F482489

General Info

Members Datasets Scaffolds Average Seq Length
826 418 1652 206

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0212422|Ga0496114_0212422_856_1464
Length 202
Sequence MSEATAGATVDRSRRTWLITSCAMGGAGAAAVAVPFVSTFQPSERAKAAGAAVEVDISGIQPGEKLVVEWRGKPVWILRRTAEQLAALETIEGQLADPNSDRTAYPTPAYAKNRHRSIKPEFLVTVGICTHLGCSPGDKLTPGPQPSLPDDWKGGFLCACHGSTFDVAGRVFKNKPAPDNLEVPPHYYLSDTTLLVGEEKQA

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
171 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
172 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
173 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
174 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
175 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
176 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
209 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
212 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
217 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
218 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
219 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
220 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
221 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
222 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
223 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
224 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
229 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
292 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
293 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
326 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
327 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
328 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
340 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
341 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
342 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
345 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
354 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
355 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
356 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
362 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
363 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
367 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
368 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
369 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
370 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
371 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
372 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
373 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
374 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
375 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
376 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
377 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
378 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
379 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
380 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
381 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
386 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
387 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
390 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
393 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
415 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
416 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
417 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
418 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.19
Metatranscriptomes 5.21
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.96
Nodule 0.61
Rhizoplane 2.42
Rhizosphere 57.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0212422 3300048917 Bacteria 1697
2 JGI25155J39150_1000022 3300002704 Bacteria 142950
3 JGI25156J39149_1000005 3300002705 Bacteria 263980
4 JGI25156J39149_1007101 3300002705 Bacteria 2980
5 JGI25154J39366_1000017 3300002738 Bacteria 252448
6 JGI25157J39369_1000003 3300002741 Bacteria 274935
7 JGI25152J39213_1017849 3300002773 Bacteria 1327
8 JGI25150J39212_1001639 3300002774 Bacteria 6091
9 JGI25150J39212_1005198 3300002774 Bacteria 2805
10 JGI25150J39212_1008124 3300002774 Bacteria 2072
11 JGI25159J45721_1000396 3300002987 Bacteria 20289
12 JGI25159J45721_1005038 3300002987 Bacteria 4216
13 JGI25159J45721_1008343 3300002987 Bacteria 2855
14 JGI25151J46595_10001069 3300003187 Bacteria 20425
15 JGI25151J46595_10081221 3300003187 Bacteria 937
16 JGI25151J46595_10084991 3300003187 Bacteria 901
17 JGI25153J46596_10004229 3300003215 Bacteria 7770
18 JGI25153J46596_10004541 3300003215 Bacteria 7462
19 JGI25160J50197_1002413 3300003354 Bacteria 8715
20 JGI25160J50197_1033794 3300003354 Bacteria 1280
21 JGI25161J50226_1000095 3300003374 Bacteria 72343
22 JGI25161J50226_1002922 3300003374 Bacteria 4147
23 Ga0007409J51694_1010614 3300003575 Bacteria 4318
24 Ga0007416J51690_1020706 3300003577 Bacteria 4433
25 Ga0006562J51391_1033687 3300003578 Bacteria 4660
26 Ga0032354_1023833 3300003693 Bacteria 4218
27 Ga0055535_1000047 3300003761 Bacteria 139836
28 Ga0055535_1001458 3300003761 Bacteria 11925
29 Ga0055542_1000080 3300003762 Bacteria 129634
30 Ga0055529_1000148 3300003763 Bacteria 100809
31 Ga0055526_1000030 3300003771 Bacteria 143833
32 Ga0055526_1000167 3300003771 Bacteria 57804
33 Ga0055526_1002375 3300003771 Bacteria 12756
34 Ga0055526_1002601 3300003771 Bacteria 12065
35 Ga0055526_1003176 3300003771 Bacteria 10628
36 Ga0055526_1011045 3300003771 Bacteria 4122
37 Ga0055537_1000150 3300003773 Bacteria 52097
38 Ga0055537_1000205 3300003773 Bacteria 44266
39 Ga0055537_1000239 3300003773 Bacteria 40300
40 Ga0055537_1010578 3300003773 Bacteria 1937
41 Ga0055524_1000017 3300003775 Bacteria 235608
42 Ga0055524_1000073 3300003775 Bacteria 123033
43 Ga0055524_1001044 3300003775 Bacteria 17076
44 Ga0055524_1006211 3300003775 Bacteria 5214
45 Ga0055524_1014364 3300003775 Bacteria 2938
46 Ga0055536_1018344 3300003781 Bacteria 2246
47 Ga0055534_1000016 3300003784 Bacteria 144444
48 Ga0055534_1000194 3300003784 Bacteria 44359
49 Ga0055534_1000363 3300003784 Bacteria 28579
50 Ga0055534_1001058 3300003784 Bacteria 11914
51 Ga0055534_1003933 3300003784 Bacteria 4485
52 Ga0055528_1000253 3300003790 Bacteria 45221
53 Ga0055528_1000289 3300003790 Bacteria 42964
54 Ga0055528_1008808 3300003790 Bacteria 4276
55 Ga0055528_1014906 3300003790 Bacteria 2841
56 Ga0055530_10001804 3300003791 Bacteria 14848
57 Ga0055530_10008565 3300003791 Bacteria 4071
58 Ga0055530_10037309 3300003791 Bacteria 1217
59 Ga0055540_1000037 3300003792 Bacteria 162957
60 Ga0055540_1002771 3300003792 Bacteria 8982
61 Ga0055540_1040942 3300003792 Bacteria 1001
62 Ga0055531_10011377 3300003794 Bacteria 4298
63 Ga0055531_10023264 3300003794 Bacteria 2331
64 Ga0055543_1000218 3300004625 Bacteria 46120
65 Ga0055543_1028236 3300004625 Bacteria 990
66 Ga0065165_1000805 3300005262 Bacteria 41844
67 Ga0065165_1037171 3300005262 Bacteria 1478
68 Ga0065165_1055083 3300005262 Bacteria 1112
69 Ga0065714_10073610 3300005288 Bacteria 3159
70 Ga0065704_10003100 3300005289 Bacteria 4362
71 Ga0070676_10194284 3300005328 Bacteria 1327
72 Ga0070677_10249905 3300005333 Bacteria 880
73 Ga0068869_100099975 3300005334 Bacteria 2193
74 Ga0068869_100185274 3300005334 Bacteria 1634
75 Ga0070666_10349580 3300005335 Bacteria 1058
76 Ga0068868_100008545 3300005338 Bacteria 7332
77 Ga0068868_100069555 3300005338 Bacteria 2805
78 Ga0070660_100001068 3300005339 Bacteria 18415
79 Ga0070661_100005897 3300005344 Bacteria 8430
80 Ga0070675_100028611 3300005354 Bacteria 4485
81 Ga0070659_100005068 3300005366 Bacteria 9444
82 Ga0070659_100343187 3300005366 Bacteria 1252
83 Ga0070667_100024333 3300005367 Bacteria 5029
84 Ga0070667_100228766 3300005367 Bacteria 1657
85 Ga0070678_100178002 3300005456 Bacteria 1738
86 Ga0070678_100296001 3300005456 Bacteria 1374
87 Ga0070678_100327262 3300005456 Bacteria 1310
88 Ga0070662_100018957 3300005457 Bacteria 4662
89 Ga0068867_100126586 3300005459 Bacteria 1980
90 Ga0068867_100268214 3300005459 Bacteria 1394
91 Ga0068853_100344331 3300005539 Bacteria 1385
92 Ga0070672_100003408 3300005543 Bacteria 10312
93 Ga0070665_100027466 3300005548 Bacteria 5733
94 Ga0070665_100634191 3300005548 Bacteria 1082
95 Ga0070665_100814421 3300005548 Bacteria 947
96 Ga0070664_100011901 3300005564 Bacteria 7062
97 Ga0070664_100221117 3300005564 Bacteria 1694
98 Ga0068857_100082461 3300005577 Bacteria 2872
99 Ga0068856_100134337 3300005614 Bacteria 2479
100 Ga0068859_100044728 3300005617 Bacteria 4448
101 Ga0068864_100019420 3300005618 Bacteria 5682
102 Ga0068866_10364797 3300005718 Bacteria 922
103 Ga0068851_10023769 3300005834 Bacteria 2997
104 Ga0068863_100018423 3300005841 Bacteria 6681
105 Ga0068863_100581246 3300005841 Bacteria 1108
106 Ga0068860_100254189 3300005843 Bacteria 1712
107 Ga0068862_100052707 3300005844 Bacteria 3482
108 Ga0068862_101039079 3300005844 Bacteria 812
109 Ga0075365_10021801 3300006038 Bacteria 4002
110 Ga0075368_10091162 3300006042 Bacteria 1247
111 Ga0075363_100050969 3300006048 Bacteria 2206
112 Ga0075363_100096973 3300006048 Bacteria 1629
113 Ga0075363_100112476 3300006048 Bacteria 1514
114 Ga0075363_100348596 3300006048 Bacteria 864
115 Ga0075364_10092158 3300006051 Bacteria 2011
116 Ga0075364_10149945 3300006051 Bacteria 1571
117 Ga0075364_10273367 3300006051 Bacteria 1149
118 Ga0075364_10464517 3300006051 Bacteria 865
119 Ga0075362_10007740 3300006177 Bacteria 4082
120 Ga0075362_10018885 3300006177 Bacteria 2860
121 Ga0075362_10035036 3300006177 Bacteria 2190
122 Ga0075369_10111044 3300006186 Bacteria 1236
123 Ga0075369_10210076 3300006186 Bacteria 900
124 Ga0075366_10001610 3300006195 Bacteria 11306
125 Ga0075366_10036288 3300006195 Bacteria 2906
126 Ga0075366_10062614 3300006195 Bacteria 2211
127 Ga0075366_10141318 3300006195 Bacteria 1456
128 Ga0075366_10165863 3300006195 Bacteria 1339
129 Ga0097621_100686774 3300006237 Bacteria 941
130 Ga0075370_10000182 3300006353 Bacteria 21846
131 Ga0075370_10035523 3300006353 Bacteria 2797
132 Ga0075370_10055531 3300006353 Bacteria 2250
133 Ga0075370_10087886 3300006353 Bacteria 1791
134 Ga0075370_10184141 3300006353 Bacteria 1230
135 Ga0097620_100044728 3300006931 Bacteria 4448
136 Ga0097620_101023521 3300006931 Bacteria 907
137 Ga0079104_1049112 3300006946 Bacteria 947
138 Ga0099826_10000033 3300006948 Bacteria 120668
139 Ga0099826_10126910 3300006948 Bacteria 1494
140 Ga0105244_10001268 3300009036 Bacteria 20676
141 Ga0105244_10003719 3300009036 Bacteria 10768
142 Ga0105245_10065399 3300009098 Bacteria 3288
143 Ga0105245_11056088 3300009098 Bacteria 858
144 Ga0105243_10000306 3300009148 Bacteria 54352
145 Ga0105241_10053049 3300009174 Bacteria 3099
146 Ga0105241_10116335 3300009174 Bacteria 2147
147 Ga0105242_10108114 3300009176 Bacteria 2366
148 Ga0105242_10152883 3300009176 Bacteria 2014
149 Ga0105242_10655434 3300009176 Bacteria 1021
150 Ga0105248_10106946 3300009177 Bacteria 3154
151 Ga0105237_10027197 3300009545 Bacteria 5841
152 Ga0105237_10653740 3300009545 Bacteria 1058
153 Ga0105249_10106069 3300009553 Bacteria 2650
154 Ga0105239_10059436 3300010375 Bacteria 4196
155 Ga0105246_10029216 3300011119 Bacteria 3629
156 Ga0105246_10369650 3300011119 Bacteria 1181
157 Ga0105246_10536995 3300011119 Bacteria 1000
158 Ga0157326_1003197 3300012513 Bacteria 1729
159 Ga0157373_10049442 3300013100 Bacteria 2996
160 Ga0157371_10065886 3300013102 Bacteria 2565
161 Ga0157370_10006343 3300013104 Bacteria 13063
162 Ga0157370_10301385 3300013104 Bacteria 1479
163 Ga0157370_10362345 3300013104 Bacteria 1336
164 Ga0157370_10431898 3300013104 Bacteria 1211
165 Ga0157369_10022693 3300013105 Bacteria 6999
166 Ga0157369_10432163 3300013105 Bacteria 1364
167 Ga0157374_10003108 3300013296 Bacteria 13934
168 Ga0157378_10153308 3300013297 Bacteria 2148
169 Ga0163162_10012566 3300013306 Bacteria 8270
170 Ga0163162_10028381 3300013306 Bacteria 5537
171 Ga0163162_10101937 3300013306 Bacteria 2963
172 Ga0163162_10230309 3300013306 Bacteria 1983
173 Ga0163162_10305543 3300013306 Bacteria 1723
174 Ga0157372_10064423 3300013307 Bacteria 4112
175 Ga0157372_10092801 3300013307 Bacteria 3435
176 Ga0157375_10066403 3300013308 Bacteria 3601
177 Ga0157375_10090664 3300013308 Bacteria 3116
178 Ga0157375_10118615 3300013308 Bacteria 2753
179 Ga0182008_10006764 3300014497 Bacteria 6380
180 Ga0182008_10007832 3300014497 Bacteria 5873
181 Ga0182008_10147580 3300014497 Bacteria 1179
182 Ga0182008_10254056 3300014497 Bacteria 907
183 Ga0157377_10001539 3300014745 Bacteria 10025
184 Ga0157379_10487384 3300014968 Bacteria 1141
185 Ga0157376_10006686 3300014969 Bacteria 8161
186 Ga0157376_10652835 3300014969 Bacteria 1053
187 Ga0182006_1000007 3300015261 Bacteria 452190
188 Ga0182007_10001496 3300015262 Bacteria 12509
189 Ga0182007_10001829 3300015262 Bacteria 11101
190 Ga0182007_10002638 3300015262 Bacteria 8809
191 Ga0182005_1000010 3300015265 Bacteria 434103
192 Ga0182005_1019707 3300015265 Bacteria 1858
193 Ga0183362_10003 3300015683 Bacteria 977584
194 Ga0163161_10001866 3300017792 Bacteria 15379
195 Ga0163161_10012281 3300017792 Bacteria 5944
196 Ga0163161_10025897 3300017792 Bacteria 4153
197 Ga0163161_10029349 3300017792 Bacteria 3910
198 Ga0163161_10060685 3300017792 Bacteria 2753
199 Ga0163161_10148443 3300017792 Bacteria 1780
200 Ga0209435_100002 3300025206 Bacteria 794178
201 Ga0209436_101922 3300025208 Bacteria 6696
202 Ga0209436_102444 3300025208 Bacteria 5582
203 Ga0209672_107033 3300025228 Bacteria 1773
204 Ga0209147_101277 3300025229 Bacteria 9822
205 Ga0209437_108392 3300025233 Bacteria 1654
206 Ga0209258_100009 3300025242 Bacteria 996276
207 Ga0209258_100072 3300025242 Bacteria 274355
208 Ga0207425_1000009 3300025245 Bacteria 593135
209 Ga0207425_1000068 3300025245 Bacteria 124067
210 Ga0207425_1000874 3300025245 Bacteria 14727
211 Ga0207425_1002707 3300025245 Bacteria 6052
212 Ga0207425_1004112 3300025245 Bacteria 4451
213 Ga0207425_1007113 3300025245 Bacteria 2989
214 Ga0209646_1000001 3300025246 Bacteria 3092932
215 Ga0209026_1000001 3300025250 Bacteria 1228671
216 Ga0209148_1000007 3300025254 Bacteria 1592273
217 Ga0209759_1000001 3300025256 Bacteria 2799452
218 Ga0209129_1000024 3300025258 Bacteria 417268
219 Ga0209129_1000061 3300025258 Bacteria 246061
220 Ga0209129_1010446 3300025258 Bacteria 2314
221 Ga0209129_1014644 3300025258 Bacteria 1660
222 Ga0209129_1024078 3300025258 Bacteria 1076
223 Ga0209565_1000032 3300025263 Bacteria 316777
224 Ga0209565_1000098 3300025263 Bacteria 132021
225 Ga0209565_1000128 3300025263 Bacteria 108959
226 Ga0209565_1000574 3300025263 Bacteria 24961
227 Ga0209565_1001099 3300025263 Bacteria 13330
228 Ga0209565_1002417 3300025263 Bacteria 6760
229 Ga0209565_1006405 3300025263 Bacteria 3305
230 Ga0209455_1000031 3300025272 Bacteria 519952
231 Ga0209455_1000053 3300025272 Bacteria 365949
232 Ga0209673_1000008 3300025273 Bacteria 626013
233 Ga0209673_1000029 3300025273 Bacteria 351978
234 Ga0209673_1000058 3300025273 Bacteria 269028
235 Ga0209673_1000410 3300025273 Bacteria 75829
236 Ga0209673_1000705 3300025273 Bacteria 47171
237 Ga0209673_1001185 3300025273 Bacteria 28137
238 Ga0209673_1002297 3300025273 Bacteria 13626
239 Ga0209673_1005091 3300025273 Bacteria 6754
240 Ga0209673_1066570 3300025273 Bacteria 875
241 Ga0209130_1000043 3300025284 Bacteria 254257
242 Ga0209130_1000072 3300025284 Bacteria 175726
243 Ga0209130_1000295 3300025284 Bacteria 60748
244 Ga0209130_1001692 3300025284 Bacteria 13338
245 Ga0209130_1002605 3300025284 Bacteria 8731
246 Ga0209675_1000010 3300025291 Bacteria 541927
247 Ga0209675_1000019 3300025291 Bacteria 351950
248 Ga0209675_1000099 3300025291 Bacteria 128911
249 Ga0209675_1000151 3300025291 Bacteria 91172
250 Ga0209675_1000381 3300025291 Bacteria 36963
251 Ga0209675_1000431 3300025291 Bacteria 33567
252 Ga0209675_1000831 3300025291 Bacteria 20312
253 Ga0209676_1000023 3300025292 Bacteria 589732
254 Ga0209676_1000028 3300025292 Bacteria 559745
255 Ga0209676_1000333 3300025292 Bacteria 90785
256 Ga0209676_1003737 3300025292 Bacteria 9056
257 Ga0209676_1040558 3300025292 Bacteria 1310
258 Ga0209676_1054982 3300025292 Bacteria 1022
259 Ga0209025_1000289 3300025294 Bacteria 113555
260 Ga0209025_1000685 3300025294 Bacteria 58093
261 Ga0209025_1003627 3300025294 Bacteria 14367
262 Ga0209025_1010777 3300025294 Bacteria 6142
263 Ga0209025_1011304 3300025294 Bacteria 5901
264 Ga0209025_1011996 3300025294 Bacteria 5618
265 Ga0209025_1017710 3300025294 Bacteria 4092
266 Ga0209564_1000010 3300025295 Bacteria 885399
267 Ga0209564_1000067 3300025295 Bacteria 311242
268 Ga0209564_1000209 3300025295 Bacteria 133651
269 Ga0209564_1000291 3300025295 Bacteria 101831
270 Ga0209564_1000315 3300025295 Bacteria 95095
271 Ga0209564_1000724 3300025295 Bacteria 47354
272 Ga0209564_1004187 3300025295 Bacteria 9003
273 Ga0209564_1005390 3300025295 Bacteria 7329
274 Ga0209564_1029662 3300025295 Bacteria 1715
275 Ga0209758_1000049 3300025297 Bacteria 345104
276 Ga0209758_1000101 3300025297 Bacteria 225913
277 Ga0209758_1000281 3300025297 Bacteria 100826
278 Ga0209758_1001181 3300025297 Bacteria 33038
279 Ga0209050_1000022 3300025298 Bacteria 565239
280 Ga0209050_1000040 3300025298 Bacteria 408492
281 Ga0209050_1000123 3300025298 Bacteria 195061
282 Ga0209050_1000303 3300025298 Bacteria 101498
283 Ga0209050_1004977 3300025298 Bacteria 8647
284 Ga0209050_1047024 3300025298 Bacteria 1128
285 Ga0209256_1000001 3300025299 Bacteria 2166974
286 Ga0209256_1000018 3300025299 Bacteria 568467
287 Ga0209256_1000058 3300025299 Bacteria 272934
288 Ga0209256_1000088 3300025299 Bacteria 217236
289 Ga0209256_1000253 3300025299 Bacteria 94918
290 Ga0209256_1001069 3300025299 Bacteria 31758
291 Ga0209256_1003581 3300025299 Bacteria 10711
292 Ga0207426_1000038 3300025302 Bacteria 441522
293 Ga0207426_1000053 3300025302 Bacteria 384818
294 Ga0207426_1000319 3300025302 Bacteria 92696
295 Ga0207426_1002753 3300025302 Bacteria 10636
296 Ga0209051_1000013 3300025303 Bacteria 565239
297 Ga0209051_1000015 3300025303 Bacteria 546798
298 Ga0209051_1000056 3300025303 Bacteria 271616
299 Ga0209051_1000545 3300025303 Bacteria 46076
300 Ga0209051_1000757 3300025303 Bacteria 34605
301 Ga0209257_1000042 3300025304 Bacteria 537149
302 Ga0209257_1000054 3300025304 Bacteria 416957
303 Ga0209257_1004784 3300025304 Bacteria 10090
304 Ga0209257_1008331 3300025304 Bacteria 5933
305 Ga0209257_1014942 3300025304 Bacteria 3281
306 Ga0207656_10107763 3300025321 Bacteria 1284
307 Ga0207655_1001917 3300025728 Bacteria 17826
308 Ga0207655_1004477 3300025728 Bacteria 9895
309 Ga0207682_10219945 3300025893 Bacteria 878
310 Ga0207682_10225060 3300025893 Bacteria 868
311 Ga0207645_10330015 3300025907 Bacteria 1019
312 Ga0207705_10134592 3300025909 Bacteria 1841
313 Ga0207705_10810221 3300025909 Bacteria 727
314 Ga0207695_10156799 3300025913 Bacteria 2211
315 Ga0207671_10078870 3300025914 Bacteria 2467
316 Ga0207671_10350948 3300025914 Bacteria 1170
317 Ga0207657_10022456 3300025919 Bacteria 5901
318 Ga0207649_10319557 3300025920 Bacteria 1140
319 Ga0207681_10025868 3300025923 Bacteria 3780
320 Ga0207650_10124563 3300025925 Bacteria 2010
321 Ga0207650_10401082 3300025925 Bacteria 1135
322 Ga0207659_10537437 3300025926 Bacteria 992
323 Ga0207687_10092852 3300025927 Bacteria 2205
324 Ga0207644_10270171 3300025931 Bacteria 1362
325 Ga0207690_10001407 3300025932 Bacteria 15134
326 Ga0207690_10156862 3300025932 Bacteria 1693
327 Ga0207690_10817484 3300025932 Bacteria 771
328 Ga0207706_10013767 3300025933 Bacteria 7340
329 Ga0207706_10043409 3300025933 Bacteria 3984
330 Ga0207686_10435813 3300025934 Bacteria 1005
331 Ga0207709_10000211 3300025935 Bacteria 75562
332 Ga0207709_10008426 3300025935 Bacteria 5703
333 Ga0207669_10384508 3300025937 Bacteria 1094
334 Ga0207691_10038575 3300025940 Bacteria 4421
335 Ga0207711_10679695 3300025941 Bacteria 960
336 Ga0207689_10134979 3300025942 Bacteria 2032
337 Ga0207689_10234466 3300025942 Bacteria 1517
338 Ga0207689_10247586 3300025942 Bacteria 1474
339 Ga0207679_10019974 3300025945 Bacteria 4513
340 Ga0207679_10068877 3300025945 Bacteria 2660
341 Ga0207667_10169047 3300025949 Bacteria 2247
342 Ga0207651_10591922 3300025960 Bacteria 969
343 Ga0207651_10694344 3300025960 Bacteria 896
344 Ga0207651_11044788 3300025960 Bacteria 731
345 Ga0207668_10396451 3300025972 Bacteria 1166
346 Ga0207658_10204356 3300025986 Bacteria 1651
347 Ga0207658_10204730 3300025986 Bacteria 1650
348 Ga0207658_10424204 3300025986 Bacteria 1173
349 Ga0207658_10890248 3300025986 Bacteria 810
350 Ga0207677_10047551 3300026023 Bacteria 2882
351 Ga0207677_10908045 3300026023 Bacteria 794
352 Ga0207703_10560627 3300026035 Bacteria 1078
353 Ga0207639_10065284 3300026041 Bacteria 2825
354 Ga0207639_10518974 3300026041 Bacteria 1091
355 Ga0207678_10425847 3300026067 Bacteria 1151
356 Ga0207641_10023894 3300026088 Bacteria 5039
357 Ga0207648_10035163 3300026089 Bacteria 4415
358 Ga0207648_10204878 3300026089 Bacteria 1750
359 Ga0207676_10008819 3300026095 Bacteria 7179
360 Ga0207674_10201153 3300026116 Bacteria 1941
361 Ga0207674_10321299 3300026116 Bacteria 1497
362 Ga0207674_10487144 3300026116 Bacteria 1192
363 Ga0207683_10159858 3300026121 Bacteria 2036
364 Ga0207683_10206870 3300026121 Bacteria 1785
365 Ga0207683_10265815 3300026121 Bacteria 1567
366 Ga0207683_10466133 3300026121 Bacteria 1165
367 Ga0207683_10705955 3300026121 Bacteria 935
368 Ga0207698_10321052 3300026142 Bacteria 1450
369 Ga0209281_1039633 3300027111 Bacteria 799
370 Ga0209282_1000014 3300027666 Bacteria 207318
371 Ga0207428_10186494 3300027907 Bacteria 1565
372 Ga0207428_10306908 3300027907 Bacteria 1174
373 Ga0268266_10019121 3300028379 Bacteria 5833
374 Ga0268266_10109565 3300028379 Bacteria 2445
375 Ga0268266_10372468 3300028379 Bacteria 1345
376 Ga0268264_10252476 3300028381 Bacteria 1639
377 Ga0307515_10004716 3300028794 Bacteria 27939
378 Ga0307515_10018282 3300028794 Bacteria 12704
379 Ga0307515_10074074 3300028794 Bacteria 4562
380 Ga0307515_10107499 3300028794 Bacteria 3297
381 Ga0307512_10068702 3300030522 Bacteria 2655
382 Ga0307512_10251743 3300030522 Bacteria 879
383 Ga0316177_1143531 3300030731 Bacteria 6959
384 Ga0316176_1081827 3300030732 Bacteria 3930
385 Ga0314311_1166419 3300030733 Bacteria 9043
386 Ga0316180_1137399 3300030736 Bacteria 1944
387 Ga0316183_1100974 3300030742 Bacteria 3193
388 Ga0316181_1019718 3300030744 Bacteria 4721
389 Ga0316182_1026069 3300030745 Bacteria 722
390 Ga0307513_10000038 3300031456 Bacteria 174780
391 Ga0307513_10115538 3300031456 Bacteria 2666
392 Ga0307513_10128755 3300031456 Bacteria 2481
393 Ga0307509_10000991 3300031507 Bacteria 48763
394 Ga0307509_10048449 3300031507 Bacteria 4563
395 Ga0307509_10416699 3300031507 Bacteria 1045
396 Ga0307509_10481766 3300031507 Bacteria 928
397 Ga0307408_100000122 3300031548 Bacteria 85798
398 Ga0307408_100065751 3300031548 Bacteria 2660
399 Ga0307408_100075215 3300031548 Bacteria 2508
400 Ga0307408_100217026 3300031548 Bacteria 1558
401 Ga0307508_10002244 3300031616 Bacteria 20612
402 Ga0307508_10007239 3300031616 Bacteria 10332
403 Ga0307514_10005041 3300031649 Bacteria 11946
404 Ga0307514_10124627 3300031649 Bacteria 1788
405 Ga0307516_10124091 3300031730 Bacteria 2369
406 Ga0307405_10011823 3300031731 Bacteria 4594
407 Ga0307405_10032034 3300031731 Bacteria 3102
408 Ga0307405_10053389 3300031731 Bacteria 2517
409 Ga0307405_10096450 3300031731 Bacteria 1972
410 Ga0307413_10177058 3300031824 Bacteria 1516
411 Ga0307518_10228812 3300031838 Bacteria 1206
412 Ga0307406_10015826 3300031901 Bacteria 4372
413 Ga0307406_10652477 3300031901 Bacteria 873
414 Ga0307407_10133357 3300031903 Bacteria 1592
415 Ga0307412_10024604 3300031911 Bacteria 3719
416 Ga0307412_10108605 3300031911 Bacteria 1976
417 Ga0307412_10127881 3300031911 Bacteria 1840
418 Ga0307412_10758598 3300031911 Bacteria 838
419 Ga0307409_100573298 3300031995 Bacteria 1111
420 Ga0307416_100008243 3300032002 Bacteria 6702
421 Ga0307416_100136594 3300032002 Bacteria 2219
422 Ga0307416_100435227 3300032002 Bacteria 1360
423 Ga0307414_10037797 3300032004 Bacteria 3235
424 Ga0307414_10056510 3300032004 Bacteria 2753
425 Ga0307414_10069652 3300032004 Bacteria 2529
426 Ga0307414_10322397 3300032004 Bacteria 1315
427 Ga0307414_10339661 3300032004 Bacteria 1285
428 Ga0307411_10064874 3300032005 Bacteria 2446
429 Ga0307510_10088354 3300033180 Bacteria 2958
430 Ga0373930_0053268 3300034816 Bacteria 888
431 Ga0373938_0036468 3300034957 Bacteria 1076
432 Ga0373932_0043834 3300035112 Bacteria 1302
433 Ga0373931_0035468 3300035691 Bacteria 2594
434 Ga0373931_0089255 3300035691 Bacteria 1715
435 Ga0395900_0030030 3300037418 Bacteria 5579
436 Ga0395905_0002893 3300037471 Bacteria 18759
437 Ga0395905_0008745 3300037471 Bacteria 9960
438 Ga0395905_0091128 3300037471 Bacteria 2858
439 Ga0395905_0490453 3300037471 Bacteria 1128
440 Ga0395901_0002440 3300038443 Bacteria 18848
441 Ga0395901_0528703 3300038443 Bacteria 1197
442 Ga0436361_0438991 3300039447 Bacteria 100787
443 Ga0439436_0000668 3300041404 Bacteria 9183
444 Ga0439436_0027592 3300041404 Bacteria 1660
445 Ga0439439_0015796 3300041406 Bacteria 1845
446 Ga0439439_0078325 3300041406 Bacteria 891
447 Ga0439447_017322 3300041407 Bacteria 1962
448 Ga0439447_025681 3300041407 Bacteria 1516
449 Ga0439466_0010194 3300041411 Bacteria 3495
450 Ga0439466_0032140 3300041411 Bacteria 1791
451 Ga0439465_0004974 3300041413 Bacteria 4269
452 Ga0451797_0634131 3300041453 Bacteria 1023
453 Ga0451795_0258631 3300041456 Bacteria 1649
454 Ga0451798_0022055 3300041458 Bacteria 2881
455 Ga0439431_0033822 3300041997 Bacteria 1279
456 Ga0439431_0047036 3300041997 Bacteria 1111
457 Ga0439433_0018693 3300041999 Bacteria 1543
458 Ga0439442_008635 3300042002 Bacteria 2057
459 Ga0439442_016767 3300042002 Bacteria 1511
460 Ga0439445_0000200 3300042004 Bacteria 10930
461 Ga0439432_012106 3300042006 Bacteria 2960
462 Ga0439449_0001627 3300042007 Bacteria 8807
463 Ga0439449_0001772 3300042007 Bacteria 8484
464 Ga0439449_0004482 3300042007 Bacteria 5393
465 Ga0439452_002059 3300042010 Bacteria 7639
466 Ga0439457_016362 3300042014 Bacteria 1653
467 Ga0439462_0005319 3300042015 Bacteria 3171
468 Ga0439462_0029804 3300042015 Bacteria 1443
469 Ga0450922_004273 3300042124 Bacteria 1313
470 Ga0450923_012192 3300042125 Bacteria 1560
471 Ga0450923_012263 3300042125 Bacteria 1557
472 Ga0450894_010049 3300042131 Bacteria 1227
473 Ga0450898_000958 3300042134 Bacteria 3630
474 Ga0450898_002604 3300042134 Bacteria 2528
475 Ga0450906_001912 3300042145 Bacteria 4557
476 Ga0450906_008396 3300042145 Bacteria 2000
477 Ga0450910_018152 3300042147 Bacteria 1050
478 Ga0439446_0010580 3300042156 Bacteria 2487
479 Ga0439446_0016721 3300042156 Bacteria 2044
480 Ga0439446_0156850 3300042156 Bacteria 751
481 Ga0439458_0064123 3300042157 Bacteria 921
482 Ga0439434_0005110 3300042435 Bacteria 3838
483 Ga0439434_0011135 3300042435 Bacteria 2656
484 Ga0450893_0019291 3300042532 Bacteria 1166
485 Ga0466982_0364230 3300044672 Bacteria 797
486 Ga0453683_0005431 3300044673 Bacteria 8894
487 Ga0466965_0378277 3300044683 Bacteria 779
488 Ga0466966_0050317 3300044684 Bacteria 2651
489 Ga0453684_0070122 3300044712 Bacteria 4440
490 Ga0466971_0112116 3300044719 Bacteria 1259
491 Ga0466970_0098965 3300044765 Bacteria 1587
492 Ga0466957_0088390 3300044842 Bacteria 1939
493 Ga0451576_0010377 3300045051 Bacteria 10695
494 Ga0451576_0941441 3300045051 Bacteria 906
495 Ga0495617_025019 3300046452 Bacteria 2013
496 Ga0495627_113570 3300046453 Bacteria 768
497 Ga0495592_0000083 3300046454 Bacteria 83092
498 Ga0495603_0158581 3300046455 Bacteria 1313
499 Ga0495590_0000014 3300046457 Bacteria 258314
500 Ga0495590_0045181 3300046457 Bacteria 1536
501 Ga0495638_0000064 3300046460 Bacteria 180807
502 Ga0495638_0127146 3300046460 Bacteria 1501
503 Ga0495638_0130434 3300046460 Bacteria 1477
504 Ga0495650_0000283 3300046471 Bacteria 96503
505 Ga0495650_0001144 3300046471 Bacteria 28755
506 Ga0495650_0001153 3300046471 Bacteria 28463
507 Ga0495650_0081307 3300046471 Bacteria 1248
508 Ga0495582_0167560 3300046473 Bacteria 1250
509 Ga0495605_0000127 3300046474 Bacteria 100664
510 Ga0495605_0004750 3300046474 Bacteria 7945
511 Ga0495639_0002158 3300046475 Bacteria 8677
512 Ga0495639_0030125 3300046475 Bacteria 2411
513 Ga0495584_0031012 3300046491 Bacteria 2705
514 Ga0495584_0251466 3300046491 Bacteria 898
515 Ga0495607_0000853 3300046501 Bacteria 28749
516 Ga0495607_0000905 3300046501 Bacteria 27603
517 Ga0495607_0076345 3300046501 Bacteria 1853
518 Ga0495607_0161083 3300046501 Bacteria 1140
519 Ga0495583_0000287 3300046506 Bacteria 80398
520 Ga0495583_0000928 3300046506 Bacteria 34428
521 Ga0495583_0005050 3300046506 Bacteria 9116
522 Ga0495606_0000353 3300046507 Bacteria 78700
523 Ga0495606_0000933 3300046507 Bacteria 43050
524 Ga0495606_0001708 3300046507 Bacteria 28313
525 Ga0495606_0006490 3300046507 Bacteria 10762
526 Ga0495606_0047455 3300046507 Bacteria 2830
527 Ga0495606_0092112 3300046507 Bacteria 1862
528 Ga0495606_0105255 3300046507 Bacteria 1710
529 Ga0495610_0001111 3300046512 Bacteria 24494
530 Ga0495610_0017794 3300046512 Bacteria 4041
531 Ga0495610_0054754 3300046512 Bacteria 1926
532 Ga0495616_0032225 3300046513 Bacteria 2740
533 Ga0495616_0046308 3300046513 Bacteria 2195
534 Ga0495620_0008764 3300046515 Bacteria 5413
535 Ga0495620_0071350 3300046515 Bacteria 1420
536 Ga0495630_0487849 3300046517 Bacteria 945
537 Ga0495631_0006138 3300046518 Bacteria 6228
538 Ga0495632_0002315 3300046519 Bacteria 14654
539 Ga0495637_0000430 3300046520 Bacteria 30664
540 Ga0495643_0000108 3300046522 Bacteria 136032
541 Ga0495643_0001013 3300046522 Bacteria 28723
542 Ga0495643_0075869 3300046522 Bacteria 1759
543 Ga0495644_0017049 3300046523 Bacteria 2779
544 Ga0495648_0000006 3300046524 Bacteria 361208
545 Ga0495648_0001956 3300046524 Bacteria 19609
546 Ga0495648_0009458 3300046524 Bacteria 7548
547 Ga0495642_0022344 3300046528 Bacteria 2492
548 Ga0495654_0000131 3300046530 Bacteria 80339
549 Ga0495654_0013618 3300046530 Bacteria 4349
550 Ga0495587_0062135 3300046536 Bacteria 2188
551 Ga0495609_0000670 3300046538 Bacteria 26591
552 Ga0495609_0020155 3300046538 Bacteria 3081
553 Ga0495609_0042404 3300046538 Bacteria 2043
554 Ga0495609_0045900 3300046538 Bacteria 1957
555 Ga0495621_0011454 3300046539 Bacteria 2744
556 Ga0495621_0012148 3300046539 Bacteria 2680
557 Ga0495597_0000091 3300046542 Bacteria 80111
558 Ga0495597_0007196 3300046542 Bacteria 5675
559 Ga0495622_0000322 3300046557 Bacteria 35249
560 Ga0495622_0015976 3300046557 Bacteria 3491
561 Ga0495622_0043332 3300046557 Bacteria 2092
562 Ga0495633_0000158 3300046558 Bacteria 88850
563 Ga0495633_0002191 3300046558 Bacteria 13994
564 Ga0495633_0002981 3300046558 Bacteria 11576
565 Ga0495633_0008695 3300046558 Bacteria 5694
566 Ga0495633_0009399 3300046558 Bacteria 5403
567 Ga0495656_0000757 3300046615 Bacteria 10411
568 Ga0495668_0000029 3300046616 Bacteria 279128
569 Ga0495668_0000119 3300046616 Bacteria 118812
570 Ga0495668_0000209 3300046616 Bacteria 84817
571 Ga0495668_0021464 3300046616 Bacteria 3702
572 Ga0495668_0036766 3300046616 Bacteria 2742
573 Ga0495668_0085253 3300046616 Bacteria 1733
574 Ga0495611_0105950 3300046648 Bacteria 1307
575 Ga0495611_0324005 3300046648 Bacteria 709
576 Ga0495625_0000871 3300046660 Bacteria 41066
577 Ga0495625_0000950 3300046660 Bacteria 38751
578 Ga0495625_0001595 3300046660 Bacteria 26843
579 Ga0495625_0002825 3300046660 Bacteria 18281
580 Ga0495625_0013051 3300046660 Bacteria 6697
581 Ga0495625_0109606 3300046660 Bacteria 1888
582 Ga0495625_0113945 3300046660 Bacteria 1846
583 Ga0495625_0118296 3300046660 Bacteria 1805
584 Ga0495625_0164648 3300046660 Bacteria 1483
585 Ga0495635_0364364 3300046663 Bacteria 963
586 Ga0495659_0000188 3300046664 Bacteria 26796
587 Ga0495659_0001672 3300046664 Bacteria 7432
588 Ga0495659_0005629 3300046664 Bacteria 3948
589 Ga0495661_0062258 3300046665 Bacteria 2211
590 Ga0495588_0067890 3300046674 Bacteria 1851
591 Ga0495588_0081687 3300046674 Bacteria 1687
592 Ga0495646_0135167 3300046680 Bacteria 1384
593 Ga0495646_0137557 3300046680 Bacteria 1369
594 Ga0495658_0011396 3300046683 Bacteria 4471
595 Ga0495669_0002335 3300046684 Bacteria 7776
596 Ga0495624_0033039 3300046690 Bacteria 3352
597 Ga0495670_0029832 3300046691 Bacteria 2709
598 Ga0495670_0036893 3300046691 Bacteria 2436
599 Ga0495670_0062358 3300046691 Bacteria 1875
600 Ga0495670_0118241 3300046691 Bacteria 1376
601 Ga0495671_0003751 3300046692 Bacteria 9235
602 Ga0495671_0010447 3300046692 Bacteria 5142
603 Ga0495671_0070745 3300046692 Bacteria 1714
604 Ga0495671_0313354 3300046692 Bacteria 754
605 Ga0495649_0011480 3300046694 Bacteria 5192
606 Ga0495649_0021278 3300046694 Bacteria 3634
607 Ga0495649_0048026 3300046694 Bacteria 2320
608 Ga0495649_0208043 3300046694 Bacteria 1014
609 Ga0495589_0030229 3300046794 Bacteria 2729
610 Ga0495660_0012736 3300046810 Bacteria 4879
611 Ga0495660_0042564 3300046810 Bacteria 2509
612 Ga0495660_0043239 3300046810 Bacteria 2486
613 Ga0495660_0071931 3300046810 Bacteria 1832
614 Ga0495660_0114732 3300046810 Bacteria 1370
615 Ga0495660_0159839 3300046810 Bacteria 1106
616 Ga0495636_0002494 3300047318 Bacteria 7054
617 Ga0495636_0022866 3300047318 Bacteria 2529
618 Ga0495672_0000088 3300047320 Bacteria 153860
619 Ga0495672_0000295 3300047320 Bacteria 68246
620 Ga0495672_0009310 3300047320 Bacteria 7131
621 Ga0495672_0023923 3300047320 Bacteria 3945
622 Ga0495672_0067974 3300047320 Bacteria 2027
623 Ga0495683_0000892 3300047323 Bacteria 21047
624 Ga0495687_000042 3300047443 Bacteria 218868
625 Ga0495687_013309 3300047443 Bacteria 4305
626 Ga0495687_037736 3300047443 Bacteria 2149
627 Ga0495677_0014959 3300047445 Bacteria 2821
628 Ga0495679_018699 3300047446 Bacteria 2452
629 Ga0495685_000081 3300047447 Bacteria 36040
630 Ga0495685_002774 3300047447 Bacteria 5523
631 Ga0495673_0003259 3300047469 Bacteria 10804
632 Ga0495681_0007092 3300047470 Bacteria 7230
633 Ga0495686_0000212 3300047472 Bacteria 107418
634 Ga0495686_0001211 3300047472 Bacteria 29663
635 Ga0495686_0004528 3300047472 Bacteria 11390
636 Ga0495686_0072272 3300047472 Bacteria 2121
637 Ga0495686_0072594 3300047472 Bacteria 2116
638 Ga0495686_0222502 3300047472 Bacteria 1073
639 Ga0495593_0055127 3300047673 Bacteria 2093
640 Ga0495614_0024137 3300048089 Bacteria 2625
641 Ga0495614_0061498 3300048089 Bacteria 1614
642 Ga0496100_0195133 3300048903 Bacteria 1472
643 Ga0496101_0170343 3300048904 Bacteria 1673
644 Ga0496102_0014383 3300048905 Bacteria 6875
645 Ga0496102_0415378 3300048905 Bacteria 1264
646 Ga0496104_0013037 3300048907 Bacteria 7486
647 Ga0496105_0011369 3300048908 Bacteria 7031
648 Ga0496106_0184482 3300048909 Bacteria 1657
649 Ga0496107_0240174 3300048910 Bacteria 1348
650 Ga0496108_0064875 3300048911 Bacteria 3077
651 Ga0496109_0505860 3300048912 Bacteria 1140
652 Ga0496109_0719244 3300048912 Bacteria 936
653 Ga0496110_0982272 3300048913 Bacteria 751
654 Ga0496111_0294871 3300048914 Bacteria 1202
655 Ga0496114_0227951 3300048917 Bacteria 1636
656 Ga0496115_0071704 3300048918 Bacteria 2810
657 Ga0496115_0656212 3300048918 Bacteria 829
658 Ga0496116_0028608 3300048919 Bacteria 4033
659 Ga0496116_0071652 3300048919 Bacteria 2193
660 Ga0496116_0312195 3300048919 Bacteria 741
661 Ga0496117_0000005 3300048920 Bacteria 777468
662 Ga0496118_0000022 3300048921 Bacteria 438602
663 Ga0496118_0009732 3300048921 Bacteria 9647
664 Ga0496118_0113107 3300048921 Bacteria 1794
665 Ga0496118_0316806 3300048921 Bacteria 848
666 Ga0496120_0138164 3300048923 Bacteria 1240
667 Ga0496121_0047683 3300048924 Bacteria 3652
668 Ga0496121_0166401 3300048924 Bacteria 1606
669 Ga0496121_0362049 3300048924 Bacteria 962
670 Ga0496122_0000612 3300048925 Bacteria 73307
671 Ga0496122_0009918 3300048925 Bacteria 9923
672 Ga0496122_0356376 3300048925 Bacteria 761
673 Ga0496123_0000274 3300048926 Bacteria 101783
674 Ga0496123_0020234 3300048926 Bacteria 5212
675 Ga0496124_0018117 3300048927 Bacteria 6609
676 Ga0496124_0073398 3300048927 Bacteria 2831
677 Ga0496124_0146250 3300048927 Bacteria 1859
678 Ga0496125_0028804 3300048928 Bacteria 5005
679 Ga0496125_0051111 3300048928 Bacteria 3412
680 Ga0496125_0235471 3300048928 Bacteria 1167
681 Ga0496125_0333316 3300048928 Bacteria 914
682 Ga0496126_0722837 3300048929 Bacteria 772
683 Ga0501306_008736 3300049127 Bacteria 1242
684 Ga0501308_008683 3300049128 Bacteria 1093
685 Ga0501309_025636 3300049129 Bacteria 848
686 Ga0501305_027674 3300049161 Bacteria 870
687 Ga0501305_043813 3300049161 Bacteria 735
688 Ga0495678_000259 3300049459 Bacteria 59034
689 Ga0495678_008378 3300049459 Bacteria 5222
690 Ga0495678_058348 3300049459 Bacteria 1458
691 Ga0495682_0002024 3300049460 Bacteria 9991
692 Ga0495682_0004316 3300049460 Bacteria 6120
693 Ga0501292_006634 3300049515 Bacteria 1651
694 Ga0501311_008121 3300049527 Bacteria 1223
695 Ga0501311_046900 3300049527 Bacteria 668
696 Ga0501314_013548 3300049530 Bacteria 791
697 Ga0501315_007576 3300049531 Bacteria 1240
698 Ga0501315_017802 3300049531 Bacteria 932
699 Ga0501320_005849 3300049536 Bacteria 1134
700 Ga0501323_006400 3300049539 Bacteria 1315
701 Ga0501323_011804 3300049539 Bacteria 1059
702 Ga0501036_0268975 3300049572 Bacteria 1427
703 Ga0501039_0266499 3300049575 Bacteria 1346
704 Ga0501042_0050325 3300049578 Bacteria 2972
705 Ga0501048_0082014 3300049582 Bacteria 2275
706 Ga0501072_0182306 3300049588 Bacteria 1675
707 Ga0501077_0185649 3300049593 Bacteria 1321
708 Ga0501222_025079 3300049662 Bacteria 807
709 Ga0501227_003408 3300049665 Bacteria 3447
710 Ga0501227_028620 3300049665 Bacteria 1324
711 Ga0501230_005166 3300049667 Bacteria 1833
712 Ga0501238_002242 3300049671 Bacteria 2293
713 Ga0501081_0204371 3300049743 Bacteria 1433
714 Ga0501269_010451 3300049766 Bacteria 1129
715 Ga0501279_007283 3300049775 Bacteria 1468
716 nmdc:mga03683_217769_c1 3300050489 Bacteria 880
717 nmdc:mga03683_52726_c1 3300050489 Bacteria 1701
718 nmdc:mga03n38_210331_c1 3300050490 Bacteria 1011
719 nmdc:mga03n38_237862_c1 3300050490 Bacteria 957
720 nmdc:mga03n38_324952_c1 3300050490 Bacteria 832
721 nmdc:mga00v17_111385_c1 3300050491 Bacteria 1737
722 nmdc:mga00v17_131135_c1 3300050491 Bacteria 1602
723 nmdc:mga00v17_261312_c1 3300050491 Bacteria 1123
724 nmdc:mga00v17_272718_c1 3300050491 Bacteria 1098
725 nmdc:mga0yw44_54808_c1 3300050492 Bacteria 2425
726 nmdc:mga0k408_13069_c2 3300050493 Bacteria 2720
727 nmdc:mga0k408_25360_c1 3300050493 Bacteria 3358
728 nmdc:mga0k408_3060_c1 3300050493 Bacteria 8871
729 nmdc:mga0k408_31969_c1 3300050493 Bacteria 3007
730 nmdc:mga06z11_331518_c1 3300050494 Bacteria 909
731 nmdc:mga06z11_355351_c1 3300050494 Bacteria 878
732 nmdc:mga07m45_25479_c1 3300050496 Bacteria 3244
733 nmdc:mga07m45_3314_c1 3300050496 Bacteria 7759
734 nmdc:mga07m45_38060_c1 3300050496 Bacteria 2684
735 nmdc:mga07m45_3823_c1 3300050496 Bacteria 7291
736 nmdc:mga07m45_42531_c1 3300050496 Bacteria 2547
737 nmdc:mga07m45_466522_c1 3300050496 Bacteria 732
738 nmdc:mga07m45_67535_c1 3300050496 Bacteria 2032
739 Ga0500610_0219697 3300053079 Bacteria 900
740 Ga0500635_0000030 3300053080 Bacteria 99936
741 Ga0500578_0000363 3300053086 Bacteria 55670
742 Ga0500644_0087237 3300053088 Bacteria 1160
743 Ga0500646_0015224 3300053090 Bacteria 2002
744 Ga0500647_0028928 3300053091 Bacteria 2626
745 Ga0500651_0011180 3300053093 Bacteria 5404
746 Ga0500651_0016838 3300053093 Bacteria 4499
747 Ga0500651_0075767 3300053093 Bacteria 2089
748 Ga0500641_0067121 3300053096 Bacteria 1503
749 Ga0500641_0070578 3300053096 Bacteria 1470
750 Ga0500555_031764 3300053103 Bacteria 1495
751 Ga0500560_066461 3300053107 Bacteria 1183
752 Ga0500571_002284 3300053110 Bacteria 9449
753 Ga0500593_000312 3300053117 Bacteria 19544
754 Ga0500594_0001013 3300053118 Bacteria 6025
755 Ga0500594_0001867 3300053118 Bacteria 4566
756 Ga0500594_0012374 3300053118 Bacteria 2009
757 Ga0500594_0080478 3300053118 Bacteria 973
758 Ga0500594_0108434 3300053118 Bacteria 861
759 Ga0500607_009334 3300053121 Bacteria 5907
760 Ga0500607_055142 3300053121 Bacteria 2102
761 Ga0500608_197886 3300053122 Bacteria 834
762 Ga0500618_003147 3300053125 Bacteria 5807
763 Ga0500623_146878 3300053127 Bacteria 978
764 Ga0500626_019470 3300053128 Bacteria 3012
765 Ga0500628_002666 3300053129 Bacteria 2944
766 Ga0500628_055474 3300053129 Bacteria 953
767 Ga0500642_0020334 3300053130 Bacteria 2607
768 Ga0500652_003742 3300053131 Bacteria 4635
769 Ga0500655_000872 3300053133 Bacteria 5856
770 Ga0500658_0000730 3300053134 Bacteria 13540
771 Ga0500559_0000019 3300053136 Bacteria 134862
772 Ga0500559_0004500 3300053136 Bacteria 6598
773 Ga0500559_0018151 3300053136 Bacteria 2973
774 Ga0500568_0001792 3300053139 Bacteria 13230
775 Ga0500568_0023959 3300053139 Bacteria 2589
776 Ga0500568_0060467 3300053139 Bacteria 1467
777 Ga0500573_0251675 3300053140 Bacteria 910
778 Ga0500574_026855 3300053141 Bacteria 1514
779 Ga0500577_0037393 3300053142 Bacteria 1745
780 Ga0500586_002852 3300053145 Bacteria 3987
781 Ga0500604_0004794 3300053151 Bacteria 3585
782 Ga0500616_0027300 3300053153 Bacteria 3152
783 Ga0500622_0001269 3300053156 Bacteria 20606
784 Ga0500622_0031643 3300053156 Bacteria 2776
785 Ga0500622_0152310 3300053156 Bacteria 1092
786 Ga0500627_0041172 3300053158 Bacteria 1985
787 Ga0500634_0005209 3300053161 Bacteria 6141
788 Ga0500634_0042082 3300053161 Bacteria 2478
789 Ga0500638_006538 3300053162 Bacteria 4780
790 Ga0500636_0028728 3300053177 Bacteria 3284
791 Ga0500636_0254012 3300053177 Bacteria 894
792 Ga0500625_121994 3300053729 Bacteria 1045
793 Ga0500645_001028 3300053730 Bacteria 15622
794 Ga0501084_1053516 3300054114 Bacteria 683
795 Ga0500661_007849 3300055283 Bacteria 1968
796 Ga0587084_000637 3300059477 Bacteria 2906
797 Ga0587066_032534 3300059490 Bacteria 939
798 Ga0587070_063946 3300059491 Bacteria 768
799 Ga0587073_0027859 3300059492 Bacteria 1143
800 Ga0587077_000886 3300059493 Bacteria 2941
801 Ga0587082_020617 3300059504 Bacteria 1070
802 Ga0587082_027390 3300059504 Bacteria 971
803 Ga0587083_0044276 3300059505 Bacteria 945
804 Ga0587085_016072 3300059506 Bacteria 1078
805 Ga0587086_011719 3300059507 Bacteria 1079
806 Ga0587090_000538 3300059510 Bacteria 3238
807 Ga0587091_006879 3300059511 Bacteria 1617
808 Ga0587091_069392 3300059511 Bacteria 768
809 Ga0587092_003071 3300059512 Bacteria 1860
810 Ga0587094_008011 3300059513 Bacteria 1311
811 Ga0587115_035574 3300059626 Bacteria 758
812 Ga0587062_005863 3300059639 Bacteria 1375
813 Ga0587067_008438 3300059640 Bacteria 1506
814 Ga0587068_003426 3300059641 Bacteria 2023
815 Ga0587068_011727 3300059641 Bacteria 1328
816 Ga0587068_020124 3300059641 Bacteria 1088
817 Ga0587069_013484 3300059642 Bacteria 1125
818 Ga0587072_010791 3300059643 Bacteria 1482
819 Ga0587072_093925 3300059643 Bacteria 665
820 Ga0587076_001426 3300059645 Bacteria 2428
821 Ga0587111_0001149 3300060346 Bacteria 3031
822 2511244643 2511231002 Bacteria 5042903
823 2587731718 2585428058 Bacteria 6853932
824 2644142440 2643221625 Bacteria 6512927
825 2644277061 2643221648 Bacteria 6521465
826 2928118008 2928115317 Bacteria 6477646
827 Ga0496114_0212422
828 JGI25155J39150_1000022
829 JGI25156J39149_1000005
830 JGI25156J39149_1007101
831 JGI25154J39366_1000017
832 JGI25157J39369_1000003
833 JGI25152J39213_1017849
834 JGI25150J39212_1001639
835 JGI25150J39212_1005198
836 JGI25150J39212_1008124
837 JGI25159J45721_1000396
838 JGI25159J45721_1005038
839 JGI25159J45721_1008343
840 JGI25151J46595_10001069
841 JGI25151J46595_10081221
842 JGI25151J46595_10084991
843 JGI25153J46596_10004229
844 JGI25153J46596_10004541
845 JGI25160J50197_1002413
846 JGI25160J50197_1033794
847 JGI25161J50226_1000095
848 JGI25161J50226_1002922
849 Ga0007409J51694_1010614
850 Ga0007416J51690_1020706
851 Ga0006562J51391_1033687
852 Ga0032354_1023833
853 Ga0055535_1000047
854 Ga0055535_1001458
855 Ga0055542_1000080
856 Ga0055529_1000148
857 Ga0055526_1000030
858 Ga0055526_1000167
859 Ga0055526_1002375
860 Ga0055526_1002601
861 Ga0055526_1003176
862 Ga0055526_1011045
863 Ga0055537_1000150
864 Ga0055537_1000205
865 Ga0055537_1000239
866 Ga0055537_1010578
867 Ga0055524_1000017
868 Ga0055524_1000073
869 Ga0055524_1001044
870 Ga0055524_1006211
871 Ga0055524_1014364
872 Ga0055536_1018344
873 Ga0055534_1000016
874 Ga0055534_1000194
875 Ga0055534_1000363
876 Ga0055534_1001058
877 Ga0055534_1003933
878 Ga0055528_1000253
879 Ga0055528_1000289
880 Ga0055528_1008808
881 Ga0055528_1014906
882 Ga0055530_10001804
883 Ga0055530_10008565
884 Ga0055530_10037309
885 Ga0055540_1000037
886 Ga0055540_1002771
887 Ga0055540_1040942
888 Ga0055531_10011377
889 Ga0055531_10023264
890 Ga0055543_1000218
891 Ga0055543_1028236
892 Ga0065165_1000805
893 Ga0065165_1037171
894 Ga0065165_1055083
895 Ga0065714_10073610
896 Ga0065704_10003100
897 Ga0070676_10194284
898 Ga0070677_10249905
899 Ga0068869_100099975
900 Ga0068869_100185274
901 Ga0070666_10349580
902 Ga0068868_100008545
903 Ga0068868_100069555
904 Ga0070660_100001068
905 Ga0070661_100005897
906 Ga0070675_100028611
907 Ga0070659_100005068
908 Ga0070659_100343187
909 Ga0070667_100024333
910 Ga0070667_100228766
911 Ga0070678_100178002
912 Ga0070678_100296001
913 Ga0070678_100327262
914 Ga0070662_100018957
915 Ga0068867_100126586
916 Ga0068867_100268214
917 Ga0068853_100344331
918 Ga0070672_100003408
919 Ga0070665_100027466
920 Ga0070665_100634191
921 Ga0070665_100814421
922 Ga0070664_100011901
923 Ga0070664_100221117
924 Ga0068857_100082461
925 Ga0068856_100134337
926 Ga0068859_100044728
927 Ga0068864_100019420
928 Ga0068866_10364797
929 Ga0068851_10023769
930 Ga0068863_100018423
931 Ga0068863_100581246
932 Ga0068860_100254189
933 Ga0068862_100052707
934 Ga0068862_101039079
935 Ga0075365_10021801
936 Ga0075368_10091162
937 Ga0075363_100050969
938 Ga0075363_100096973
939 Ga0075363_100112476
940 Ga0075363_100348596
941 Ga0075364_10092158
942 Ga0075364_10149945
943 Ga0075364_10273367
944 Ga0075364_10464517
945 Ga0075362_10007740
946 Ga0075362_10018885
947 Ga0075362_10035036
948 Ga0075369_10111044
949 Ga0075369_10210076
950 Ga0075366_10001610
951 Ga0075366_10036288
952 Ga0075366_10062614
953 Ga0075366_10141318
954 Ga0075366_10165863
955 Ga0097621_100686774
956 Ga0075370_10000182
957 Ga0075370_10035523
958 Ga0075370_10055531
959 Ga0075370_10087886
960 Ga0075370_10184141
961 Ga0097620_100044728
962 Ga0097620_101023521
963 Ga0079104_1049112
964 Ga0099826_10000033
965 Ga0099826_10126910
966 Ga0105244_10001268
967 Ga0105244_10003719
968 Ga0105245_10065399
969 Ga0105245_11056088
970 Ga0105243_10000306
971 Ga0105241_10053049
972 Ga0105241_10116335
973 Ga0105242_10108114
974 Ga0105242_10152883
975 Ga0105242_10655434
976 Ga0105248_10106946
977 Ga0105237_10027197
978 Ga0105237_10653740
979 Ga0105249_10106069
980 Ga0105239_10059436
981 Ga0105246_10029216
982 Ga0105246_10369650
983 Ga0105246_10536995
984 Ga0157326_1003197
985 Ga0157373_10049442
986 Ga0157371_10065886
987 Ga0157370_10006343
988 Ga0157370_10301385
989 Ga0157370_10362345
990 Ga0157370_10431898
991 Ga0157369_10022693
992 Ga0157369_10432163
993 Ga0157374_10003108
994 Ga0157378_10153308
995 Ga0163162_10012566
996 Ga0163162_10028381
997 Ga0163162_10101937
998 Ga0163162_10230309
999 Ga0163162_10305543
1000 Ga0157372_10064423
1001 Ga0157372_10092801
1002 Ga0157375_10066403
1003 Ga0157375_10090664
1004 Ga0157375_10118615
1005 Ga0182008_10006764
1006 Ga0182008_10007832
1007 Ga0182008_10147580
1008 Ga0182008_10254056
1009 Ga0157377_10001539
1010 Ga0157379_10487384
1011 Ga0157376_10006686
1012 Ga0157376_10652835
1013 Ga0182006_1000007
1014 Ga0182007_10001496
1015 Ga0182007_10001829
1016 Ga0182007_10002638
1017 Ga0182005_1000010
1018 Ga0182005_1019707
1019 Ga0183362_10003
1020 Ga0163161_10001866
1021 Ga0163161_10012281
1022 Ga0163161_10025897
1023 Ga0163161_10029349
1024 Ga0163161_10060685
1025 Ga0163161_10148443
1026 Ga0209435_100002
1027 Ga0209436_101922
1028 Ga0209436_102444
1029 Ga0209672_107033
1030 Ga0209147_101277
1031 Ga0209437_108392
1032 Ga0209258_100009
1033 Ga0209258_100072
1034 Ga0207425_1000009
1035 Ga0207425_1000068
1036 Ga0207425_1000874
1037 Ga0207425_1002707
1038 Ga0207425_1004112
1039 Ga0207425_1007113
1040 Ga0209646_1000001
1041 Ga0209026_1000001
1042 Ga0209148_1000007
1043 Ga0209759_1000001
1044 Ga0209129_1000024
1045 Ga0209129_1000061
1046 Ga0209129_1010446
1047 Ga0209129_1014644
1048 Ga0209129_1024078
1049 Ga0209565_1000032
1050 Ga0209565_1000098
1051 Ga0209565_1000128
1052 Ga0209565_1000574
1053 Ga0209565_1001099
1054 Ga0209565_1002417
1055 Ga0209565_1006405
1056 Ga0209455_1000031
1057 Ga0209455_1000053
1058 Ga0209673_1000008
1059 Ga0209673_1000029
1060 Ga0209673_1000058
1061 Ga0209673_1000410
1062 Ga0209673_1000705
1063 Ga0209673_1001185
1064 Ga0209673_1002297
1065 Ga0209673_1005091
1066 Ga0209673_1066570
1067 Ga0209130_1000043
1068 Ga0209130_1000072
1069 Ga0209130_1000295
1070 Ga0209130_1001692
1071 Ga0209130_1002605
1072 Ga0209675_1000010
1073 Ga0209675_1000019
1074 Ga0209675_1000099
1075 Ga0209675_1000151
1076 Ga0209675_1000381
1077 Ga0209675_1000431
1078 Ga0209675_1000831
1079 Ga0209676_1000023
1080 Ga0209676_1000028
1081 Ga0209676_1000333
1082 Ga0209676_1003737
1083 Ga0209676_1040558
1084 Ga0209676_1054982
1085 Ga0209025_1000289
1086 Ga0209025_1000685
1087 Ga0209025_1003627
1088 Ga0209025_1010777
1089 Ga0209025_1011304
1090 Ga0209025_1011996
1091 Ga0209025_1017710
1092 Ga0209564_1000010
1093 Ga0209564_1000067
1094 Ga0209564_1000209
1095 Ga0209564_1000291
1096 Ga0209564_1000315
1097 Ga0209564_1000724
1098 Ga0209564_1004187
1099 Ga0209564_1005390
1100 Ga0209564_1029662
1101 Ga0209758_1000049
1102 Ga0209758_1000101
1103 Ga0209758_1000281
1104 Ga0209758_1001181
1105 Ga0209050_1000022
1106 Ga0209050_1000040
1107 Ga0209050_1000123
1108 Ga0209050_1000303
1109 Ga0209050_1004977
1110 Ga0209050_1047024
1111 Ga0209256_1000001
1112 Ga0209256_1000018
1113 Ga0209256_1000058
1114 Ga0209256_1000088
1115 Ga0209256_1000253
1116 Ga0209256_1001069
1117 Ga0209256_1003581
1118 Ga0207426_1000038
1119 Ga0207426_1000053
1120 Ga0207426_1000319
1121 Ga0207426_1002753
1122 Ga0209051_1000013
1123 Ga0209051_1000015
1124 Ga0209051_1000056
1125 Ga0209051_1000545
1126 Ga0209051_1000757
1127 Ga0209257_1000042
1128 Ga0209257_1000054
1129 Ga0209257_1004784
1130 Ga0209257_1008331
1131 Ga0209257_1014942
1132 Ga0207656_10107763
1133 Ga0207655_1001917
1134 Ga0207655_1004477
1135 Ga0207682_10219945
1136 Ga0207682_10225060
1137 Ga0207645_10330015
1138 Ga0207705_10134592
1139 Ga0207705_10810221
1140 Ga0207695_10156799
1141 Ga0207671_10078870
1142 Ga0207671_10350948
1143 Ga0207657_10022456
1144 Ga0207649_10319557
1145 Ga0207681_10025868
1146 Ga0207650_10124563
1147 Ga0207650_10401082
1148 Ga0207659_10537437
1149 Ga0207687_10092852
1150 Ga0207644_10270171
1151 Ga0207690_10001407
1152 Ga0207690_10156862
1153 Ga0207690_10817484
1154 Ga0207706_10013767
1155 Ga0207706_10043409
1156 Ga0207686_10435813
1157 Ga0207709_10000211
1158 Ga0207709_10008426
1159 Ga0207669_10384508
1160 Ga0207691_10038575
1161 Ga0207711_10679695
1162 Ga0207689_10134979
1163 Ga0207689_10234466
1164 Ga0207689_10247586
1165 Ga0207679_10019974
1166 Ga0207679_10068877
1167 Ga0207667_10169047
1168 Ga0207651_10591922
1169 Ga0207651_10694344
1170 Ga0207651_11044788
1171 Ga0207668_10396451
1172 Ga0207658_10204356
1173 Ga0207658_10204730
1174 Ga0207658_10424204
1175 Ga0207658_10890248
1176 Ga0207677_10047551
1177 Ga0207677_10908045
1178 Ga0207703_10560627
1179 Ga0207639_10065284
1180 Ga0207639_10518974
1181 Ga0207678_10425847
1182 Ga0207641_10023894
1183 Ga0207648_10035163
1184 Ga0207648_10204878
1185 Ga0207676_10008819
1186 Ga0207674_10201153
1187 Ga0207674_10321299
1188 Ga0207674_10487144
1189 Ga0207683_10159858
1190 Ga0207683_10206870
1191 Ga0207683_10265815
1192 Ga0207683_10466133
1193 Ga0207683_10705955
1194 Ga0207698_10321052
1195 Ga0209281_1039633
1196 Ga0209282_1000014
1197 Ga0207428_10186494
1198 Ga0207428_10306908
1199 Ga0268266_10019121
1200 Ga0268266_10109565
1201 Ga0268266_10372468
1202 Ga0268264_10252476
1203 Ga0307515_10004716
1204 Ga0307515_10018282
1205 Ga0307515_10074074
1206 Ga0307515_10107499
1207 Ga0307512_10068702
1208 Ga0307512_10251743
1209 Ga0316177_1143531
1210 Ga0316176_1081827
1211 Ga0314311_1166419
1212 Ga0316180_1137399
1213 Ga0316183_1100974
1214 Ga0316181_1019718
1215 Ga0316182_1026069
1216 Ga0307513_10000038
1217 Ga0307513_10115538
1218 Ga0307513_10128755
1219 Ga0307509_10000991
1220 Ga0307509_10048449
1221 Ga0307509_10416699
1222 Ga0307509_10481766
1223 Ga0307408_100000122
1224 Ga0307408_100065751
1225 Ga0307408_100075215
1226 Ga0307408_100217026
1227 Ga0307508_10002244
1228 Ga0307508_10007239
1229 Ga0307514_10005041
1230 Ga0307514_10124627
1231 Ga0307516_10124091
1232 Ga0307405_10011823
1233 Ga0307405_10032034
1234 Ga0307405_10053389
1235 Ga0307405_10096450
1236 Ga0307413_10177058
1237 Ga0307518_10228812
1238 Ga0307406_10015826
1239 Ga0307406_10652477
1240 Ga0307407_10133357
1241 Ga0307412_10024604
1242 Ga0307412_10108605
1243 Ga0307412_10127881
1244 Ga0307412_10758598
1245 Ga0307409_100573298
1246 Ga0307416_100008243
1247 Ga0307416_100136594
1248 Ga0307416_100435227
1249 Ga0307414_10037797
1250 Ga0307414_10056510
1251 Ga0307414_10069652
1252 Ga0307414_10322397
1253 Ga0307414_10339661
1254 Ga0307411_10064874
1255 Ga0307510_10088354
1256 Ga0373930_0053268
1257 Ga0373938_0036468
1258 Ga0373932_0043834
1259 Ga0373931_0035468
1260 Ga0373931_0089255
1261 Ga0395900_0030030
1262 Ga0395905_0002893
1263 Ga0395905_0008745
1264 Ga0395905_0091128
1265 Ga0395905_0490453
1266 Ga0395901_0002440
1267 Ga0395901_0528703
1268 Ga0436361_0438991
1269 Ga0439436_0000668
1270 Ga0439436_0027592
1271 Ga0439439_0015796
1272 Ga0439439_0078325
1273 Ga0439447_017322
1274 Ga0439447_025681
1275 Ga0439466_0010194
1276 Ga0439466_0032140
1277 Ga0439465_0004974
1278 Ga0451797_0634131
1279 Ga0451795_0258631
1280 Ga0451798_0022055
1281 Ga0439431_0033822
1282 Ga0439431_0047036
1283 Ga0439433_0018693
1284 Ga0439442_008635
1285 Ga0439442_016767
1286 Ga0439445_0000200
1287 Ga0439432_012106
1288 Ga0439449_0001627
1289 Ga0439449_0001772
1290 Ga0439449_0004482
1291 Ga0439452_002059
1292 Ga0439457_016362
1293 Ga0439462_0005319
1294 Ga0439462_0029804
1295 Ga0450922_004273
1296 Ga0450923_012192
1297 Ga0450923_012263
1298 Ga0450894_010049
1299 Ga0450898_000958
1300 Ga0450898_002604
1301 Ga0450906_001912
1302 Ga0450906_008396
1303 Ga0450910_018152
1304 Ga0439446_0010580
1305 Ga0439446_0016721
1306 Ga0439446_0156850
1307 Ga0439458_0064123
1308 Ga0439434_0005110
1309 Ga0439434_0011135
1310 Ga0450893_0019291
1311 Ga0466982_0364230
1312 Ga0453683_0005431
1313 Ga0466965_0378277
1314 Ga0466966_0050317
1315 Ga0453684_0070122
1316 Ga0466971_0112116
1317 Ga0466970_0098965
1318 Ga0466957_0088390
1319 Ga0451576_0010377
1320 Ga0451576_0941441
1321 Ga0495617_025019
1322 Ga0495627_113570
1323 Ga0495592_0000083
1324 Ga0495603_0158581
1325 Ga0495590_0000014
1326 Ga0495590_0045181
1327 Ga0495638_0000064
1328 Ga0495638_0127146
1329 Ga0495638_0130434
1330 Ga0495650_0000283
1331 Ga0495650_0001144
1332 Ga0495650_0001153
1333 Ga0495650_0081307
1334 Ga0495582_0167560
1335 Ga0495605_0000127
1336 Ga0495605_0004750
1337 Ga0495639_0002158
1338 Ga0495639_0030125
1339 Ga0495584_0031012
1340 Ga0495584_0251466
1341 Ga0495607_0000853
1342 Ga0495607_0000905
1343 Ga0495607_0076345
1344 Ga0495607_0161083
1345 Ga0495583_0000287
1346 Ga0495583_0000928
1347 Ga0495583_0005050
1348 Ga0495606_0000353
1349 Ga0495606_0000933
1350 Ga0495606_0001708
1351 Ga0495606_0006490
1352 Ga0495606_0047455
1353 Ga0495606_0092112
1354 Ga0495606_0105255
1355 Ga0495610_0001111
1356 Ga0495610_0017794
1357 Ga0495610_0054754
1358 Ga0495616_0032225
1359 Ga0495616_0046308
1360 Ga0495620_0008764
1361 Ga0495620_0071350
1362 Ga0495630_0487849
1363 Ga0495631_0006138
1364 Ga0495632_0002315
1365 Ga0495637_0000430
1366 Ga0495643_0000108
1367 Ga0495643_0001013
1368 Ga0495643_0075869
1369 Ga0495644_0017049
1370 Ga0495648_0000006
1371 Ga0495648_0001956
1372 Ga0495648_0009458
1373 Ga0495642_0022344
1374 Ga0495654_0000131
1375 Ga0495654_0013618
1376 Ga0495587_0062135
1377 Ga0495609_0000670
1378 Ga0495609_0020155
1379 Ga0495609_0042404
1380 Ga0495609_0045900
1381 Ga0495621_0011454
1382 Ga0495621_0012148
1383 Ga0495597_0000091
1384 Ga0495597_0007196
1385 Ga0495622_0000322
1386 Ga0495622_0015976
1387 Ga0495622_0043332
1388 Ga0495633_0000158
1389 Ga0495633_0002191
1390 Ga0495633_0002981
1391 Ga0495633_0008695
1392 Ga0495633_0009399
1393 Ga0495656_0000757
1394 Ga0495668_0000029
1395 Ga0495668_0000119
1396 Ga0495668_0000209
1397 Ga0495668_0021464
1398 Ga0495668_0036766
1399 Ga0495668_0085253
1400 Ga0495611_0105950
1401 Ga0495611_0324005
1402 Ga0495625_0000871
1403 Ga0495625_0000950
1404 Ga0495625_0001595
1405 Ga0495625_0002825
1406 Ga0495625_0013051
1407 Ga0495625_0109606
1408 Ga0495625_0113945
1409 Ga0495625_0118296
1410 Ga0495625_0164648
1411 Ga0495635_0364364
1412 Ga0495659_0000188
1413 Ga0495659_0001672
1414 Ga0495659_0005629
1415 Ga0495661_0062258
1416 Ga0495588_0067890
1417 Ga0495588_0081687
1418 Ga0495646_0135167
1419 Ga0495646_0137557
1420 Ga0495658_0011396
1421 Ga0495669_0002335
1422 Ga0495624_0033039
1423 Ga0495670_0029832
1424 Ga0495670_0036893
1425 Ga0495670_0062358
1426 Ga0495670_0118241
1427 Ga0495671_0003751
1428 Ga0495671_0010447
1429 Ga0495671_0070745
1430 Ga0495671_0313354
1431 Ga0495649_0011480
1432 Ga0495649_0021278
1433 Ga0495649_0048026
1434 Ga0495649_0208043
1435 Ga0495589_0030229
1436 Ga0495660_0012736
1437 Ga0495660_0042564
1438 Ga0495660_0043239
1439 Ga0495660_0071931
1440 Ga0495660_0114732
1441 Ga0495660_0159839
1442 Ga0495636_0002494
1443 Ga0495636_0022866
1444 Ga0495672_0000088
1445 Ga0495672_0000295
1446 Ga0495672_0009310
1447 Ga0495672_0023923
1448 Ga0495672_0067974
1449 Ga0495683_0000892
1450 Ga0495687_000042
1451 Ga0495687_013309
1452 Ga0495687_037736
1453 Ga0495677_0014959
1454 Ga0495679_018699
1455 Ga0495685_000081
1456 Ga0495685_002774
1457 Ga0495673_0003259
1458 Ga0495681_0007092
1459 Ga0495686_0000212
1460 Ga0495686_0001211
1461 Ga0495686_0004528
1462 Ga0495686_0072272
1463 Ga0495686_0072594
1464 Ga0495686_0222502
1465 Ga0495593_0055127
1466 Ga0495614_0024137
1467 Ga0495614_0061498
1468 Ga0496100_0195133
1469 Ga0496101_0170343
1470 Ga0496102_0014383
1471 Ga0496102_0415378
1472 Ga0496104_0013037
1473 Ga0496105_0011369
1474 Ga0496106_0184482
1475 Ga0496107_0240174
1476 Ga0496108_0064875
1477 Ga0496109_0505860
1478 Ga0496109_0719244
1479 Ga0496110_0982272
1480 Ga0496111_0294871
1481 Ga0496114_0227951
1482 Ga0496115_0071704
1483 Ga0496115_0656212
1484 Ga0496116_0028608
1485 Ga0496116_0071652
1486 Ga0496116_0312195
1487 Ga0496117_0000005
1488 Ga0496118_0000022
1489 Ga0496118_0009732
1490 Ga0496118_0113107
1491 Ga0496118_0316806
1492 Ga0496120_0138164
1493 Ga0496121_0047683
1494 Ga0496121_0166401
1495 Ga0496121_0362049
1496 Ga0496122_0000612
1497 Ga0496122_0009918
1498 Ga0496122_0356376
1499 Ga0496123_0000274
1500 Ga0496123_0020234
1501 Ga0496124_0018117
1502 Ga0496124_0073398
1503 Ga0496124_0146250
1504 Ga0496125_0028804
1505 Ga0496125_0051111
1506 Ga0496125_0235471
1507 Ga0496125_0333316
1508 Ga0496126_0722837
1509 Ga0501306_008736
1510 Ga0501308_008683
1511 Ga0501309_025636
1512 Ga0501305_027674
1513 Ga0501305_043813
1514 Ga0495678_000259
1515 Ga0495678_008378
1516 Ga0495678_058348
1517 Ga0495682_0002024
1518 Ga0495682_0004316
1519 Ga0501292_006634
1520 Ga0501311_008121
1521 Ga0501311_046900
1522 Ga0501314_013548
1523 Ga0501315_007576
1524 Ga0501315_017802
1525 Ga0501320_005849
1526 Ga0501323_006400
1527 Ga0501323_011804
1528 Ga0501036_0268975
1529 Ga0501039_0266499
1530 Ga0501042_0050325
1531 Ga0501048_0082014
1532 Ga0501072_0182306
1533 Ga0501077_0185649
1534 Ga0501222_025079
1535 Ga0501227_003408
1536 Ga0501227_028620
1537 Ga0501230_005166
1538 Ga0501238_002242
1539 Ga0501081_0204371
1540 Ga0501269_010451
1541 Ga0501279_007283
1542 nmdc:mga03683_217769_c1
1543 nmdc:mga03683_52726_c1
1544 nmdc:mga03n38_210331_c1
1545 nmdc:mga03n38_237862_c1
1546 nmdc:mga03n38_324952_c1
1547 nmdc:mga00v17_111385_c1
1548 nmdc:mga00v17_131135_c1
1549 nmdc:mga00v17_261312_c1
1550 nmdc:mga00v17_272718_c1
1551 nmdc:mga0yw44_54808_c1
1552 nmdc:mga0k408_13069_c2
1553 nmdc:mga0k408_25360_c1
1554 nmdc:mga0k408_3060_c1
1555 nmdc:mga0k408_31969_c1
1556 nmdc:mga06z11_331518_c1
1557 nmdc:mga06z11_355351_c1
1558 nmdc:mga07m45_25479_c1
1559 nmdc:mga07m45_3314_c1
1560 nmdc:mga07m45_38060_c1
1561 nmdc:mga07m45_3823_c1
1562 nmdc:mga07m45_42531_c1
1563 nmdc:mga07m45_466522_c1
1564 nmdc:mga07m45_67535_c1
1565 Ga0500610_0219697
1566 Ga0500635_0000030
1567 Ga0500578_0000363
1568 Ga0500644_0087237
1569 Ga0500646_0015224
1570 Ga0500647_0028928
1571 Ga0500651_0011180
1572 Ga0500651_0016838
1573 Ga0500651_0075767
1574 Ga0500641_0067121
1575 Ga0500641_0070578
1576 Ga0500555_031764
1577 Ga0500560_066461
1578 Ga0500571_002284
1579 Ga0500593_000312
1580 Ga0500594_0001013
1581 Ga0500594_0001867
1582 Ga0500594_0012374
1583 Ga0500594_0080478
1584 Ga0500594_0108434
1585 Ga0500607_009334
1586 Ga0500607_055142
1587 Ga0500608_197886
1588 Ga0500618_003147
1589 Ga0500623_146878
1590 Ga0500626_019470
1591 Ga0500628_002666
1592 Ga0500628_055474
1593 Ga0500642_0020334
1594 Ga0500652_003742
1595 Ga0500655_000872
1596 Ga0500658_0000730
1597 Ga0500559_0000019
1598 Ga0500559_0004500
1599 Ga0500559_0018151
1600 Ga0500568_0001792
1601 Ga0500568_0023959
1602 Ga0500568_0060467
1603 Ga0500573_0251675
1604 Ga0500574_026855
1605 Ga0500577_0037393
1606 Ga0500586_002852
1607 Ga0500604_0004794
1608 Ga0500616_0027300
1609 Ga0500622_0001269
1610 Ga0500622_0031643
1611 Ga0500622_0152310
1612 Ga0500627_0041172
1613 Ga0500634_0005209
1614 Ga0500634_0042082
1615 Ga0500638_006538
1616 Ga0500636_0028728
1617 Ga0500636_0254012
1618 Ga0500625_121994
1619 Ga0500645_001028
1620 Ga0501084_1053516
1621 Ga0500661_007849
1622 Ga0587084_000637
1623 Ga0587066_032534
1624 Ga0587070_063946
1625 Ga0587073_0027859
1626 Ga0587077_000886
1627 Ga0587082_020617
1628 Ga0587082_027390
1629 Ga0587083_0044276
1630 Ga0587085_016072
1631 Ga0587086_011719
1632 Ga0587090_000538
1633 Ga0587091_006879
1634 Ga0587091_069392
1635 Ga0587092_003071
1636 Ga0587094_008011
1637 Ga0587115_035574
1638 Ga0587062_005863
1639 Ga0587067_008438
1640 Ga0587068_003426
1641 Ga0587068_011727
1642 Ga0587068_020124
1643 Ga0587069_013484
1644 Ga0587072_010791
1645 Ga0587072_093925
1646 Ga0587076_001426
1647 Ga0587111_0001149
1648 2511244643
1649 2587731718
1650 2644142440
1651 2644277061
1652 2928118008

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

110

185

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.9822 61 209
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.969 61 209
8smr-assembly1.cif.gz_C cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.9073 41 208
6giq-assembly1.cif.gz_E saccharomyces cerevisiae respiratory supercomplex iii2iv 0.8604 56 206
8aba-assembly1.cif.gz_P complex iii2 from yarrowia lipolytica, ascorbate-reduced, int-position 0.8375 46 205
ID Description Score Start End Superfamily
3qitA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9072 72 85 3.40.50.1820
3l71E02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8439 55 206 2.102.10.10
3l71E02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8204 55 206 2.102.10.10
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8199 56 206 2.102.10.10
2yiuC02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.803 59 206 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A4R3V318-F1-model_v4 deleted 0.9839 74 211
AF-A0A259NLI5-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9826 57 211 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-A0A4Q3P3S4-F1-model_v4 deleted 0.9771 107 209
AF-A0A536Y491-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9767 58 211 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-H0BYK6-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.971 61 211 GO:0008121
GO:0016020
GO:0046872
GO:0051537

Map