F482489
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 826 | 418 | 1652 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0212422|Ga0496114_0212422_856_1464 |
| Length | 202 |
| Sequence | MSEATAGATVDRSRRTWLITSCAMGGAGAAAVAVPFVSTFQPSERAKAAGAAVEVDISGIQPGEKLVVEWRGKPVWILRRTAEQLAALETIEGQLADPNSDRTAYPTPAYAKNRHRSIKPEFLVTVGICTHLGCSPGDKLTPGPQPSLPDDWKGGFLCACHGSTFDVAGRVFKNKPAPDNLEVPPHYYLSDTTLLVGEEKQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 70 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 170 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 171 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 172 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 173 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 174 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 175 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 176 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 203 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 204 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 205 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 206 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 207 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 212 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 213 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 214 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 215 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 216 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 217 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 218 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 219 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 220 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 221 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 222 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 223 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 224 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 225 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 226 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 227 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 228 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 229 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 230 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 340 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 342 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 355 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 363 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 367 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 368 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 372 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 373 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 374 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 375 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 377 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 379 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 381 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 385 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 390 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 393 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 415 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 416 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 417 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 418 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.19 |
| Metatranscriptomes | 5.21 |
| Isolates | 0.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 31.96 |
| Nodule | 0.61 |
| Rhizoplane | 2.42 |
| Rhizosphere | 57.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496114_0212422 | 3300048917 | Bacteria | 1697 |
| 2 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 3 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 4 | JGI25156J39149_1007101 | 3300002705 | Bacteria | 2980 |
| 5 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 6 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 7 | JGI25152J39213_1017849 | 3300002773 | Bacteria | 1327 |
| 8 | JGI25150J39212_1001639 | 3300002774 | Bacteria | 6091 |
| 9 | JGI25150J39212_1005198 | 3300002774 | Bacteria | 2805 |
| 10 | JGI25150J39212_1008124 | 3300002774 | Bacteria | 2072 |
| 11 | JGI25159J45721_1000396 | 3300002987 | Bacteria | 20289 |
| 12 | JGI25159J45721_1005038 | 3300002987 | Bacteria | 4216 |
| 13 | JGI25159J45721_1008343 | 3300002987 | Bacteria | 2855 |
| 14 | JGI25151J46595_10001069 | 3300003187 | Bacteria | 20425 |
| 15 | JGI25151J46595_10081221 | 3300003187 | Bacteria | 937 |
| 16 | JGI25151J46595_10084991 | 3300003187 | Bacteria | 901 |
| 17 | JGI25153J46596_10004229 | 3300003215 | Bacteria | 7770 |
| 18 | JGI25153J46596_10004541 | 3300003215 | Bacteria | 7462 |
| 19 | JGI25160J50197_1002413 | 3300003354 | Bacteria | 8715 |
| 20 | JGI25160J50197_1033794 | 3300003354 | Bacteria | 1280 |
| 21 | JGI25161J50226_1000095 | 3300003374 | Bacteria | 72343 |
| 22 | JGI25161J50226_1002922 | 3300003374 | Bacteria | 4147 |
| 23 | Ga0007409J51694_1010614 | 3300003575 | Bacteria | 4318 |
| 24 | Ga0007416J51690_1020706 | 3300003577 | Bacteria | 4433 |
| 25 | Ga0006562J51391_1033687 | 3300003578 | Bacteria | 4660 |
| 26 | Ga0032354_1023833 | 3300003693 | Bacteria | 4218 |
| 27 | Ga0055535_1000047 | 3300003761 | Bacteria | 139836 |
| 28 | Ga0055535_1001458 | 3300003761 | Bacteria | 11925 |
| 29 | Ga0055542_1000080 | 3300003762 | Bacteria | 129634 |
| 30 | Ga0055529_1000148 | 3300003763 | Bacteria | 100809 |
| 31 | Ga0055526_1000030 | 3300003771 | Bacteria | 143833 |
| 32 | Ga0055526_1000167 | 3300003771 | Bacteria | 57804 |
| 33 | Ga0055526_1002375 | 3300003771 | Bacteria | 12756 |
| 34 | Ga0055526_1002601 | 3300003771 | Bacteria | 12065 |
| 35 | Ga0055526_1003176 | 3300003771 | Bacteria | 10628 |
| 36 | Ga0055526_1011045 | 3300003771 | Bacteria | 4122 |
| 37 | Ga0055537_1000150 | 3300003773 | Bacteria | 52097 |
| 38 | Ga0055537_1000205 | 3300003773 | Bacteria | 44266 |
| 39 | Ga0055537_1000239 | 3300003773 | Bacteria | 40300 |
| 40 | Ga0055537_1010578 | 3300003773 | Bacteria | 1937 |
| 41 | Ga0055524_1000017 | 3300003775 | Bacteria | 235608 |
| 42 | Ga0055524_1000073 | 3300003775 | Bacteria | 123033 |
| 43 | Ga0055524_1001044 | 3300003775 | Bacteria | 17076 |
| 44 | Ga0055524_1006211 | 3300003775 | Bacteria | 5214 |
| 45 | Ga0055524_1014364 | 3300003775 | Bacteria | 2938 |
| 46 | Ga0055536_1018344 | 3300003781 | Bacteria | 2246 |
| 47 | Ga0055534_1000016 | 3300003784 | Bacteria | 144444 |
| 48 | Ga0055534_1000194 | 3300003784 | Bacteria | 44359 |
| 49 | Ga0055534_1000363 | 3300003784 | Bacteria | 28579 |
| 50 | Ga0055534_1001058 | 3300003784 | Bacteria | 11914 |
| 51 | Ga0055534_1003933 | 3300003784 | Bacteria | 4485 |
| 52 | Ga0055528_1000253 | 3300003790 | Bacteria | 45221 |
| 53 | Ga0055528_1000289 | 3300003790 | Bacteria | 42964 |
| 54 | Ga0055528_1008808 | 3300003790 | Bacteria | 4276 |
| 55 | Ga0055528_1014906 | 3300003790 | Bacteria | 2841 |
| 56 | Ga0055530_10001804 | 3300003791 | Bacteria | 14848 |
| 57 | Ga0055530_10008565 | 3300003791 | Bacteria | 4071 |
| 58 | Ga0055530_10037309 | 3300003791 | Bacteria | 1217 |
| 59 | Ga0055540_1000037 | 3300003792 | Bacteria | 162957 |
| 60 | Ga0055540_1002771 | 3300003792 | Bacteria | 8982 |
| 61 | Ga0055540_1040942 | 3300003792 | Bacteria | 1001 |
| 62 | Ga0055531_10011377 | 3300003794 | Bacteria | 4298 |
| 63 | Ga0055531_10023264 | 3300003794 | Bacteria | 2331 |
| 64 | Ga0055543_1000218 | 3300004625 | Bacteria | 46120 |
| 65 | Ga0055543_1028236 | 3300004625 | Bacteria | 990 |
| 66 | Ga0065165_1000805 | 3300005262 | Bacteria | 41844 |
| 67 | Ga0065165_1037171 | 3300005262 | Bacteria | 1478 |
| 68 | Ga0065165_1055083 | 3300005262 | Bacteria | 1112 |
| 69 | Ga0065714_10073610 | 3300005288 | Bacteria | 3159 |
| 70 | Ga0065704_10003100 | 3300005289 | Bacteria | 4362 |
| 71 | Ga0070676_10194284 | 3300005328 | Bacteria | 1327 |
| 72 | Ga0070677_10249905 | 3300005333 | Bacteria | 880 |
| 73 | Ga0068869_100099975 | 3300005334 | Bacteria | 2193 |
| 74 | Ga0068869_100185274 | 3300005334 | Bacteria | 1634 |
| 75 | Ga0070666_10349580 | 3300005335 | Bacteria | 1058 |
| 76 | Ga0068868_100008545 | 3300005338 | Bacteria | 7332 |
| 77 | Ga0068868_100069555 | 3300005338 | Bacteria | 2805 |
| 78 | Ga0070660_100001068 | 3300005339 | Bacteria | 18415 |
| 79 | Ga0070661_100005897 | 3300005344 | Bacteria | 8430 |
| 80 | Ga0070675_100028611 | 3300005354 | Bacteria | 4485 |
| 81 | Ga0070659_100005068 | 3300005366 | Bacteria | 9444 |
| 82 | Ga0070659_100343187 | 3300005366 | Bacteria | 1252 |
| 83 | Ga0070667_100024333 | 3300005367 | Bacteria | 5029 |
| 84 | Ga0070667_100228766 | 3300005367 | Bacteria | 1657 |
| 85 | Ga0070678_100178002 | 3300005456 | Bacteria | 1738 |
| 86 | Ga0070678_100296001 | 3300005456 | Bacteria | 1374 |
| 87 | Ga0070678_100327262 | 3300005456 | Bacteria | 1310 |
| 88 | Ga0070662_100018957 | 3300005457 | Bacteria | 4662 |
| 89 | Ga0068867_100126586 | 3300005459 | Bacteria | 1980 |
| 90 | Ga0068867_100268214 | 3300005459 | Bacteria | 1394 |
| 91 | Ga0068853_100344331 | 3300005539 | Bacteria | 1385 |
| 92 | Ga0070672_100003408 | 3300005543 | Bacteria | 10312 |
| 93 | Ga0070665_100027466 | 3300005548 | Bacteria | 5733 |
| 94 | Ga0070665_100634191 | 3300005548 | Bacteria | 1082 |
| 95 | Ga0070665_100814421 | 3300005548 | Bacteria | 947 |
| 96 | Ga0070664_100011901 | 3300005564 | Bacteria | 7062 |
| 97 | Ga0070664_100221117 | 3300005564 | Bacteria | 1694 |
| 98 | Ga0068857_100082461 | 3300005577 | Bacteria | 2872 |
| 99 | Ga0068856_100134337 | 3300005614 | Bacteria | 2479 |
| 100 | Ga0068859_100044728 | 3300005617 | Bacteria | 4448 |
| 101 | Ga0068864_100019420 | 3300005618 | Bacteria | 5682 |
| 102 | Ga0068866_10364797 | 3300005718 | Bacteria | 922 |
| 103 | Ga0068851_10023769 | 3300005834 | Bacteria | 2997 |
| 104 | Ga0068863_100018423 | 3300005841 | Bacteria | 6681 |
| 105 | Ga0068863_100581246 | 3300005841 | Bacteria | 1108 |
| 106 | Ga0068860_100254189 | 3300005843 | Bacteria | 1712 |
| 107 | Ga0068862_100052707 | 3300005844 | Bacteria | 3482 |
| 108 | Ga0068862_101039079 | 3300005844 | Bacteria | 812 |
| 109 | Ga0075365_10021801 | 3300006038 | Bacteria | 4002 |
| 110 | Ga0075368_10091162 | 3300006042 | Bacteria | 1247 |
| 111 | Ga0075363_100050969 | 3300006048 | Bacteria | 2206 |
| 112 | Ga0075363_100096973 | 3300006048 | Bacteria | 1629 |
| 113 | Ga0075363_100112476 | 3300006048 | Bacteria | 1514 |
| 114 | Ga0075363_100348596 | 3300006048 | Bacteria | 864 |
| 115 | Ga0075364_10092158 | 3300006051 | Bacteria | 2011 |
| 116 | Ga0075364_10149945 | 3300006051 | Bacteria | 1571 |
| 117 | Ga0075364_10273367 | 3300006051 | Bacteria | 1149 |
| 118 | Ga0075364_10464517 | 3300006051 | Bacteria | 865 |
| 119 | Ga0075362_10007740 | 3300006177 | Bacteria | 4082 |
| 120 | Ga0075362_10018885 | 3300006177 | Bacteria | 2860 |
| 121 | Ga0075362_10035036 | 3300006177 | Bacteria | 2190 |
| 122 | Ga0075369_10111044 | 3300006186 | Bacteria | 1236 |
| 123 | Ga0075369_10210076 | 3300006186 | Bacteria | 900 |
| 124 | Ga0075366_10001610 | 3300006195 | Bacteria | 11306 |
| 125 | Ga0075366_10036288 | 3300006195 | Bacteria | 2906 |
| 126 | Ga0075366_10062614 | 3300006195 | Bacteria | 2211 |
| 127 | Ga0075366_10141318 | 3300006195 | Bacteria | 1456 |
| 128 | Ga0075366_10165863 | 3300006195 | Bacteria | 1339 |
| 129 | Ga0097621_100686774 | 3300006237 | Bacteria | 941 |
| 130 | Ga0075370_10000182 | 3300006353 | Bacteria | 21846 |
| 131 | Ga0075370_10035523 | 3300006353 | Bacteria | 2797 |
| 132 | Ga0075370_10055531 | 3300006353 | Bacteria | 2250 |
| 133 | Ga0075370_10087886 | 3300006353 | Bacteria | 1791 |
| 134 | Ga0075370_10184141 | 3300006353 | Bacteria | 1230 |
| 135 | Ga0097620_100044728 | 3300006931 | Bacteria | 4448 |
| 136 | Ga0097620_101023521 | 3300006931 | Bacteria | 907 |
| 137 | Ga0079104_1049112 | 3300006946 | Bacteria | 947 |
| 138 | Ga0099826_10000033 | 3300006948 | Bacteria | 120668 |
| 139 | Ga0099826_10126910 | 3300006948 | Bacteria | 1494 |
| 140 | Ga0105244_10001268 | 3300009036 | Bacteria | 20676 |
| 141 | Ga0105244_10003719 | 3300009036 | Bacteria | 10768 |
| 142 | Ga0105245_10065399 | 3300009098 | Bacteria | 3288 |
| 143 | Ga0105245_11056088 | 3300009098 | Bacteria | 858 |
| 144 | Ga0105243_10000306 | 3300009148 | Bacteria | 54352 |
| 145 | Ga0105241_10053049 | 3300009174 | Bacteria | 3099 |
| 146 | Ga0105241_10116335 | 3300009174 | Bacteria | 2147 |
| 147 | Ga0105242_10108114 | 3300009176 | Bacteria | 2366 |
| 148 | Ga0105242_10152883 | 3300009176 | Bacteria | 2014 |
| 149 | Ga0105242_10655434 | 3300009176 | Bacteria | 1021 |
| 150 | Ga0105248_10106946 | 3300009177 | Bacteria | 3154 |
| 151 | Ga0105237_10027197 | 3300009545 | Bacteria | 5841 |
| 152 | Ga0105237_10653740 | 3300009545 | Bacteria | 1058 |
| 153 | Ga0105249_10106069 | 3300009553 | Bacteria | 2650 |
| 154 | Ga0105239_10059436 | 3300010375 | Bacteria | 4196 |
| 155 | Ga0105246_10029216 | 3300011119 | Bacteria | 3629 |
| 156 | Ga0105246_10369650 | 3300011119 | Bacteria | 1181 |
| 157 | Ga0105246_10536995 | 3300011119 | Bacteria | 1000 |
| 158 | Ga0157326_1003197 | 3300012513 | Bacteria | 1729 |
| 159 | Ga0157373_10049442 | 3300013100 | Bacteria | 2996 |
| 160 | Ga0157371_10065886 | 3300013102 | Bacteria | 2565 |
| 161 | Ga0157370_10006343 | 3300013104 | Bacteria | 13063 |
| 162 | Ga0157370_10301385 | 3300013104 | Bacteria | 1479 |
| 163 | Ga0157370_10362345 | 3300013104 | Bacteria | 1336 |
| 164 | Ga0157370_10431898 | 3300013104 | Bacteria | 1211 |
| 165 | Ga0157369_10022693 | 3300013105 | Bacteria | 6999 |
| 166 | Ga0157369_10432163 | 3300013105 | Bacteria | 1364 |
| 167 | Ga0157374_10003108 | 3300013296 | Bacteria | 13934 |
| 168 | Ga0157378_10153308 | 3300013297 | Bacteria | 2148 |
| 169 | Ga0163162_10012566 | 3300013306 | Bacteria | 8270 |
| 170 | Ga0163162_10028381 | 3300013306 | Bacteria | 5537 |
| 171 | Ga0163162_10101937 | 3300013306 | Bacteria | 2963 |
| 172 | Ga0163162_10230309 | 3300013306 | Bacteria | 1983 |
| 173 | Ga0163162_10305543 | 3300013306 | Bacteria | 1723 |
| 174 | Ga0157372_10064423 | 3300013307 | Bacteria | 4112 |
| 175 | Ga0157372_10092801 | 3300013307 | Bacteria | 3435 |
| 176 | Ga0157375_10066403 | 3300013308 | Bacteria | 3601 |
| 177 | Ga0157375_10090664 | 3300013308 | Bacteria | 3116 |
| 178 | Ga0157375_10118615 | 3300013308 | Bacteria | 2753 |
| 179 | Ga0182008_10006764 | 3300014497 | Bacteria | 6380 |
| 180 | Ga0182008_10007832 | 3300014497 | Bacteria | 5873 |
| 181 | Ga0182008_10147580 | 3300014497 | Bacteria | 1179 |
| 182 | Ga0182008_10254056 | 3300014497 | Bacteria | 907 |
| 183 | Ga0157377_10001539 | 3300014745 | Bacteria | 10025 |
| 184 | Ga0157379_10487384 | 3300014968 | Bacteria | 1141 |
| 185 | Ga0157376_10006686 | 3300014969 | Bacteria | 8161 |
| 186 | Ga0157376_10652835 | 3300014969 | Bacteria | 1053 |
| 187 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 188 | Ga0182007_10001496 | 3300015262 | Bacteria | 12509 |
| 189 | Ga0182007_10001829 | 3300015262 | Bacteria | 11101 |
| 190 | Ga0182007_10002638 | 3300015262 | Bacteria | 8809 |
| 191 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 192 | Ga0182005_1019707 | 3300015265 | Bacteria | 1858 |
| 193 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 194 | Ga0163161_10001866 | 3300017792 | Bacteria | 15379 |
| 195 | Ga0163161_10012281 | 3300017792 | Bacteria | 5944 |
| 196 | Ga0163161_10025897 | 3300017792 | Bacteria | 4153 |
| 197 | Ga0163161_10029349 | 3300017792 | Bacteria | 3910 |
| 198 | Ga0163161_10060685 | 3300017792 | Bacteria | 2753 |
| 199 | Ga0163161_10148443 | 3300017792 | Bacteria | 1780 |
| 200 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 201 | Ga0209436_101922 | 3300025208 | Bacteria | 6696 |
| 202 | Ga0209436_102444 | 3300025208 | Bacteria | 5582 |
| 203 | Ga0209672_107033 | 3300025228 | Bacteria | 1773 |
| 204 | Ga0209147_101277 | 3300025229 | Bacteria | 9822 |
| 205 | Ga0209437_108392 | 3300025233 | Bacteria | 1654 |
| 206 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 207 | Ga0209258_100072 | 3300025242 | Bacteria | 274355 |
| 208 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 209 | Ga0207425_1000068 | 3300025245 | Bacteria | 124067 |
| 210 | Ga0207425_1000874 | 3300025245 | Bacteria | 14727 |
| 211 | Ga0207425_1002707 | 3300025245 | Bacteria | 6052 |
| 212 | Ga0207425_1004112 | 3300025245 | Bacteria | 4451 |
| 213 | Ga0207425_1007113 | 3300025245 | Bacteria | 2989 |
| 214 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 215 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 216 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 217 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 218 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 219 | Ga0209129_1000061 | 3300025258 | Bacteria | 246061 |
| 220 | Ga0209129_1010446 | 3300025258 | Bacteria | 2314 |
| 221 | Ga0209129_1014644 | 3300025258 | Bacteria | 1660 |
| 222 | Ga0209129_1024078 | 3300025258 | Bacteria | 1076 |
| 223 | Ga0209565_1000032 | 3300025263 | Bacteria | 316777 |
| 224 | Ga0209565_1000098 | 3300025263 | Bacteria | 132021 |
| 225 | Ga0209565_1000128 | 3300025263 | Bacteria | 108959 |
| 226 | Ga0209565_1000574 | 3300025263 | Bacteria | 24961 |
| 227 | Ga0209565_1001099 | 3300025263 | Bacteria | 13330 |
| 228 | Ga0209565_1002417 | 3300025263 | Bacteria | 6760 |
| 229 | Ga0209565_1006405 | 3300025263 | Bacteria | 3305 |
| 230 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 231 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 232 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 233 | Ga0209673_1000029 | 3300025273 | Bacteria | 351978 |
| 234 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 235 | Ga0209673_1000410 | 3300025273 | Bacteria | 75829 |
| 236 | Ga0209673_1000705 | 3300025273 | Bacteria | 47171 |
| 237 | Ga0209673_1001185 | 3300025273 | Bacteria | 28137 |
| 238 | Ga0209673_1002297 | 3300025273 | Bacteria | 13626 |
| 239 | Ga0209673_1005091 | 3300025273 | Bacteria | 6754 |
| 240 | Ga0209673_1066570 | 3300025273 | Bacteria | 875 |
| 241 | Ga0209130_1000043 | 3300025284 | Bacteria | 254257 |
| 242 | Ga0209130_1000072 | 3300025284 | Bacteria | 175726 |
| 243 | Ga0209130_1000295 | 3300025284 | Bacteria | 60748 |
| 244 | Ga0209130_1001692 | 3300025284 | Bacteria | 13338 |
| 245 | Ga0209130_1002605 | 3300025284 | Bacteria | 8731 |
| 246 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 247 | Ga0209675_1000019 | 3300025291 | Bacteria | 351950 |
| 248 | Ga0209675_1000099 | 3300025291 | Bacteria | 128911 |
| 249 | Ga0209675_1000151 | 3300025291 | Bacteria | 91172 |
| 250 | Ga0209675_1000381 | 3300025291 | Bacteria | 36963 |
| 251 | Ga0209675_1000431 | 3300025291 | Bacteria | 33567 |
| 252 | Ga0209675_1000831 | 3300025291 | Bacteria | 20312 |
| 253 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 254 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 255 | Ga0209676_1000333 | 3300025292 | Bacteria | 90785 |
| 256 | Ga0209676_1003737 | 3300025292 | Bacteria | 9056 |
| 257 | Ga0209676_1040558 | 3300025292 | Bacteria | 1310 |
| 258 | Ga0209676_1054982 | 3300025292 | Bacteria | 1022 |
| 259 | Ga0209025_1000289 | 3300025294 | Bacteria | 113555 |
| 260 | Ga0209025_1000685 | 3300025294 | Bacteria | 58093 |
| 261 | Ga0209025_1003627 | 3300025294 | Bacteria | 14367 |
| 262 | Ga0209025_1010777 | 3300025294 | Bacteria | 6142 |
| 263 | Ga0209025_1011304 | 3300025294 | Bacteria | 5901 |
| 264 | Ga0209025_1011996 | 3300025294 | Bacteria | 5618 |
| 265 | Ga0209025_1017710 | 3300025294 | Bacteria | 4092 |
| 266 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 267 | Ga0209564_1000067 | 3300025295 | Bacteria | 311242 |
| 268 | Ga0209564_1000209 | 3300025295 | Bacteria | 133651 |
| 269 | Ga0209564_1000291 | 3300025295 | Bacteria | 101831 |
| 270 | Ga0209564_1000315 | 3300025295 | Bacteria | 95095 |
| 271 | Ga0209564_1000724 | 3300025295 | Bacteria | 47354 |
| 272 | Ga0209564_1004187 | 3300025295 | Bacteria | 9003 |
| 273 | Ga0209564_1005390 | 3300025295 | Bacteria | 7329 |
| 274 | Ga0209564_1029662 | 3300025295 | Bacteria | 1715 |
| 275 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 276 | Ga0209758_1000101 | 3300025297 | Bacteria | 225913 |
| 277 | Ga0209758_1000281 | 3300025297 | Bacteria | 100826 |
| 278 | Ga0209758_1001181 | 3300025297 | Bacteria | 33038 |
| 279 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 280 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 281 | Ga0209050_1000123 | 3300025298 | Bacteria | 195061 |
| 282 | Ga0209050_1000303 | 3300025298 | Bacteria | 101498 |
| 283 | Ga0209050_1004977 | 3300025298 | Bacteria | 8647 |
| 284 | Ga0209050_1047024 | 3300025298 | Bacteria | 1128 |
| 285 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 286 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 287 | Ga0209256_1000058 | 3300025299 | Bacteria | 272934 |
| 288 | Ga0209256_1000088 | 3300025299 | Bacteria | 217236 |
| 289 | Ga0209256_1000253 | 3300025299 | Bacteria | 94918 |
| 290 | Ga0209256_1001069 | 3300025299 | Bacteria | 31758 |
| 291 | Ga0209256_1003581 | 3300025299 | Bacteria | 10711 |
| 292 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 293 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 294 | Ga0207426_1000319 | 3300025302 | Bacteria | 92696 |
| 295 | Ga0207426_1002753 | 3300025302 | Bacteria | 10636 |
| 296 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 297 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 298 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 299 | Ga0209051_1000545 | 3300025303 | Bacteria | 46076 |
| 300 | Ga0209051_1000757 | 3300025303 | Bacteria | 34605 |
| 301 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 302 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 303 | Ga0209257_1004784 | 3300025304 | Bacteria | 10090 |
| 304 | Ga0209257_1008331 | 3300025304 | Bacteria | 5933 |
| 305 | Ga0209257_1014942 | 3300025304 | Bacteria | 3281 |
| 306 | Ga0207656_10107763 | 3300025321 | Bacteria | 1284 |
| 307 | Ga0207655_1001917 | 3300025728 | Bacteria | 17826 |
| 308 | Ga0207655_1004477 | 3300025728 | Bacteria | 9895 |
| 309 | Ga0207682_10219945 | 3300025893 | Bacteria | 878 |
| 310 | Ga0207682_10225060 | 3300025893 | Bacteria | 868 |
| 311 | Ga0207645_10330015 | 3300025907 | Bacteria | 1019 |
| 312 | Ga0207705_10134592 | 3300025909 | Bacteria | 1841 |
| 313 | Ga0207705_10810221 | 3300025909 | Bacteria | 727 |
| 314 | Ga0207695_10156799 | 3300025913 | Bacteria | 2211 |
| 315 | Ga0207671_10078870 | 3300025914 | Bacteria | 2467 |
| 316 | Ga0207671_10350948 | 3300025914 | Bacteria | 1170 |
| 317 | Ga0207657_10022456 | 3300025919 | Bacteria | 5901 |
| 318 | Ga0207649_10319557 | 3300025920 | Bacteria | 1140 |
| 319 | Ga0207681_10025868 | 3300025923 | Bacteria | 3780 |
| 320 | Ga0207650_10124563 | 3300025925 | Bacteria | 2010 |
| 321 | Ga0207650_10401082 | 3300025925 | Bacteria | 1135 |
| 322 | Ga0207659_10537437 | 3300025926 | Bacteria | 992 |
| 323 | Ga0207687_10092852 | 3300025927 | Bacteria | 2205 |
| 324 | Ga0207644_10270171 | 3300025931 | Bacteria | 1362 |
| 325 | Ga0207690_10001407 | 3300025932 | Bacteria | 15134 |
| 326 | Ga0207690_10156862 | 3300025932 | Bacteria | 1693 |
| 327 | Ga0207690_10817484 | 3300025932 | Bacteria | 771 |
| 328 | Ga0207706_10013767 | 3300025933 | Bacteria | 7340 |
| 329 | Ga0207706_10043409 | 3300025933 | Bacteria | 3984 |
| 330 | Ga0207686_10435813 | 3300025934 | Bacteria | 1005 |
| 331 | Ga0207709_10000211 | 3300025935 | Bacteria | 75562 |
| 332 | Ga0207709_10008426 | 3300025935 | Bacteria | 5703 |
| 333 | Ga0207669_10384508 | 3300025937 | Bacteria | 1094 |
| 334 | Ga0207691_10038575 | 3300025940 | Bacteria | 4421 |
| 335 | Ga0207711_10679695 | 3300025941 | Bacteria | 960 |
| 336 | Ga0207689_10134979 | 3300025942 | Bacteria | 2032 |
| 337 | Ga0207689_10234466 | 3300025942 | Bacteria | 1517 |
| 338 | Ga0207689_10247586 | 3300025942 | Bacteria | 1474 |
| 339 | Ga0207679_10019974 | 3300025945 | Bacteria | 4513 |
| 340 | Ga0207679_10068877 | 3300025945 | Bacteria | 2660 |
| 341 | Ga0207667_10169047 | 3300025949 | Bacteria | 2247 |
| 342 | Ga0207651_10591922 | 3300025960 | Bacteria | 969 |
| 343 | Ga0207651_10694344 | 3300025960 | Bacteria | 896 |
| 344 | Ga0207651_11044788 | 3300025960 | Bacteria | 731 |
| 345 | Ga0207668_10396451 | 3300025972 | Bacteria | 1166 |
| 346 | Ga0207658_10204356 | 3300025986 | Bacteria | 1651 |
| 347 | Ga0207658_10204730 | 3300025986 | Bacteria | 1650 |
| 348 | Ga0207658_10424204 | 3300025986 | Bacteria | 1173 |
| 349 | Ga0207658_10890248 | 3300025986 | Bacteria | 810 |
| 350 | Ga0207677_10047551 | 3300026023 | Bacteria | 2882 |
| 351 | Ga0207677_10908045 | 3300026023 | Bacteria | 794 |
| 352 | Ga0207703_10560627 | 3300026035 | Bacteria | 1078 |
| 353 | Ga0207639_10065284 | 3300026041 | Bacteria | 2825 |
| 354 | Ga0207639_10518974 | 3300026041 | Bacteria | 1091 |
| 355 | Ga0207678_10425847 | 3300026067 | Bacteria | 1151 |
| 356 | Ga0207641_10023894 | 3300026088 | Bacteria | 5039 |
| 357 | Ga0207648_10035163 | 3300026089 | Bacteria | 4415 |
| 358 | Ga0207648_10204878 | 3300026089 | Bacteria | 1750 |
| 359 | Ga0207676_10008819 | 3300026095 | Bacteria | 7179 |
| 360 | Ga0207674_10201153 | 3300026116 | Bacteria | 1941 |
| 361 | Ga0207674_10321299 | 3300026116 | Bacteria | 1497 |
| 362 | Ga0207674_10487144 | 3300026116 | Bacteria | 1192 |
| 363 | Ga0207683_10159858 | 3300026121 | Bacteria | 2036 |
| 364 | Ga0207683_10206870 | 3300026121 | Bacteria | 1785 |
| 365 | Ga0207683_10265815 | 3300026121 | Bacteria | 1567 |
| 366 | Ga0207683_10466133 | 3300026121 | Bacteria | 1165 |
| 367 | Ga0207683_10705955 | 3300026121 | Bacteria | 935 |
| 368 | Ga0207698_10321052 | 3300026142 | Bacteria | 1450 |
| 369 | Ga0209281_1039633 | 3300027111 | Bacteria | 799 |
| 370 | Ga0209282_1000014 | 3300027666 | Bacteria | 207318 |
| 371 | Ga0207428_10186494 | 3300027907 | Bacteria | 1565 |
| 372 | Ga0207428_10306908 | 3300027907 | Bacteria | 1174 |
| 373 | Ga0268266_10019121 | 3300028379 | Bacteria | 5833 |
| 374 | Ga0268266_10109565 | 3300028379 | Bacteria | 2445 |
| 375 | Ga0268266_10372468 | 3300028379 | Bacteria | 1345 |
| 376 | Ga0268264_10252476 | 3300028381 | Bacteria | 1639 |
| 377 | Ga0307515_10004716 | 3300028794 | Bacteria | 27939 |
| 378 | Ga0307515_10018282 | 3300028794 | Bacteria | 12704 |
| 379 | Ga0307515_10074074 | 3300028794 | Bacteria | 4562 |
| 380 | Ga0307515_10107499 | 3300028794 | Bacteria | 3297 |
| 381 | Ga0307512_10068702 | 3300030522 | Bacteria | 2655 |
| 382 | Ga0307512_10251743 | 3300030522 | Bacteria | 879 |
| 383 | Ga0316177_1143531 | 3300030731 | Bacteria | 6959 |
| 384 | Ga0316176_1081827 | 3300030732 | Bacteria | 3930 |
| 385 | Ga0314311_1166419 | 3300030733 | Bacteria | 9043 |
| 386 | Ga0316180_1137399 | 3300030736 | Bacteria | 1944 |
| 387 | Ga0316183_1100974 | 3300030742 | Bacteria | 3193 |
| 388 | Ga0316181_1019718 | 3300030744 | Bacteria | 4721 |
| 389 | Ga0316182_1026069 | 3300030745 | Bacteria | 722 |
| 390 | Ga0307513_10000038 | 3300031456 | Bacteria | 174780 |
| 391 | Ga0307513_10115538 | 3300031456 | Bacteria | 2666 |
| 392 | Ga0307513_10128755 | 3300031456 | Bacteria | 2481 |
| 393 | Ga0307509_10000991 | 3300031507 | Bacteria | 48763 |
| 394 | Ga0307509_10048449 | 3300031507 | Bacteria | 4563 |
| 395 | Ga0307509_10416699 | 3300031507 | Bacteria | 1045 |
| 396 | Ga0307509_10481766 | 3300031507 | Bacteria | 928 |
| 397 | Ga0307408_100000122 | 3300031548 | Bacteria | 85798 |
| 398 | Ga0307408_100065751 | 3300031548 | Bacteria | 2660 |
| 399 | Ga0307408_100075215 | 3300031548 | Bacteria | 2508 |
| 400 | Ga0307408_100217026 | 3300031548 | Bacteria | 1558 |
| 401 | Ga0307508_10002244 | 3300031616 | Bacteria | 20612 |
| 402 | Ga0307508_10007239 | 3300031616 | Bacteria | 10332 |
| 403 | Ga0307514_10005041 | 3300031649 | Bacteria | 11946 |
| 404 | Ga0307514_10124627 | 3300031649 | Bacteria | 1788 |
| 405 | Ga0307516_10124091 | 3300031730 | Bacteria | 2369 |
| 406 | Ga0307405_10011823 | 3300031731 | Bacteria | 4594 |
| 407 | Ga0307405_10032034 | 3300031731 | Bacteria | 3102 |
| 408 | Ga0307405_10053389 | 3300031731 | Bacteria | 2517 |
| 409 | Ga0307405_10096450 | 3300031731 | Bacteria | 1972 |
| 410 | Ga0307413_10177058 | 3300031824 | Bacteria | 1516 |
| 411 | Ga0307518_10228812 | 3300031838 | Bacteria | 1206 |
| 412 | Ga0307406_10015826 | 3300031901 | Bacteria | 4372 |
| 413 | Ga0307406_10652477 | 3300031901 | Bacteria | 873 |
| 414 | Ga0307407_10133357 | 3300031903 | Bacteria | 1592 |
| 415 | Ga0307412_10024604 | 3300031911 | Bacteria | 3719 |
| 416 | Ga0307412_10108605 | 3300031911 | Bacteria | 1976 |
| 417 | Ga0307412_10127881 | 3300031911 | Bacteria | 1840 |
| 418 | Ga0307412_10758598 | 3300031911 | Bacteria | 838 |
| 419 | Ga0307409_100573298 | 3300031995 | Bacteria | 1111 |
| 420 | Ga0307416_100008243 | 3300032002 | Bacteria | 6702 |
| 421 | Ga0307416_100136594 | 3300032002 | Bacteria | 2219 |
| 422 | Ga0307416_100435227 | 3300032002 | Bacteria | 1360 |
| 423 | Ga0307414_10037797 | 3300032004 | Bacteria | 3235 |
| 424 | Ga0307414_10056510 | 3300032004 | Bacteria | 2753 |
| 425 | Ga0307414_10069652 | 3300032004 | Bacteria | 2529 |
| 426 | Ga0307414_10322397 | 3300032004 | Bacteria | 1315 |
| 427 | Ga0307414_10339661 | 3300032004 | Bacteria | 1285 |
| 428 | Ga0307411_10064874 | 3300032005 | Bacteria | 2446 |
| 429 | Ga0307510_10088354 | 3300033180 | Bacteria | 2958 |
| 430 | Ga0373930_0053268 | 3300034816 | Bacteria | 888 |
| 431 | Ga0373938_0036468 | 3300034957 | Bacteria | 1076 |
| 432 | Ga0373932_0043834 | 3300035112 | Bacteria | 1302 |
| 433 | Ga0373931_0035468 | 3300035691 | Bacteria | 2594 |
| 434 | Ga0373931_0089255 | 3300035691 | Bacteria | 1715 |
| 435 | Ga0395900_0030030 | 3300037418 | Bacteria | 5579 |
| 436 | Ga0395905_0002893 | 3300037471 | Bacteria | 18759 |
| 437 | Ga0395905_0008745 | 3300037471 | Bacteria | 9960 |
| 438 | Ga0395905_0091128 | 3300037471 | Bacteria | 2858 |
| 439 | Ga0395905_0490453 | 3300037471 | Bacteria | 1128 |
| 440 | Ga0395901_0002440 | 3300038443 | Bacteria | 18848 |
| 441 | Ga0395901_0528703 | 3300038443 | Bacteria | 1197 |
| 442 | Ga0436361_0438991 | 3300039447 | Bacteria | 100787 |
| 443 | Ga0439436_0000668 | 3300041404 | Bacteria | 9183 |
| 444 | Ga0439436_0027592 | 3300041404 | Bacteria | 1660 |
| 445 | Ga0439439_0015796 | 3300041406 | Bacteria | 1845 |
| 446 | Ga0439439_0078325 | 3300041406 | Bacteria | 891 |
| 447 | Ga0439447_017322 | 3300041407 | Bacteria | 1962 |
| 448 | Ga0439447_025681 | 3300041407 | Bacteria | 1516 |
| 449 | Ga0439466_0010194 | 3300041411 | Bacteria | 3495 |
| 450 | Ga0439466_0032140 | 3300041411 | Bacteria | 1791 |
| 451 | Ga0439465_0004974 | 3300041413 | Bacteria | 4269 |
| 452 | Ga0451797_0634131 | 3300041453 | Bacteria | 1023 |
| 453 | Ga0451795_0258631 | 3300041456 | Bacteria | 1649 |
| 454 | Ga0451798_0022055 | 3300041458 | Bacteria | 2881 |
| 455 | Ga0439431_0033822 | 3300041997 | Bacteria | 1279 |
| 456 | Ga0439431_0047036 | 3300041997 | Bacteria | 1111 |
| 457 | Ga0439433_0018693 | 3300041999 | Bacteria | 1543 |
| 458 | Ga0439442_008635 | 3300042002 | Bacteria | 2057 |
| 459 | Ga0439442_016767 | 3300042002 | Bacteria | 1511 |
| 460 | Ga0439445_0000200 | 3300042004 | Bacteria | 10930 |
| 461 | Ga0439432_012106 | 3300042006 | Bacteria | 2960 |
| 462 | Ga0439449_0001627 | 3300042007 | Bacteria | 8807 |
| 463 | Ga0439449_0001772 | 3300042007 | Bacteria | 8484 |
| 464 | Ga0439449_0004482 | 3300042007 | Bacteria | 5393 |
| 465 | Ga0439452_002059 | 3300042010 | Bacteria | 7639 |
| 466 | Ga0439457_016362 | 3300042014 | Bacteria | 1653 |
| 467 | Ga0439462_0005319 | 3300042015 | Bacteria | 3171 |
| 468 | Ga0439462_0029804 | 3300042015 | Bacteria | 1443 |
| 469 | Ga0450922_004273 | 3300042124 | Bacteria | 1313 |
| 470 | Ga0450923_012192 | 3300042125 | Bacteria | 1560 |
| 471 | Ga0450923_012263 | 3300042125 | Bacteria | 1557 |
| 472 | Ga0450894_010049 | 3300042131 | Bacteria | 1227 |
| 473 | Ga0450898_000958 | 3300042134 | Bacteria | 3630 |
| 474 | Ga0450898_002604 | 3300042134 | Bacteria | 2528 |
| 475 | Ga0450906_001912 | 3300042145 | Bacteria | 4557 |
| 476 | Ga0450906_008396 | 3300042145 | Bacteria | 2000 |
| 477 | Ga0450910_018152 | 3300042147 | Bacteria | 1050 |
| 478 | Ga0439446_0010580 | 3300042156 | Bacteria | 2487 |
| 479 | Ga0439446_0016721 | 3300042156 | Bacteria | 2044 |
| 480 | Ga0439446_0156850 | 3300042156 | Bacteria | 751 |
| 481 | Ga0439458_0064123 | 3300042157 | Bacteria | 921 |
| 482 | Ga0439434_0005110 | 3300042435 | Bacteria | 3838 |
| 483 | Ga0439434_0011135 | 3300042435 | Bacteria | 2656 |
| 484 | Ga0450893_0019291 | 3300042532 | Bacteria | 1166 |
| 485 | Ga0466982_0364230 | 3300044672 | Bacteria | 797 |
| 486 | Ga0453683_0005431 | 3300044673 | Bacteria | 8894 |
| 487 | Ga0466965_0378277 | 3300044683 | Bacteria | 779 |
| 488 | Ga0466966_0050317 | 3300044684 | Bacteria | 2651 |
| 489 | Ga0453684_0070122 | 3300044712 | Bacteria | 4440 |
| 490 | Ga0466971_0112116 | 3300044719 | Bacteria | 1259 |
| 491 | Ga0466970_0098965 | 3300044765 | Bacteria | 1587 |
| 492 | Ga0466957_0088390 | 3300044842 | Bacteria | 1939 |
| 493 | Ga0451576_0010377 | 3300045051 | Bacteria | 10695 |
| 494 | Ga0451576_0941441 | 3300045051 | Bacteria | 906 |
| 495 | Ga0495617_025019 | 3300046452 | Bacteria | 2013 |
| 496 | Ga0495627_113570 | 3300046453 | Bacteria | 768 |
| 497 | Ga0495592_0000083 | 3300046454 | Bacteria | 83092 |
| 498 | Ga0495603_0158581 | 3300046455 | Bacteria | 1313 |
| 499 | Ga0495590_0000014 | 3300046457 | Bacteria | 258314 |
| 500 | Ga0495590_0045181 | 3300046457 | Bacteria | 1536 |
| 501 | Ga0495638_0000064 | 3300046460 | Bacteria | 180807 |
| 502 | Ga0495638_0127146 | 3300046460 | Bacteria | 1501 |
| 503 | Ga0495638_0130434 | 3300046460 | Bacteria | 1477 |
| 504 | Ga0495650_0000283 | 3300046471 | Bacteria | 96503 |
| 505 | Ga0495650_0001144 | 3300046471 | Bacteria | 28755 |
| 506 | Ga0495650_0001153 | 3300046471 | Bacteria | 28463 |
| 507 | Ga0495650_0081307 | 3300046471 | Bacteria | 1248 |
| 508 | Ga0495582_0167560 | 3300046473 | Bacteria | 1250 |
| 509 | Ga0495605_0000127 | 3300046474 | Bacteria | 100664 |
| 510 | Ga0495605_0004750 | 3300046474 | Bacteria | 7945 |
| 511 | Ga0495639_0002158 | 3300046475 | Bacteria | 8677 |
| 512 | Ga0495639_0030125 | 3300046475 | Bacteria | 2411 |
| 513 | Ga0495584_0031012 | 3300046491 | Bacteria | 2705 |
| 514 | Ga0495584_0251466 | 3300046491 | Bacteria | 898 |
| 515 | Ga0495607_0000853 | 3300046501 | Bacteria | 28749 |
| 516 | Ga0495607_0000905 | 3300046501 | Bacteria | 27603 |
| 517 | Ga0495607_0076345 | 3300046501 | Bacteria | 1853 |
| 518 | Ga0495607_0161083 | 3300046501 | Bacteria | 1140 |
| 519 | Ga0495583_0000287 | 3300046506 | Bacteria | 80398 |
| 520 | Ga0495583_0000928 | 3300046506 | Bacteria | 34428 |
| 521 | Ga0495583_0005050 | 3300046506 | Bacteria | 9116 |
| 522 | Ga0495606_0000353 | 3300046507 | Bacteria | 78700 |
| 523 | Ga0495606_0000933 | 3300046507 | Bacteria | 43050 |
| 524 | Ga0495606_0001708 | 3300046507 | Bacteria | 28313 |
| 525 | Ga0495606_0006490 | 3300046507 | Bacteria | 10762 |
| 526 | Ga0495606_0047455 | 3300046507 | Bacteria | 2830 |
| 527 | Ga0495606_0092112 | 3300046507 | Bacteria | 1862 |
| 528 | Ga0495606_0105255 | 3300046507 | Bacteria | 1710 |
| 529 | Ga0495610_0001111 | 3300046512 | Bacteria | 24494 |
| 530 | Ga0495610_0017794 | 3300046512 | Bacteria | 4041 |
| 531 | Ga0495610_0054754 | 3300046512 | Bacteria | 1926 |
| 532 | Ga0495616_0032225 | 3300046513 | Bacteria | 2740 |
| 533 | Ga0495616_0046308 | 3300046513 | Bacteria | 2195 |
| 534 | Ga0495620_0008764 | 3300046515 | Bacteria | 5413 |
| 535 | Ga0495620_0071350 | 3300046515 | Bacteria | 1420 |
| 536 | Ga0495630_0487849 | 3300046517 | Bacteria | 945 |
| 537 | Ga0495631_0006138 | 3300046518 | Bacteria | 6228 |
| 538 | Ga0495632_0002315 | 3300046519 | Bacteria | 14654 |
| 539 | Ga0495637_0000430 | 3300046520 | Bacteria | 30664 |
| 540 | Ga0495643_0000108 | 3300046522 | Bacteria | 136032 |
| 541 | Ga0495643_0001013 | 3300046522 | Bacteria | 28723 |
| 542 | Ga0495643_0075869 | 3300046522 | Bacteria | 1759 |
| 543 | Ga0495644_0017049 | 3300046523 | Bacteria | 2779 |
| 544 | Ga0495648_0000006 | 3300046524 | Bacteria | 361208 |
| 545 | Ga0495648_0001956 | 3300046524 | Bacteria | 19609 |
| 546 | Ga0495648_0009458 | 3300046524 | Bacteria | 7548 |
| 547 | Ga0495642_0022344 | 3300046528 | Bacteria | 2492 |
| 548 | Ga0495654_0000131 | 3300046530 | Bacteria | 80339 |
| 549 | Ga0495654_0013618 | 3300046530 | Bacteria | 4349 |
| 550 | Ga0495587_0062135 | 3300046536 | Bacteria | 2188 |
| 551 | Ga0495609_0000670 | 3300046538 | Bacteria | 26591 |
| 552 | Ga0495609_0020155 | 3300046538 | Bacteria | 3081 |
| 553 | Ga0495609_0042404 | 3300046538 | Bacteria | 2043 |
| 554 | Ga0495609_0045900 | 3300046538 | Bacteria | 1957 |
| 555 | Ga0495621_0011454 | 3300046539 | Bacteria | 2744 |
| 556 | Ga0495621_0012148 | 3300046539 | Bacteria | 2680 |
| 557 | Ga0495597_0000091 | 3300046542 | Bacteria | 80111 |
| 558 | Ga0495597_0007196 | 3300046542 | Bacteria | 5675 |
| 559 | Ga0495622_0000322 | 3300046557 | Bacteria | 35249 |
| 560 | Ga0495622_0015976 | 3300046557 | Bacteria | 3491 |
| 561 | Ga0495622_0043332 | 3300046557 | Bacteria | 2092 |
| 562 | Ga0495633_0000158 | 3300046558 | Bacteria | 88850 |
| 563 | Ga0495633_0002191 | 3300046558 | Bacteria | 13994 |
| 564 | Ga0495633_0002981 | 3300046558 | Bacteria | 11576 |
| 565 | Ga0495633_0008695 | 3300046558 | Bacteria | 5694 |
| 566 | Ga0495633_0009399 | 3300046558 | Bacteria | 5403 |
| 567 | Ga0495656_0000757 | 3300046615 | Bacteria | 10411 |
| 568 | Ga0495668_0000029 | 3300046616 | Bacteria | 279128 |
| 569 | Ga0495668_0000119 | 3300046616 | Bacteria | 118812 |
| 570 | Ga0495668_0000209 | 3300046616 | Bacteria | 84817 |
| 571 | Ga0495668_0021464 | 3300046616 | Bacteria | 3702 |
| 572 | Ga0495668_0036766 | 3300046616 | Bacteria | 2742 |
| 573 | Ga0495668_0085253 | 3300046616 | Bacteria | 1733 |
| 574 | Ga0495611_0105950 | 3300046648 | Bacteria | 1307 |
| 575 | Ga0495611_0324005 | 3300046648 | Bacteria | 709 |
| 576 | Ga0495625_0000871 | 3300046660 | Bacteria | 41066 |
| 577 | Ga0495625_0000950 | 3300046660 | Bacteria | 38751 |
| 578 | Ga0495625_0001595 | 3300046660 | Bacteria | 26843 |
| 579 | Ga0495625_0002825 | 3300046660 | Bacteria | 18281 |
| 580 | Ga0495625_0013051 | 3300046660 | Bacteria | 6697 |
| 581 | Ga0495625_0109606 | 3300046660 | Bacteria | 1888 |
| 582 | Ga0495625_0113945 | 3300046660 | Bacteria | 1846 |
| 583 | Ga0495625_0118296 | 3300046660 | Bacteria | 1805 |
| 584 | Ga0495625_0164648 | 3300046660 | Bacteria | 1483 |
| 585 | Ga0495635_0364364 | 3300046663 | Bacteria | 963 |
| 586 | Ga0495659_0000188 | 3300046664 | Bacteria | 26796 |
| 587 | Ga0495659_0001672 | 3300046664 | Bacteria | 7432 |
| 588 | Ga0495659_0005629 | 3300046664 | Bacteria | 3948 |
| 589 | Ga0495661_0062258 | 3300046665 | Bacteria | 2211 |
| 590 | Ga0495588_0067890 | 3300046674 | Bacteria | 1851 |
| 591 | Ga0495588_0081687 | 3300046674 | Bacteria | 1687 |
| 592 | Ga0495646_0135167 | 3300046680 | Bacteria | 1384 |
| 593 | Ga0495646_0137557 | 3300046680 | Bacteria | 1369 |
| 594 | Ga0495658_0011396 | 3300046683 | Bacteria | 4471 |
| 595 | Ga0495669_0002335 | 3300046684 | Bacteria | 7776 |
| 596 | Ga0495624_0033039 | 3300046690 | Bacteria | 3352 |
| 597 | Ga0495670_0029832 | 3300046691 | Bacteria | 2709 |
| 598 | Ga0495670_0036893 | 3300046691 | Bacteria | 2436 |
| 599 | Ga0495670_0062358 | 3300046691 | Bacteria | 1875 |
| 600 | Ga0495670_0118241 | 3300046691 | Bacteria | 1376 |
| 601 | Ga0495671_0003751 | 3300046692 | Bacteria | 9235 |
| 602 | Ga0495671_0010447 | 3300046692 | Bacteria | 5142 |
| 603 | Ga0495671_0070745 | 3300046692 | Bacteria | 1714 |
| 604 | Ga0495671_0313354 | 3300046692 | Bacteria | 754 |
| 605 | Ga0495649_0011480 | 3300046694 | Bacteria | 5192 |
| 606 | Ga0495649_0021278 | 3300046694 | Bacteria | 3634 |
| 607 | Ga0495649_0048026 | 3300046694 | Bacteria | 2320 |
| 608 | Ga0495649_0208043 | 3300046694 | Bacteria | 1014 |
| 609 | Ga0495589_0030229 | 3300046794 | Bacteria | 2729 |
| 610 | Ga0495660_0012736 | 3300046810 | Bacteria | 4879 |
| 611 | Ga0495660_0042564 | 3300046810 | Bacteria | 2509 |
| 612 | Ga0495660_0043239 | 3300046810 | Bacteria | 2486 |
| 613 | Ga0495660_0071931 | 3300046810 | Bacteria | 1832 |
| 614 | Ga0495660_0114732 | 3300046810 | Bacteria | 1370 |
| 615 | Ga0495660_0159839 | 3300046810 | Bacteria | 1106 |
| 616 | Ga0495636_0002494 | 3300047318 | Bacteria | 7054 |
| 617 | Ga0495636_0022866 | 3300047318 | Bacteria | 2529 |
| 618 | Ga0495672_0000088 | 3300047320 | Bacteria | 153860 |
| 619 | Ga0495672_0000295 | 3300047320 | Bacteria | 68246 |
| 620 | Ga0495672_0009310 | 3300047320 | Bacteria | 7131 |
| 621 | Ga0495672_0023923 | 3300047320 | Bacteria | 3945 |
| 622 | Ga0495672_0067974 | 3300047320 | Bacteria | 2027 |
| 623 | Ga0495683_0000892 | 3300047323 | Bacteria | 21047 |
| 624 | Ga0495687_000042 | 3300047443 | Bacteria | 218868 |
| 625 | Ga0495687_013309 | 3300047443 | Bacteria | 4305 |
| 626 | Ga0495687_037736 | 3300047443 | Bacteria | 2149 |
| 627 | Ga0495677_0014959 | 3300047445 | Bacteria | 2821 |
| 628 | Ga0495679_018699 | 3300047446 | Bacteria | 2452 |
| 629 | Ga0495685_000081 | 3300047447 | Bacteria | 36040 |
| 630 | Ga0495685_002774 | 3300047447 | Bacteria | 5523 |
| 631 | Ga0495673_0003259 | 3300047469 | Bacteria | 10804 |
| 632 | Ga0495681_0007092 | 3300047470 | Bacteria | 7230 |
| 633 | Ga0495686_0000212 | 3300047472 | Bacteria | 107418 |
| 634 | Ga0495686_0001211 | 3300047472 | Bacteria | 29663 |
| 635 | Ga0495686_0004528 | 3300047472 | Bacteria | 11390 |
| 636 | Ga0495686_0072272 | 3300047472 | Bacteria | 2121 |
| 637 | Ga0495686_0072594 | 3300047472 | Bacteria | 2116 |
| 638 | Ga0495686_0222502 | 3300047472 | Bacteria | 1073 |
| 639 | Ga0495593_0055127 | 3300047673 | Bacteria | 2093 |
| 640 | Ga0495614_0024137 | 3300048089 | Bacteria | 2625 |
| 641 | Ga0495614_0061498 | 3300048089 | Bacteria | 1614 |
| 642 | Ga0496100_0195133 | 3300048903 | Bacteria | 1472 |
| 643 | Ga0496101_0170343 | 3300048904 | Bacteria | 1673 |
| 644 | Ga0496102_0014383 | 3300048905 | Bacteria | 6875 |
| 645 | Ga0496102_0415378 | 3300048905 | Bacteria | 1264 |
| 646 | Ga0496104_0013037 | 3300048907 | Bacteria | 7486 |
| 647 | Ga0496105_0011369 | 3300048908 | Bacteria | 7031 |
| 648 | Ga0496106_0184482 | 3300048909 | Bacteria | 1657 |
| 649 | Ga0496107_0240174 | 3300048910 | Bacteria | 1348 |
| 650 | Ga0496108_0064875 | 3300048911 | Bacteria | 3077 |
| 651 | Ga0496109_0505860 | 3300048912 | Bacteria | 1140 |
| 652 | Ga0496109_0719244 | 3300048912 | Bacteria | 936 |
| 653 | Ga0496110_0982272 | 3300048913 | Bacteria | 751 |
| 654 | Ga0496111_0294871 | 3300048914 | Bacteria | 1202 |
| 655 | Ga0496114_0227951 | 3300048917 | Bacteria | 1636 |
| 656 | Ga0496115_0071704 | 3300048918 | Bacteria | 2810 |
| 657 | Ga0496115_0656212 | 3300048918 | Bacteria | 829 |
| 658 | Ga0496116_0028608 | 3300048919 | Bacteria | 4033 |
| 659 | Ga0496116_0071652 | 3300048919 | Bacteria | 2193 |
| 660 | Ga0496116_0312195 | 3300048919 | Bacteria | 741 |
| 661 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 662 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 663 | Ga0496118_0009732 | 3300048921 | Bacteria | 9647 |
| 664 | Ga0496118_0113107 | 3300048921 | Bacteria | 1794 |
| 665 | Ga0496118_0316806 | 3300048921 | Bacteria | 848 |
| 666 | Ga0496120_0138164 | 3300048923 | Bacteria | 1240 |
| 667 | Ga0496121_0047683 | 3300048924 | Bacteria | 3652 |
| 668 | Ga0496121_0166401 | 3300048924 | Bacteria | 1606 |
| 669 | Ga0496121_0362049 | 3300048924 | Bacteria | 962 |
| 670 | Ga0496122_0000612 | 3300048925 | Bacteria | 73307 |
| 671 | Ga0496122_0009918 | 3300048925 | Bacteria | 9923 |
| 672 | Ga0496122_0356376 | 3300048925 | Bacteria | 761 |
| 673 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 674 | Ga0496123_0020234 | 3300048926 | Bacteria | 5212 |
| 675 | Ga0496124_0018117 | 3300048927 | Bacteria | 6609 |
| 676 | Ga0496124_0073398 | 3300048927 | Bacteria | 2831 |
| 677 | Ga0496124_0146250 | 3300048927 | Bacteria | 1859 |
| 678 | Ga0496125_0028804 | 3300048928 | Bacteria | 5005 |
| 679 | Ga0496125_0051111 | 3300048928 | Bacteria | 3412 |
| 680 | Ga0496125_0235471 | 3300048928 | Bacteria | 1167 |
| 681 | Ga0496125_0333316 | 3300048928 | Bacteria | 914 |
| 682 | Ga0496126_0722837 | 3300048929 | Bacteria | 772 |
| 683 | Ga0501306_008736 | 3300049127 | Bacteria | 1242 |
| 684 | Ga0501308_008683 | 3300049128 | Bacteria | 1093 |
| 685 | Ga0501309_025636 | 3300049129 | Bacteria | 848 |
| 686 | Ga0501305_027674 | 3300049161 | Bacteria | 870 |
| 687 | Ga0501305_043813 | 3300049161 | Bacteria | 735 |
| 688 | Ga0495678_000259 | 3300049459 | Bacteria | 59034 |
| 689 | Ga0495678_008378 | 3300049459 | Bacteria | 5222 |
| 690 | Ga0495678_058348 | 3300049459 | Bacteria | 1458 |
| 691 | Ga0495682_0002024 | 3300049460 | Bacteria | 9991 |
| 692 | Ga0495682_0004316 | 3300049460 | Bacteria | 6120 |
| 693 | Ga0501292_006634 | 3300049515 | Bacteria | 1651 |
| 694 | Ga0501311_008121 | 3300049527 | Bacteria | 1223 |
| 695 | Ga0501311_046900 | 3300049527 | Bacteria | 668 |
| 696 | Ga0501314_013548 | 3300049530 | Bacteria | 791 |
| 697 | Ga0501315_007576 | 3300049531 | Bacteria | 1240 |
| 698 | Ga0501315_017802 | 3300049531 | Bacteria | 932 |
| 699 | Ga0501320_005849 | 3300049536 | Bacteria | 1134 |
| 700 | Ga0501323_006400 | 3300049539 | Bacteria | 1315 |
| 701 | Ga0501323_011804 | 3300049539 | Bacteria | 1059 |
| 702 | Ga0501036_0268975 | 3300049572 | Bacteria | 1427 |
| 703 | Ga0501039_0266499 | 3300049575 | Bacteria | 1346 |
| 704 | Ga0501042_0050325 | 3300049578 | Bacteria | 2972 |
| 705 | Ga0501048_0082014 | 3300049582 | Bacteria | 2275 |
| 706 | Ga0501072_0182306 | 3300049588 | Bacteria | 1675 |
| 707 | Ga0501077_0185649 | 3300049593 | Bacteria | 1321 |
| 708 | Ga0501222_025079 | 3300049662 | Bacteria | 807 |
| 709 | Ga0501227_003408 | 3300049665 | Bacteria | 3447 |
| 710 | Ga0501227_028620 | 3300049665 | Bacteria | 1324 |
| 711 | Ga0501230_005166 | 3300049667 | Bacteria | 1833 |
| 712 | Ga0501238_002242 | 3300049671 | Bacteria | 2293 |
| 713 | Ga0501081_0204371 | 3300049743 | Bacteria | 1433 |
| 714 | Ga0501269_010451 | 3300049766 | Bacteria | 1129 |
| 715 | Ga0501279_007283 | 3300049775 | Bacteria | 1468 |
| 716 | nmdc:mga03683_217769_c1 | 3300050489 | Bacteria | 880 |
| 717 | nmdc:mga03683_52726_c1 | 3300050489 | Bacteria | 1701 |
| 718 | nmdc:mga03n38_210331_c1 | 3300050490 | Bacteria | 1011 |
| 719 | nmdc:mga03n38_237862_c1 | 3300050490 | Bacteria | 957 |
| 720 | nmdc:mga03n38_324952_c1 | 3300050490 | Bacteria | 832 |
| 721 | nmdc:mga00v17_111385_c1 | 3300050491 | Bacteria | 1737 |
| 722 | nmdc:mga00v17_131135_c1 | 3300050491 | Bacteria | 1602 |
| 723 | nmdc:mga00v17_261312_c1 | 3300050491 | Bacteria | 1123 |
| 724 | nmdc:mga00v17_272718_c1 | 3300050491 | Bacteria | 1098 |
| 725 | nmdc:mga0yw44_54808_c1 | 3300050492 | Bacteria | 2425 |
| 726 | nmdc:mga0k408_13069_c2 | 3300050493 | Bacteria | 2720 |
| 727 | nmdc:mga0k408_25360_c1 | 3300050493 | Bacteria | 3358 |
| 728 | nmdc:mga0k408_3060_c1 | 3300050493 | Bacteria | 8871 |
| 729 | nmdc:mga0k408_31969_c1 | 3300050493 | Bacteria | 3007 |
| 730 | nmdc:mga06z11_331518_c1 | 3300050494 | Bacteria | 909 |
| 731 | nmdc:mga06z11_355351_c1 | 3300050494 | Bacteria | 878 |
| 732 | nmdc:mga07m45_25479_c1 | 3300050496 | Bacteria | 3244 |
| 733 | nmdc:mga07m45_3314_c1 | 3300050496 | Bacteria | 7759 |
| 734 | nmdc:mga07m45_38060_c1 | 3300050496 | Bacteria | 2684 |
| 735 | nmdc:mga07m45_3823_c1 | 3300050496 | Bacteria | 7291 |
| 736 | nmdc:mga07m45_42531_c1 | 3300050496 | Bacteria | 2547 |
| 737 | nmdc:mga07m45_466522_c1 | 3300050496 | Bacteria | 732 |
| 738 | nmdc:mga07m45_67535_c1 | 3300050496 | Bacteria | 2032 |
| 739 | Ga0500610_0219697 | 3300053079 | Bacteria | 900 |
| 740 | Ga0500635_0000030 | 3300053080 | Bacteria | 99936 |
| 741 | Ga0500578_0000363 | 3300053086 | Bacteria | 55670 |
| 742 | Ga0500644_0087237 | 3300053088 | Bacteria | 1160 |
| 743 | Ga0500646_0015224 | 3300053090 | Bacteria | 2002 |
| 744 | Ga0500647_0028928 | 3300053091 | Bacteria | 2626 |
| 745 | Ga0500651_0011180 | 3300053093 | Bacteria | 5404 |
| 746 | Ga0500651_0016838 | 3300053093 | Bacteria | 4499 |
| 747 | Ga0500651_0075767 | 3300053093 | Bacteria | 2089 |
| 748 | Ga0500641_0067121 | 3300053096 | Bacteria | 1503 |
| 749 | Ga0500641_0070578 | 3300053096 | Bacteria | 1470 |
| 750 | Ga0500555_031764 | 3300053103 | Bacteria | 1495 |
| 751 | Ga0500560_066461 | 3300053107 | Bacteria | 1183 |
| 752 | Ga0500571_002284 | 3300053110 | Bacteria | 9449 |
| 753 | Ga0500593_000312 | 3300053117 | Bacteria | 19544 |
| 754 | Ga0500594_0001013 | 3300053118 | Bacteria | 6025 |
| 755 | Ga0500594_0001867 | 3300053118 | Bacteria | 4566 |
| 756 | Ga0500594_0012374 | 3300053118 | Bacteria | 2009 |
| 757 | Ga0500594_0080478 | 3300053118 | Bacteria | 973 |
| 758 | Ga0500594_0108434 | 3300053118 | Bacteria | 861 |
| 759 | Ga0500607_009334 | 3300053121 | Bacteria | 5907 |
| 760 | Ga0500607_055142 | 3300053121 | Bacteria | 2102 |
| 761 | Ga0500608_197886 | 3300053122 | Bacteria | 834 |
| 762 | Ga0500618_003147 | 3300053125 | Bacteria | 5807 |
| 763 | Ga0500623_146878 | 3300053127 | Bacteria | 978 |
| 764 | Ga0500626_019470 | 3300053128 | Bacteria | 3012 |
| 765 | Ga0500628_002666 | 3300053129 | Bacteria | 2944 |
| 766 | Ga0500628_055474 | 3300053129 | Bacteria | 953 |
| 767 | Ga0500642_0020334 | 3300053130 | Bacteria | 2607 |
| 768 | Ga0500652_003742 | 3300053131 | Bacteria | 4635 |
| 769 | Ga0500655_000872 | 3300053133 | Bacteria | 5856 |
| 770 | Ga0500658_0000730 | 3300053134 | Bacteria | 13540 |
| 771 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 772 | Ga0500559_0004500 | 3300053136 | Bacteria | 6598 |
| 773 | Ga0500559_0018151 | 3300053136 | Bacteria | 2973 |
| 774 | Ga0500568_0001792 | 3300053139 | Bacteria | 13230 |
| 775 | Ga0500568_0023959 | 3300053139 | Bacteria | 2589 |
| 776 | Ga0500568_0060467 | 3300053139 | Bacteria | 1467 |
| 777 | Ga0500573_0251675 | 3300053140 | Bacteria | 910 |
| 778 | Ga0500574_026855 | 3300053141 | Bacteria | 1514 |
| 779 | Ga0500577_0037393 | 3300053142 | Bacteria | 1745 |
| 780 | Ga0500586_002852 | 3300053145 | Bacteria | 3987 |
| 781 | Ga0500604_0004794 | 3300053151 | Bacteria | 3585 |
| 782 | Ga0500616_0027300 | 3300053153 | Bacteria | 3152 |
| 783 | Ga0500622_0001269 | 3300053156 | Bacteria | 20606 |
| 784 | Ga0500622_0031643 | 3300053156 | Bacteria | 2776 |
| 785 | Ga0500622_0152310 | 3300053156 | Bacteria | 1092 |
| 786 | Ga0500627_0041172 | 3300053158 | Bacteria | 1985 |
| 787 | Ga0500634_0005209 | 3300053161 | Bacteria | 6141 |
| 788 | Ga0500634_0042082 | 3300053161 | Bacteria | 2478 |
| 789 | Ga0500638_006538 | 3300053162 | Bacteria | 4780 |
| 790 | Ga0500636_0028728 | 3300053177 | Bacteria | 3284 |
| 791 | Ga0500636_0254012 | 3300053177 | Bacteria | 894 |
| 792 | Ga0500625_121994 | 3300053729 | Bacteria | 1045 |
| 793 | Ga0500645_001028 | 3300053730 | Bacteria | 15622 |
| 794 | Ga0501084_1053516 | 3300054114 | Bacteria | 683 |
| 795 | Ga0500661_007849 | 3300055283 | Bacteria | 1968 |
| 796 | Ga0587084_000637 | 3300059477 | Bacteria | 2906 |
| 797 | Ga0587066_032534 | 3300059490 | Bacteria | 939 |
| 798 | Ga0587070_063946 | 3300059491 | Bacteria | 768 |
| 799 | Ga0587073_0027859 | 3300059492 | Bacteria | 1143 |
| 800 | Ga0587077_000886 | 3300059493 | Bacteria | 2941 |
| 801 | Ga0587082_020617 | 3300059504 | Bacteria | 1070 |
| 802 | Ga0587082_027390 | 3300059504 | Bacteria | 971 |
| 803 | Ga0587083_0044276 | 3300059505 | Bacteria | 945 |
| 804 | Ga0587085_016072 | 3300059506 | Bacteria | 1078 |
| 805 | Ga0587086_011719 | 3300059507 | Bacteria | 1079 |
| 806 | Ga0587090_000538 | 3300059510 | Bacteria | 3238 |
| 807 | Ga0587091_006879 | 3300059511 | Bacteria | 1617 |
| 808 | Ga0587091_069392 | 3300059511 | Bacteria | 768 |
| 809 | Ga0587092_003071 | 3300059512 | Bacteria | 1860 |
| 810 | Ga0587094_008011 | 3300059513 | Bacteria | 1311 |
| 811 | Ga0587115_035574 | 3300059626 | Bacteria | 758 |
| 812 | Ga0587062_005863 | 3300059639 | Bacteria | 1375 |
| 813 | Ga0587067_008438 | 3300059640 | Bacteria | 1506 |
| 814 | Ga0587068_003426 | 3300059641 | Bacteria | 2023 |
| 815 | Ga0587068_011727 | 3300059641 | Bacteria | 1328 |
| 816 | Ga0587068_020124 | 3300059641 | Bacteria | 1088 |
| 817 | Ga0587069_013484 | 3300059642 | Bacteria | 1125 |
| 818 | Ga0587072_010791 | 3300059643 | Bacteria | 1482 |
| 819 | Ga0587072_093925 | 3300059643 | Bacteria | 665 |
| 820 | Ga0587076_001426 | 3300059645 | Bacteria | 2428 |
| 821 | Ga0587111_0001149 | 3300060346 | Bacteria | 3031 |
| 822 | 2511244643 | 2511231002 | Bacteria | 5042903 |
| 823 | 2587731718 | 2585428058 | Bacteria | 6853932 |
| 824 | 2644142440 | 2643221625 | Bacteria | 6512927 |
| 825 | 2644277061 | 2643221648 | Bacteria | 6521465 |
| 826 | 2928118008 | 2928115317 | Bacteria | 6477646 |
| 827 | Ga0496114_0212422 | |||
| 828 | JGI25155J39150_1000022 | |||
| 829 | JGI25156J39149_1000005 | |||
| 830 | JGI25156J39149_1007101 | |||
| 831 | JGI25154J39366_1000017 | |||
| 832 | JGI25157J39369_1000003 | |||
| 833 | JGI25152J39213_1017849 | |||
| 834 | JGI25150J39212_1001639 | |||
| 835 | JGI25150J39212_1005198 | |||
| 836 | JGI25150J39212_1008124 | |||
| 837 | JGI25159J45721_1000396 | |||
| 838 | JGI25159J45721_1005038 | |||
| 839 | JGI25159J45721_1008343 | |||
| 840 | JGI25151J46595_10001069 | |||
| 841 | JGI25151J46595_10081221 | |||
| 842 | JGI25151J46595_10084991 | |||
| 843 | JGI25153J46596_10004229 | |||
| 844 | JGI25153J46596_10004541 | |||
| 845 | JGI25160J50197_1002413 | |||
| 846 | JGI25160J50197_1033794 | |||
| 847 | JGI25161J50226_1000095 | |||
| 848 | JGI25161J50226_1002922 | |||
| 849 | Ga0007409J51694_1010614 | |||
| 850 | Ga0007416J51690_1020706 | |||
| 851 | Ga0006562J51391_1033687 | |||
| 852 | Ga0032354_1023833 | |||
| 853 | Ga0055535_1000047 | |||
| 854 | Ga0055535_1001458 | |||
| 855 | Ga0055542_1000080 | |||
| 856 | Ga0055529_1000148 | |||
| 857 | Ga0055526_1000030 | |||
| 858 | Ga0055526_1000167 | |||
| 859 | Ga0055526_1002375 | |||
| 860 | Ga0055526_1002601 | |||
| 861 | Ga0055526_1003176 | |||
| 862 | Ga0055526_1011045 | |||
| 863 | Ga0055537_1000150 | |||
| 864 | Ga0055537_1000205 | |||
| 865 | Ga0055537_1000239 | |||
| 866 | Ga0055537_1010578 | |||
| 867 | Ga0055524_1000017 | |||
| 868 | Ga0055524_1000073 | |||
| 869 | Ga0055524_1001044 | |||
| 870 | Ga0055524_1006211 | |||
| 871 | Ga0055524_1014364 | |||
| 872 | Ga0055536_1018344 | |||
| 873 | Ga0055534_1000016 | |||
| 874 | Ga0055534_1000194 | |||
| 875 | Ga0055534_1000363 | |||
| 876 | Ga0055534_1001058 | |||
| 877 | Ga0055534_1003933 | |||
| 878 | Ga0055528_1000253 | |||
| 879 | Ga0055528_1000289 | |||
| 880 | Ga0055528_1008808 | |||
| 881 | Ga0055528_1014906 | |||
| 882 | Ga0055530_10001804 | |||
| 883 | Ga0055530_10008565 | |||
| 884 | Ga0055530_10037309 | |||
| 885 | Ga0055540_1000037 | |||
| 886 | Ga0055540_1002771 | |||
| 887 | Ga0055540_1040942 | |||
| 888 | Ga0055531_10011377 | |||
| 889 | Ga0055531_10023264 | |||
| 890 | Ga0055543_1000218 | |||
| 891 | Ga0055543_1028236 | |||
| 892 | Ga0065165_1000805 | |||
| 893 | Ga0065165_1037171 | |||
| 894 | Ga0065165_1055083 | |||
| 895 | Ga0065714_10073610 | |||
| 896 | Ga0065704_10003100 | |||
| 897 | Ga0070676_10194284 | |||
| 898 | Ga0070677_10249905 | |||
| 899 | Ga0068869_100099975 | |||
| 900 | Ga0068869_100185274 | |||
| 901 | Ga0070666_10349580 | |||
| 902 | Ga0068868_100008545 | |||
| 903 | Ga0068868_100069555 | |||
| 904 | Ga0070660_100001068 | |||
| 905 | Ga0070661_100005897 | |||
| 906 | Ga0070675_100028611 | |||
| 907 | Ga0070659_100005068 | |||
| 908 | Ga0070659_100343187 | |||
| 909 | Ga0070667_100024333 | |||
| 910 | Ga0070667_100228766 | |||
| 911 | Ga0070678_100178002 | |||
| 912 | Ga0070678_100296001 | |||
| 913 | Ga0070678_100327262 | |||
| 914 | Ga0070662_100018957 | |||
| 915 | Ga0068867_100126586 | |||
| 916 | Ga0068867_100268214 | |||
| 917 | Ga0068853_100344331 | |||
| 918 | Ga0070672_100003408 | |||
| 919 | Ga0070665_100027466 | |||
| 920 | Ga0070665_100634191 | |||
| 921 | Ga0070665_100814421 | |||
| 922 | Ga0070664_100011901 | |||
| 923 | Ga0070664_100221117 | |||
| 924 | Ga0068857_100082461 | |||
| 925 | Ga0068856_100134337 | |||
| 926 | Ga0068859_100044728 | |||
| 927 | Ga0068864_100019420 | |||
| 928 | Ga0068866_10364797 | |||
| 929 | Ga0068851_10023769 | |||
| 930 | Ga0068863_100018423 | |||
| 931 | Ga0068863_100581246 | |||
| 932 | Ga0068860_100254189 | |||
| 933 | Ga0068862_100052707 | |||
| 934 | Ga0068862_101039079 | |||
| 935 | Ga0075365_10021801 | |||
| 936 | Ga0075368_10091162 | |||
| 937 | Ga0075363_100050969 | |||
| 938 | Ga0075363_100096973 | |||
| 939 | Ga0075363_100112476 | |||
| 940 | Ga0075363_100348596 | |||
| 941 | Ga0075364_10092158 | |||
| 942 | Ga0075364_10149945 | |||
| 943 | Ga0075364_10273367 | |||
| 944 | Ga0075364_10464517 | |||
| 945 | Ga0075362_10007740 | |||
| 946 | Ga0075362_10018885 | |||
| 947 | Ga0075362_10035036 | |||
| 948 | Ga0075369_10111044 | |||
| 949 | Ga0075369_10210076 | |||
| 950 | Ga0075366_10001610 | |||
| 951 | Ga0075366_10036288 | |||
| 952 | Ga0075366_10062614 | |||
| 953 | Ga0075366_10141318 | |||
| 954 | Ga0075366_10165863 | |||
| 955 | Ga0097621_100686774 | |||
| 956 | Ga0075370_10000182 | |||
| 957 | Ga0075370_10035523 | |||
| 958 | Ga0075370_10055531 | |||
| 959 | Ga0075370_10087886 | |||
| 960 | Ga0075370_10184141 | |||
| 961 | Ga0097620_100044728 | |||
| 962 | Ga0097620_101023521 | |||
| 963 | Ga0079104_1049112 | |||
| 964 | Ga0099826_10000033 | |||
| 965 | Ga0099826_10126910 | |||
| 966 | Ga0105244_10001268 | |||
| 967 | Ga0105244_10003719 | |||
| 968 | Ga0105245_10065399 | |||
| 969 | Ga0105245_11056088 | |||
| 970 | Ga0105243_10000306 | |||
| 971 | Ga0105241_10053049 | |||
| 972 | Ga0105241_10116335 | |||
| 973 | Ga0105242_10108114 | |||
| 974 | Ga0105242_10152883 | |||
| 975 | Ga0105242_10655434 | |||
| 976 | Ga0105248_10106946 | |||
| 977 | Ga0105237_10027197 | |||
| 978 | Ga0105237_10653740 | |||
| 979 | Ga0105249_10106069 | |||
| 980 | Ga0105239_10059436 | |||
| 981 | Ga0105246_10029216 | |||
| 982 | Ga0105246_10369650 | |||
| 983 | Ga0105246_10536995 | |||
| 984 | Ga0157326_1003197 | |||
| 985 | Ga0157373_10049442 | |||
| 986 | Ga0157371_10065886 | |||
| 987 | Ga0157370_10006343 | |||
| 988 | Ga0157370_10301385 | |||
| 989 | Ga0157370_10362345 | |||
| 990 | Ga0157370_10431898 | |||
| 991 | Ga0157369_10022693 | |||
| 992 | Ga0157369_10432163 | |||
| 993 | Ga0157374_10003108 | |||
| 994 | Ga0157378_10153308 | |||
| 995 | Ga0163162_10012566 | |||
| 996 | Ga0163162_10028381 | |||
| 997 | Ga0163162_10101937 | |||
| 998 | Ga0163162_10230309 | |||
| 999 | Ga0163162_10305543 | |||
| 1000 | Ga0157372_10064423 | |||
| 1001 | Ga0157372_10092801 | |||
| 1002 | Ga0157375_10066403 | |||
| 1003 | Ga0157375_10090664 | |||
| 1004 | Ga0157375_10118615 | |||
| 1005 | Ga0182008_10006764 | |||
| 1006 | Ga0182008_10007832 | |||
| 1007 | Ga0182008_10147580 | |||
| 1008 | Ga0182008_10254056 | |||
| 1009 | Ga0157377_10001539 | |||
| 1010 | Ga0157379_10487384 | |||
| 1011 | Ga0157376_10006686 | |||
| 1012 | Ga0157376_10652835 | |||
| 1013 | Ga0182006_1000007 | |||
| 1014 | Ga0182007_10001496 | |||
| 1015 | Ga0182007_10001829 | |||
| 1016 | Ga0182007_10002638 | |||
| 1017 | Ga0182005_1000010 | |||
| 1018 | Ga0182005_1019707 | |||
| 1019 | Ga0183362_10003 | |||
| 1020 | Ga0163161_10001866 | |||
| 1021 | Ga0163161_10012281 | |||
| 1022 | Ga0163161_10025897 | |||
| 1023 | Ga0163161_10029349 | |||
| 1024 | Ga0163161_10060685 | |||
| 1025 | Ga0163161_10148443 | |||
| 1026 | Ga0209435_100002 | |||
| 1027 | Ga0209436_101922 | |||
| 1028 | Ga0209436_102444 | |||
| 1029 | Ga0209672_107033 | |||
| 1030 | Ga0209147_101277 | |||
| 1031 | Ga0209437_108392 | |||
| 1032 | Ga0209258_100009 | |||
| 1033 | Ga0209258_100072 | |||
| 1034 | Ga0207425_1000009 | |||
| 1035 | Ga0207425_1000068 | |||
| 1036 | Ga0207425_1000874 | |||
| 1037 | Ga0207425_1002707 | |||
| 1038 | Ga0207425_1004112 | |||
| 1039 | Ga0207425_1007113 | |||
| 1040 | Ga0209646_1000001 | |||
| 1041 | Ga0209026_1000001 | |||
| 1042 | Ga0209148_1000007 | |||
| 1043 | Ga0209759_1000001 | |||
| 1044 | Ga0209129_1000024 | |||
| 1045 | Ga0209129_1000061 | |||
| 1046 | Ga0209129_1010446 | |||
| 1047 | Ga0209129_1014644 | |||
| 1048 | Ga0209129_1024078 | |||
| 1049 | Ga0209565_1000032 | |||
| 1050 | Ga0209565_1000098 | |||
| 1051 | Ga0209565_1000128 | |||
| 1052 | Ga0209565_1000574 | |||
| 1053 | Ga0209565_1001099 | |||
| 1054 | Ga0209565_1002417 | |||
| 1055 | Ga0209565_1006405 | |||
| 1056 | Ga0209455_1000031 | |||
| 1057 | Ga0209455_1000053 | |||
| 1058 | Ga0209673_1000008 | |||
| 1059 | Ga0209673_1000029 | |||
| 1060 | Ga0209673_1000058 | |||
| 1061 | Ga0209673_1000410 | |||
| 1062 | Ga0209673_1000705 | |||
| 1063 | Ga0209673_1001185 | |||
| 1064 | Ga0209673_1002297 | |||
| 1065 | Ga0209673_1005091 | |||
| 1066 | Ga0209673_1066570 | |||
| 1067 | Ga0209130_1000043 | |||
| 1068 | Ga0209130_1000072 | |||
| 1069 | Ga0209130_1000295 | |||
| 1070 | Ga0209130_1001692 | |||
| 1071 | Ga0209130_1002605 | |||
| 1072 | Ga0209675_1000010 | |||
| 1073 | Ga0209675_1000019 | |||
| 1074 | Ga0209675_1000099 | |||
| 1075 | Ga0209675_1000151 | |||
| 1076 | Ga0209675_1000381 | |||
| 1077 | Ga0209675_1000431 | |||
| 1078 | Ga0209675_1000831 | |||
| 1079 | Ga0209676_1000023 | |||
| 1080 | Ga0209676_1000028 | |||
| 1081 | Ga0209676_1000333 | |||
| 1082 | Ga0209676_1003737 | |||
| 1083 | Ga0209676_1040558 | |||
| 1084 | Ga0209676_1054982 | |||
| 1085 | Ga0209025_1000289 | |||
| 1086 | Ga0209025_1000685 | |||
| 1087 | Ga0209025_1003627 | |||
| 1088 | Ga0209025_1010777 | |||
| 1089 | Ga0209025_1011304 | |||
| 1090 | Ga0209025_1011996 | |||
| 1091 | Ga0209025_1017710 | |||
| 1092 | Ga0209564_1000010 | |||
| 1093 | Ga0209564_1000067 | |||
| 1094 | Ga0209564_1000209 | |||
| 1095 | Ga0209564_1000291 | |||
| 1096 | Ga0209564_1000315 | |||
| 1097 | Ga0209564_1000724 | |||
| 1098 | Ga0209564_1004187 | |||
| 1099 | Ga0209564_1005390 | |||
| 1100 | Ga0209564_1029662 | |||
| 1101 | Ga0209758_1000049 | |||
| 1102 | Ga0209758_1000101 | |||
| 1103 | Ga0209758_1000281 | |||
| 1104 | Ga0209758_1001181 | |||
| 1105 | Ga0209050_1000022 | |||
| 1106 | Ga0209050_1000040 | |||
| 1107 | Ga0209050_1000123 | |||
| 1108 | Ga0209050_1000303 | |||
| 1109 | Ga0209050_1004977 | |||
| 1110 | Ga0209050_1047024 | |||
| 1111 | Ga0209256_1000001 | |||
| 1112 | Ga0209256_1000018 | |||
| 1113 | Ga0209256_1000058 | |||
| 1114 | Ga0209256_1000088 | |||
| 1115 | Ga0209256_1000253 | |||
| 1116 | Ga0209256_1001069 | |||
| 1117 | Ga0209256_1003581 | |||
| 1118 | Ga0207426_1000038 | |||
| 1119 | Ga0207426_1000053 | |||
| 1120 | Ga0207426_1000319 | |||
| 1121 | Ga0207426_1002753 | |||
| 1122 | Ga0209051_1000013 | |||
| 1123 | Ga0209051_1000015 | |||
| 1124 | Ga0209051_1000056 | |||
| 1125 | Ga0209051_1000545 | |||
| 1126 | Ga0209051_1000757 | |||
| 1127 | Ga0209257_1000042 | |||
| 1128 | Ga0209257_1000054 | |||
| 1129 | Ga0209257_1004784 | |||
| 1130 | Ga0209257_1008331 | |||
| 1131 | Ga0209257_1014942 | |||
| 1132 | Ga0207656_10107763 | |||
| 1133 | Ga0207655_1001917 | |||
| 1134 | Ga0207655_1004477 | |||
| 1135 | Ga0207682_10219945 | |||
| 1136 | Ga0207682_10225060 | |||
| 1137 | Ga0207645_10330015 | |||
| 1138 | Ga0207705_10134592 | |||
| 1139 | Ga0207705_10810221 | |||
| 1140 | Ga0207695_10156799 | |||
| 1141 | Ga0207671_10078870 | |||
| 1142 | Ga0207671_10350948 | |||
| 1143 | Ga0207657_10022456 | |||
| 1144 | Ga0207649_10319557 | |||
| 1145 | Ga0207681_10025868 | |||
| 1146 | Ga0207650_10124563 | |||
| 1147 | Ga0207650_10401082 | |||
| 1148 | Ga0207659_10537437 | |||
| 1149 | Ga0207687_10092852 | |||
| 1150 | Ga0207644_10270171 | |||
| 1151 | Ga0207690_10001407 | |||
| 1152 | Ga0207690_10156862 | |||
| 1153 | Ga0207690_10817484 | |||
| 1154 | Ga0207706_10013767 | |||
| 1155 | Ga0207706_10043409 | |||
| 1156 | Ga0207686_10435813 | |||
| 1157 | Ga0207709_10000211 | |||
| 1158 | Ga0207709_10008426 | |||
| 1159 | Ga0207669_10384508 | |||
| 1160 | Ga0207691_10038575 | |||
| 1161 | Ga0207711_10679695 | |||
| 1162 | Ga0207689_10134979 | |||
| 1163 | Ga0207689_10234466 | |||
| 1164 | Ga0207689_10247586 | |||
| 1165 | Ga0207679_10019974 | |||
| 1166 | Ga0207679_10068877 | |||
| 1167 | Ga0207667_10169047 | |||
| 1168 | Ga0207651_10591922 | |||
| 1169 | Ga0207651_10694344 | |||
| 1170 | Ga0207651_11044788 | |||
| 1171 | Ga0207668_10396451 | |||
| 1172 | Ga0207658_10204356 | |||
| 1173 | Ga0207658_10204730 | |||
| 1174 | Ga0207658_10424204 | |||
| 1175 | Ga0207658_10890248 | |||
| 1176 | Ga0207677_10047551 | |||
| 1177 | Ga0207677_10908045 | |||
| 1178 | Ga0207703_10560627 | |||
| 1179 | Ga0207639_10065284 | |||
| 1180 | Ga0207639_10518974 | |||
| 1181 | Ga0207678_10425847 | |||
| 1182 | Ga0207641_10023894 | |||
| 1183 | Ga0207648_10035163 | |||
| 1184 | Ga0207648_10204878 | |||
| 1185 | Ga0207676_10008819 | |||
| 1186 | Ga0207674_10201153 | |||
| 1187 | Ga0207674_10321299 | |||
| 1188 | Ga0207674_10487144 | |||
| 1189 | Ga0207683_10159858 | |||
| 1190 | Ga0207683_10206870 | |||
| 1191 | Ga0207683_10265815 | |||
| 1192 | Ga0207683_10466133 | |||
| 1193 | Ga0207683_10705955 | |||
| 1194 | Ga0207698_10321052 | |||
| 1195 | Ga0209281_1039633 | |||
| 1196 | Ga0209282_1000014 | |||
| 1197 | Ga0207428_10186494 | |||
| 1198 | Ga0207428_10306908 | |||
| 1199 | Ga0268266_10019121 | |||
| 1200 | Ga0268266_10109565 | |||
| 1201 | Ga0268266_10372468 | |||
| 1202 | Ga0268264_10252476 | |||
| 1203 | Ga0307515_10004716 | |||
| 1204 | Ga0307515_10018282 | |||
| 1205 | Ga0307515_10074074 | |||
| 1206 | Ga0307515_10107499 | |||
| 1207 | Ga0307512_10068702 | |||
| 1208 | Ga0307512_10251743 | |||
| 1209 | Ga0316177_1143531 | |||
| 1210 | Ga0316176_1081827 | |||
| 1211 | Ga0314311_1166419 | |||
| 1212 | Ga0316180_1137399 | |||
| 1213 | Ga0316183_1100974 | |||
| 1214 | Ga0316181_1019718 | |||
| 1215 | Ga0316182_1026069 | |||
| 1216 | Ga0307513_10000038 | |||
| 1217 | Ga0307513_10115538 | |||
| 1218 | Ga0307513_10128755 | |||
| 1219 | Ga0307509_10000991 | |||
| 1220 | Ga0307509_10048449 | |||
| 1221 | Ga0307509_10416699 | |||
| 1222 | Ga0307509_10481766 | |||
| 1223 | Ga0307408_100000122 | |||
| 1224 | Ga0307408_100065751 | |||
| 1225 | Ga0307408_100075215 | |||
| 1226 | Ga0307408_100217026 | |||
| 1227 | Ga0307508_10002244 | |||
| 1228 | Ga0307508_10007239 | |||
| 1229 | Ga0307514_10005041 | |||
| 1230 | Ga0307514_10124627 | |||
| 1231 | Ga0307516_10124091 | |||
| 1232 | Ga0307405_10011823 | |||
| 1233 | Ga0307405_10032034 | |||
| 1234 | Ga0307405_10053389 | |||
| 1235 | Ga0307405_10096450 | |||
| 1236 | Ga0307413_10177058 | |||
| 1237 | Ga0307518_10228812 | |||
| 1238 | Ga0307406_10015826 | |||
| 1239 | Ga0307406_10652477 | |||
| 1240 | Ga0307407_10133357 | |||
| 1241 | Ga0307412_10024604 | |||
| 1242 | Ga0307412_10108605 | |||
| 1243 | Ga0307412_10127881 | |||
| 1244 | Ga0307412_10758598 | |||
| 1245 | Ga0307409_100573298 | |||
| 1246 | Ga0307416_100008243 | |||
| 1247 | Ga0307416_100136594 | |||
| 1248 | Ga0307416_100435227 | |||
| 1249 | Ga0307414_10037797 | |||
| 1250 | Ga0307414_10056510 | |||
| 1251 | Ga0307414_10069652 | |||
| 1252 | Ga0307414_10322397 | |||
| 1253 | Ga0307414_10339661 | |||
| 1254 | Ga0307411_10064874 | |||
| 1255 | Ga0307510_10088354 | |||
| 1256 | Ga0373930_0053268 | |||
| 1257 | Ga0373938_0036468 | |||
| 1258 | Ga0373932_0043834 | |||
| 1259 | Ga0373931_0035468 | |||
| 1260 | Ga0373931_0089255 | |||
| 1261 | Ga0395900_0030030 | |||
| 1262 | Ga0395905_0002893 | |||
| 1263 | Ga0395905_0008745 | |||
| 1264 | Ga0395905_0091128 | |||
| 1265 | Ga0395905_0490453 | |||
| 1266 | Ga0395901_0002440 | |||
| 1267 | Ga0395901_0528703 | |||
| 1268 | Ga0436361_0438991 | |||
| 1269 | Ga0439436_0000668 | |||
| 1270 | Ga0439436_0027592 | |||
| 1271 | Ga0439439_0015796 | |||
| 1272 | Ga0439439_0078325 | |||
| 1273 | Ga0439447_017322 | |||
| 1274 | Ga0439447_025681 | |||
| 1275 | Ga0439466_0010194 | |||
| 1276 | Ga0439466_0032140 | |||
| 1277 | Ga0439465_0004974 | |||
| 1278 | Ga0451797_0634131 | |||
| 1279 | Ga0451795_0258631 | |||
| 1280 | Ga0451798_0022055 | |||
| 1281 | Ga0439431_0033822 | |||
| 1282 | Ga0439431_0047036 | |||
| 1283 | Ga0439433_0018693 | |||
| 1284 | Ga0439442_008635 | |||
| 1285 | Ga0439442_016767 | |||
| 1286 | Ga0439445_0000200 | |||
| 1287 | Ga0439432_012106 | |||
| 1288 | Ga0439449_0001627 | |||
| 1289 | Ga0439449_0001772 | |||
| 1290 | Ga0439449_0004482 | |||
| 1291 | Ga0439452_002059 | |||
| 1292 | Ga0439457_016362 | |||
| 1293 | Ga0439462_0005319 | |||
| 1294 | Ga0439462_0029804 | |||
| 1295 | Ga0450922_004273 | |||
| 1296 | Ga0450923_012192 | |||
| 1297 | Ga0450923_012263 | |||
| 1298 | Ga0450894_010049 | |||
| 1299 | Ga0450898_000958 | |||
| 1300 | Ga0450898_002604 | |||
| 1301 | Ga0450906_001912 | |||
| 1302 | Ga0450906_008396 | |||
| 1303 | Ga0450910_018152 | |||
| 1304 | Ga0439446_0010580 | |||
| 1305 | Ga0439446_0016721 | |||
| 1306 | Ga0439446_0156850 | |||
| 1307 | Ga0439458_0064123 | |||
| 1308 | Ga0439434_0005110 | |||
| 1309 | Ga0439434_0011135 | |||
| 1310 | Ga0450893_0019291 | |||
| 1311 | Ga0466982_0364230 | |||
| 1312 | Ga0453683_0005431 | |||
| 1313 | Ga0466965_0378277 | |||
| 1314 | Ga0466966_0050317 | |||
| 1315 | Ga0453684_0070122 | |||
| 1316 | Ga0466971_0112116 | |||
| 1317 | Ga0466970_0098965 | |||
| 1318 | Ga0466957_0088390 | |||
| 1319 | Ga0451576_0010377 | |||
| 1320 | Ga0451576_0941441 | |||
| 1321 | Ga0495617_025019 | |||
| 1322 | Ga0495627_113570 | |||
| 1323 | Ga0495592_0000083 | |||
| 1324 | Ga0495603_0158581 | |||
| 1325 | Ga0495590_0000014 | |||
| 1326 | Ga0495590_0045181 | |||
| 1327 | Ga0495638_0000064 | |||
| 1328 | Ga0495638_0127146 | |||
| 1329 | Ga0495638_0130434 | |||
| 1330 | Ga0495650_0000283 | |||
| 1331 | Ga0495650_0001144 | |||
| 1332 | Ga0495650_0001153 | |||
| 1333 | Ga0495650_0081307 | |||
| 1334 | Ga0495582_0167560 | |||
| 1335 | Ga0495605_0000127 | |||
| 1336 | Ga0495605_0004750 | |||
| 1337 | Ga0495639_0002158 | |||
| 1338 | Ga0495639_0030125 | |||
| 1339 | Ga0495584_0031012 | |||
| 1340 | Ga0495584_0251466 | |||
| 1341 | Ga0495607_0000853 | |||
| 1342 | Ga0495607_0000905 | |||
| 1343 | Ga0495607_0076345 | |||
| 1344 | Ga0495607_0161083 | |||
| 1345 | Ga0495583_0000287 | |||
| 1346 | Ga0495583_0000928 | |||
| 1347 | Ga0495583_0005050 | |||
| 1348 | Ga0495606_0000353 | |||
| 1349 | Ga0495606_0000933 | |||
| 1350 | Ga0495606_0001708 | |||
| 1351 | Ga0495606_0006490 | |||
| 1352 | Ga0495606_0047455 | |||
| 1353 | Ga0495606_0092112 | |||
| 1354 | Ga0495606_0105255 | |||
| 1355 | Ga0495610_0001111 | |||
| 1356 | Ga0495610_0017794 | |||
| 1357 | Ga0495610_0054754 | |||
| 1358 | Ga0495616_0032225 | |||
| 1359 | Ga0495616_0046308 | |||
| 1360 | Ga0495620_0008764 | |||
| 1361 | Ga0495620_0071350 | |||
| 1362 | Ga0495630_0487849 | |||
| 1363 | Ga0495631_0006138 | |||
| 1364 | Ga0495632_0002315 | |||
| 1365 | Ga0495637_0000430 | |||
| 1366 | Ga0495643_0000108 | |||
| 1367 | Ga0495643_0001013 | |||
| 1368 | Ga0495643_0075869 | |||
| 1369 | Ga0495644_0017049 | |||
| 1370 | Ga0495648_0000006 | |||
| 1371 | Ga0495648_0001956 | |||
| 1372 | Ga0495648_0009458 | |||
| 1373 | Ga0495642_0022344 | |||
| 1374 | Ga0495654_0000131 | |||
| 1375 | Ga0495654_0013618 | |||
| 1376 | Ga0495587_0062135 | |||
| 1377 | Ga0495609_0000670 | |||
| 1378 | Ga0495609_0020155 | |||
| 1379 | Ga0495609_0042404 | |||
| 1380 | Ga0495609_0045900 | |||
| 1381 | Ga0495621_0011454 | |||
| 1382 | Ga0495621_0012148 | |||
| 1383 | Ga0495597_0000091 | |||
| 1384 | Ga0495597_0007196 | |||
| 1385 | Ga0495622_0000322 | |||
| 1386 | Ga0495622_0015976 | |||
| 1387 | Ga0495622_0043332 | |||
| 1388 | Ga0495633_0000158 | |||
| 1389 | Ga0495633_0002191 | |||
| 1390 | Ga0495633_0002981 | |||
| 1391 | Ga0495633_0008695 | |||
| 1392 | Ga0495633_0009399 | |||
| 1393 | Ga0495656_0000757 | |||
| 1394 | Ga0495668_0000029 | |||
| 1395 | Ga0495668_0000119 | |||
| 1396 | Ga0495668_0000209 | |||
| 1397 | Ga0495668_0021464 | |||
| 1398 | Ga0495668_0036766 | |||
| 1399 | Ga0495668_0085253 | |||
| 1400 | Ga0495611_0105950 | |||
| 1401 | Ga0495611_0324005 | |||
| 1402 | Ga0495625_0000871 | |||
| 1403 | Ga0495625_0000950 | |||
| 1404 | Ga0495625_0001595 | |||
| 1405 | Ga0495625_0002825 | |||
| 1406 | Ga0495625_0013051 | |||
| 1407 | Ga0495625_0109606 | |||
| 1408 | Ga0495625_0113945 | |||
| 1409 | Ga0495625_0118296 | |||
| 1410 | Ga0495625_0164648 | |||
| 1411 | Ga0495635_0364364 | |||
| 1412 | Ga0495659_0000188 | |||
| 1413 | Ga0495659_0001672 | |||
| 1414 | Ga0495659_0005629 | |||
| 1415 | Ga0495661_0062258 | |||
| 1416 | Ga0495588_0067890 | |||
| 1417 | Ga0495588_0081687 | |||
| 1418 | Ga0495646_0135167 | |||
| 1419 | Ga0495646_0137557 | |||
| 1420 | Ga0495658_0011396 | |||
| 1421 | Ga0495669_0002335 | |||
| 1422 | Ga0495624_0033039 | |||
| 1423 | Ga0495670_0029832 | |||
| 1424 | Ga0495670_0036893 | |||
| 1425 | Ga0495670_0062358 | |||
| 1426 | Ga0495670_0118241 | |||
| 1427 | Ga0495671_0003751 | |||
| 1428 | Ga0495671_0010447 | |||
| 1429 | Ga0495671_0070745 | |||
| 1430 | Ga0495671_0313354 | |||
| 1431 | Ga0495649_0011480 | |||
| 1432 | Ga0495649_0021278 | |||
| 1433 | Ga0495649_0048026 | |||
| 1434 | Ga0495649_0208043 | |||
| 1435 | Ga0495589_0030229 | |||
| 1436 | Ga0495660_0012736 | |||
| 1437 | Ga0495660_0042564 | |||
| 1438 | Ga0495660_0043239 | |||
| 1439 | Ga0495660_0071931 | |||
| 1440 | Ga0495660_0114732 | |||
| 1441 | Ga0495660_0159839 | |||
| 1442 | Ga0495636_0002494 | |||
| 1443 | Ga0495636_0022866 | |||
| 1444 | Ga0495672_0000088 | |||
| 1445 | Ga0495672_0000295 | |||
| 1446 | Ga0495672_0009310 | |||
| 1447 | Ga0495672_0023923 | |||
| 1448 | Ga0495672_0067974 | |||
| 1449 | Ga0495683_0000892 | |||
| 1450 | Ga0495687_000042 | |||
| 1451 | Ga0495687_013309 | |||
| 1452 | Ga0495687_037736 | |||
| 1453 | Ga0495677_0014959 | |||
| 1454 | Ga0495679_018699 | |||
| 1455 | Ga0495685_000081 | |||
| 1456 | Ga0495685_002774 | |||
| 1457 | Ga0495673_0003259 | |||
| 1458 | Ga0495681_0007092 | |||
| 1459 | Ga0495686_0000212 | |||
| 1460 | Ga0495686_0001211 | |||
| 1461 | Ga0495686_0004528 | |||
| 1462 | Ga0495686_0072272 | |||
| 1463 | Ga0495686_0072594 | |||
| 1464 | Ga0495686_0222502 | |||
| 1465 | Ga0495593_0055127 | |||
| 1466 | Ga0495614_0024137 | |||
| 1467 | Ga0495614_0061498 | |||
| 1468 | Ga0496100_0195133 | |||
| 1469 | Ga0496101_0170343 | |||
| 1470 | Ga0496102_0014383 | |||
| 1471 | Ga0496102_0415378 | |||
| 1472 | Ga0496104_0013037 | |||
| 1473 | Ga0496105_0011369 | |||
| 1474 | Ga0496106_0184482 | |||
| 1475 | Ga0496107_0240174 | |||
| 1476 | Ga0496108_0064875 | |||
| 1477 | Ga0496109_0505860 | |||
| 1478 | Ga0496109_0719244 | |||
| 1479 | Ga0496110_0982272 | |||
| 1480 | Ga0496111_0294871 | |||
| 1481 | Ga0496114_0227951 | |||
| 1482 | Ga0496115_0071704 | |||
| 1483 | Ga0496115_0656212 | |||
| 1484 | Ga0496116_0028608 | |||
| 1485 | Ga0496116_0071652 | |||
| 1486 | Ga0496116_0312195 | |||
| 1487 | Ga0496117_0000005 | |||
| 1488 | Ga0496118_0000022 | |||
| 1489 | Ga0496118_0009732 | |||
| 1490 | Ga0496118_0113107 | |||
| 1491 | Ga0496118_0316806 | |||
| 1492 | Ga0496120_0138164 | |||
| 1493 | Ga0496121_0047683 | |||
| 1494 | Ga0496121_0166401 | |||
| 1495 | Ga0496121_0362049 | |||
| 1496 | Ga0496122_0000612 | |||
| 1497 | Ga0496122_0009918 | |||
| 1498 | Ga0496122_0356376 | |||
| 1499 | Ga0496123_0000274 | |||
| 1500 | Ga0496123_0020234 | |||
| 1501 | Ga0496124_0018117 | |||
| 1502 | Ga0496124_0073398 | |||
| 1503 | Ga0496124_0146250 | |||
| 1504 | Ga0496125_0028804 | |||
| 1505 | Ga0496125_0051111 | |||
| 1506 | Ga0496125_0235471 | |||
| 1507 | Ga0496125_0333316 | |||
| 1508 | Ga0496126_0722837 | |||
| 1509 | Ga0501306_008736 | |||
| 1510 | Ga0501308_008683 | |||
| 1511 | Ga0501309_025636 | |||
| 1512 | Ga0501305_027674 | |||
| 1513 | Ga0501305_043813 | |||
| 1514 | Ga0495678_000259 | |||
| 1515 | Ga0495678_008378 | |||
| 1516 | Ga0495678_058348 | |||
| 1517 | Ga0495682_0002024 | |||
| 1518 | Ga0495682_0004316 | |||
| 1519 | Ga0501292_006634 | |||
| 1520 | Ga0501311_008121 | |||
| 1521 | Ga0501311_046900 | |||
| 1522 | Ga0501314_013548 | |||
| 1523 | Ga0501315_007576 | |||
| 1524 | Ga0501315_017802 | |||
| 1525 | Ga0501320_005849 | |||
| 1526 | Ga0501323_006400 | |||
| 1527 | Ga0501323_011804 | |||
| 1528 | Ga0501036_0268975 | |||
| 1529 | Ga0501039_0266499 | |||
| 1530 | Ga0501042_0050325 | |||
| 1531 | Ga0501048_0082014 | |||
| 1532 | Ga0501072_0182306 | |||
| 1533 | Ga0501077_0185649 | |||
| 1534 | Ga0501222_025079 | |||
| 1535 | Ga0501227_003408 | |||
| 1536 | Ga0501227_028620 | |||
| 1537 | Ga0501230_005166 | |||
| 1538 | Ga0501238_002242 | |||
| 1539 | Ga0501081_0204371 | |||
| 1540 | Ga0501269_010451 | |||
| 1541 | Ga0501279_007283 | |||
| 1542 | nmdc:mga03683_217769_c1 | |||
| 1543 | nmdc:mga03683_52726_c1 | |||
| 1544 | nmdc:mga03n38_210331_c1 | |||
| 1545 | nmdc:mga03n38_237862_c1 | |||
| 1546 | nmdc:mga03n38_324952_c1 | |||
| 1547 | nmdc:mga00v17_111385_c1 | |||
| 1548 | nmdc:mga00v17_131135_c1 | |||
| 1549 | nmdc:mga00v17_261312_c1 | |||
| 1550 | nmdc:mga00v17_272718_c1 | |||
| 1551 | nmdc:mga0yw44_54808_c1 | |||
| 1552 | nmdc:mga0k408_13069_c2 | |||
| 1553 | nmdc:mga0k408_25360_c1 | |||
| 1554 | nmdc:mga0k408_3060_c1 | |||
| 1555 | nmdc:mga0k408_31969_c1 | |||
| 1556 | nmdc:mga06z11_331518_c1 | |||
| 1557 | nmdc:mga06z11_355351_c1 | |||
| 1558 | nmdc:mga07m45_25479_c1 | |||
| 1559 | nmdc:mga07m45_3314_c1 | |||
| 1560 | nmdc:mga07m45_38060_c1 | |||
| 1561 | nmdc:mga07m45_3823_c1 | |||
| 1562 | nmdc:mga07m45_42531_c1 | |||
| 1563 | nmdc:mga07m45_466522_c1 | |||
| 1564 | nmdc:mga07m45_67535_c1 | |||
| 1565 | Ga0500610_0219697 | |||
| 1566 | Ga0500635_0000030 | |||
| 1567 | Ga0500578_0000363 | |||
| 1568 | Ga0500644_0087237 | |||
| 1569 | Ga0500646_0015224 | |||
| 1570 | Ga0500647_0028928 | |||
| 1571 | Ga0500651_0011180 | |||
| 1572 | Ga0500651_0016838 | |||
| 1573 | Ga0500651_0075767 | |||
| 1574 | Ga0500641_0067121 | |||
| 1575 | Ga0500641_0070578 | |||
| 1576 | Ga0500555_031764 | |||
| 1577 | Ga0500560_066461 | |||
| 1578 | Ga0500571_002284 | |||
| 1579 | Ga0500593_000312 | |||
| 1580 | Ga0500594_0001013 | |||
| 1581 | Ga0500594_0001867 | |||
| 1582 | Ga0500594_0012374 | |||
| 1583 | Ga0500594_0080478 | |||
| 1584 | Ga0500594_0108434 | |||
| 1585 | Ga0500607_009334 | |||
| 1586 | Ga0500607_055142 | |||
| 1587 | Ga0500608_197886 | |||
| 1588 | Ga0500618_003147 | |||
| 1589 | Ga0500623_146878 | |||
| 1590 | Ga0500626_019470 | |||
| 1591 | Ga0500628_002666 | |||
| 1592 | Ga0500628_055474 | |||
| 1593 | Ga0500642_0020334 | |||
| 1594 | Ga0500652_003742 | |||
| 1595 | Ga0500655_000872 | |||
| 1596 | Ga0500658_0000730 | |||
| 1597 | Ga0500559_0000019 | |||
| 1598 | Ga0500559_0004500 | |||
| 1599 | Ga0500559_0018151 | |||
| 1600 | Ga0500568_0001792 | |||
| 1601 | Ga0500568_0023959 | |||
| 1602 | Ga0500568_0060467 | |||
| 1603 | Ga0500573_0251675 | |||
| 1604 | Ga0500574_026855 | |||
| 1605 | Ga0500577_0037393 | |||
| 1606 | Ga0500586_002852 | |||
| 1607 | Ga0500604_0004794 | |||
| 1608 | Ga0500616_0027300 | |||
| 1609 | Ga0500622_0001269 | |||
| 1610 | Ga0500622_0031643 | |||
| 1611 | Ga0500622_0152310 | |||
| 1612 | Ga0500627_0041172 | |||
| 1613 | Ga0500634_0005209 | |||
| 1614 | Ga0500634_0042082 | |||
| 1615 | Ga0500638_006538 | |||
| 1616 | Ga0500636_0028728 | |||
| 1617 | Ga0500636_0254012 | |||
| 1618 | Ga0500625_121994 | |||
| 1619 | Ga0500645_001028 | |||
| 1620 | Ga0501084_1053516 | |||
| 1621 | Ga0500661_007849 | |||
| 1622 | Ga0587084_000637 | |||
| 1623 | Ga0587066_032534 | |||
| 1624 | Ga0587070_063946 | |||
| 1625 | Ga0587073_0027859 | |||
| 1626 | Ga0587077_000886 | |||
| 1627 | Ga0587082_020617 | |||
| 1628 | Ga0587082_027390 | |||
| 1629 | Ga0587083_0044276 | |||
| 1630 | Ga0587085_016072 | |||
| 1631 | Ga0587086_011719 | |||
| 1632 | Ga0587090_000538 | |||
| 1633 | Ga0587091_006879 | |||
| 1634 | Ga0587091_069392 | |||
| 1635 | Ga0587092_003071 | |||
| 1636 | Ga0587094_008011 | |||
| 1637 | Ga0587115_035574 | |||
| 1638 | Ga0587062_005863 | |||
| 1639 | Ga0587067_008438 | |||
| 1640 | Ga0587068_003426 | |||
| 1641 | Ga0587068_011727 | |||
| 1642 | Ga0587068_020124 | |||
| 1643 | Ga0587069_013484 | |||
| 1644 | Ga0587072_010791 | |||
| 1645 | Ga0587072_093925 | |||
| 1646 | Ga0587076_001426 | |||
| 1647 | Ga0587111_0001149 | |||
| 1648 | 2511244643 | |||
| 1649 | 2587731718 | |||
| 1650 | 2644142440 | |||
| 1651 | 2644277061 | |||
| 1652 | 2928118008 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yra-assembly1.cif.gz_B | crystal structure of [2fe-2s]-ttpeta | 0.9822 | 61 | 209 |
| 7yra-assembly1.cif.gz_B | crystal structure of [2fe-2s]-ttpeta | 0.969 | 61 | 209 |
| 8smr-assembly1.cif.gz_C | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.9073 | 41 | 208 |
| 6giq-assembly1.cif.gz_E | saccharomyces cerevisiae respiratory supercomplex iii2iv | 0.8604 | 56 | 206 |
| 8aba-assembly1.cif.gz_P | complex iii2 from yarrowia lipolytica, ascorbate-reduced, int-position | 0.8375 | 46 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qitA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9072 | 72 | 85 | 3.40.50.1820 |
| 3l71E02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8439 | 55 | 206 | 2.102.10.10 |
| 3l71E02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8204 | 55 | 206 | 2.102.10.10 |
| af_Q4DS82_165_295_2.102.10.10 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8199 | 56 | 206 | 2.102.10.10 |
| 2yiuC02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.803 | 59 | 206 | 2.102.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R3V318-F1-model_v4 | deleted | 0.9839 | 74 | 211 |
|
| AF-A0A259NLI5-F1-model_v4 | Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) | 0.9826 | 57 | 211 |
GO:0008121
GO:0016020 GO:0046872 GO:0051537 |
| AF-A0A4Q3P3S4-F1-model_v4 | deleted | 0.9771 | 107 | 209 |
|
| AF-A0A536Y491-F1-model_v4 | Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) | 0.9767 | 58 | 211 |
GO:0008121
GO:0016020 GO:0046872 GO:0051537 |
| AF-H0BYK6-F1-model_v4 | Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) | 0.971 | 61 | 211 |
GO:0008121
GO:0016020 GO:0046872 GO:0051537 |