_001573 Ga0495617_001573_5474_5875 133
425 3300046452 Ga0495617_007522 Ga0495617_007522_2672_3073 133
426 3300046452 Ga0495617_029655 Ga0495617_029655_101_502 133
427 3300046452 Ga0495617_041805 Ga0495617_041805_522_923 133
428 3300046452 Ga0495617_117922 Ga0495617_117922_309_722 133
429 3300046453 Ga0495627_002236 Ga0495627_002236_8264_8680 133
430 3300046453 Ga0495627_019540 Ga0495627_019540_624_1049 133
431 3300046453 Ga0495627_026303 Ga0495627_026303_751_1152 133
432 3300046453 Ga0495627_036370 Ga0495627_036370_1095_1496 133
433 3300046455 Ga0495603_0051857 Ga0495603_0051857_1848_2249 133
434 3300046455 Ga0495603_0101506 Ga0495603_0101506_530_931 133
435 3300046457 Ga0495590_0000177 Ga0495590_0000177_24171_24572 133
436 3300046457 Ga0495590_0001583 Ga0495590_0001583_1158_1571 133
437 3300046457 Ga0495590_0001764 Ga0495590_0001764_6855_7268 133
438 3300046457 Ga0495590_0014179 Ga0495590_0014179_632_1033 133
439 3300046457 Ga0495590_0111277 Ga0495590_0111277_515_916 133
440 3300046458 Ga0495591_000172 Ga0495591_000172_20279_20704 133
441 3300046458 Ga0495591_009526 Ga0495591_009526_611_1012 133
442 3300046458 Ga0495591_016068 Ga0495591_016068_1570_1971 133
443 3300046458 Ga0495591_016545 Ga0495591_016545_656_1057 133
444 3300046458 Ga0495591_039110 Ga0495591_039110_319_720 133
445 3300046458 Ga0495591_048832 Ga0495591_048832_754_1155 133
446 3300046459 Ga0495629_0031034 Ga0495629_0031034_2736_3137 133
447 3300046459 Ga0495629_0403113 Ga0495629_0403113_426_827 133
448 3300046460 Ga0495638_0006987 Ga0495638_0006987_2719_3120 133
449 3300046460 Ga0495638_0021055 Ga0495638_0021055_26_427 133
450 3300046460 Ga0495638_0035019 Ga0495638_0035019_874_1275 133
451 3300046460 Ga0495638_0056127 Ga0495638_0056127_1653_2066 133
452 3300046460 Ga0495638_0197295 Ga0495638_0197295_531_944 133
453 3300046463 Ga0495653_0019284 Ga0495653_0019284_2823_3224 133
454 3300046463 Ga0495653_0223232 Ga0495653_0223232_404_805 133
455 3300046471 Ga0495650_0004343 Ga0495650_0004343_3177_3590 133
456 3300046471 Ga0495650_0007351 Ga0495650_0007351_1319_1732 133
457 3300046471 Ga0495650_0009484 Ga0495650_0009484_4388_4789 133
458 3300046471 Ga0495650_0015582 Ga0495650_0015582_2903_3304 133
459 3300046471 Ga0495650_0058708 Ga0495650_0058708_453_854 133
460 3300046473 Ga0495582_0002904 Ga0495582_0002904_3579_3980 133
461 3300046474 Ga0495605_0000054 Ga0495605_0000054_99212_99637 133
462 3300046474 Ga0495605_0000778 Ga0495605_0000778_560_961 133
463 3300046474 Ga0495605_0000840 Ga0495605_0000840_2862_3275 133
464 3300046474 Ga0495605_0009605 Ga0495605_0009605_4431_4832 133
465 3300046474 Ga0495605_0010382 Ga0495605_0010382_3207_3608 133
466 3300046474 Ga0495605_0025277 Ga0495605_0025277_2025_2426 133
467 3300046474 Ga0495605_0078472 Ga0495605_0078472_1036_1449 133
468 3300046475 Ga0495639_0000053 Ga0495639_0000053_43307_43720 133
469 3300046475 Ga0495639_0028192 Ga0495639_0028192_192_593 133
470 3300046475 Ga0495639_0031856 Ga0495639_0031856_98_499 133
471 3300046491 Ga0495584_0000120 Ga0495584_0000120_4821_5234 133
472 3300046491 Ga0495584_0000715 Ga0495584_0000715_18203_18604 133
473 3300046491 Ga0495584_0002413 Ga0495584_0002413_7534_7947 133
474 3300046491 Ga0495584_0008390 Ga0495584_0008390_3033_3434 133
475 3300046491 Ga0495584_0036184 Ga0495584_0036184_560_961 133
476 3300046491 Ga0495584_0046528 Ga0495584_0046528_620_1021 133
477 3300046491 Ga0495584_0053842 Ga0495584_0053842_1201_1602 133
478 3300046491 Ga0495584_0094159 Ga0495584_0094159_842_1267 133
479 3300046491 Ga0495584_0229537 Ga0495584_0229537_71_472 133
480 3300046491 Ga0495584_0587959 Ga0495584_0587959_71_472 133
481 3300046492 Ga0495585_0010605 Ga0495585_0010605_3427_3828 133
482 3300046492 Ga0495585_0090687 Ga0495585_0090687_597_998 133
483 3300046492 Ga0495585_0144035 Ga0495585_0144035_256_657 133
484 3300046492 Ga0495585_0173625 Ga0495585_0173625_614_1015 133
485 3300046499 Ga0495594_0005932 Ga0495594_0005932_4975_5376 133
486 3300046499 Ga0495594_0020571 Ga0495594_0020571_1249_1662 133
487 3300046499 Ga0495594_0020880 Ga0495594_0020880_3053_3454 133
488 3300046499 Ga0495594_0097227 Ga0495594_0097227_489_890 133
489 3300046501 Ga0495607_0000036 Ga0495607_0000036_64623_65048 133
490 3300046501 Ga0495607_0000041 Ga0495607_0000041_122406_122819 133
491 3300046501 Ga0495607_0006048 Ga0495607_0006048_4853_5254 133
492 3300046501 Ga0495607_0007191 Ga0495607_0007191_3110_3523 133
493 3300046501 Ga0495607_0052365 Ga0495607_0052365_1765_2166 133
494 3300046501 Ga0495607_0063314 Ga0495607_0063314_729_1130 133
495 3300046506 Ga0495583_0000865 Ga0495583_0000865_2991_3392 133
496 3300046506 Ga0495583_0005112 Ga0495583_0005112_5965_6366 133
497 3300046506 Ga0495583_0016921 Ga0495583_0016921_2641_3054 133
498 3300046506 Ga0495583_0017034 Ga0495583_0017034_674_1075 133
499 3300046506 Ga0495583_0037940 Ga0495583_0037940_1440_1841 133
500 3300046507 Ga0495606_0008267 Ga0495606_0008267_7045_7458 133
501 3300046507 Ga0495606_0025524 Ga0495606_0025524_2460_2861 133
502 3300046507 Ga0495606_0050167 Ga0495606_0050167_735_1148 133
503 3300046507 Ga0495606_0243170 Ga0495606_0243170_171_572 133
504 3300046512 Ga0495610_0000455 Ga0495610_0000455_31264_31665 133
505 3300046512 Ga0495610_0005087 Ga0495610_0005087_7595_7996 133
506 3300046512 Ga0495610_0016320 Ga0495610_0016320_3411_3812 133
507 3300046512 Ga0495610_0057020 Ga0495610_0057020_48_449 133
508 3300046512 Ga0495610_0059192 Ga0495610_0059192_1224_1625 133
509 3300046513 Ga0495616_0000535 Ga0495616_0000535_22448_22861 133
510 3300046513 Ga0495616_0000695 Ga0495616_0000695_22671_23084 133
511 3300046513 Ga0495616_0016806 Ga0495616_0016806_3538_3939 133
512 3300046513 Ga0495616_0042849 Ga0495616_0042849_483_884 133
513 3300046513 Ga0495616_0126617 Ga0495616_0126617_499_900 133
514 3300046515 Ga0495620_0000014 Ga0495620_0000014_133586_134002 133
515 3300046515 Ga0495620_0000152 Ga0495620_0000152_3616_4041 133
516 3300046515 Ga0495620_0011843 Ga0495620_0011843_3444_3845 133
517 3300046515 Ga0495620_0028707 Ga0495620_0028707_717_1130 133
518 3300046515 Ga0495620_0028889 Ga0495620_0028889_1621_2022 133
519 3300046516 Ga0495628_0427484 Ga0495628_0427484_74_475 133
520 3300046517 Ga0495630_0009776 Ga0495630_0009776_580_981 133
521 3300046517 Ga0495630_0016625 Ga0495630_0016625_1403_1804 133
522 3300046517 Ga0495630_0064602 Ga0495630_0064602_1770_2171 133
523 3300046518 Ga0495631_0000175 Ga0495631_0000175_36834_37235 133
524 3300046518 Ga0495631_0009829 Ga0495631_0009829_695_1096 133
525 3300046518 Ga0495631_0031749 Ga0495631_0031749_1516_1917 133
526 3300046518 Ga0495631_0050061 Ga0495631_0050061_739_1152 133
527 3300046518 Ga0495631_0400780 Ga0495631_0400780_86_487 133
528 3300046519 Ga0495632_0003232 Ga0495632_0003232_690_1091 133
529 3300046519 Ga0495632_0006774 Ga0495632_0006774_383_796 133
530 3300046519 Ga0495632_0081263 Ga0495632_0081263_558_959 133
531 3300046520 Ga0495637_0000950 Ga0495637_0000950_5923_6336 133
532 3300046520 Ga0495637_0001455 Ga0495637_0001455_679_1080 133
533 3300046520 Ga0495637_0011047 Ga0495637_0011047_3213_3614 133
534 3300046520 Ga0495637_0032013 Ga0495637_0032013_1111_1512 133
535 3300046520 Ga0495637_0040208 Ga0495637_0040208_792_1205 133
536 3300046522 Ga0495643_0035792 Ga0495643_0035792_2165_2566 133
537 3300046522 Ga0495643_0125262 Ga0495643_0125262_288_689 133
538 3300046523 Ga0495644_0031488 Ga0495644_0031488_355_756 133
539 3300046523 Ga0495644_0047237 Ga0495644_0047237_556_957 133
540 3300046523 Ga0495644_0088142 Ga0495644_0088142_73_474 133
541 3300046523 Ga0495644_0113182 Ga0495644_0113182_66_479 133
542 3300046524 Ga0495648_0002500 Ga0495648_0002500_13564_13965 133
543 3300046524 Ga0495648_0026624 Ga0495648_0026624_2856_3257 133
544 3300046524 Ga0495648_0032415 Ga0495648_0032415_2389_2790 133
545 3300046524 Ga0495648_0044373 Ga0495648_0044373_1482_1895 133
546 3300046524 Ga0495648_0070184 Ga0495648_0070184_752_1153 133
547 3300046524 Ga0495648_0077012 Ga0495648_0077012_850_1251 133
548 3300046524 Ga0495648_0087463 Ga0495648_0087463_870_1271 133
549 3300046524 Ga0495648_0108944 Ga0495648_0108944_425_826 133
550 3300046524 Ga0495648_0176561 Ga0495648_0176561_92_505 133
551 3300046526 Ga0495666_0001595 Ga0495666_0001595_1732_2133 133
552 3300046526 Ga0495666_0016517 Ga0495666_0016517_2569_2982 133
553 3300046526 Ga0495666_0097056 Ga0495666_0097056_198_599 133
554 3300046528 Ga0495642_0000006 Ga0495642_0000006_27675_28076 133
555 3300046528 Ga0495642_0000044 Ga0495642_0000044_67951_68352 133
556 3300046528 Ga0495642_0001263 Ga0495642_0001263_6341_6754 133
557 3300046529 Ga0495652_0286483 Ga0495652_0286483_70_471 133
558 3300046530 Ga0495654_0000113 Ga0495654_0000113_88482_88883 133
559 3300046530 Ga0495654_0000600 Ga0495654_0000600_22954_23367 133
560 3300046530 Ga0495654_0013073 Ga0495654_0013073_3275_3676 133
561 3300046530 Ga0495654_0017811 Ga0495654_0017811_614_1015 133
562 3300046530 Ga0495654_0027907 Ga0495654_0027907_1939_2352 133
563 3300046530 Ga0495654_0035081 Ga0495654_0035081_1416_1817 133
564 3300046530 Ga0495654_0038948 Ga0495654_0038948_481_882 133
565 3300046530 Ga0495654_0053823 Ga0495654_0053823_844_1245 133
566 3300046530 Ga0495654_0109267 Ga0495654_0109267_796_1209 133
567 3300046530 Ga0495654_0216285 Ga0495654_0216285_401_802 133
568 3300046530 Ga0495654_0244260 Ga0495654_0244260_252_665 133
569 3300046535 Ga0495586_0011723 Ga0495586_0011723_3579_3980 133
570 3300046536 Ga0495587_0003803 Ga0495587_0003803_5069_5470 133
571 3300046536 Ga0495587_0007630 Ga0495587_0007630_5233_5634 133
572 3300046538 Ga0495609_0001936 Ga0495609_0001936_4926_5339 133
573 3300046538 Ga0495609_0013575 Ga0495609_0013575_2106_2507 133
574 3300046538 Ga0495609_0097613 Ga0495609_0097613_730_1131 133
575 3300046538 Ga0495609_0331038 Ga0495609_0331038_95_496 133
576 3300046542 Ga0495597_0000800 Ga0495597_0000800_3544_3960 133
577 3300046542 Ga0495597_0004988 Ga0495597_0004988_3090_3503 133
578 3300046542 Ga0495597_0016614 Ga0495597_0016614_1140_1553 133
579 3300046542 Ga0495597_0037997 Ga0495597_0037997_1606_2007 133
580 3300046542 Ga0495597_0085319 Ga0495597_0085319_501_902 133
581 3300046542 Ga0495597_0102766 Ga0495597_0102766_219_620 133
582 3300046542 Ga0495597_0374678 Ga0495597_0374678_27_440 133
583 3300046543 Ga0495645_0118658 Ga0495645_0118658_199_600 133
584 3300046557 Ga0495622_0002204 Ga0495622_0002204_6864_7277 133
585 3300046557 Ga0495622_0012172 Ga0495622_0012172_3522_3923 133
586 3300046557 Ga0495622_0041663 Ga0495622_0041663_733_1134 133
587 3300046557 Ga0495622_0046353 Ga0495622_0046353_863_1264 133
588 3300046557 Ga0495622_0069296 Ga0495622_0069296_57_458 133
589 3300046557 Ga0495622_0108867 Ga0495622_0108867_687_1088 133
590 3300046557 Ga0495622_0141881 Ga0495622_0141881_15_416 133
591 3300046558 Ga0495633_0009087 Ga0495633_0009087_902_1303 133
592 3300046558 Ga0495633_0022226 Ga0495633_0022226_594_1007 133
593 3300046615 Ga0495656_0000803 Ga0495656_0000803_1130_1531 133
594 3300046615 Ga0495656_0011867 Ga0495656_0011867_791_1204 133
595 3300046615 Ga0495656_0060624 Ga0495656_0060624_1094_1495 133
596 3300046616 Ga0495668_0007019 Ga0495668_0007019_3943_4344 133
597 3300046616 Ga0495668_0247363 Ga0495668_0247363_141_542 133
598 3300046642 Ga0495634_0000815 Ga0495634_0000815_6352_6753 133
599 3300046648 Ga0495611_0001208 Ga0495611_0001208_2765_3181 133
600 3300046648 Ga0495611_0067058 Ga0495611_0067058_665_1078 133
601 3300046648 Ga0495611_0083051 Ga0495611_0083051_319_732 133
602 3300046648 Ga0495611_0236798 Ga0495611_0236798_29_430 133
603 3300046660 Ga0495625_0029114 Ga0495625_0029114_801_1202 133
604 3300046660 Ga0495625_0030599 Ga0495625_0030599_843_1244 133
605 3300046660 Ga0495625_0033795 Ga0495625_0033795_2315_2728 133
606 3300046660 Ga0495625_0061955 Ga0495625_0061955_1559_1972 133
607 3300046660 Ga0495625_0107071 Ga0495625_0107071_545_946 133
608 3300046660 Ga0495625_0129009 Ga0495625_0129009_428_829 133
609 3300046660 Ga0495625_0141502 Ga0495625_0141502_839_1240 133
610 3300046660 Ga0495625_0298326 Ga0495625_0298326_451_852 133
611 3300046663 Ga0495635_0000522 Ga0495635_0000522_23279_23680 133
612 3300046663 Ga0495635_0005853 Ga0495635_0005853_1462_1863 133
613 3300046664 Ga0495659_0000119 Ga0495659_0000119_6687_7100 133
614 3300046664 Ga0495659_0034500 Ga0495659_0034500_1282_1683 133
615 3300046664 Ga0495659_0091690 Ga0495659_0091690_643_1056 133
616 3300046665 Ga0495661_0005186 Ga0495661_0005186_2939_3364 133
617 3300046665 Ga0495661_0025282 Ga0495661_0025282_520_921 133
618 3300046665 Ga0495661_0028776 Ga0495661_0028776_1623_2024 133
619 3300046665 Ga0495661_0048908 Ga0495661_0048908_901_1314 133
620 3300046665 Ga0495661_0190175 Ga0495661_0190175_63_464 133
621 3300046665 Ga0495661_0353665 Ga0495661_0353665_257_658 133
622 3300046674 Ga0495588_0046530 Ga0495588_0046530_32_433 133
623 3300046674 Ga0495588_0055238 Ga0495588_0055238_688_1089 133
624 3300046674 Ga0495588_0095680 Ga0495588_0095680_1125_1526 133
625 3300046674 Ga0495588_0129943 Ga0495588_0129943_58_459 133
626 3300046674 Ga0495588_0150563 Ga0495588_0150563_495_896 133
627 3300046679 Ga0495623_0009066 Ga0495623_0009066_600_1001 133
628 3300046680 Ga0495646_0003353 Ga0495646_0003353_4256_4657 133
629 3300046680 Ga0495646_0003495 Ga0495646_0003495_4611_5012 133
630 3300046684 Ga0495669_0001087 Ga0495669_0001087_4413_4814 133
631 3300046684 Ga0495669_0006622 Ga0495669_0006622_1415_1816 133
632 3300046689 Ga0495613_0020085 Ga0495613_0020085_1676_2077 133
633 3300046689 Ga0495613_0136940 Ga0495613_0136940_451_852 133
634 3300046689 Ga0495613_0698840 Ga0495613_0698840_98_499 133
635 3300046691 Ga0495670_0007044 Ga0495670_0007044_2824_3225 133
636 3300046691 Ga0495670_0012161 Ga0495670_0012161_2919_3320 133
637 3300046691 Ga0495670_0063344 Ga0495670_0063344_1364_1765 133
638 3300046691 Ga0495670_0088900 Ga0495670_0088900_471_884 133
639 3300046691 Ga0495670_0238853 Ga0495670_0238853_17_430 133
640 3300046691 Ga0495670_0370016 Ga0495670_0370016_275_688 133
641 3300046692 Ga0495671_0000210 Ga0495671_0000210_44041_44454 133
642 3300046692 Ga0495671_0001187 Ga0495671_0001187_11723_12124 133
643 3300046692 Ga0495671_0017328 Ga0495671_0017328_2795_3196 133
644 3300046692 Ga0495671_0023620 Ga0495671_0023620_607_1008 133
645 3300046692 Ga0495671_0043243 Ga0495671_0043243_1423_1824 133
646 3300046692 Ga0495671_0043410 Ga0495671_0043410_1294_1695 133
647 3300046692 Ga0495671_0063638 Ga0495671_0063638_1256_1657 133
648 3300046692 Ga0495671_0157659 Ga0495671_0157659_29_430 133
649 3300046692 Ga0495671_0373375 Ga0495671_0373375_160_561 133
650 3300046694 Ga0495649_0000748 Ga0495649_0000748_5089_5490 133
651 3300046694 Ga0495649_0002964 Ga0495649_0002964_6307_6720 133
652 3300046694 Ga0495649_0009159 Ga0495649_0009159_4600_5001 133
653 3300046694 Ga0495649_0012051 Ga0495649_0012051_557_970 133
654 3300046694 Ga0495649_0369863 Ga0495649_0369863_25_426 133
655 3300046794 Ga0495589_0000326 Ga0495589_0000326_34016_34429 133
656 3300046794 Ga0495589_0001450 Ga0495589_0001450_10297_10713 133
657 3300046794 Ga0495589_0012195 Ga0495589_0012195_430_843 133
658 3300046794 Ga0495589_0014155 Ga0495589_0014155_3023_3424 133
659 3300046794 Ga0495589_0017546 Ga0495589_0017546_2151_2552 133
660 3300046794 Ga0495589_0038437 Ga0495589_0038437_490_891 133
661 3300046809 Ga0495600_0006261 Ga0495600_0006261_1522_1923 133
662 3300046810 Ga0495660_0017436 Ga0495660_0017436_995_1396 133
663 3300046810 Ga0495660_0030407 Ga0495660_0030407_654_1055 133
664 3300046810 Ga0495660_0043831 Ga0495660_0043831_1582_1983 133
665 3300046810 Ga0495660_0053342 Ga0495660_0053342_1147_1548 133
666 3300046810 Ga0495660_0059680 Ga0495660_0059680_431_832 133
667 3300046810 Ga0495660_0159625 Ga0495660_0159625_158_559 133
668 3300047315 Ga0495581_0008518 Ga0495581_0008518_1524_1925 133
669 3300047317 Ga0495604_0045394 Ga0495604_0045394_2246_2647 133
670 3300047317 Ga0495604_0221960 Ga0495604_0221960_291_692 133
671 3300047318 Ga0495636_0092741 Ga0495636_0092741_762_1163 133
672 3300047318 Ga0495636_0093220 Ga0495636_0093220_493_906 133
673 3300047319 Ga0495674_0009374 Ga0495674_0009374_3977_4378 133
674 3300047320 Ga0495672_0000817 Ga0495672_0000817_2367_2780 133
675 3300047320 Ga0495672_0001555 Ga0495672_0001555_20119_20520 133
676 3300047320 Ga0495672_0002413 Ga0495672_0002413_14058_14459 133
677 3300047320 Ga0495672_0025473 Ga0495672_0025473_2647_3048 133
678 3300047320 Ga0495672_0035456 Ga0495672_0035456_751_1152 133
679 3300047320 Ga0495672_0038366 Ga0495672_0038366_1374_1775 133
680 3300047320 Ga0495672_0055685 Ga0495672_0055685_691_1104 133
681 3300047320 Ga0495672_0124329 Ga0495672_0124329_833_1234 133
682 3300047320 Ga0495672_0304553 Ga0495672_0304553_247_648 133
683 3300047322 Ga0495680_0002029 Ga0495680_0002029_7481_7882 133
684 3300047322 Ga0495680_0027810 Ga0495680_0027810_3793_4194 133
685 3300047322 Ga0495680_0034253 Ga0495680_0034253_1255_1656 133
686 3300047323 Ga0495683_0000356 Ga0495683_0000356_31964_32365 133
687 3300047323 Ga0495683_0029299 Ga0495683_0029299_1031_1444 133
688 3300047323 Ga0495683_0040036 Ga0495683_0040036_523_936 133
689 3300047323 Ga0495683_0082635 Ga0495683_0082635_1067_1468 133
690 3300047443 Ga0495687_000977 Ga0495687_000977_4020_4421 133
691 3300047443 Ga0495687_006152 Ga0495687_006152_691_1104 133
692 3300047443 Ga0495687_007971 Ga0495687_007971_691_1104 133
693 3300047443 Ga0495687_014259 Ga0495687_014259_954_1355 133
694 3300047444 Ga0495675_0009385 Ga0495675_0009385_1757_2158 133
695 3300047444 Ga0495675_0023304 Ga0495675_0023304_765_1166 133
696 3300047445 Ga0495677_0000848 Ga0495677_0000848_11280_11681 133
697 3300047445 Ga0495677_0258370 Ga0495677_0258370_36_449 133
698 3300047446 Ga0495679_000137 Ga0495679_000137_39300_39716 133
699 3300047446 Ga0495679_010574 Ga0495679_010574_2656_3057 133
700 3300047446 Ga0495679_010914 Ga0495679_010914_662_1063 133
701 3300047446 Ga0495679_015261 Ga0495679_015261_2172_2573 133
702 3300047447 Ga0495685_034244 Ga0495685_034244_645_1058 133
703 3300047447 Ga0495685_047041 Ga0495685_047041_644_1045 133
704 3300047469 Ga0495673_0000465 Ga0495673_0000465_6992_7393 133
705 3300047469 Ga0495673_0001451 Ga0495673_0001451_5324_5725 133
706 3300047469 Ga0495673_0005021 Ga0495673_0005021_6634_7047 133
707 3300047469 Ga0495673_0010214 Ga0495673_0010214_2801_3202 133
708 3300047469 Ga0495673_0011327 Ga0495673_0011327_3689_4090 133
709 3300047469 Ga0495673_0020111 Ga0495673_0020111_1935_2360 133
710 3300047469 Ga0495673_0024412 Ga0495673_0024412_586_987 133
711 3300047469 Ga0495673_0038574 Ga0495673_0038574_630_1043 133
712 3300047469 Ga0495673_0039389 Ga0495673_0039389_1152_1553 133
713 3300047469 Ga0495673_0061453 Ga0495673_0061453_959_1372 133
714 3300047470 Ga0495681_0001797 Ga0495681_0001797_12619_13020 133
715 3300047470 Ga0495681_0002364 Ga0495681_0002364_3525_3938 133
716 3300047470 Ga0495681_0003644 Ga0495681_0003644_7095_7496 133
717 3300047470 Ga0495681_0005548 Ga0495681_0005548_5435_5836 133
718 3300047470 Ga0495681_0014600 Ga0495681_0014600_749_1162 133
719 3300047470 Ga0495681_0036270 Ga0495681_0036270_57_458 133
720 3300047470 Ga0495681_0052163 Ga0495681_0052163_508_921 133
721 3300047472 Ga0495686_0324568 Ga0495686_0324568_301_702 133
722 3300047472 Ga0495686_0485753 Ga0495686_0485753_215_616 133
723 3300047673 Ga0495593_0017983 Ga0495593_0017983_2742_3143 133
724 3300047673 Ga0495593_0058767 Ga0495593_0058767_492_893 133
725 3300047673 Ga0495593_0083383 Ga0495593_0083383_44_445 133
726 3300048089 Ga0495614_0390669 Ga0495614_0390669_121_522 133
727 3300048090 Ga0495615_0036994 Ga0495615_0036994_533_934 133
728 3300048091 Ga0495626_0000064 Ga0495626_0000064_118596_118997 133
729 3300048091 Ga0495626_0000616 Ga0495626_0000616_29008_29421 133
730 3300048091 Ga0495626_0000958 Ga0495626_0000958_21371_21772 133
731 3300048091 Ga0495626_0018101 Ga0495626_0018101_538_951 133
732 3300048091 Ga0495626_0050643 Ga0495626_0050643_989_1390 133
733 3300048091 Ga0495626_0073492 Ga0495626_0073492_611_1024 133
734 3300048091 Ga0495626_0123318 Ga0495626_0123318_614_1015 133
735 3300048905 Ga0496102_0000774 Ga0496102_0000774_23745_24146 133
736 3300048905 Ga0496102_0424208 Ga0496102_0424208_620_1045 133
737 3300048905 Ga0496102_0809598 Ga0496102_0809598_363_764 133
738 3300048906 Ga0496103_0020077 Ga0496103_0020077_613_1014 133
739 3300048907 Ga0496104_0693498 Ga0496104_0693498_371_784 133
740 3300048908 Ga0496105_0402110 Ga0496105_0402110_571_984 133
741 3300048909 Ga0496106_0090601 Ga0496106_0090601_791_1204 133
742 3300048909 Ga0496106_0222792 Ga0496106_0222792_789_1190 133
743 3300048913 Ga0496110_0013875 Ga0496110_0013875_5829_6254 133
744 3300048913 Ga0496110_0223792 Ga0496110_0223792_667_1080 133
745 3300048913 Ga0496110_0268410 Ga0496110_0268410_733_1134 133
746 3300048913 Ga0496110_0578910 Ga0496110_0578910_135_536 133
747 3300048914 Ga0496111_0041086 Ga0496111_0041086_775_1176 133
748 3300048914 Ga0496111_0182712 Ga0496111_0182712_712_1137 133
749 3300048915 Ga0496112_0119275 Ga0496112_0119275_333_746 133
750 3300048915 Ga0496112_0243115 Ga0496112_0243115_783_1208 133
751 3300048916 Ga0496113_0141233 Ga0496113_0141233_812_1237 133
752 3300048916 Ga0496113_1118158 Ga0496113_1118158_98_523 133
753 3300048917 Ga0496114_0448898 Ga0496114_0448898_483_884 133
754 3300048919 Ga0496116_0008609 Ga0496116_0008609_1735_2148 133
755 3300048920 Ga0496117_0037708 Ga0496117_0037708_242_643 133
756 3300048920 Ga0496117_0038309 Ga0496117_0038309_790_1215 133
757 3300048920 Ga0496117_0122716 Ga0496117_0122716_610_1023 133
758 3300048921 Ga0496118_0028878 Ga0496118_0028878_174_599 133
759 3300048921 Ga0496118_0034082 Ga0496118_0034082_3280_3681 133
760 3300048921 Ga0496118_0042318 Ga0496118_0042318_2624_3025 133
761 3300048921 Ga0496118_0083049 Ga0496118_0083049_1245_1658 133
762 3300048922 Ga0496119_0140968 Ga0496119_0140968_364_765 133
763 3300048922 Ga0496119_0514450 Ga0496119_0514450_19_432 133
764 3300048923 Ga0496120_0025586 Ga0496120_0025586_2970_3383 133
765 3300048923 Ga0496120_0067238 Ga0496120_0067238_1033_1446 133
766 3300048923 Ga0496120_0334758 Ga0496120_0334758_97_498 133
767 3300048924 Ga0496121_0001708 Ga0496121_0001708_28875_29288 133
768 3300048924 Ga0496121_0001828 Ga0496121_0001828_16047_16472 133
769 3300048924 Ga0496121_0143931 Ga0496121_0143931_444_857 133
770 3300048925 Ga0496122_0000411 Ga0496122_0000411_22732_23157 133
771 3300048925 Ga0496122_0025179 Ga0496122_0025179_755_1168 133
772 3300048925 Ga0496122_0049865 Ga0496122_0049865_140_556 133
773 3300048925 Ga0496122_0052939 Ga0496122_0052939_2557_2970 133
774 3300048925 Ga0496122_0091935 Ga0496122_0091935_1641_2042 133
775 3300048926 Ga0496123_0000055 Ga0496123_0000055_71042_71467 133
776 3300048926 Ga0496123_0003979 Ga0496123_0003979_15178_15594 133
777 3300048926 Ga0496123_0024051 Ga0496123_0024051_2816_3241 133
778 3300048926 Ga0496123_0031880 Ga0496123_0031880_628_1041 133
779 3300048926 Ga0496123_0079871 Ga0496123_0079871_67_480 133
780 3300048926 Ga0496123_0082097 Ga0496123_0082097_23_424 133
781 3300048926 Ga0496123_0090478 Ga0496123_0090478_473_886 133
782 3300048927 Ga0496124_0001124 Ga0496124_0001124_27115_27540 133
783 3300048927 Ga0496124_0004348 Ga0496124_0004348_12976_13389 133
784 3300048927 Ga0496124_0007542 Ga0496124_0007542_8280_8693 133
785 3300048927 Ga0496124_0045697 Ga0496124_0045697_2831_3232 133
786 3300048927 Ga0496124_0184645 Ga0496124_0184645_534_959 133
787 3300048927 Ga0496124_0223350 Ga0496124_0223350_572_985 133
788 3300048928 Ga0496125_0004187 Ga0496125_0004187_12977_13390 133
789 3300048928 Ga0496125_0022673 Ga0496125_0022673_2633_3046 133
790 3300048928 Ga0496125_0039387 Ga0496125_0039387_3050_3451 133
791 3300048928 Ga0496125_0060557 Ga0496125_0060557_265_678 133
792 3300048928 Ga0496125_0071065 Ga0496125_0071065_496_897 133
793 3300048928 Ga0496125_0072714 Ga0496125_0072714_250_651 133
794 3300048928 Ga0496125_0072984 Ga0496125_0072984_1692_2093 133
795 3300048928 Ga0496125_0080206 Ga0496125_0080206_1545_1958 133
796 3300048928 Ga0496125_0134381 Ga0496125_0134381_633_1034 133
797 3300048929 Ga0496126_0044914 Ga0496126_0044914_2854_3255 133
798 3300048929 Ga0496126_0063125 Ga0496126_0063125_1766_2179 133
799 3300048929 Ga0496126_0226085 Ga0496126_0226085_371_784 133
800 3300048929 Ga0496126_0359912 Ga0496126_0359912_474_875 133
801 3300049459 Ga0495678_000578 Ga0495678_000578_5343_5756 133
802 3300049459 Ga0495678_004245 Ga0495678_004245_3284_3697 133
803 3300049459 Ga0495678_011644 Ga0495678_011644_2567_2968 133
804 3300049459 Ga0495678_168185 Ga0495678_168185_96_497 133
805 3300049460 Ga0495682_0000025 Ga0495682_0000025_63062_63487 133
806 3300049460 Ga0495682_0006579 Ga0495682_0006579_777_1178 133
807 3300049460 Ga0495682_0007925 Ga0495682_0007925_490_903 133
808 3300049460 Ga0495682_0028070 Ga0495682_0028070_1531_1932 133
809 3300049460 Ga0495682_0048600 Ga0495682_0048600_417_818 133
810 3300049460 Ga0495682_0065560 Ga0495682_0065560_480_893 133
811 3300049460 Ga0495682_0075362 Ga0495682_0075362_199_600 133
812 3300049460 Ga0495682_0123154 Ga0495682_0123154_360_761 133
813 3300049460 Ga0495682_0125573 Ga0495682_0125573_444_845 133
814 3300049568 Ga0501031_0491400 Ga0501031_0491400_123_578 133
815 3300049570 Ga0501033_0207297 Ga0501033_0207297_152_607 133
816 3300049571 Ga0501034_0355992 Ga0501034_0355992_273_728 133
817 3300049822 Ga0501035_0381926 Ga0501035_0381926_522_977 133
818 3300050489 nmdc:mga03683_12119_c1 nmdc:mga03683_12119_c1_2196_2597 133
819 3300050489 nmdc:mga03683_45902_c1 nmdc:mga03683_45902_c1_1242_1643 133
820 3300050489 nmdc:mga03683_7051_c1 nmdc:mga03683_7051_c1_2765_3166 133
821 3300050491 nmdc:mga00v17_124811_c1 nmdc:mga00v17_124811_c1_49_450 133
822 3300050491 nmdc:mga00v17_55303_c1 nmdc:mga00v17_55303_c1_556_957 133
823 3300050491 nmdc:mga00v17_83857_c1 nmdc:mga00v17_83857_c1_1490_1891 133
824 3300050514 nmdc:mga08x19_185693_c1 nmdc:mga08x19_185693_c1_970_1371 133
825 3300053140 Ga0500573_0029972 Ga0500573_0029972_594_1022 133
826 3300053161 Ga0500634_0031016 Ga0500634_0031016_445_846 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

8

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7865 6 120
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7739 6 119
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.7675 6 120
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7595 6 120
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.7526 6 120
ID Description Score Start End Superfamily
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8706 8 121 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8671 6 123 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.841 7 120 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8408 8 121 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8296 6 123 1.10.3730.20
ID Description Score Start End GO Terms
AF-Q4KC78-F1-model_v4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (L-Ara4N-phosphoundecaprenol flippase subunit ArnF) (Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF) 0.9775 1 124 GO:0005886
GO:0009103
GO:0009245
GO:1901505
AF-Q3KCB7-F1-model_v4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (L-Ara4N-phosphoundecaprenol flippase subunit ArnF) (Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF) 0.9309 1 133 GO:0005886
GO:0009103
GO:0009245
GO:1901505
AF-Q3KCB7-F1-model_v4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (L-Ara4N-phosphoundecaprenol flippase subunit ArnF) (Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF) 0.9241 1 133 GO:0005886
GO:0009103
GO:0009245
GO:1901505
AF-J2RYD9-F1-model_v4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (L-Ara4N-phosphoundecaprenol flippase subunit ArnF) (Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF) 0.9212 1 133 GO:0005886
GO:0009103
GO:0009245
GO:1901505
AF-A0A098G5X1-F1-model_v4 Putative 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE 0.9212 6 119 GO:0005886
GO:0009103
GO:0009245
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.39 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map