F482564
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 828 | 382 | 827 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0007238|Ga0373936_0007238_2380_2697 |
| Length | 105 |
| Sequence | MTGVIENFAGFALMAHKKAGGSTRNGRDSHSKRLGVKRFGGEFVLAGNILIRQRGTPVRAGSNVGTGTDHTLFAKVSGTVKFQKRGAEQRMYVHVFPETQAAETH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 192 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 311 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 312 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 313 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 314 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 359 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 362 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 365 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 366 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 369 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 372 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 373 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 375 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 376 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 2.29 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.9 |
| Nodule | 0 |
| Rhizoplane | 6.04 |
| Rhizosphere | 84.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10005201 | 3300003322 | Bacteria | 4801 |
| 2 | Ga0058863_11557338 | 3300004799 | Bacteria | 645 |
| 3 | Ga0058861_10031889 | 3300004800 | Bacteria | 1126 |
| 4 | Ga0058861_11881647 | 3300004800 | Bacteria | 1360 |
| 5 | Ga0058862_12676565 | 3300004803 | Unclassified | 1136 |
| 6 | Ga0065712_10147864 | 3300005290 | Bacteria | 1393 |
| 7 | Ga0070658_11074880 | 3300005327 | Bacteria | 700 |
| 8 | Ga0070658_11135394 | 3300005327 | Bacteria | 680 |
| 9 | Ga0070683_100071707 | 3300005329 | Bacteria | 3232 |
| 10 | Ga0070683_102110982 | 3300005329 | Bacteria | 541 |
| 11 | Ga0070690_100073158 | 3300005330 | Bacteria | 2230 |
| 12 | Ga0070670_100093327 | 3300005331 | Bacteria | 2589 |
| 13 | Ga0070677_10049093 | 3300005333 | Bacteria | 1698 |
| 14 | Ga0068869_100953051 | 3300005334 | Bacteria | 745 |
| 15 | Ga0068869_101258284 | 3300005334 | Bacteria | 652 |
| 16 | Ga0068869_101539412 | 3300005334 | Bacteria | 591 |
| 17 | Ga0070666_10003541 | 3300005335 | Bacteria | 9466 |
| 18 | Ga0070666_10050030 | 3300005335 | Bacteria | 2810 |
| 19 | Ga0070666_10060735 | 3300005335 | Bacteria | 2558 |
| 20 | Ga0070666_10229154 | 3300005335 | Bacteria | 1312 |
| 21 | Ga0070680_100008953 | 3300005336 | Bacteria | 7673 |
| 22 | Ga0070680_100035650 | 3300005336 | Bacteria | 4017 |
| 23 | Ga0070680_100220232 | 3300005336 | Bacteria | 1602 |
| 24 | Ga0070682_100335930 | 3300005337 | Bacteria | 1121 |
| 25 | Ga0070682_101363353 | 3300005337 | Bacteria | 605 |
| 26 | Ga0068868_100113483 | 3300005338 | Bacteria | 2203 |
| 27 | Ga0068868_101961260 | 3300005338 | Bacteria | 555 |
| 28 | Ga0070660_100362854 | 3300005339 | Unclassified | 1194 |
| 29 | Ga0070689_100509167 | 3300005340 | Bacteria | 1032 |
| 30 | Ga0070691_10797072 | 3300005341 | Bacteria | 575 |
| 31 | Ga0070691_10959208 | 3300005341 | Bacteria | 531 |
| 32 | Ga0070661_100286571 | 3300005344 | Bacteria | 1279 |
| 33 | Ga0070692_10713532 | 3300005345 | Bacteria | 676 |
| 34 | Ga0070669_100324959 | 3300005353 | Bacteria | 1243 |
| 35 | Ga0070675_100320816 | 3300005354 | Bacteria | 1368 |
| 36 | Ga0070675_100704803 | 3300005354 | Bacteria | 919 |
| 37 | Ga0070671_100000151 | 3300005355 | Bacteria | 45208 |
| 38 | Ga0070671_100001600 | 3300005355 | Bacteria | 17040 |
| 39 | Ga0070671_100045856 | 3300005355 | Bacteria | 3634 |
| 40 | Ga0070671_100260477 | 3300005355 | Bacteria | 1474 |
| 41 | Ga0070671_101184592 | 3300005355 | Bacteria | 672 |
| 42 | Ga0070674_100714600 | 3300005356 | Bacteria | 858 |
| 43 | Ga0070673_100002156 | 3300005364 | Bacteria | 11928 |
| 44 | Ga0070673_100075636 | 3300005364 | Bacteria | 2717 |
| 45 | Ga0070688_100127686 | 3300005365 | Bacteria | 1711 |
| 46 | Ga0070667_100006038 | 3300005367 | Bacteria | 10063 |
| 47 | Ga0070667_100065881 | 3300005367 | Bacteria | 3076 |
| 48 | Ga0070667_100144166 | 3300005367 | Bacteria | 2088 |
| 49 | Ga0070667_101153594 | 3300005367 | Bacteria | 725 |
| 50 | Ga0070709_10004940 | 3300005434 | Bacteria | 7204 |
| 51 | Ga0070709_10133822 | 3300005434 | Bacteria | 1695 |
| 52 | Ga0070714_100046383 | 3300005435 | Bacteria | 3686 |
| 53 | Ga0070714_100099986 | 3300005435 | Bacteria | 2553 |
| 54 | Ga0070714_100727071 | 3300005435 | Bacteria | 959 |
| 55 | Ga0070714_101205251 | 3300005435 | Bacteria | 738 |
| 56 | Ga0070714_102235140 | 3300005435 | Bacteria | 532 |
| 57 | Ga0070713_100006790 | 3300005436 | Bacteria | 7976 |
| 58 | Ga0070713_100651688 | 3300005436 | Bacteria | 1003 |
| 59 | Ga0070710_10003950 | 3300005437 | Bacteria | 7027 |
| 60 | Ga0070711_100010223 | 3300005439 | Bacteria | 5800 |
| 61 | Ga0070711_101165513 | 3300005439 | Bacteria | 666 |
| 62 | Ga0070711_101392627 | 3300005439 | Unclassified | 610 |
| 63 | Ga0070705_100032801 | 3300005440 | Bacteria | 2889 |
| 64 | Ga0070705_100511022 | 3300005440 | Bacteria | 914 |
| 65 | Ga0070694_101019668 | 3300005444 | Bacteria | 688 |
| 66 | Ga0070708_101143182 | 3300005445 | Bacteria | 729 |
| 67 | Ga0070663_100015011 | 3300005455 | Bacteria | 4984 |
| 68 | Ga0070678_100003428 | 3300005456 | Bacteria | 8843 |
| 69 | Ga0070678_101100119 | 3300005456 | Bacteria | 734 |
| 70 | Ga0070662_100352551 | 3300005457 | Bacteria | 1206 |
| 71 | Ga0070681_10024301 | 3300005458 | Bacteria | 6099 |
| 72 | Ga0070681_10064439 | 3300005458 | Bacteria | 3635 |
| 73 | Ga0070681_10155492 | 3300005458 | Bacteria | 2212 |
| 74 | Ga0068867_101518976 | 3300005459 | Bacteria | 624 |
| 75 | Ga0070685_10433325 | 3300005466 | Bacteria | 917 |
| 76 | Ga0070706_101457542 | 3300005467 | Bacteria | 626 |
| 77 | Ga0070699_100038047 | 3300005518 | Bacteria | 4166 |
| 78 | Ga0070679_100088711 | 3300005530 | Bacteria | 3079 |
| 79 | Ga0070679_100153605 | 3300005530 | Bacteria | 2278 |
| 80 | Ga0070679_100363692 | 3300005530 | Bacteria | 1394 |
| 81 | Ga0070684_100097767 | 3300005535 | Bacteria | 2618 |
| 82 | Ga0070684_100235917 | 3300005535 | Bacteria | 1671 |
| 83 | Ga0070697_101008717 | 3300005536 | Bacteria | 740 |
| 84 | Ga0070697_101432463 | 3300005536 | Bacteria | 617 |
| 85 | Ga0068853_100120842 | 3300005539 | Bacteria | 2336 |
| 86 | Ga0070672_100221899 | 3300005543 | Bacteria | 1586 |
| 87 | Ga0070672_100903479 | 3300005543 | Bacteria | 780 |
| 88 | Ga0070686_100006579 | 3300005544 | Bacteria | 6471 |
| 89 | Ga0070686_100465269 | 3300005544 | Bacteria | 975 |
| 90 | Ga0070686_100526673 | 3300005544 | Bacteria | 921 |
| 91 | Ga0070686_101008213 | 3300005544 | Bacteria | 683 |
| 92 | Ga0070695_100050009 | 3300005545 | Bacteria | 2677 |
| 93 | Ga0070695_100087477 | 3300005545 | Bacteria | 2073 |
| 94 | Ga0070695_100319577 | 3300005545 | Bacteria | 1153 |
| 95 | Ga0070695_100524923 | 3300005545 | Bacteria | 919 |
| 96 | Ga0070696_100228535 | 3300005546 | Bacteria | 1399 |
| 97 | Ga0070696_100457913 | 3300005546 | Bacteria | 1008 |
| 98 | Ga0070696_100510005 | 3300005546 | Bacteria | 958 |
| 99 | Ga0070696_101348236 | 3300005546 | Bacteria | 607 |
| 100 | Ga0070693_100268429 | 3300005547 | Bacteria | 1138 |
| 101 | Ga0070665_100003611 | 3300005548 | Bacteria | 16385 |
| 102 | Ga0070665_100004871 | 3300005548 | Bacteria | 13946 |
| 103 | Ga0070665_100013789 | 3300005548 | Bacteria | 8131 |
| 104 | Ga0070665_100083403 | 3300005548 | Bacteria | 3201 |
| 105 | Ga0070665_100207913 | 3300005548 | Bacteria | 1958 |
| 106 | Ga0070665_100995694 | 3300005548 | Bacteria | 850 |
| 107 | Ga0070704_100019210 | 3300005549 | Bacteria | 4388 |
| 108 | Ga0070704_100055374 | 3300005549 | Bacteria | 2812 |
| 109 | Ga0068855_100002251 | 3300005563 | Bacteria | 23841 |
| 110 | Ga0068855_100194400 | 3300005563 | Bacteria | 2286 |
| 111 | Ga0068855_100317537 | 3300005563 | Bacteria | 1723 |
| 112 | Ga0068855_100453038 | 3300005563 | Bacteria | 1400 |
| 113 | Ga0068855_101059198 | 3300005563 | Bacteria | 850 |
| 114 | Ga0068855_101750191 | 3300005563 | Bacteria | 633 |
| 115 | Ga0068855_102276696 | 3300005563 | Bacteria | 543 |
| 116 | Ga0068854_100625654 | 3300005578 | Bacteria | 922 |
| 117 | Ga0068854_101068171 | 3300005578 | Bacteria | 718 |
| 118 | Ga0068854_101541978 | 3300005578 | Bacteria | 604 |
| 119 | Ga0068856_100011130 | 3300005614 | Bacteria | 8734 |
| 120 | Ga0068856_100504036 | 3300005614 | Bacteria | 1231 |
| 121 | Ga0068856_101962575 | 3300005614 | Bacteria | 596 |
| 122 | Ga0068852_100169717 | 3300005616 | Bacteria | 2044 |
| 123 | Ga0068852_100404967 | 3300005616 | Bacteria | 1343 |
| 124 | Ga0068859_100002492 | 3300005617 | Bacteria | 18727 |
| 125 | Ga0068859_100097108 | 3300005617 | Bacteria | 2999 |
| 126 | Ga0068859_100112422 | 3300005617 | Bacteria | 2787 |
| 127 | Ga0068859_100304358 | 3300005617 | Bacteria | 1687 |
| 128 | Ga0068859_102192543 | 3300005617 | Bacteria | 610 |
| 129 | Ga0068864_100357428 | 3300005618 | Bacteria | 1380 |
| 130 | Ga0068866_10011986 | 3300005718 | Bacteria | 3769 |
| 131 | Ga0068861_100201276 | 3300005719 | Bacteria | 1672 |
| 132 | Ga0068851_10494564 | 3300005834 | Bacteria | 732 |
| 133 | Ga0068870_10451812 | 3300005840 | Bacteria | 847 |
| 134 | Ga0068863_100002637 | 3300005841 | Bacteria | 17759 |
| 135 | Ga0068863_100024954 | 3300005841 | Bacteria | 5702 |
| 136 | Ga0068863_100237934 | 3300005841 | Bacteria | 1757 |
| 137 | Ga0068863_100850934 | 3300005841 | Bacteria | 911 |
| 138 | Ga0068863_101416778 | 3300005841 | Bacteria | 703 |
| 139 | Ga0068863_101682147 | 3300005841 | Bacteria | 644 |
| 140 | Ga0068858_100012257 | 3300005842 | Bacteria | 8083 |
| 141 | Ga0068858_100044008 | 3300005842 | Bacteria | 4139 |
| 142 | Ga0068858_100055111 | 3300005842 | Bacteria | 3675 |
| 143 | Ga0068858_100216347 | 3300005842 | Bacteria | 1814 |
| 144 | Ga0068858_100910989 | 3300005842 | Bacteria | 860 |
| 145 | Ga0068858_102408880 | 3300005842 | Bacteria | 520 |
| 146 | Ga0068860_100000086 | 3300005843 | Bacteria | 165786 |
| 147 | Ga0068860_100011176 | 3300005843 | Bacteria | 8848 |
| 148 | Ga0068860_100644567 | 3300005843 | Bacteria | 1067 |
| 149 | Ga0068860_101453660 | 3300005843 | Bacteria | 707 |
| 150 | Ga0068862_100100277 | 3300005844 | Bacteria | 2532 |
| 151 | Ga0070717_10000760 | 3300006028 | Bacteria | 21071 |
| 152 | Ga0070715_10002439 | 3300006163 | Bacteria | 5706 |
| 153 | Ga0070715_10136337 | 3300006163 | Bacteria | 1187 |
| 154 | Ga0070716_100005892 | 3300006173 | Bacteria | 5961 |
| 155 | Ga0070716_100073753 | 3300006173 | Bacteria | 2014 |
| 156 | Ga0070716_100261823 | 3300006173 | Bacteria | 1184 |
| 157 | Ga0070716_100296973 | 3300006173 | Bacteria | 1122 |
| 158 | Ga0070716_100780320 | 3300006173 | Bacteria | 738 |
| 159 | Ga0070712_100030975 | 3300006175 | Bacteria | 3600 |
| 160 | Ga0070712_100195131 | 3300006175 | Bacteria | 1587 |
| 161 | Ga0070712_100608330 | 3300006175 | Bacteria | 926 |
| 162 | Ga0097621_100014033 | 3300006237 | Bacteria | 5987 |
| 163 | Ga0097621_100040451 | 3300006237 | Bacteria | 3748 |
| 164 | Ga0097621_100074563 | 3300006237 | Bacteria | 2811 |
| 165 | Ga0068871_100004650 | 3300006358 | Bacteria | 9587 |
| 166 | Ga0068871_100018250 | 3300006358 | Bacteria | 5328 |
| 167 | Ga0068871_100047768 | 3300006358 | Bacteria | 3453 |
| 168 | Ga0075428_100015490 | 3300006844 | Bacteria | 8452 |
| 169 | Ga0075428_100148124 | 3300006844 | Bacteria | 2551 |
| 170 | Ga0075428_100855944 | 3300006844 | Bacteria | 965 |
| 171 | Ga0075428_101527782 | 3300006844 | Bacteria | 699 |
| 172 | Ga0075430_100303868 | 3300006846 | Bacteria | 1320 |
| 173 | Ga0075433_10002778 | 3300006852 | Bacteria | 13393 |
| 174 | Ga0075433_10341105 | 3300006852 | Bacteria | 1324 |
| 175 | Ga0075434_100000511 | 3300006871 | Bacteria | 29418 |
| 176 | Ga0075434_100190538 | 3300006871 | Bacteria | 2071 |
| 177 | Ga0075429_100547744 | 3300006880 | Bacteria | 1014 |
| 178 | Ga0068865_101028230 | 3300006881 | Bacteria | 723 |
| 179 | Ga0075436_100064140 | 3300006914 | Bacteria | 2539 |
| 180 | Ga0097620_100002492 | 3300006931 | Bacteria | 18727 |
| 181 | Ga0097620_100097094 | 3300006931 | Bacteria | 2999 |
| 182 | Ga0097620_100112429 | 3300006931 | Bacteria | 2787 |
| 183 | Ga0097620_100304362 | 3300006931 | Bacteria | 1687 |
| 184 | Ga0097620_102192567 | 3300006931 | Bacteria | 610 |
| 185 | Ga0075435_100078594 | 3300007076 | Bacteria | 2706 |
| 186 | Ga0075435_100535228 | 3300007076 | Bacteria | 1014 |
| 187 | Ga0075435_101598602 | 3300007076 | Bacteria | 572 |
| 188 | Ga0099794_10107726 | 3300007265 | Bacteria | 1394 |
| 189 | Ga0099795_10000002 | 3300007788 | Bacteria | 161112 |
| 190 | Ga0105251_10463151 | 3300009011 | Bacteria | 589 |
| 191 | Ga0105250_10442685 | 3300009092 | Bacteria | 582 |
| 192 | Ga0105240_10004128 | 3300009093 | Bacteria | 22275 |
| 193 | Ga0105240_10014216 | 3300009093 | Bacteria | 10872 |
| 194 | Ga0105240_10020430 | 3300009093 | Bacteria | 8833 |
| 195 | Ga0105240_10039058 | 3300009093 | Bacteria | 6082 |
| 196 | Ga0105240_10055791 | 3300009093 | Bacteria | 4946 |
| 197 | Ga0105240_10071345 | 3300009093 | Bacteria | 4296 |
| 198 | Ga0105240_10104214 | 3300009093 | Bacteria | 3445 |
| 199 | Ga0105240_10135285 | 3300009093 | Bacteria | 2952 |
| 200 | Ga0105240_10249099 | 3300009093 | Bacteria | 2055 |
| 201 | Ga0105240_10986188 | 3300009093 | Bacteria | 902 |
| 202 | Ga0105240_11744292 | 3300009093 | Bacteria | 649 |
| 203 | Ga0105240_11884654 | 3300009093 | Bacteria | 622 |
| 204 | Ga0111539_10005609 | 3300009094 | Bacteria | 16231 |
| 205 | Ga0111539_10083250 | 3300009094 | Bacteria | 3763 |
| 206 | Ga0105245_10016229 | 3300009098 | Bacteria | 6492 |
| 207 | Ga0105245_10160655 | 3300009098 | Bacteria | 2132 |
| 208 | Ga0105247_10000121 | 3300009101 | Bacteria | 75837 |
| 209 | Ga0105247_10015518 | 3300009101 | Bacteria | 4561 |
| 210 | Ga0105247_10037501 | 3300009101 | Bacteria | 2958 |
| 211 | Ga0105247_10970141 | 3300009101 | Bacteria | 661 |
| 212 | Ga0114129_10277066 | 3300009147 | Bacteria | 2242 |
| 213 | Ga0114129_10439647 | 3300009147 | Bacteria | 1712 |
| 214 | Ga0114129_13386664 | 3300009147 | Bacteria | 513 |
| 215 | Ga0105243_11562036 | 3300009148 | Bacteria | 685 |
| 216 | Ga0105241_10250646 | 3300009174 | Bacteria | 1501 |
| 217 | Ga0105241_11932227 | 3300009174 | Bacteria | 579 |
| 218 | Ga0105242_10866816 | 3300009176 | Bacteria | 900 |
| 219 | Ga0105248_10025370 | 3300009177 | Bacteria | 6590 |
| 220 | Ga0105248_10033582 | 3300009177 | Bacteria | 5732 |
| 221 | Ga0105248_10139556 | 3300009177 | Bacteria | 2734 |
| 222 | Ga0105237_10001548 | 3300009545 | Bacteria | 30012 |
| 223 | Ga0105237_10046552 | 3300009545 | Bacteria | 4363 |
| 224 | Ga0105237_10212733 | 3300009545 | Bacteria | 1933 |
| 225 | Ga0105237_10293400 | 3300009545 | Bacteria | 1629 |
| 226 | Ga0105237_10739728 | 3300009545 | Bacteria | 990 |
| 227 | Ga0105237_11169003 | 3300009545 | Bacteria | 776 |
| 228 | Ga0105237_11216391 | 3300009545 | Bacteria | 760 |
| 229 | Ga0105237_11964051 | 3300009545 | Bacteria | 593 |
| 230 | Ga0105238_10194161 | 3300009551 | Bacteria | 2006 |
| 231 | Ga0105238_10478239 | 3300009551 | Bacteria | 1245 |
| 232 | Ga0105238_10509300 | 3300009551 | Bacteria | 1205 |
| 233 | Ga0105238_10786385 | 3300009551 | Bacteria | 967 |
| 234 | Ga0105238_11096108 | 3300009551 | Bacteria | 819 |
| 235 | Ga0105238_12482647 | 3300009551 | Bacteria | 554 |
| 236 | Ga0105249_10010844 | 3300009553 | Bacteria | 8008 |
| 237 | Ga0105249_10274888 | 3300009553 | Bacteria | 1680 |
| 238 | Ga0105249_10467819 | 3300009553 | Bacteria | 1302 |
| 239 | Ga0105249_10698940 | 3300009553 | Bacteria | 1074 |
| 240 | Ga0105249_12398636 | 3300009553 | Bacteria | 600 |
| 241 | Ga0099796_10000017 | 3300010159 | Bacteria | 48991 |
| 242 | Ga0099796_10004720 | 3300010159 | Bacteria | 3329 |
| 243 | Ga0099796_10459602 | 3300010159 | Bacteria | 567 |
| 244 | Ga0105239_10041139 | 3300010375 | Bacteria | 5064 |
| 245 | Ga0105239_10466297 | 3300010375 | Bacteria | 1434 |
| 246 | Ga0105239_10506505 | 3300010375 | Bacteria | 1373 |
| 247 | Ga0105239_10639967 | 3300010375 | Bacteria | 1214 |
| 248 | Ga0105239_11658937 | 3300010375 | Bacteria | 740 |
| 249 | Ga0157373_10996329 | 3300013100 | Bacteria | 625 |
| 250 | Ga0157373_11321647 | 3300013100 | Bacteria | 546 |
| 251 | Ga0157370_10557273 | 3300013104 | Bacteria | 1050 |
| 252 | Ga0157369_10037254 | 3300013105 | Bacteria | 5325 |
| 253 | Ga0157369_10122452 | 3300013105 | Bacteria | 2759 |
| 254 | Ga0157369_12056973 | 3300013105 | Bacteria | 579 |
| 255 | Ga0157369_12272717 | 3300013105 | Bacteria | 550 |
| 256 | Ga0157374_10063599 | 3300013296 | Bacteria | 3461 |
| 257 | Ga0157374_10738178 | 3300013296 | Bacteria | 999 |
| 258 | Ga0157374_10953483 | 3300013296 | Bacteria | 876 |
| 259 | Ga0157378_10004170 | 3300013297 | Bacteria | 12760 |
| 260 | Ga0157378_11972821 | 3300013297 | Bacteria | 633 |
| 261 | Ga0157378_12612424 | 3300013297 | Bacteria | 557 |
| 262 | Ga0163162_10028264 | 3300013306 | Bacteria | 5547 |
| 263 | Ga0163162_10067993 | 3300013306 | Bacteria | 3613 |
| 264 | Ga0163162_10309660 | 3300013306 | Bacteria | 1711 |
| 265 | Ga0163162_13353181 | 3300013306 | Bacteria | 512 |
| 266 | Ga0157372_10783580 | 3300013307 | Bacteria | 1108 |
| 267 | Ga0157372_10851934 | 3300013307 | Bacteria | 1058 |
| 268 | Ga0157372_12993832 | 3300013307 | Bacteria | 540 |
| 269 | Ga0157375_10065112 | 3300013308 | Bacteria | 3632 |
| 270 | Ga0163163_10166862 | 3300014325 | Bacteria | 2248 |
| 271 | Ga0163163_10279514 | 3300014325 | Bacteria | 1721 |
| 272 | Ga0163163_10297117 | 3300014325 | Bacteria | 1667 |
| 273 | Ga0163163_10339352 | 3300014325 | Bacteria | 1558 |
| 274 | Ga0163163_10462976 | 3300014325 | Bacteria | 1328 |
| 275 | Ga0157380_10001383 | 3300014326 | Bacteria | 15829 |
| 276 | Ga0157380_10085969 | 3300014326 | Bacteria | 2583 |
| 277 | Ga0157380_10151671 | 3300014326 | Bacteria | 2004 |
| 278 | Ga0157377_10142660 | 3300014745 | Bacteria | 1473 |
| 279 | Ga0157377_10955799 | 3300014745 | Bacteria | 645 |
| 280 | Ga0157379_10007334 | 3300014968 | Bacteria | 9542 |
| 281 | Ga0157379_10041003 | 3300014968 | Bacteria | 4133 |
| 282 | Ga0157379_10043135 | 3300014968 | Bacteria | 4027 |
| 283 | Ga0157379_10204325 | 3300014968 | Bacteria | 1787 |
| 284 | Ga0157379_10455890 | 3300014968 | Bacteria | 1181 |
| 285 | Ga0157379_10893019 | 3300014968 | Bacteria | 843 |
| 286 | Ga0157379_11833126 | 3300014968 | Bacteria | 597 |
| 287 | Ga0157379_12120780 | 3300014968 | Bacteria | 557 |
| 288 | Ga0157376_10067583 | 3300014969 | Bacteria | 3024 |
| 289 | Ga0157376_10246601 | 3300014969 | Bacteria | 1666 |
| 290 | Ga0157376_11139404 | 3300014969 | Bacteria | 807 |
| 291 | Ga0157376_11245656 | 3300014969 | Bacteria | 773 |
| 292 | Ga0163161_11523473 | 3300017792 | Bacteria | 588 |
| 293 | Ga0163161_12055211 | 3300017792 | Bacteria | 508 |
| 294 | Ga0197907_10713066 | 3300020069 | Bacteria | 662 |
| 295 | Ga0206356_10181451 | 3300020070 | Bacteria | 662 |
| 296 | Ga0206355_1308584 | 3300020076 | Bacteria | 586 |
| 297 | Ga0206355_1702270 | 3300020076 | Bacteria | 569 |
| 298 | Ga0206353_10959879 | 3300020082 | Bacteria | 821 |
| 299 | Ga0206353_11943938 | 3300020082 | Bacteria | 1115 |
| 300 | Ga0213873_10012196 | 3300021358 | Bacteria | 1859 |
| 301 | Ga0213873_10120672 | 3300021358 | Bacteria | 769 |
| 302 | Ga0213874_10005551 | 3300021377 | Bacteria | 2944 |
| 303 | Ga0213874_10029286 | 3300021377 | Bacteria | 1579 |
| 304 | Ga0213876_10069373 | 3300021384 | Bacteria | 1862 |
| 305 | Ga0213871_10033535 | 3300021441 | Bacteria | 1351 |
| 306 | Ga0213871_10074139 | 3300021441 | Bacteria | 966 |
| 307 | Ga0224712_10216531 | 3300022467 | Bacteria | 875 |
| 308 | Ga0224712_10400429 | 3300022467 | Bacteria | 654 |
| 309 | Ga0228598_1039800 | 3300024227 | Bacteria | 928 |
| 310 | Ga0207656_10232823 | 3300025321 | Bacteria | 898 |
| 311 | Ga0207682_10074108 | 3300025893 | Bacteria | 1447 |
| 312 | Ga0207692_10009224 | 3300025898 | Bacteria | 4112 |
| 313 | Ga0207642_10106921 | 3300025899 | Bacteria | 1417 |
| 314 | Ga0207710_10000156 | 3300025900 | Bacteria | 73078 |
| 315 | Ga0207710_10029645 | 3300025900 | Bacteria | 2382 |
| 316 | Ga0207710_10556803 | 3300025900 | Bacteria | 598 |
| 317 | Ga0207688_10441734 | 3300025901 | Bacteria | 810 |
| 318 | Ga0207680_10127325 | 3300025903 | Bacteria | 1674 |
| 319 | Ga0207680_10229957 | 3300025903 | Bacteria | 1274 |
| 320 | Ga0207680_10980035 | 3300025903 | Bacteria | 606 |
| 321 | Ga0207680_11058820 | 3300025903 | Bacteria | 580 |
| 322 | Ga0207685_10102133 | 3300025905 | Bacteria | 1228 |
| 323 | Ga0207685_10206128 | 3300025905 | Bacteria | 927 |
| 324 | Ga0207685_10710040 | 3300025905 | Bacteria | 548 |
| 325 | Ga0207699_10040830 | 3300025906 | Bacteria | 2676 |
| 326 | Ga0207699_10094159 | 3300025906 | Bacteria | 1886 |
| 327 | Ga0207699_10101861 | 3300025906 | Bacteria | 1824 |
| 328 | Ga0207699_10472644 | 3300025906 | Bacteria | 902 |
| 329 | Ga0207643_10607231 | 3300025908 | Bacteria | 704 |
| 330 | Ga0207705_10845286 | 3300025909 | Bacteria | 710 |
| 331 | Ga0207705_11463360 | 3300025909 | Bacteria | 518 |
| 332 | Ga0207654_10160065 | 3300025911 | Bacteria | 1454 |
| 333 | Ga0207707_10030748 | 3300025912 | Bacteria | 4697 |
| 334 | Ga0207707_10063322 | 3300025912 | Bacteria | 3219 |
| 335 | Ga0207707_10796962 | 3300025912 | Bacteria | 787 |
| 336 | Ga0207695_10023762 | 3300025913 | Bacteria | 6917 |
| 337 | Ga0207695_10025453 | 3300025913 | Bacteria | 6624 |
| 338 | Ga0207695_10069998 | 3300025913 | Bacteria | 3589 |
| 339 | Ga0207695_10082369 | 3300025913 | Bacteria | 3253 |
| 340 | Ga0207695_10115487 | 3300025913 | Bacteria | 2659 |
| 341 | Ga0207695_10209268 | 3300025913 | Bacteria | 1862 |
| 342 | Ga0207695_10232450 | 3300025913 | Bacteria | 1747 |
| 343 | Ga0207671_10053442 | 3300025914 | Bacteria | 2993 |
| 344 | Ga0207671_10112900 | 3300025914 | Bacteria | 2069 |
| 345 | Ga0207671_10546284 | 3300025914 | Bacteria | 924 |
| 346 | Ga0207671_10575061 | 3300025914 | Bacteria | 898 |
| 347 | Ga0207693_10001234 | 3300025915 | Bacteria | 22783 |
| 348 | Ga0207693_10105161 | 3300025915 | Bacteria | 2213 |
| 349 | Ga0207693_10140040 | 3300025915 | Bacteria | 1902 |
| 350 | Ga0207693_10410367 | 3300025915 | Bacteria | 1059 |
| 351 | Ga0207663_10006531 | 3300025916 | Bacteria | 5977 |
| 352 | Ga0207663_10193450 | 3300025916 | Bacteria | 1462 |
| 353 | Ga0207663_10379568 | 3300025916 | Bacteria | 1076 |
| 354 | Ga0207663_10453555 | 3300025916 | Bacteria | 989 |
| 355 | Ga0207663_10966220 | 3300025916 | Bacteria | 683 |
| 356 | Ga0207660_10148443 | 3300025917 | Bacteria | 1799 |
| 357 | Ga0207660_10238606 | 3300025917 | Bacteria | 1431 |
| 358 | Ga0207660_11431983 | 3300025917 | Bacteria | 559 |
| 359 | Ga0207660_11559893 | 3300025917 | Bacteria | 533 |
| 360 | Ga0207662_10353526 | 3300025918 | Bacteria | 987 |
| 361 | Ga0207662_10527352 | 3300025918 | Bacteria | 816 |
| 362 | Ga0207649_10613714 | 3300025920 | Bacteria | 837 |
| 363 | Ga0207649_11373854 | 3300025920 | Bacteria | 559 |
| 364 | Ga0207652_10144509 | 3300025921 | Bacteria | 2128 |
| 365 | Ga0207652_10214999 | 3300025921 | Bacteria | 1731 |
| 366 | Ga0207652_11445557 | 3300025921 | Bacteria | 591 |
| 367 | Ga0207681_10461414 | 3300025923 | Bacteria | 1035 |
| 368 | Ga0207694_10146747 | 3300025924 | Bacteria | 1899 |
| 369 | Ga0207694_10279351 | 3300025924 | Bacteria | 1371 |
| 370 | Ga0207694_10820205 | 3300025924 | Bacteria | 786 |
| 371 | Ga0207694_11681863 | 3300025924 | Bacteria | 534 |
| 372 | Ga0207650_10260539 | 3300025925 | Bacteria | 1406 |
| 373 | Ga0207659_10175073 | 3300025926 | Bacteria | 1695 |
| 374 | Ga0207659_11876848 | 3300025926 | Bacteria | 508 |
| 375 | Ga0207687_10060791 | 3300025927 | Bacteria | 2666 |
| 376 | Ga0207687_10270485 | 3300025927 | Bacteria | 1358 |
| 377 | Ga0207687_10411665 | 3300025927 | Bacteria | 1114 |
| 378 | Ga0207700_10194355 | 3300025928 | Bacteria | 1706 |
| 379 | Ga0207700_10333694 | 3300025928 | Bacteria | 1317 |
| 380 | Ga0207700_10798771 | 3300025928 | Bacteria | 844 |
| 381 | Ga0207664_10011864 | 3300025929 | Bacteria | 6216 |
| 382 | Ga0207664_10263658 | 3300025929 | Bacteria | 1507 |
| 383 | Ga0207664_10578554 | 3300025929 | Bacteria | 1008 |
| 384 | Ga0207644_10001117 | 3300025931 | Bacteria | 17225 |
| 385 | Ga0207644_10003342 | 3300025931 | Bacteria | 10348 |
| 386 | Ga0207644_10015950 | 3300025931 | Bacteria | 5051 |
| 387 | Ga0207644_10147761 | 3300025931 | Bacteria | 1816 |
| 388 | Ga0207644_11443530 | 3300025931 | Bacteria | 578 |
| 389 | Ga0207690_11451859 | 3300025932 | Bacteria | 574 |
| 390 | Ga0207686_10721576 | 3300025934 | Bacteria | 794 |
| 391 | Ga0207704_10529524 | 3300025938 | Bacteria | 954 |
| 392 | Ga0207704_10720892 | 3300025938 | Bacteria | 827 |
| 393 | Ga0207665_10004448 | 3300025939 | Bacteria | 9310 |
| 394 | Ga0207665_10165087 | 3300025939 | Bacteria | 1596 |
| 395 | Ga0207665_10228444 | 3300025939 | Bacteria | 1367 |
| 396 | Ga0207665_11494269 | 3300025939 | Bacteria | 537 |
| 397 | Ga0207691_10241382 | 3300025940 | Bacteria | 1562 |
| 398 | Ga0207711_10062029 | 3300025941 | Bacteria | 3224 |
| 399 | Ga0207711_10091677 | 3300025941 | Bacteria | 2673 |
| 400 | Ga0207711_10119829 | 3300025941 | Bacteria | 2348 |
| 401 | Ga0207689_10141841 | 3300025942 | Bacteria | 1979 |
| 402 | Ga0207689_10850800 | 3300025942 | Bacteria | 770 |
| 403 | Ga0207661_10035722 | 3300025944 | Bacteria | 3875 |
| 404 | Ga0207679_10651199 | 3300025945 | Bacteria | 953 |
| 405 | Ga0207667_10007515 | 3300025949 | Bacteria | 13083 |
| 406 | Ga0207667_10041325 | 3300025949 | Bacteria | 4905 |
| 407 | Ga0207667_10235472 | 3300025949 | Bacteria | 1874 |
| 408 | Ga0207667_10367869 | 3300025949 | Bacteria | 1466 |
| 409 | Ga0207667_10563922 | 3300025949 | Bacteria | 1151 |
| 410 | Ga0207651_10051352 | 3300025960 | Bacteria | 2805 |
| 411 | Ga0207651_10436874 | 3300025960 | Bacteria | 1120 |
| 412 | Ga0207712_10330185 | 3300025961 | Bacteria | 1261 |
| 413 | Ga0207712_10340677 | 3300025961 | Bacteria | 1243 |
| 414 | Ga0207640_10609488 | 3300025981 | Bacteria | 925 |
| 415 | Ga0207640_10744126 | 3300025981 | Bacteria | 845 |
| 416 | Ga0207640_11924286 | 3300025981 | Bacteria | 535 |
| 417 | Ga0207658_10009137 | 3300025986 | Bacteria | 6723 |
| 418 | Ga0207658_10040613 | 3300025986 | Bacteria | 3364 |
| 419 | Ga0207658_10072403 | 3300025986 | Bacteria | 2612 |
| 420 | Ga0207658_10364093 | 3300025986 | Bacteria | 1262 |
| 421 | Ga0207658_10471169 | 3300025986 | Bacteria | 1115 |
| 422 | Ga0207658_10485839 | 3300025986 | Bacteria | 1098 |
| 423 | Ga0207677_11313773 | 3300026023 | Bacteria | 664 |
| 424 | Ga0207703_10001045 | 3300026035 | Bacteria | 26367 |
| 425 | Ga0207703_10006750 | 3300026035 | Bacteria | 9152 |
| 426 | Ga0207703_10143532 | 3300026035 | Bacteria | 2074 |
| 427 | Ga0207703_10159232 | 3300026035 | Bacteria | 1976 |
| 428 | Ga0207703_10635699 | 3300026035 | Bacteria | 1011 |
| 429 | Ga0207703_12295672 | 3300026035 | Bacteria | 515 |
| 430 | Ga0207639_10405368 | 3300026041 | Bacteria | 1229 |
| 431 | Ga0207639_10863439 | 3300026041 | Bacteria | 845 |
| 432 | Ga0207678_10008217 | 3300026067 | Bacteria | 9198 |
| 433 | Ga0207702_10175164 | 3300026078 | Bacteria | 1970 |
| 434 | Ga0207702_10272412 | 3300026078 | Bacteria | 1597 |
| 435 | Ga0207702_11415981 | 3300026078 | Bacteria | 689 |
| 436 | Ga0207702_11614864 | 3300026078 | Bacteria | 642 |
| 437 | Ga0207641_10000411 | 3300026088 | Bacteria | 50003 |
| 438 | Ga0207641_10044965 | 3300026088 | Bacteria | 3715 |
| 439 | Ga0207641_10221982 | 3300026088 | Bacteria | 1753 |
| 440 | Ga0207641_10575778 | 3300026088 | Bacteria | 1100 |
| 441 | Ga0207641_11098884 | 3300026088 | Bacteria | 794 |
| 442 | Ga0207641_11231562 | 3300026088 | Bacteria | 748 |
| 443 | Ga0207648_10161837 | 3300026089 | Bacteria | 1976 |
| 444 | Ga0207648_10556719 | 3300026089 | Bacteria | 1054 |
| 445 | Ga0207676_10247113 | 3300026095 | Bacteria | 1604 |
| 446 | Ga0207675_100344003 | 3300026118 | Bacteria | 1460 |
| 447 | Ga0207683_10012302 | 3300026121 | Bacteria | 7304 |
| 448 | Ga0207683_11209375 | 3300026121 | Bacteria | 700 |
| 449 | Ga0207683_11219393 | 3300026121 | Bacteria | 697 |
| 450 | Ga0207698_10250314 | 3300026142 | Bacteria | 1621 |
| 451 | Ga0207698_11081785 | 3300026142 | Bacteria | 814 |
| 452 | Ga0210000_1060146 | 3300027462 | Bacteria | 615 |
| 453 | Ga0209179_1000003 | 3300027512 | Bacteria | 121837 |
| 454 | Ga0209968_1040006 | 3300027526 | Bacteria | 800 |
| 455 | Ga0207428_10043304 | 3300027907 | Bacteria | 3636 |
| 456 | Ga0207428_10772990 | 3300027907 | Bacteria | 683 |
| 457 | Ga0268266_10000891 | 3300028379 | Bacteria | 38646 |
| 458 | Ga0268266_10015611 | 3300028379 | Bacteria | 6509 |
| 459 | Ga0268266_10024405 | 3300028379 | Bacteria | 5142 |
| 460 | Ga0268266_10150760 | 3300028379 | Bacteria | 2095 |
| 461 | Ga0268266_10164591 | 3300028379 | Bacteria | 2008 |
| 462 | Ga0268266_10347935 | 3300028379 | Bacteria | 1392 |
| 463 | Ga0268265_10141141 | 3300028380 | Bacteria | 2017 |
| 464 | Ga0268265_11550864 | 3300028380 | Bacteria | 667 |
| 465 | Ga0268264_10000044 | 3300028381 | Bacteria | 368079 |
| 466 | Ga0268264_10011423 | 3300028381 | Bacteria | 7332 |
| 467 | Ga0268264_10584281 | 3300028381 | Bacteria | 1099 |
| 468 | Ga0307515_10114699 | 3300028794 | Bacteria | 3111 |
| 469 | Ga0307515_10382947 | 3300028794 | Bacteria | 1038 |
| 470 | Ga0265338_10187301 | 3300028800 | Bacteria | 1572 |
| 471 | Ga0265338_10222478 | 3300028800 | Bacteria | 1409 |
| 472 | Ga0307511_10002869 | 3300030521 | Bacteria | 17883 |
| 473 | Ga0307511_10023554 | 3300030521 | Bacteria | 5735 |
| 474 | Ga0316176_1176152 | 3300030732 | Bacteria | 709 |
| 475 | Ga0265763_1001427 | 3300030763 | Bacteria | 1703 |
| 476 | Ga0265770_1075597 | 3300030878 | Bacteria | 650 |
| 477 | Ga0265768_112292 | 3300030963 | Bacteria | 571 |
| 478 | Ga0265320_10457119 | 3300031240 | Bacteria | 564 |
| 479 | Ga0265340_10021798 | 3300031247 | Bacteria | 3282 |
| 480 | Ga0265340_10213596 | 3300031247 | Bacteria | 865 |
| 481 | Ga0265340_10472822 | 3300031247 | Bacteria | 552 |
| 482 | Ga0265331_10109927 | 3300031250 | Bacteria | 1265 |
| 483 | Ga0307513_10413620 | 3300031456 | Bacteria | 1080 |
| 484 | Ga0307513_10429419 | 3300031456 | Bacteria | 1050 |
| 485 | Ga0307509_10000162 | 3300031507 | Bacteria | 104449 |
| 486 | Ga0265313_10257489 | 3300031595 | Bacteria | 710 |
| 487 | Ga0265313_10401338 | 3300031595 | Bacteria | 538 |
| 488 | Ga0316575_10083908 | 3300031665 | Bacteria | 1286 |
| 489 | Ga0316576_10007759 | 3300031727 | Bacteria | 6777 |
| 490 | Ga0316577_10057581 | 3300031733 | Bacteria | 2170 |
| 491 | Ga0316577_10192843 | 3300031733 | Bacteria | 1151 |
| 492 | Ga0316577_10232668 | 3300031733 | Bacteria | 1042 |
| 493 | Ga0307413_10966564 | 3300031824 | Bacteria | 728 |
| 494 | Ga0307410_11136746 | 3300031852 | Bacteria | 678 |
| 495 | Ga0307407_10139544 | 3300031903 | Bacteria | 1562 |
| 496 | Ga0307407_10509429 | 3300031903 | Bacteria | 883 |
| 497 | Ga0307415_100590832 | 3300032126 | Bacteria | 986 |
| 498 | Ga0307507_10288646 | 3300033179 | Bacteria | 1018 |
| 499 | Ga0307507_10313842 | 3300033179 | Bacteria | 950 |
| 500 | Ga0307510_10000011 | 3300033180 | Bacteria | 355464 |
| 501 | Ga0307510_10014196 | 3300033180 | Bacteria | 9434 |
| 502 | Ga0373923_0413665 | 3300035111 | Bacteria | 650 |
| 503 | Ga0373932_0117943 | 3300035112 | Bacteria | 882 |
| 504 | Ga0373936_0007238 | 3300035113 | Bacteria | 4177 |
| 505 | Ga0373945_0041352 | 3300035116 | Bacteria | 1666 |
| 506 | Ga0373954_0012268 | 3300035118 | Bacteria | 3810 |
| 507 | Ga0373956_0030548 | 3300035119 | Bacteria | 2356 |
| 508 | Ga0373943_0064800 | 3300035170 | Bacteria | 1836 |
| 509 | Ga0373946_0098183 | 3300035171 | Bacteria | 1309 |
| 510 | Ga0373955_0056144 | 3300035172 | Bacteria | 2160 |
| 511 | Ga0373955_0207351 | 3300035172 | Bacteria | 1168 |
| 512 | Ga0316574_0145510 | 3300035398 | Bacteria | 1527 |
| 513 | Ga0373935_0800188 | 3300035692 | Bacteria | 696 |
| 514 | Ga0373927_0030967 | 3300035695 | Bacteria | 3490 |
| 515 | Ga0373927_0087723 | 3300035695 | Bacteria | 2020 |
| 516 | Ga0373933_0322529 | 3300035724 | Bacteria | 1002 |
| 517 | Ga0373937_0041733 | 3300036401 | Bacteria | 4185 |
| 518 | Ga0373937_0117078 | 3300036401 | Bacteria | 2482 |
| 519 | Ga0373937_0217963 | 3300036401 | Bacteria | 1796 |
| 520 | Ga0373937_0555809 | 3300036401 | Bacteria | 1090 |
| 521 | Ga0316584_0055643 | 3300036712 | Bacteria | 2962 |
| 522 | Ga0373925_0092039 | 3300037068 | Bacteria | 2319 |
| 523 | Ga0373925_0122502 | 3300037068 | Bacteria | 2020 |
| 524 | Ga0395900_0379087 | 3300037418 | Bacteria | 1383 |
| 525 | Ga0395900_0434309 | 3300037418 | Bacteria | 1272 |
| 526 | Ga0395898_0006120 | 3300037466 | Bacteria | 12900 |
| 527 | Ga0395898_0058585 | 3300037466 | Bacteria | 3749 |
| 528 | Ga0395905_0262396 | 3300037471 | Bacteria | 1613 |
| 529 | Ga0436364_0434002 | 3300037853 | Bacteria | 605 |
| 530 | Ga0436364_0477485 | 3300037853 | Bacteria | 828 |
| 531 | Ga0436364_0894341 | 3300037853 | Bacteria | 587 |
| 532 | Ga0395901_1135576 | 3300038443 | Bacteria | 750 |
| 533 | Ga0436365_0521742 | 3300039437 | Bacteria | 2040 |
| 534 | Ga0436365_0942025 | 3300039437 | Bacteria | 4868 |
| 535 | Ga0436365_1109929 | 3300039437 | Bacteria | 546 |
| 536 | Ga0436365_1254679 | 3300039437 | Bacteria | 773 |
| 537 | Ga0436365_1346489 | 3300039437 | Bacteria | 1621 |
| 538 | Ga0436360_0086470 | 3300039438 | Bacteria | 1405 |
| 539 | Ga0436360_0766596 | 3300039438 | Bacteria | 19938 |
| 540 | Ga0436360_0831083 | 3300039438 | Bacteria | 3005 |
| 541 | Ga0436360_0970001 | 3300039438 | Bacteria | 1646 |
| 542 | Ga0436361_0477235 | 3300039447 | Bacteria | 738 |
| 543 | Ga0436361_0501117 | 3300039447 | Bacteria | 786 |
| 544 | Ga0436361_0654178 | 3300039447 | Bacteria | 1739 |
| 545 | Ga0436361_1160407 | 3300039447 | Bacteria | 1221 |
| 546 | Ga0436363_0045740 | 3300039450 | Bacteria | 3540 |
| 547 | Ga0436363_0237012 | 3300039450 | Bacteria | 2015 |
| 548 | Ga0436363_0269421 | 3300039450 | Bacteria | 579 |
| 549 | Ga0436363_0594067 | 3300039450 | Bacteria | 1948 |
| 550 | Ga0436363_0868312 | 3300039450 | Unclassified | 841 |
| 551 | Ga0436363_1183369 | 3300039450 | Bacteria | 670 |
| 552 | Ga0436363_1492427 | 3300039450 | Bacteria | 4711 |
| 553 | Ga0436362_0063292 | 3300039453 | Bacteria | 688 |
| 554 | Ga0436362_0075590 | 3300039453 | Bacteria | 1342 |
| 555 | Ga0436362_0340884 | 3300039453 | Bacteria | 898 |
| 556 | Ga0436362_0734099 | 3300039453 | Bacteria | 2524 |
| 557 | Ga0436362_0828451 | 3300039453 | Bacteria | 1201 |
| 558 | Ga0436362_0907425 | 3300039453 | Bacteria | 508 |
| 559 | Ga0451789_1334491 | 3300041443 | Bacteria | 799 |
| 560 | Ga0451791_0622945 | 3300041451 | Bacteria | 850 |
| 561 | Ga0451793_0730076 | 3300041452 | Bacteria | 773 |
| 562 | Ga0451797_1526605 | 3300041453 | Bacteria | 1183 |
| 563 | Ga0451798_0071954 | 3300041458 | Bacteria | 1083 |
| 564 | Ga0451800_1134045 | 3300041459 | Bacteria | 746 |
| 565 | Ga0451802_1329548 | 3300041460 | Bacteria | 566 |
| 566 | Ga0451807_1727859 | 3300041486 | Bacteria | 1157 |
| 567 | Ga0451843_0981204 | 3300041509 | Bacteria | 540 |
| 568 | Ga0451853_3495509 | 3300041512 | Bacteria | 1243 |
| 569 | Ga0451577_0141707 | 3300042876 | Bacteria | 2160 |
| 570 | Ga0451577_0989231 | 3300042876 | Bacteria | 756 |
| 571 | Ga0466969_0003022 | 3300044656 | Bacteria | 8961 |
| 572 | Ga0466969_0031684 | 3300044656 | Bacteria | 2691 |
| 573 | Ga0453683_0057997 | 3300044673 | Bacteria | 2422 |
| 574 | Ga0453683_0086552 | 3300044673 | Bacteria | 1963 |
| 575 | Ga0466966_0194261 | 3300044684 | Bacteria | 1229 |
| 576 | Ga0466961_0114113 | 3300044693 | Bacteria | 1698 |
| 577 | Ga0466961_0567678 | 3300044693 | Bacteria | 683 |
| 578 | Ga0453684_0038649 | 3300044712 | Bacteria | 6520 |
| 579 | Ga0453684_0080604 | 3300044712 | Bacteria | 4064 |
| 580 | Ga0453684_0350059 | 3300044712 | Bacteria | 1666 |
| 581 | Ga0453684_0511371 | 3300044712 | Bacteria | 1328 |
| 582 | Ga0453684_0878115 | 3300044712 | Bacteria | 962 |
| 583 | Ga0453684_2259650 | 3300044712 | Bacteria | 542 |
| 584 | Ga0466970_0332022 | 3300044765 | Bacteria | 861 |
| 585 | Ga0466959_0003023 | 3300045049 | Bacteria | 10870 |
| 586 | Ga0466959_0022104 | 3300045049 | Bacteria | 4700 |
| 587 | Ga0466959_0040209 | 3300045049 | Bacteria | 3455 |
| 588 | Ga0466959_0085349 | 3300045049 | Bacteria | 2272 |
| 589 | Ga0466959_0296220 | 3300045049 | Bacteria | 1108 |
| 590 | Ga0451576_0000046 | 3300045051 | Bacteria | 334064 |
| 591 | Ga0451576_0015026 | 3300045051 | Bacteria | 8599 |
| 592 | Ga0451576_0087654 | 3300045051 | Bacteria | 3237 |
| 593 | Ga0466967_1628117 | 3300045976 | Bacteria | 643 |
| 594 | Ga0495603_0188564 | 3300046455 | Bacteria | 1192 |
| 595 | Ga0495603_0822176 | 3300046455 | Bacteria | 529 |
| 596 | Ga0495591_045888 | 3300046458 | Bacteria | 1216 |
| 597 | Ga0495629_0234037 | 3300046459 | Bacteria | 1266 |
| 598 | Ga0495629_0337672 | 3300046459 | Bacteria | 1029 |
| 599 | Ga0495580_0349641 | 3300046472 | Bacteria | 1001 |
| 600 | Ga0495580_0414430 | 3300046472 | Bacteria | 907 |
| 601 | Ga0495580_0742434 | 3300046472 | Bacteria | 640 |
| 602 | Ga0495582_0113293 | 3300046473 | Bacteria | 1524 |
| 603 | Ga0495639_0074366 | 3300046475 | Bacteria | 1574 |
| 604 | Ga0495664_0088156 | 3300046477 | Bacteria | 1865 |
| 605 | Ga0495664_0264049 | 3300046477 | Bacteria | 1041 |
| 606 | Ga0495606_0074410 | 3300046507 | Bacteria | 2128 |
| 607 | Ga0495606_0111138 | 3300046507 | Bacteria | 1653 |
| 608 | Ga0495606_0189216 | 3300046507 | Bacteria | 1181 |
| 609 | Ga0495608_0481137 | 3300046511 | Bacteria | 753 |
| 610 | Ga0495618_0071963 | 3300046514 | Bacteria | 2200 |
| 611 | Ga0495628_1103804 | 3300046516 | Bacteria | 542 |
| 612 | Ga0495630_0067544 | 3300046517 | Bacteria | 2688 |
| 613 | Ga0495630_0695145 | 3300046517 | Bacteria | 778 |
| 614 | Ga0495631_0490507 | 3300046518 | Bacteria | 523 |
| 615 | Ga0495632_0212921 | 3300046519 | Bacteria | 876 |
| 616 | Ga0495644_0050781 | 3300046523 | Bacteria | 1557 |
| 617 | Ga0495648_0312451 | 3300046524 | Bacteria | 732 |
| 618 | Ga0495654_0099094 | 3300046530 | Bacteria | 1344 |
| 619 | Ga0495665_0701489 | 3300046531 | Bacteria | 502 |
| 620 | Ga0495586_0739713 | 3300046535 | Bacteria | 568 |
| 621 | Ga0495609_0283392 | 3300046538 | Bacteria | 677 |
| 622 | Ga0495621_0007215 | 3300046539 | Bacteria | 3282 |
| 623 | Ga0495645_0376363 | 3300046543 | Bacteria | 909 |
| 624 | Ga0495633_0197052 | 3300046558 | Bacteria | 925 |
| 625 | Ga0495668_0446443 | 3300046616 | Unclassified | 712 |
| 626 | Ga0495657_0271591 | 3300046675 | Bacteria | 1017 |
| 627 | Ga0495623_0155348 | 3300046679 | Bacteria | 1349 |
| 628 | Ga0495623_0510091 | 3300046679 | Bacteria | 634 |
| 629 | Ga0495647_0018104 | 3300046681 | Bacteria | 2502 |
| 630 | Ga0495647_0413604 | 3300046681 | Bacteria | 621 |
| 631 | Ga0495658_0509556 | 3300046683 | Bacteria | 770 |
| 632 | Ga0495613_0151126 | 3300046689 | Bacteria | 1656 |
| 633 | Ga0495613_0415527 | 3300046689 | Bacteria | 916 |
| 634 | Ga0495600_0470413 | 3300046809 | Bacteria | 775 |
| 635 | Ga0495600_0825357 | 3300046809 | Unclassified | 551 |
| 636 | Ga0495604_0175094 | 3300047317 | Bacteria | 1505 |
| 637 | Ga0495674_0245065 | 3300047319 | Bacteria | 1476 |
| 638 | Ga0495683_0463189 | 3300047323 | Bacteria | 519 |
| 639 | Ga0495687_063656 | 3300047443 | Bacteria | 1509 |
| 640 | Ga0495677_0109832 | 3300047445 | Bacteria | 1048 |
| 641 | Ga0495686_0113447 | 3300047472 | Bacteria | 1623 |
| 642 | Ga0495593_0292228 | 3300047673 | Bacteria | 815 |
| 643 | Ga0495602_0341522 | 3300048088 | Bacteria | 1083 |
| 644 | Ga0496100_0051687 | 3300048903 | Bacteria | 2669 |
| 645 | Ga0496100_0053077 | 3300048903 | Bacteria | 2638 |
| 646 | Ga0496100_0143826 | 3300048903 | Bacteria | 1694 |
| 647 | Ga0496101_0182911 | 3300048904 | Bacteria | 1614 |
| 648 | Ga0496101_0734679 | 3300048904 | Bacteria | 779 |
| 649 | Ga0496102_0008678 | 3300048905 | Bacteria | 8725 |
| 650 | Ga0496102_0028338 | 3300048905 | Bacteria | 5001 |
| 651 | Ga0496102_0140257 | 3300048905 | Bacteria | 2266 |
| 652 | Ga0496102_0146867 | 3300048905 | Bacteria | 2213 |
| 653 | Ga0496102_1260356 | 3300048905 | Bacteria | 658 |
| 654 | Ga0496103_0084215 | 3300048906 | Bacteria | 2003 |
| 655 | Ga0496103_0090911 | 3300048906 | Bacteria | 1926 |
| 656 | Ga0496104_0081925 | 3300048907 | Bacteria | 3077 |
| 657 | Ga0496104_0556064 | 3300048907 | Bacteria | 1058 |
| 658 | Ga0496104_1595494 | 3300048907 | Bacteria | 555 |
| 659 | Ga0496105_0009915 | 3300048908 | Bacteria | 7471 |
| 660 | Ga0496105_0280070 | 3300048908 | Bacteria | 1345 |
| 661 | Ga0496105_1074160 | 3300048908 | Bacteria | 599 |
| 662 | Ga0496106_0014237 | 3300048909 | Bacteria | 5875 |
| 663 | Ga0496106_0413952 | 3300048909 | Bacteria | 1083 |
| 664 | Ga0496106_0478667 | 3300048909 | Bacteria | 1000 |
| 665 | Ga0496106_0651137 | 3300048909 | Bacteria | 842 |
| 666 | Ga0496107_0073989 | 3300048910 | Bacteria | 2479 |
| 667 | Ga0496107_0288548 | 3300048910 | Bacteria | 1221 |
| 668 | Ga0496108_0060411 | 3300048911 | Bacteria | 3189 |
| 669 | Ga0496108_0406564 | 3300048911 | Bacteria | 1189 |
| 670 | Ga0496109_0008587 | 3300048912 | Bacteria | 8694 |
| 671 | Ga0496109_0215623 | 3300048912 | Bacteria | 1805 |
| 672 | Ga0496109_0276699 | 3300048912 | Bacteria | 1582 |
| 673 | Ga0496110_0003769 | 3300048913 | Bacteria | 11681 |
| 674 | Ga0496110_0558358 | 3300048913 | Bacteria | 1040 |
| 675 | Ga0496110_1008179 | 3300048913 | Bacteria | 740 |
| 676 | Ga0496111_0019260 | 3300048914 | Bacteria | 4738 |
| 677 | Ga0496111_0097004 | 3300048914 | Bacteria | 2164 |
| 678 | Ga0496112_0031109 | 3300048915 | Bacteria | 5173 |
| 679 | Ga0496112_0044032 | 3300048915 | Bacteria | 4371 |
| 680 | Ga0496112_0081124 | 3300048915 | Bacteria | 3208 |
| 681 | Ga0496113_0114120 | 3300048916 | Bacteria | 2106 |
| 682 | Ga0496113_0499499 | 3300048916 | Bacteria | 977 |
| 683 | Ga0496114_0005168 | 3300048917 | Bacteria | 10186 |
| 684 | Ga0496114_0590398 | 3300048917 | Bacteria | 980 |
| 685 | Ga0496115_0129568 | 3300048918 | Bacteria | 2079 |
| 686 | Ga0496116_0077357 | 3300048919 | Bacteria | 2079 |
| 687 | Ga0496117_0000373 | 3300048920 | Bacteria | 77595 |
| 688 | Ga0496117_0273991 | 3300048920 | Bacteria | 907 |
| 689 | Ga0496118_0000021 | 3300048921 | Bacteria | 444988 |
| 690 | Ga0496118_0160497 | 3300048921 | Bacteria | 1391 |
| 691 | Ga0496119_0001387 | 3300048922 | Bacteria | 29399 |
| 692 | Ga0496119_0002294 | 3300048922 | Bacteria | 21157 |
| 693 | Ga0496119_0223536 | 3300048922 | Bacteria | 962 |
| 694 | Ga0496120_0002163 | 3300048923 | Bacteria | 20906 |
| 695 | Ga0496120_0022135 | 3300048923 | Bacteria | 4002 |
| 696 | Ga0496121_0000547 | 3300048924 | Bacteria | 70979 |
| 697 | Ga0496121_0002740 | 3300048924 | Bacteria | 26193 |
| 698 | Ga0496121_0831529 | 3300048924 | Bacteria | 539 |
| 699 | Ga0496123_0319298 | 3300048926 | Bacteria | 734 |
| 700 | Ga0496124_0250666 | 3300048927 | Bacteria | 1310 |
| 701 | Ga0496125_0000112 | 3300048928 | Bacteria | 188192 |
| 702 | Ga0496125_0023886 | 3300048928 | Bacteria | 5633 |
| 703 | Ga0496125_0764482 | 3300048928 | Bacteria | 504 |
| 704 | Ga0496126_0006924 | 3300048929 | Bacteria | 12557 |
| 705 | Ga0496126_0038813 | 3300048929 | Bacteria | 4426 |
| 706 | Ga0496126_0148783 | 3300048929 | Bacteria | 2008 |
| 707 | Ga0495682_0064478 | 3300049460 | Bacteria | 1321 |
| 708 | Ga0495682_0145824 | 3300049460 | Bacteria | 845 |
| 709 | Ga0501312_035006 | 3300049528 | Bacteria | 802 |
| 710 | Ga0501031_0451789 | 3300049568 | Bacteria | 830 |
| 711 | Ga0501031_0860079 | 3300049568 | Bacteria | 581 |
| 712 | Ga0501033_0071202 | 3300049570 | Bacteria | 2554 |
| 713 | Ga0501036_0003994 | 3300049572 | Bacteria | 11857 |
| 714 | Ga0501036_1147619 | 3300049572 | Bacteria | 634 |
| 715 | Ga0501037_0255173 | 3300049573 | Bacteria | 1226 |
| 716 | Ga0501038_0006721 | 3300049574 | Bacteria | 10630 |
| 717 | Ga0501039_0010751 | 3300049575 | Bacteria | 6968 |
| 718 | Ga0501039_0189216 | 3300049575 | Bacteria | 1619 |
| 719 | Ga0501039_0735362 | 3300049575 | Bacteria | 771 |
| 720 | Ga0501040_0003685 | 3300049576 | Bacteria | 9929 |
| 721 | Ga0501040_0004342 | 3300049576 | Bacteria | 9213 |
| 722 | Ga0501040_1089110 | 3300049576 | Bacteria | 579 |
| 723 | Ga0501041_0002953 | 3300049577 | Bacteria | 9749 |
| 724 | Ga0501041_0012431 | 3300049577 | Bacteria | 5043 |
| 725 | Ga0501041_0213463 | 3300049577 | Bacteria | 1210 |
| 726 | Ga0501041_0451194 | 3300049577 | Bacteria | 816 |
| 727 | Ga0501041_0610760 | 3300049577 | Bacteria | 696 |
| 728 | Ga0501042_0003310 | 3300049578 | Bacteria | 10084 |
| 729 | Ga0501042_0076695 | 3300049578 | Bacteria | 2393 |
| 730 | Ga0501043_0573578 | 3300049579 | Bacteria | 836 |
| 731 | Ga0501046_0003536 | 3300049580 | Bacteria | 14309 |
| 732 | Ga0501048_0004812 | 3300049582 | Bacteria | 10288 |
| 733 | Ga0501048_0067436 | 3300049582 | Bacteria | 2529 |
| 734 | Ga0501048_1414785 | 3300049582 | Bacteria | 500 |
| 735 | Ga0501067_0304048 | 3300049583 | Bacteria | 888 |
| 736 | Ga0501068_1112498 | 3300049584 | Bacteria | 522 |
| 737 | Ga0501070_1068535 | 3300049586 | Bacteria | 624 |
| 738 | Ga0501071_0001540 | 3300049587 | Bacteria | 13464 |
| 739 | Ga0501071_0069646 | 3300049587 | Bacteria | 2562 |
| 740 | Ga0501071_0431610 | 3300049587 | Bacteria | 1007 |
| 741 | Ga0501072_0012132 | 3300049588 | Bacteria | 6584 |
| 742 | Ga0501072_0012597 | 3300049588 | Bacteria | 6465 |
| 743 | Ga0501072_1557609 | 3300049588 | Bacteria | 510 |
| 744 | Ga0501073_0175068 | 3300049589 | Bacteria | 1485 |
| 745 | Ga0501073_0820955 | 3300049589 | Bacteria | 641 |
| 746 | Ga0501074_0049116 | 3300049590 | Bacteria | 3046 |
| 747 | Ga0501074_0073437 | 3300049590 | Bacteria | 2457 |
| 748 | Ga0501074_1177059 | 3300049590 | Bacteria | 538 |
| 749 | Ga0501075_0001216 | 3300049591 | Bacteria | 16684 |
| 750 | Ga0501075_0076770 | 3300049591 | Bacteria | 2527 |
| 751 | Ga0501075_0575092 | 3300049591 | Bacteria | 859 |
| 752 | Ga0501076_0006804 | 3300049592 | Bacteria | 8296 |
| 753 | Ga0501076_0155282 | 3300049592 | Bacteria | 1862 |
| 754 | Ga0501076_0621292 | 3300049592 | Bacteria | 891 |
| 755 | Ga0501077_0010223 | 3300049593 | Bacteria | 5843 |
| 756 | Ga0501079_0002187 | 3300049741 | Bacteria | 14094 |
| 757 | Ga0501079_0121281 | 3300049741 | Bacteria | 2033 |
| 758 | Ga0501079_0268996 | 3300049741 | Bacteria | 1332 |
| 759 | Ga0501079_0962770 | 3300049741 | Bacteria | 672 |
| 760 | Ga0501080_0003675 | 3300049742 | Bacteria | 13532 |
| 761 | Ga0501080_0110143 | 3300049742 | Bacteria | 2552 |
| 762 | Ga0501080_0191856 | 3300049742 | Bacteria | 1877 |
| 763 | Ga0501081_0002620 | 3300049743 | Bacteria | 11374 |
| 764 | Ga0501081_0075009 | 3300049743 | Bacteria | 2360 |
| 765 | Ga0501081_0133482 | 3300049743 | Bacteria | 1775 |
| 766 | Ga0501081_0214930 | 3300049743 | Bacteria | 1397 |
| 767 | Ga0501081_0472939 | 3300049743 | Bacteria | 932 |
| 768 | Ga0501083_0052825 | 3300049744 | Bacteria | 2729 |
| 769 | Ga0501083_0602568 | 3300049744 | Bacteria | 715 |
| 770 | Ga0501083_0906977 | 3300049744 | Bacteria | 573 |
| 771 | Ga0501035_0104697 | 3300049822 | Bacteria | 2481 |
| 772 | Ga0501045_0002837 | 3300049824 | Bacteria | 11829 |
| 773 | Ga0501045_0013189 | 3300049824 | Bacteria | 5829 |
| 774 | nmdc:mga05p37_335223_c1 | 3300050507 | Bacteria | 1785 |
| 775 | nmdc:mga05p37_60382_c1 | 3300050507 | Bacteria | 4668 |
| 776 | nmdc:mga09592_1644125_c1 | 3300050508 | Bacteria | 519 |
| 777 | nmdc:mga0qj67_384617_c1 | 3300050509 | Bacteria | 1133 |
| 778 | nmdc:mga08y16_280438_c1 | 3300050511 | Bacteria | 1719 |
| 779 | nmdc:mga08y16_65021_c1 | 3300050511 | Bacteria | 3808 |
| 780 | nmdc:mga0n895_112570_c1 | 3300050512 | Bacteria | 2738 |
| 781 | nmdc:mga0n895_141969_c1 | 3300050512 | Bacteria | 2430 |
| 782 | nmdc:mga0n895_16043_c1 | 3300050512 | Bacteria | 6862 |
| 783 | nmdc:mga0rr50_1356395_c1 | 3300050513 | Bacteria | 602 |
| 784 | nmdc:mga0rr50_1748325_c1 | 3300050513 | Bacteria | 524 |
| 785 | nmdc:mga0rr50_358444_c1 | 3300050513 | Bacteria | 1227 |
| 786 | nmdc:mga0rr50_820016_c1 | 3300050513 | Bacteria | 794 |
| 787 | nmdc:mga0a205_167973_c1 | 3300050515 | Bacteria | 2089 |
| 788 | nmdc:mga0a205_9194_c1 | 3300050515 | Bacteria | 9021 |
| 789 | Ga0495612_0032435 | 3300053078 | Bacteria | 2111 |
| 790 | Ga0495612_0161196 | 3300053078 | Bacteria | 979 |
| 791 | Ga0500646_0154254 | 3300053090 | Bacteria | 762 |
| 792 | Ga0500583_0004150 | 3300053092 | Bacteria | 4679 |
| 793 | Ga0500583_0021011 | 3300053092 | Bacteria | 2707 |
| 794 | Ga0500583_0102333 | 3300053092 | Bacteria | 1404 |
| 795 | Ga0500651_0057949 | 3300053093 | Bacteria | 2423 |
| 796 | Ga0500640_112928 | 3300053095 | Bacteria | 1102 |
| 797 | Ga0500641_0007963 | 3300053096 | Bacteria | 3779 |
| 798 | Ga0500650_0280864 | 3300053098 | Bacteria | 740 |
| 799 | Ga0500650_0443130 | 3300053098 | Bacteria | 557 |
| 800 | Ga0500660_097501 | 3300053100 | Bacteria | 1293 |
| 801 | Ga0500569_290496 | 3300053109 | Bacteria | 551 |
| 802 | Ga0500572_004051 | 3300053111 | Bacteria | 3334 |
| 803 | Ga0500642_0189537 | 3300053130 | Bacteria | 960 |
| 804 | Ga0500652_124533 | 3300053131 | Bacteria | 1077 |
| 805 | Ga0500655_013178 | 3300053133 | Bacteria | 1507 |
| 806 | Ga0500559_0131199 | 3300053136 | Bacteria | 1170 |
| 807 | Ga0500573_0320380 | 3300053140 | Bacteria | 766 |
| 808 | Ga0500590_083952 | 3300053148 | Bacteria | 1560 |
| 809 | Ga0500616_0063191 | 3300053153 | Bacteria | 1910 |
| 810 | Ga0500630_108203 | 3300053159 | Bacteria | 1254 |
| 811 | Ga0500639_139624 | 3300053163 | Bacteria | 1135 |
| 812 | Ga0500639_289168 | 3300053163 | Bacteria | 625 |
| 813 | Ga0500637_0238906 | 3300053178 | Bacteria | 1019 |
| 814 | Ga0500637_0352663 | 3300053178 | Bacteria | 782 |
| 815 | Ga0501084_0000340 | 3300054114 | Bacteria | 35562 |
| 816 | Ga0501084_0152613 | 3300054114 | Bacteria | 1947 |
| 817 | Ga0501084_0994444 | 3300054114 | Bacteria | 705 |
| 818 | Ga0501084_1074353 | 3300054114 | Bacteria | 676 |
| 819 | Ga0587068_093285 | 3300059641 | Bacteria | 623 |
| 820 | Ga0587071_131600 | 3300060344 | Bacteria | 607 |
| 821 | Ga0587111_0226171 | 3300060346 | Bacteria | 542 |
| 822 | Ga0501082_0003014 | 3300060353 | Bacteria | 14716 |
| 823 | Ga0501082_0082975 | 3300060353 | Bacteria | 2765 |
| 824 | Ga0501082_1257324 | 3300060353 | Bacteria | 647 |
| 825 | Ga0530510_0004076 | 3300061734 | Bacteria | 10084 |
| 826 | Ga0530510_0026414 | 3300061734 | Bacteria | 4156 |
| 827 | Ga0530510_0032714 | 3300061734 | Bacteria | 3743 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005840 | Ga0068870_10451812 | Ga0068870_104518122 | 84 |
| 2 | 3300006844 | Ga0075428_101527782 | Ga0075428_1015277822 | 84 |
| 3 | 3300031733 | Ga0316577_10057581 | Ga0316577_100575813 | 84 |
| 4 | 3300031733 | Ga0316577_10192843 | Ga0316577_101928432 | 84 |
| 5 | 3300005290 | Ga0065712_10147864 | Ga0065712_101478642 | 85 |
| 6 | 3300005327 | Ga0070658_11135394 | Ga0070658_111353941 | 85 |
| 7 | 3300005333 | Ga0070677_10049093 | Ga0070677_100490933 | 85 |
| 8 | 3300005334 | Ga0068869_101258284 | Ga0068869_1012582842 | 85 |
| 9 | 3300005337 | Ga0070682_100335930 | Ga0070682_1003359302 | 85 |
| 10 | 3300005341 | Ga0070691_10797072 | Ga0070691_107970721 | 85 |
| 11 | 3300005353 | Ga0070669_100324959 | Ga0070669_1003249591 | 85 |
| 12 | 3300005354 | Ga0070675_100320816 | Ga0070675_1003208162 | 85 |
| 13 | 3300005354 | Ga0070675_100704803 | Ga0070675_1007048032 | 85 |
| 14 | 3300005355 | Ga0070671_101184592 | Ga0070671_1011845922 | 85 |
| 15 | 3300005356 | Ga0070674_100714600 | Ga0070674_1007146001 | 85 |
| 16 | 3300005364 | Ga0070673_100075636 | Ga0070673_1000756363 | 85 |
| 17 | 3300005440 | Ga0070705_100511022 | Ga0070705_1005110222 | 85 |
| 18 | 3300005444 | Ga0070694_101019668 | Ga0070694_1010196682 | 85 |
| 19 | 3300005456 | Ga0070678_101100119 | Ga0070678_1011001192 | 85 |
| 20 | 3300005543 | Ga0070672_100221899 | Ga0070672_1002218993 | 85 |
| 21 | 3300005544 | Ga0070686_101008213 | Ga0070686_1010082131 | 85 |
| 22 | 3300005545 | Ga0070695_100319577 | Ga0070695_1003195772 | 85 |
| 23 | 3300005545 | Ga0070695_100524923 | Ga0070695_1005249231 | 85 |
| 24 | 3300005546 | Ga0070696_100457913 | Ga0070696_1004579131 | 85 |
| 25 | 3300005546 | Ga0070696_101348236 | Ga0070696_1013482362 | 85 |
| 26 | 3300005549 | Ga0070704_100019210 | Ga0070704_1000192104 | 85 |
| 27 | 3300005578 | Ga0068854_101541978 | Ga0068854_1015419782 | 85 |
| 28 | 3300005617 | Ga0068859_100097108 | Ga0068859_1000971082 | 85 |
| 29 | 3300005841 | Ga0068863_101682147 | Ga0068863_1016821472 | 85 |
| 30 | 3300005843 | Ga0068860_100644567 | Ga0068860_1006445673 | 85 |
| 31 | 3300006173 | Ga0070716_100780320 | Ga0070716_1007803202 | 85 |
| 32 | 3300006844 | Ga0075428_100015490 | Ga0075428_1000154907 | 85 |
| 33 | 3300006844 | Ga0075428_100148124 | Ga0075428_1001481244 | 85 |
| 34 | 3300006844 | Ga0075428_100855944 | Ga0075428_1008559442 | 85 |
| 35 | 3300006852 | Ga0075433_10002778 | Ga0075433_1000277815 | 85 |
| 36 | 3300006871 | Ga0075434_100000511 | Ga0075434_10000051115 | 85 |
| 37 | 3300006880 | Ga0075429_100547744 | Ga0075429_1005477442 | 85 |
| 38 | 3300006881 | Ga0068865_101028230 | Ga0068865_1010282302 | 85 |
| 39 | 3300006931 | Ga0097620_100097094 | Ga0097620_1000970942 | 85 |
| 40 | 3300007076 | Ga0075435_100535228 | Ga0075435_1005352282 | 85 |
| 41 | 3300009094 | Ga0111539_10005609 | Ga0111539_1000560914 | 85 |
| 42 | 3300009094 | Ga0111539_10083250 | Ga0111539_100832504 | 85 |
| 43 | 3300009147 | Ga0114129_10439647 | Ga0114129_104396473 | 85 |
| 44 | 3300009147 | Ga0114129_13386664 | Ga0114129_133866642 | 85 |
| 45 | 3300009148 | Ga0105243_11562036 | Ga0105243_115620361 | 85 |
| 46 | 3300009553 | Ga0105249_12398636 | Ga0105249_123986362 | 85 |
| 47 | 3300014326 | Ga0157380_10001383 | Ga0157380_100013831 | 85 |
| 48 | 3300014326 | Ga0157380_10085969 | Ga0157380_100859692 | 85 |
| 49 | 3300014326 | Ga0157380_10151671 | Ga0157380_101516713 | 85 |
| 50 | 3300014745 | Ga0157377_10142660 | Ga0157377_101426603 | 85 |
| 51 | 3300014745 | Ga0157377_10955799 | Ga0157377_109557992 | 85 |
| 52 | 3300014969 | Ga0157376_10246601 | Ga0157376_102466013 | 85 |
| 53 | 3300017792 | Ga0163161_12055211 | Ga0163161_120552111 | 85 |
| 54 | 3300025893 | Ga0207682_10074108 | Ga0207682_100741083 | 85 |
| 55 | 3300025908 | Ga0207643_10607231 | Ga0207643_106072311 | 85 |
| 56 | 3300025909 | Ga0207705_11463360 | Ga0207705_114633601 | 85 |
| 57 | 3300025918 | Ga0207662_10527352 | Ga0207662_105273522 | 85 |
| 58 | 3300025923 | Ga0207681_10461414 | Ga0207681_104614141 | 85 |
| 59 | 3300025926 | Ga0207659_10175073 | Ga0207659_101750732 | 85 |
| 60 | 3300025926 | Ga0207659_11876848 | Ga0207659_118768482 | 85 |
| 61 | 3300025931 | Ga0207644_11443530 | Ga0207644_114435302 | 85 |
| 62 | 3300025940 | Ga0207691_10241382 | Ga0207691_102413823 | 85 |
| 63 | 3300025942 | Ga0207689_10141841 | Ga0207689_101418413 | 85 |
| 64 | 3300025960 | Ga0207651_10436874 | Ga0207651_104368742 | 85 |
| 65 | 3300025981 | Ga0207640_11924286 | Ga0207640_119242862 | 85 |
| 66 | 3300025986 | Ga0207658_10471169 | Ga0207658_104711691 | 85 |
| 67 | 3300026088 | Ga0207641_11098884 | Ga0207641_110988842 | 85 |
| 68 | 3300026089 | Ga0207648_10556719 | Ga0207648_105567192 | 85 |
| 69 | 3300026121 | Ga0207683_11209375 | Ga0207683_112093752 | 85 |
| 70 | 3300027462 | Ga0210000_1060146 | Ga0210000_10601462 | 85 |
| 71 | 3300027526 | Ga0209968_1040006 | Ga0209968_10400062 | 85 |
| 72 | 3300027907 | Ga0207428_10043304 | Ga0207428_100433044 | 85 |
| 73 | 3300027907 | Ga0207428_10772990 | Ga0207428_107729902 | 85 |
| 74 | 3300028380 | Ga0268265_11550864 | Ga0268265_115508641 | 85 |
| 75 | 3300031240 | Ga0265320_10457119 | Ga0265320_104571191 | 85 |
| 76 | 3300031250 | Ga0265331_10109927 | Ga0265331_101099271 | 85 |
| 77 | 3300031456 | Ga0307513_10429419 | Ga0307513_104294191 | 85 |
| 78 | 3300031727 | Ga0316576_10007759 | Ga0316576_100077594 | 85 |
| 79 | 3300031733 | Ga0316577_10232668 | Ga0316577_102326682 | 85 |
| 80 | 3300031903 | Ga0307407_10509429 | Ga0307407_105094292 | 85 |
| 81 | 3300035398 | Ga0316574_0145510 | Ga0316574_0145510_705_962 | 85 |
| 82 | 3300036401 | Ga0373937_0117078 | Ga0373937_0117078_269_526 | 85 |
| 83 | 3300036401 | Ga0373937_0555809 | Ga0373937_0555809_512_769 | 85 |
| 84 | 3300036712 | Ga0316584_0055643 | Ga0316584_0055643_1596_1853 | 85 |
| 85 | 3300041443 | Ga0451789_1334491 | Ga0451789_1334491_233_490 | 85 |
| 86 | 3300041451 | Ga0451791_0622945 | Ga0451791_0622945_51_308 | 85 |
| 87 | 3300041452 | Ga0451793_0730076 | Ga0451793_0730076_399_656 | 85 |
| 88 | 3300041453 | Ga0451797_1526605 | Ga0451797_1526605_423_680 | 85 |
| 89 | 3300041458 | Ga0451798_0071954 | Ga0451798_0071954_540_797 | 85 |
| 90 | 3300041459 | Ga0451800_1134045 | Ga0451800_1134045_219_476 | 85 |
| 91 | 3300041460 | Ga0451802_1329548 | Ga0451802_1329548_23_280 | 85 |
| 92 | 3300041486 | Ga0451807_1727859 | Ga0451807_1727859_871_1128 | 85 |
| 93 | 3300041509 | Ga0451843_0981204 | Ga0451843_0981204_150_407 | 85 |
| 94 | 3300046455 | Ga0495603_0188564 | Ga0495603_0188564_61_318 | 85 |
| 95 | 3300046455 | Ga0495603_0822176 | Ga0495603_0822176_25_282 | 85 |
| 96 | 3300046458 | Ga0495591_045888 | Ga0495591_045888_129_386 | 85 |
| 97 | 3300046459 | Ga0495629_0234037 | Ga0495629_0234037_30_287 | 85 |
| 98 | 3300046459 | Ga0495629_0337672 | Ga0495629_0337672_17_274 | 85 |
| 99 | 3300046472 | Ga0495580_0414430 | Ga0495580_0414430_624_881 | 85 |
| 100 | 3300046472 | Ga0495580_0742434 | Ga0495580_0742434_285_542 | 85 |
| 101 | 3300046475 | Ga0495639_0074366 | Ga0495639_0074366_778_1035 | 85 |
| 102 | 3300046477 | Ga0495664_0088156 | Ga0495664_0088156_643_900 | 85 |
| 103 | 3300046518 | Ga0495631_0490507 | Ga0495631_0490507_149_406 | 85 |
| 104 | 3300046523 | Ga0495644_0050781 | Ga0495644_0050781_241_498 | 85 |
| 105 | 3300046524 | Ga0495648_0312451 | Ga0495648_0312451_362_619 | 85 |
| 106 | 3300046530 | Ga0495654_0099094 | Ga0495654_0099094_307_564 | 85 |
| 107 | 3300046535 | Ga0495586_0739713 | Ga0495586_0739713_34_291 | 85 |
| 108 | 3300046539 | Ga0495621_0007215 | Ga0495621_0007215_2290_2547 | 85 |
| 109 | 3300046558 | Ga0495633_0197052 | Ga0495633_0197052_436_693 | 85 |
| 110 | 3300046681 | Ga0495647_0018104 | Ga0495647_0018104_981_1238 | 85 |
| 111 | 3300046689 | Ga0495613_0151126 | Ga0495613_0151126_627_884 | 85 |
| 112 | 3300046689 | Ga0495613_0415527 | Ga0495613_0415527_537_794 | 85 |
| 113 | 3300046809 | Ga0495600_0470413 | Ga0495600_0470413_175_432 | 85 |
| 114 | 3300047319 | Ga0495674_0245065 | Ga0495674_0245065_881_1138 | 85 |
| 115 | 3300047445 | Ga0495677_0109832 | Ga0495677_0109832_322_579 | 85 |
| 116 | 3300047472 | Ga0495686_0113447 | Ga0495686_0113447_1220_1477 | 85 |
| 117 | 3300047673 | Ga0495593_0292228 | Ga0495593_0292228_520_777 | 85 |
| 118 | 3300048913 | Ga0496110_1008179 | Ga0496110_1008179_93_350 | 85 |
| 119 | 3300049568 | Ga0501031_0451789 | Ga0501031_0451789_197_454 | 85 |
| 120 | 3300049568 | Ga0501031_0860079 | Ga0501031_0860079_76_333 | 85 |
| 121 | 3300049570 | Ga0501033_0071202 | Ga0501033_0071202_1315_1572 | 85 |
| 122 | 3300049572 | Ga0501036_0003994 | Ga0501036_0003994_2198_2455 | 85 |
| 123 | 3300049572 | Ga0501036_1147619 | Ga0501036_1147619_10_267 | 85 |
| 124 | 3300049573 | Ga0501037_0255173 | Ga0501037_0255173_830_1087 | 85 |
| 125 | 3300049574 | Ga0501038_0006721 | Ga0501038_0006721_9035_9292 | 85 |
| 126 | 3300049575 | Ga0501039_0010751 | Ga0501039_0010751_6028_6285 | 85 |
| 127 | 3300049575 | Ga0501039_0735362 | Ga0501039_0735362_53_310 | 85 |
| 128 | 3300049576 | Ga0501040_0003685 | Ga0501040_0003685_6729_6986 | 85 |
| 129 | 3300049576 | Ga0501040_0004342 | Ga0501040_0004342_6142_6399 | 85 |
| 130 | 3300049576 | Ga0501040_1089110 | Ga0501040_1089110_202_459 | 85 |
| 131 | 3300049577 | Ga0501041_0002953 | Ga0501041_0002953_1068_1325 | 85 |
| 132 | 3300049577 | Ga0501041_0012431 | Ga0501041_0012431_60_317 | 85 |
| 133 | 3300049577 | Ga0501041_0213463 | Ga0501041_0213463_718_975 | 85 |
| 134 | 3300049577 | Ga0501041_0451194 | Ga0501041_0451194_372_629 | 85 |
| 135 | 3300049578 | Ga0501042_0003310 | Ga0501042_0003310_3378_3635 | 85 |
| 136 | 3300049578 | Ga0501042_0076695 | Ga0501042_0076695_2008_2265 | 85 |
| 137 | 3300049579 | Ga0501043_0573578 | Ga0501043_0573578_487_744 | 85 |
| 138 | 3300049580 | Ga0501046_0003536 | Ga0501046_0003536_5021_5278 | 85 |
| 139 | 3300049582 | Ga0501048_0004812 | Ga0501048_0004812_6806_7063 | 85 |
| 140 | 3300049582 | Ga0501048_0067436 | Ga0501048_0067436_642_899 | 85 |
| 141 | 3300049582 | Ga0501048_1414785 | Ga0501048_1414785_213_470 | 85 |
| 142 | 3300049584 | Ga0501068_1112498 | Ga0501068_1112498_166_423 | 85 |
| 143 | 3300049586 | Ga0501070_1068535 | Ga0501070_1068535_298_555 | 85 |
| 144 | 3300049587 | Ga0501071_0001540 | Ga0501071_0001540_3906_4163 | 85 |
| 145 | 3300049587 | Ga0501071_0069646 | Ga0501071_0069646_1966_2223 | 85 |
| 146 | 3300049587 | Ga0501071_0431610 | Ga0501071_0431610_205_462 | 85 |
| 147 | 3300049588 | Ga0501072_0012132 | Ga0501072_0012132_2208_2465 | 85 |
| 148 | 3300049588 | Ga0501072_0012597 | Ga0501072_0012597_5572_5829 | 85 |
| 149 | 3300049589 | Ga0501073_0175068 | Ga0501073_0175068_516_773 | 85 |
| 150 | 3300049589 | Ga0501073_0820955 | Ga0501073_0820955_200_457 | 85 |
| 151 | 3300049590 | Ga0501074_0049116 | Ga0501074_0049116_807_1064 | 85 |
| 152 | 3300049590 | Ga0501074_0073437 | Ga0501074_0073437_67_324 | 85 |
| 153 | 3300049590 | Ga0501074_1177059 | Ga0501074_1177059_248_505 | 85 |
| 154 | 3300049591 | Ga0501075_0001216 | Ga0501075_0001216_10217_10474 | 85 |
| 155 | 3300049591 | Ga0501075_0076770 | Ga0501075_0076770_1172_1429 | 85 |
| 156 | 3300049591 | Ga0501075_0575092 | Ga0501075_0575092_100_357 | 85 |
| 157 | 3300049592 | Ga0501076_0006804 | Ga0501076_0006804_7216_7473 | 85 |
| 158 | 3300049592 | Ga0501076_0155282 | Ga0501076_0155282_1059_1316 | 85 |
| 159 | 3300049592 | Ga0501076_0621292 | Ga0501076_0621292_517_774 | 85 |
| 160 | 3300049593 | Ga0501077_0010223 | Ga0501077_0010223_1998_2255 | 85 |
| 161 | 3300049741 | Ga0501079_0002187 | Ga0501079_0002187_2593_2850 | 85 |
| 162 | 3300049741 | Ga0501079_0121281 | Ga0501079_0121281_1646_1903 | 85 |
| 163 | 3300049741 | Ga0501079_0268996 | Ga0501079_0268996_717_974 | 85 |
| 164 | 3300049741 | Ga0501079_0962770 | Ga0501079_0962770_44_301 | 85 |
| 165 | 3300049742 | Ga0501080_0003675 | Ga0501080_0003675_3722_3979 | 85 |
| 166 | 3300049742 | Ga0501080_0110143 | Ga0501080_0110143_1946_2203 | 85 |
| 167 | 3300049742 | Ga0501080_0191856 | Ga0501080_0191856_1231_1488 | 85 |
| 168 | 3300049743 | Ga0501081_0002620 | Ga0501081_0002620_10369_10626 | 85 |
| 169 | 3300049743 | Ga0501081_0075009 | Ga0501081_0075009_282_539 | 85 |
| 170 | 3300049743 | Ga0501081_0133482 | Ga0501081_0133482_1138_1395 | 85 |
| 171 | 3300049743 | Ga0501081_0214930 | Ga0501081_0214930_666_923 | 85 |
| 172 | 3300049743 | Ga0501081_0472939 | Ga0501081_0472939_662_919 | 85 |
| 173 | 3300049744 | Ga0501083_0052825 | Ga0501083_0052825_2040_2297 | 85 |
| 174 | 3300049744 | Ga0501083_0602568 | Ga0501083_0602568_206_463 | 85 |
| 175 | 3300049744 | Ga0501083_0906977 | Ga0501083_0906977_264_521 | 85 |
| 176 | 3300049822 | Ga0501035_0104697 | Ga0501035_0104697_1141_1398 | 85 |
| 177 | 3300049824 | Ga0501045_0002837 | Ga0501045_0002837_10657_10914 | 85 |
| 178 | 3300049824 | Ga0501045_0013189 | Ga0501045_0013189_4950_5207 | 85 |
| 179 | 3300050507 | nmdc:mga05p37_60382_c1 | nmdc:mga05p37_60382_c1_278_535 | 85 |
| 180 | 3300050508 | nmdc:mga09592_1644125_c1 | nmdc:mga09592_1644125_c1_145_402 | 85 |
| 181 | 3300050511 | nmdc:mga08y16_280438_c1 | nmdc:mga08y16_280438_c1_362_619 | 85 |
| 182 | 3300050511 | nmdc:mga08y16_65021_c1 | nmdc:mga08y16_65021_c1_915_1172 | 85 |
| 183 | 3300050512 | nmdc:mga0n895_16043_c1 | nmdc:mga0n895_16043_c1_4481_4738 | 85 |
| 184 | 3300050513 | nmdc:mga0rr50_820016_c1 | nmdc:mga0rr50_820016_c1_409_666 | 85 |
| 185 | 3300050515 | nmdc:mga0a205_9194_c1 | nmdc:mga0a205_9194_c1_7691_7948 | 85 |
| 186 | 3300054114 | Ga0501084_0000340 | Ga0501084_0000340_34408_34665 | 85 |
| 187 | 3300054114 | Ga0501084_0152613 | Ga0501084_0152613_145_402 | 85 |
| 188 | 3300054114 | Ga0501084_0994444 | Ga0501084_0994444_112_369 | 85 |
| 189 | 3300054114 | Ga0501084_1074353 | Ga0501084_1074353_88_345 | 85 |
| 190 | 3300060353 | Ga0501082_0003014 | Ga0501082_0003014_6521_6778 | 85 |
| 191 | 3300060353 | Ga0501082_0082975 | Ga0501082_0082975_470_727 | 85 |
| 192 | 3300060353 | Ga0501082_1257324 | Ga0501082_1257324_187_444 | 85 |
| 193 | 3300061734 | Ga0530510_0004076 | Ga0530510_0004076_7311_7568 | 85 |
| 194 | 3300061734 | Ga0530510_0026414 | Ga0530510_0026414_3345_3602 | 85 |
| 195 | 3300061734 | Ga0530510_0032714 | Ga0530510_0032714_3282_3539 | 85 |
| 196 | iso_pu_bacteria | 2574179768 | 2574431107 | 85 |
| 197 | 3300005841 | Ga0068863_101416778 | Ga0068863_1014167782 | 86 |
| 198 | 3300026088 | Ga0207641_11231562 | Ga0207641_112315622 | 86 |
| 199 | 3300028794 | Ga0307515_10114699 | Ga0307515_101146993 | 86 |
| 200 | 3300031665 | Ga0316575_10083908 | Ga0316575_100839082 | 86 |
| 201 | 3300041512 | Ga0451853_3495509 | Ga0451853_3495509_367_630 | 86 |
| 202 | 3300042876 | Ga0451577_0141707 | Ga0451577_0141707_870_1130 | 86 |
| 203 | 3300044673 | Ga0453683_0057997 | Ga0453683_0057997_873_1133 | 86 |
| 204 | 3300044712 | Ga0453684_0080604 | Ga0453684_0080604_1187_1447 | 86 |
| 205 | 3300045051 | Ga0451576_0087654 | Ga0451576_0087654_1618_1878 | 86 |
| 206 | 3300049583 | Ga0501067_0304048 | Ga0501067_0304048_404_664 | 86 |
| 207 | 3300053140 | Ga0500573_0320380 | Ga0500573_0320380_343_603 | 86 |
| 208 | 3300053153 | Ga0500616_0063191 | Ga0500616_0063191_1619_1879 | 86 |
| 209 | 3300005336 | Ga0070680_100220232 | Ga0070680_1002202323 | 87 |
| 210 | 3300005435 | Ga0070714_100046383 | Ga0070714_1000463835 | 87 |
| 211 | 3300005435 | Ga0070714_101205251 | Ga0070714_1012052511 | 87 |
| 212 | 3300005435 | Ga0070714_102235140 | Ga0070714_1022351401 | 87 |
| 213 | 3300005436 | Ga0070713_100651688 | Ga0070713_1006516881 | 87 |
| 214 | 3300005439 | Ga0070711_101392627 | Ga0070711_1013926272 | 87 |
| 215 | 3300005445 | Ga0070708_101143182 | Ga0070708_1011431822 | 87 |
| 216 | 3300005458 | Ga0070681_10155492 | Ga0070681_101554923 | 87 |
| 217 | 3300005518 | Ga0070699_100038047 | Ga0070699_1000380472 | 87 |
| 218 | 3300005536 | Ga0070697_101432463 | Ga0070697_1014324632 | 87 |
| 219 | 3300005545 | Ga0070695_100050009 | Ga0070695_1000500094 | 87 |
| 220 | 3300005546 | Ga0070696_100228535 | Ga0070696_1002285352 | 87 |
| 221 | 3300005614 | Ga0068856_101962575 | Ga0068856_1019625751 | 87 |
| 222 | 3300006028 | Ga0070717_10000760 | Ga0070717_100007604 | 87 |
| 223 | 3300006163 | Ga0070715_10136337 | Ga0070715_101363371 | 87 |
| 224 | 3300006173 | Ga0070716_100073753 | Ga0070716_1000737533 | 87 |
| 225 | 3300006173 | Ga0070716_100261823 | Ga0070716_1002618232 | 87 |
| 226 | 3300006173 | Ga0070716_100296973 | Ga0070716_1002969732 | 87 |
| 227 | 3300006175 | Ga0070712_100195131 | Ga0070712_1001951311 | 87 |
| 228 | 3300006175 | Ga0070712_100608330 | Ga0070712_1006083302 | 87 |
| 229 | 3300006846 | Ga0075430_100303868 | Ga0075430_1003038682 | 87 |
| 230 | 3300006871 | Ga0075434_100190538 | Ga0075434_1001905382 | 87 |
| 231 | 3300006914 | Ga0075436_100064140 | Ga0075436_1000641402 | 87 |
| 232 | 3300007076 | Ga0075435_100078594 | Ga0075435_1000785944 | 87 |
| 233 | 3300007265 | Ga0099794_10107726 | Ga0099794_101077262 | 87 |
| 234 | 3300010159 | Ga0099796_10004720 | Ga0099796_100047205 | 87 |
| 235 | 3300013306 | Ga0163162_13353181 | Ga0163162_133531811 | 87 |
| 236 | 3300021358 | Ga0213873_10120672 | Ga0213873_101206721 | 87 |
| 237 | 3300021377 | Ga0213874_10029286 | Ga0213874_100292863 | 87 |
| 238 | 3300021441 | Ga0213871_10033535 | Ga0213871_100335352 | 87 |
| 239 | 3300021441 | Ga0213871_10074139 | Ga0213871_100741391 | 87 |
| 240 | 3300025905 | Ga0207685_10206128 | Ga0207685_102061282 | 87 |
| 241 | 3300025905 | Ga0207685_10710040 | Ga0207685_107100402 | 87 |
| 242 | 3300025906 | Ga0207699_10040830 | Ga0207699_100408301 | 87 |
| 243 | 3300025912 | Ga0207707_10030748 | Ga0207707_100307485 | 87 |
| 244 | 3300025915 | Ga0207693_10105161 | Ga0207693_101051612 | 87 |
| 245 | 3300025915 | Ga0207693_10140040 | Ga0207693_101400402 | 87 |
| 246 | 3300025915 | Ga0207693_10410367 | Ga0207693_104103672 | 87 |
| 247 | 3300025916 | Ga0207663_10193450 | Ga0207663_101934502 | 87 |
| 248 | 3300025916 | Ga0207663_10966220 | Ga0207663_109662202 | 87 |
| 249 | 3300025917 | Ga0207660_10238606 | Ga0207660_102386062 | 87 |
| 250 | 3300025928 | Ga0207700_10333694 | Ga0207700_103336942 | 87 |
| 251 | 3300025928 | Ga0207700_10798771 | Ga0207700_107987711 | 87 |
| 252 | 3300025929 | Ga0207664_10011864 | Ga0207664_100118645 | 87 |
| 253 | 3300025939 | Ga0207665_10165087 | Ga0207665_101650872 | 87 |
| 254 | 3300025939 | Ga0207665_10228444 | Ga0207665_102284442 | 87 |
| 255 | 3300025939 | Ga0207665_11494269 | Ga0207665_114942692 | 87 |
| 256 | 3300026078 | Ga0207702_11614864 | Ga0207702_116148641 | 87 |
| 257 | 3300028794 | Ga0307515_10382947 | Ga0307515_103829472 | 87 |
| 258 | 3300028800 | Ga0265338_10187301 | Ga0265338_101873012 | 87 |
| 259 | 3300030763 | Ga0265763_1001427 | Ga0265763_10014272 | 87 |
| 260 | 3300030963 | Ga0265768_112292 | Ga0265768_1122922 | 87 |
| 261 | 3300031456 | Ga0307513_10413620 | Ga0307513_104136202 | 87 |
| 262 | 3300031595 | Ga0265313_10257489 | Ga0265313_102574891 | 87 |
| 263 | 3300035172 | Ga0373955_0056144 | Ga0373955_0056144_1535_1798 | 87 |
| 264 | 3300036401 | Ga0373937_0041733 | Ga0373937_0041733_3099_3362 | 87 |
| 265 | 3300037853 | Ga0436364_0477485 | Ga0436364_0477485_324_587 | 87 |
| 266 | 3300039438 | Ga0436360_0086470 | Ga0436360_0086470_195_458 | 87 |
| 267 | 3300039438 | Ga0436360_0766596 | Ga0436360_0766596_15450_15713 | 87 |
| 268 | 3300039438 | Ga0436360_0831083 | Ga0436360_0831083_945_1208 | 87 |
| 269 | 3300039438 | Ga0436360_0970001 | Ga0436360_0970001_464_727 | 87 |
| 270 | 3300039447 | Ga0436361_0477235 | Ga0436361_0477235_165_428 | 87 |
| 271 | 3300039447 | Ga0436361_0501117 | Ga0436361_0501117_346_609 | 87 |
| 272 | 3300039447 | Ga0436361_0654178 | Ga0436361_0654178_810_1073 | 87 |
| 273 | 3300039447 | Ga0436361_1160407 | Ga0436361_1160407_781_1044 | 87 |
| 274 | 3300039450 | Ga0436363_0045740 | Ga0436363_0045740_596_859 | 87 |
| 275 | 3300039450 | Ga0436363_0237012 | Ga0436363_0237012_70_333 | 87 |
| 276 | 3300039450 | Ga0436363_0868312 | Ga0436363_0868312_22_285 | 87 |
| 277 | 3300039453 | Ga0436362_0063292 | Ga0436362_0063292_147_410 | 87 |
| 278 | 3300039453 | Ga0436362_0075590 | Ga0436362_0075590_999_1262 | 87 |
| 279 | 3300039453 | Ga0436362_0340884 | Ga0436362_0340884_399_662 | 87 |
| 280 | 3300039453 | Ga0436362_0828451 | Ga0436362_0828451_444_707 | 87 |
| 281 | 3300039453 | Ga0436362_0907425 | Ga0436362_0907425_136_399 | 87 |
| 282 | 3300042876 | Ga0451577_0989231 | Ga0451577_0989231_303_575 | 87 |
| 283 | 3300044656 | Ga0466969_0031684 | Ga0466969_0031684_210_473 | 87 |
| 284 | 3300044673 | Ga0453683_0086552 | Ga0453683_0086552_64_336 | 87 |
| 285 | 3300044712 | Ga0453684_0511371 | Ga0453684_0511371_1019_1291 | 87 |
| 286 | 3300044712 | Ga0453684_0878115 | Ga0453684_0878115_641_913 | 87 |
| 287 | 3300044712 | Ga0453684_2259650 | Ga0453684_2259650_240_512 | 87 |
| 288 | 3300045051 | Ga0451576_0000046 | Ga0451576_0000046_140835_141107 | 87 |
| 289 | 3300045051 | Ga0451576_0015026 | Ga0451576_0015026_3304_3576 | 87 |
| 290 | 3300046516 | Ga0495628_1103804 | Ga0495628_1103804_95_358 | 87 |
| 291 | 3300046519 | Ga0495632_0212921 | Ga0495632_0212921_205_468 | 87 |
| 292 | 3300046543 | Ga0495645_0376363 | Ga0495645_0376363_51_314 | 87 |
| 293 | 3300046679 | Ga0495623_0155348 | Ga0495623_0155348_484_747 | 87 |
| 294 | 3300046679 | Ga0495623_0510091 | Ga0495623_0510091_41_304 | 87 |
| 295 | 3300046809 | Ga0495600_0825357 | Ga0495600_0825357_249_512 | 87 |
| 296 | 3300047317 | Ga0495604_0175094 | Ga0495604_0175094_1174_1437 | 87 |
| 297 | 3300048088 | Ga0495602_0341522 | Ga0495602_0341522_426_689 | 87 |
| 298 | 3300048905 | Ga0496102_1260356 | Ga0496102_1260356_318_581 | 87 |
| 299 | 3300048907 | Ga0496104_0556064 | Ga0496104_0556064_503_766 | 87 |
| 300 | 3300048907 | Ga0496104_1595494 | Ga0496104_1595494_190_453 | 87 |
| 301 | 3300048908 | Ga0496105_0280070 | Ga0496105_0280070_772_1035 | 87 |
| 302 | 3300048909 | Ga0496106_0651137 | Ga0496106_0651137_407_670 | 87 |
| 303 | 3300048916 | Ga0496113_0499499 | Ga0496113_0499499_595_858 | 87 |
| 304 | 3300049575 | Ga0501039_0189216 | Ga0501039_0189216_1257_1520 | 87 |
| 305 | 3300050509 | nmdc:mga0qj67_384617_c1 | nmdc:mga0qj67_384617_c1_358_621 | 87 |
| 306 | 3300050512 | nmdc:mga0n895_141969_c1 | nmdc:mga0n895_141969_c1_1698_1961 | 87 |
| 307 | 3300050513 | nmdc:mga0rr50_358444_c1 | nmdc:mga0rr50_358444_c1_434_697 | 87 |
| 308 | 3300053078 | Ga0495612_0032435 | Ga0495612_0032435_866_1129 | 87 |
| 309 | 3300053078 | Ga0495612_0161196 | Ga0495612_0161196_674_937 | 87 |
| 310 | 3300053090 | Ga0500646_0154254 | Ga0500646_0154254_383_646 | 87 |
| 311 | 3300053092 | Ga0500583_0004150 | Ga0500583_0004150_837_1100 | 87 |
| 312 | 3300053096 | Ga0500641_0007963 | Ga0500641_0007963_3458_3721 | 87 |
| 313 | 3300053100 | Ga0500660_097501 | Ga0500660_097501_560_823 | 87 |
| 314 | 3300053109 | Ga0500569_290496 | Ga0500569_290496_167_430 | 87 |
| 315 | 3300053131 | Ga0500652_124533 | Ga0500652_124533_327_590 | 87 |
| 316 | 3300005355 | Ga0070671_100001600 | Ga0070671_1000016008 | 88 |
| 317 | 3300005365 | Ga0070688_100127686 | Ga0070688_1001276862 | 88 |
| 318 | 3300005544 | Ga0070686_100465269 | Ga0070686_1004652692 | 88 |
| 319 | 3300005841 | Ga0068863_100850934 | Ga0068863_1008509342 | 88 |
| 320 | 3300009176 | Ga0105242_10866816 | Ga0105242_108668162 | 88 |
| 321 | 3300013297 | Ga0157378_12612424 | Ga0157378_126124241 | 88 |
| 322 | 3300025901 | Ga0207688_10441734 | Ga0207688_104417341 | 88 |
| 323 | 3300025903 | Ga0207680_10980035 | Ga0207680_109800352 | 88 |
| 324 | 3300025916 | Ga0207663_10453555 | Ga0207663_104535551 | 88 |
| 325 | 3300025918 | Ga0207662_10353526 | Ga0207662_103535261 | 88 |
| 326 | 3300025931 | Ga0207644_10001117 | Ga0207644_1000111711 | 88 |
| 327 | 3300025934 | Ga0207686_10721576 | Ga0207686_107215762 | 88 |
| 328 | 3300026088 | Ga0207641_10221982 | Ga0207641_102219822 | 88 |
| 329 | 3300044712 | Ga0453684_0350059 | Ga0453684_0350059_1085_1360 | 88 |
| 330 | 3300053093 | Ga0500651_0057949 | Ga0500651_0057949_958_1224 | 88 |
| 331 | 3300005334 | Ga0068869_100953051 | Ga0068869_1009530512 | 89 |
| 332 | 3300005335 | Ga0070666_10060735 | Ga0070666_100607353 | 89 |
| 333 | 3300005338 | Ga0068868_100113483 | Ga0068868_1001134831 | 89 |
| 334 | 3300005355 | Ga0070671_100045856 | Ga0070671_1000458561 | 89 |
| 335 | 3300005364 | Ga0070673_100002156 | Ga0070673_1000021568 | 89 |
| 336 | 3300005367 | Ga0070667_100065881 | Ga0070667_1000658811 | 89 |
| 337 | 3300005434 | Ga0070709_10004940 | Ga0070709_100049401 | 89 |
| 338 | 3300005436 | Ga0070713_100006790 | Ga0070713_1000067906 | 89 |
| 339 | 3300005437 | Ga0070710_10003950 | Ga0070710_100039503 | 89 |
| 340 | 3300005439 | Ga0070711_100010223 | Ga0070711_1000102235 | 89 |
| 341 | 3300005440 | Ga0070705_100032801 | Ga0070705_1000328012 | 89 |
| 342 | 3300005456 | Ga0070678_100003428 | Ga0070678_1000034283 | 89 |
| 343 | 3300005459 | Ga0068867_101518976 | Ga0068867_1015189761 | 89 |
| 344 | 3300005543 | Ga0070672_100903479 | Ga0070672_1009034792 | 89 |
| 345 | 3300005544 | Ga0070686_100526673 | Ga0070686_1005266732 | 89 |
| 346 | 3300005545 | Ga0070695_100087477 | Ga0070695_1000874772 | 89 |
| 347 | 3300005546 | Ga0070696_100510005 | Ga0070696_1005100052 | 89 |
| 348 | 3300005548 | Ga0070665_100004871 | Ga0070665_10000487110 | 89 |
| 349 | 3300005563 | Ga0068855_100453038 | Ga0068855_1004530383 | 89 |
| 350 | 3300005614 | Ga0068856_100011130 | Ga0068856_1000111307 | 89 |
| 351 | 3300005617 | Ga0068859_100304358 | Ga0068859_1003043583 | 89 |
| 352 | 3300005718 | Ga0068866_10011986 | Ga0068866_100119862 | 89 |
| 353 | 3300005841 | Ga0068863_100024954 | Ga0068863_1000249545 | 89 |
| 354 | 3300005842 | Ga0068858_100055111 | Ga0068858_1000551112 | 89 |
| 355 | 3300005843 | Ga0068860_100011176 | Ga0068860_1000111763 | 89 |
| 356 | 3300006163 | Ga0070715_10002439 | Ga0070715_100024397 | 89 |
| 357 | 3300006173 | Ga0070716_100005892 | Ga0070716_1000058926 | 89 |
| 358 | 3300006175 | Ga0070712_100030975 | Ga0070712_1000309751 | 89 |
| 359 | 3300006237 | Ga0097621_100040451 | Ga0097621_1000404513 | 89 |
| 360 | 3300006358 | Ga0068871_100004650 | Ga0068871_1000046506 | 89 |
| 361 | 3300006931 | Ga0097620_100304362 | Ga0097620_1003043622 | 89 |
| 362 | 3300009011 | Ga0105251_10463151 | Ga0105251_104631512 | 89 |
| 363 | 3300009098 | Ga0105245_10016229 | Ga0105245_100162295 | 89 |
| 364 | 3300009101 | Ga0105247_10015518 | Ga0105247_100155183 | 89 |
| 365 | 3300009177 | Ga0105248_10025370 | Ga0105248_100253706 | 89 |
| 366 | 3300009545 | Ga0105237_10739728 | Ga0105237_107397281 | 89 |
| 367 | 3300009551 | Ga0105238_12482647 | Ga0105238_124826472 | 89 |
| 368 | 3300009553 | Ga0105249_10274888 | Ga0105249_102748883 | 89 |
| 369 | 3300010375 | Ga0105239_10041139 | Ga0105239_100411394 | 89 |
| 370 | 3300013296 | Ga0157374_10063599 | Ga0157374_100635993 | 89 |
| 371 | 3300013297 | Ga0157378_10004170 | Ga0157378_100041707 | 89 |
| 372 | 3300013306 | Ga0163162_10067993 | Ga0163162_100679932 | 89 |
| 373 | 3300013307 | Ga0157372_10851934 | Ga0157372_108519342 | 89 |
| 374 | 3300013308 | Ga0157375_10065112 | Ga0157375_100651125 | 89 |
| 375 | 3300014968 | Ga0157379_10043135 | Ga0157379_100431353 | 89 |
| 376 | 3300014969 | Ga0157376_10067583 | Ga0157376_100675832 | 89 |
| 377 | 3300017792 | Ga0163161_11523473 | Ga0163161_115234731 | 89 |
| 378 | 3300021358 | Ga0213873_10012196 | Ga0213873_100121962 | 89 |
| 379 | 3300021377 | Ga0213874_10005551 | Ga0213874_100055512 | 89 |
| 380 | 3300024227 | Ga0228598_1039800 | Ga0228598_10398001 | 89 |
| 381 | 3300025898 | Ga0207692_10009224 | Ga0207692_100092243 | 89 |
| 382 | 3300025899 | Ga0207642_10106921 | Ga0207642_101069212 | 89 |
| 383 | 3300025900 | Ga0207710_10556803 | Ga0207710_105568032 | 89 |
| 384 | 3300025903 | Ga0207680_10229957 | Ga0207680_102299572 | 89 |
| 385 | 3300025905 | Ga0207685_10102133 | Ga0207685_101021333 | 89 |
| 386 | 3300025906 | Ga0207699_10094159 | Ga0207699_100941592 | 89 |
| 387 | 3300025915 | Ga0207693_10001234 | Ga0207693_1000123413 | 89 |
| 388 | 3300025916 | Ga0207663_10006531 | Ga0207663_100065318 | 89 |
| 389 | 3300025927 | Ga0207687_10060791 | Ga0207687_100607912 | 89 |
| 390 | 3300025928 | Ga0207700_10194355 | Ga0207700_101943553 | 89 |
| 391 | 3300025929 | Ga0207664_10578554 | Ga0207664_105785541 | 89 |
| 392 | 3300025931 | Ga0207644_10015950 | Ga0207644_100159504 | 89 |
| 393 | 3300025938 | Ga0207704_10720892 | Ga0207704_107208922 | 89 |
| 394 | 3300025939 | Ga0207665_10004448 | Ga0207665_100044486 | 89 |
| 395 | 3300025941 | Ga0207711_10119829 | Ga0207711_101198294 | 89 |
| 396 | 3300025942 | Ga0207689_10850800 | Ga0207689_108508002 | 89 |
| 397 | 3300025949 | Ga0207667_10367869 | Ga0207667_103678692 | 89 |
| 398 | 3300025960 | Ga0207651_10051352 | Ga0207651_100513522 | 89 |
| 399 | 3300025986 | Ga0207658_10040613 | Ga0207658_100406132 | 89 |
| 400 | 3300026023 | Ga0207677_11313773 | Ga0207677_113137731 | 89 |
| 401 | 3300026035 | Ga0207703_10143532 | Ga0207703_101435321 | 89 |
| 402 | 3300026078 | Ga0207702_10175164 | Ga0207702_101751641 | 89 |
| 403 | 3300026088 | Ga0207641_10575778 | Ga0207641_105757782 | 89 |
| 404 | 3300026089 | Ga0207648_10161837 | Ga0207648_101618372 | 89 |
| 405 | 3300026095 | Ga0207676_10247113 | Ga0207676_102471131 | 89 |
| 406 | 3300026121 | Ga0207683_10012302 | Ga0207683_100123026 | 89 |
| 407 | 3300028379 | Ga0268266_10347935 | Ga0268266_103479352 | 89 |
| 408 | 3300028381 | Ga0268264_10584281 | Ga0268264_105842811 | 89 |
| 409 | 3300030732 | Ga0316176_1176152 | Ga0316176_11761522 | 89 |
| 410 | 3300031824 | Ga0307413_10966564 | Ga0307413_109665643 | 89 |
| 411 | 3300031852 | Ga0307410_11136746 | Ga0307410_111367462 | 89 |
| 412 | 3300031903 | Ga0307407_10139544 | Ga0307407_101395442 | 89 |
| 413 | 3300032126 | Ga0307415_100590832 | Ga0307415_1005908322 | 89 |
| 414 | 3300035116 | Ga0373945_0041352 | Ga0373945_0041352_199_468 | 89 |
| 415 | 3300035118 | Ga0373954_0012268 | Ga0373954_0012268_1833_2102 | 89 |
| 416 | 3300035119 | Ga0373956_0030548 | Ga0373956_0030548_1737_2006 | 89 |
| 417 | 3300035170 | Ga0373943_0064800 | Ga0373943_0064800_478_747 | 89 |
| 418 | 3300035171 | Ga0373946_0098183 | Ga0373946_0098183_286_555 | 89 |
| 419 | 3300035172 | Ga0373955_0207351 | Ga0373955_0207351_692_961 | 89 |
| 420 | 3300035692 | Ga0373935_0800188 | Ga0373935_0800188_406_675 | 89 |
| 421 | 3300035695 | Ga0373927_0030967 | Ga0373927_0030967_740_1009 | 89 |
| 422 | 3300035724 | Ga0373933_0322529 | Ga0373933_0322529_35_304 | 89 |
| 423 | 3300036401 | Ga0373937_0217963 | Ga0373937_0217963_348_617 | 89 |
| 424 | 3300037068 | Ga0373925_0092039 | Ga0373925_0092039_115_384 | 89 |
| 425 | 3300037068 | Ga0373925_0122502 | Ga0373925_0122502_1621_1890 | 89 |
| 426 | 3300039437 | Ga0436365_0942025 | Ga0436365_0942025_2932_3201 | 89 |
| 427 | 3300039437 | Ga0436365_1109929 | Ga0436365_1109929_181_450 | 89 |
| 428 | 3300039437 | Ga0436365_1346489 | Ga0436365_1346489_152_421 | 89 |
| 429 | 3300039450 | Ga0436363_0269421 | Ga0436363_0269421_42_311 | 89 |
| 430 | 3300039450 | Ga0436363_1492427 | Ga0436363_1492427_1507_1776 | 89 |
| 431 | 3300039453 | Ga0436362_0734099 | Ga0436362_0734099_1702_1971 | 89 |
| 432 | 3300046472 | Ga0495580_0349641 | Ga0495580_0349641_149_418 | 89 |
| 433 | 3300046473 | Ga0495582_0113293 | Ga0495582_0113293_754_1023 | 89 |
| 434 | 3300046477 | Ga0495664_0264049 | Ga0495664_0264049_481_750 | 89 |
| 435 | 3300046511 | Ga0495608_0481137 | Ga0495608_0481137_101_370 | 89 |
| 436 | 3300046514 | Ga0495618_0071963 | Ga0495618_0071963_1603_1872 | 89 |
| 437 | 3300046517 | Ga0495630_0067544 | Ga0495630_0067544_2374_2643 | 89 |
| 438 | 3300046531 | Ga0495665_0701489 | Ga0495665_0701489_199_468 | 89 |
| 439 | 3300046675 | Ga0495657_0271591 | Ga0495657_0271591_254_523 | 89 |
| 440 | 3300046681 | Ga0495647_0413604 | Ga0495647_0413604_334_603 | 89 |
| 441 | 3300046683 | Ga0495658_0509556 | Ga0495658_0509556_465_734 | 89 |
| 442 | 3300048903 | Ga0496100_0053077 | Ga0496100_0053077_572_841 | 89 |
| 443 | 3300048904 | Ga0496101_0182911 | Ga0496101_0182911_1331_1600 | 89 |
| 444 | 3300048906 | Ga0496103_0090911 | Ga0496103_0090911_196_465 | 89 |
| 445 | 3300048907 | Ga0496104_0081925 | Ga0496104_0081925_1354_1623 | 89 |
| 446 | 3300048908 | Ga0496105_0009915 | Ga0496105_0009915_1729_1998 | 89 |
| 447 | 3300048909 | Ga0496106_0014237 | Ga0496106_0014237_2595_2864 | 89 |
| 448 | 3300048910 | Ga0496107_0073989 | Ga0496107_0073989_1660_1929 | 89 |
| 449 | 3300048911 | Ga0496108_0060411 | Ga0496108_0060411_2611_2880 | 89 |
| 450 | 3300048912 | Ga0496109_0008587 | Ga0496109_0008587_1916_2185 | 89 |
| 451 | 3300048913 | Ga0496110_0003769 | Ga0496110_0003769_3035_3304 | 89 |
| 452 | 3300048914 | Ga0496111_0019260 | Ga0496111_0019260_2518_2787 | 89 |
| 453 | 3300048915 | Ga0496112_0031109 | Ga0496112_0031109_2291_2560 | 89 |
| 454 | 3300048916 | Ga0496113_0114120 | Ga0496113_0114120_1727_1996 | 89 |
| 455 | 3300048917 | Ga0496114_0005168 | Ga0496114_0005168_5809_6078 | 89 |
| 456 | 3300049528 | Ga0501312_035006 | Ga0501312_035006_396_668 | 89 |
| 457 | 3300049577 | Ga0501041_0610760 | Ga0501041_0610760_363_632 | 89 |
| 458 | 3300049588 | Ga0501072_1557609 | Ga0501072_1557609_64_333 | 89 |
| 459 | 3300050513 | nmdc:mga0rr50_1748325_c1 | nmdc:mga0rr50_1748325_c1_237_506 | 89 |
| 460 | 3300005327 | Ga0070658_11074880 | Ga0070658_110748802 | 90 |
| 461 | 3300005344 | Ga0070661_100286571 | Ga0070661_1002865712 | 90 |
| 462 | 3300005618 | Ga0068864_100357428 | Ga0068864_1003574282 | 90 |
| 463 | 3300005844 | Ga0068862_100100277 | Ga0068862_1001002772 | 90 |
| 464 | 3300009093 | Ga0105240_10055791 | Ga0105240_100557914 | 90 |
| 465 | 3300009093 | Ga0105240_10104214 | Ga0105240_101042145 | 90 |
| 466 | 3300009545 | Ga0105237_11964051 | Ga0105237_119640511 | 90 |
| 467 | 3300009551 | Ga0105238_10509300 | Ga0105238_105093002 | 90 |
| 468 | 3300009553 | Ga0105249_10467819 | Ga0105249_104678192 | 90 |
| 469 | 3300014325 | Ga0163163_10297117 | Ga0163163_102971172 | 90 |
| 470 | 3300014968 | Ga0157379_10893019 | Ga0157379_108930192 | 90 |
| 471 | 3300025909 | Ga0207705_10845286 | Ga0207705_108452862 | 90 |
| 472 | 3300025913 | Ga0207695_10082369 | Ga0207695_100823692 | 90 |
| 473 | 3300025913 | Ga0207695_10209268 | Ga0207695_102092683 | 90 |
| 474 | 3300025920 | Ga0207649_10613714 | Ga0207649_106137142 | 90 |
| 475 | 3300025924 | Ga0207694_10820205 | Ga0207694_108202052 | 90 |
| 476 | 3300025961 | Ga0207712_10330185 | Ga0207712_103301852 | 90 |
| 477 | 3300028379 | Ga0268266_10024405 | Ga0268266_100244053 | 90 |
| 478 | 3300028380 | Ga0268265_10141141 | Ga0268265_101411413 | 90 |
| 479 | 3300044693 | Ga0466961_0114113 | Ga0466961_0114113_1384_1659 | 90 |
| 480 | 3300044712 | Ga0453684_0038649 | Ga0453684_0038649_288_560 | 90 |
| 481 | 3300045049 | Ga0466959_0296220 | Ga0466959_0296220_52_327 | 90 |
| 482 | 3300048926 | Ga0496123_0319298 | Ga0496123_0319298_56_343 | 90 |
| 483 | 3300005334 | Ga0068869_101539412 | Ga0068869_1015394121 | 91 |
| 484 | 3300005337 | Ga0070682_101363353 | Ga0070682_1013633532 | 91 |
| 485 | 3300005338 | Ga0068868_101961260 | Ga0068868_1019612601 | 91 |
| 486 | 3300005345 | Ga0070692_10713532 | Ga0070692_107135321 | 91 |
| 487 | 3300005355 | Ga0070671_100260477 | Ga0070671_1002604773 | 91 |
| 488 | 3300005457 | Ga0070662_100352551 | Ga0070662_1003525511 | 91 |
| 489 | 3300005530 | Ga0070679_100363692 | Ga0070679_1003636921 | 91 |
| 490 | 3300005536 | Ga0070697_101008717 | Ga0070697_1010087172 | 91 |
| 491 | 3300005549 | Ga0070704_100055374 | Ga0070704_1000553742 | 91 |
| 492 | 3300005578 | Ga0068854_101068171 | Ga0068854_1010681712 | 91 |
| 493 | 3300006852 | Ga0075433_10341105 | Ga0075433_103411052 | 91 |
| 494 | 3300007076 | Ga0075435_101598602 | Ga0075435_1015986022 | 91 |
| 495 | 3300009147 | Ga0114129_10277066 | Ga0114129_102770663 | 91 |
| 496 | 3300010375 | Ga0105239_10506505 | Ga0105239_105065052 | 91 |
| 497 | 3300013297 | Ga0157378_11972821 | Ga0157378_119728212 | 91 |
| 498 | 3300025917 | Ga0207660_11431983 | Ga0207660_114319832 | 91 |
| 499 | 3300025920 | Ga0207649_11373854 | Ga0207649_113738542 | 91 |
| 500 | 3300025921 | Ga0207652_11445557 | Ga0207652_114455572 | 91 |
| 501 | 3300025927 | Ga0207687_10270485 | Ga0207687_102704852 | 91 |
| 502 | 3300025932 | Ga0207690_11451859 | Ga0207690_114518592 | 91 |
| 503 | 3300025938 | Ga0207704_10529524 | Ga0207704_105295242 | 91 |
| 504 | 3300025981 | Ga0207640_10744126 | Ga0207640_107441262 | 91 |
| 505 | 3300026121 | Ga0207683_11219393 | Ga0207683_112193932 | 91 |
| 506 | 3300028800 | Ga0265338_10222478 | Ga0265338_102224782 | 91 |
| 507 | 3300031247 | Ga0265340_10021798 | Ga0265340_100217985 | 91 |
| 508 | 3300031247 | Ga0265340_10213596 | Ga0265340_102135961 | 91 |
| 509 | 3300048904 | Ga0496101_0734679 | Ga0496101_0734679_389_664 | 91 |
| 510 | 3300048905 | Ga0496102_0140257 | Ga0496102_0140257_1876_2151 | 91 |
| 511 | 3300048905 | Ga0496102_0146867 | Ga0496102_0146867_1899_2174 | 91 |
| 512 | 3300048909 | Ga0496106_0413952 | Ga0496106_0413952_719_994 | 91 |
| 513 | 3300048910 | Ga0496107_0288548 | Ga0496107_0288548_839_1114 | 91 |
| 514 | 3300048912 | Ga0496109_0276699 | Ga0496109_0276699_977_1252 | 91 |
| 515 | 3300048913 | Ga0496110_0558358 | Ga0496110_0558358_123_398 | 91 |
| 516 | 3300048914 | Ga0496111_0097004 | Ga0496111_0097004_371_646 | 91 |
| 517 | 3300048915 | Ga0496112_0081124 | Ga0496112_0081124_1063_1338 | 91 |
| 518 | 3300050507 | nmdc:mga05p37_335223_c1 | nmdc:mga05p37_335223_c1_1010_1285 | 91 |
| 519 | 3300050512 | nmdc:mga0n895_112570_c1 | nmdc:mga0n895_112570_c1_2058_2333 | 91 |
| 520 | 3300050513 | nmdc:mga0rr50_1356395_c1 | nmdc:mga0rr50_1356395_c1_208_483 | 91 |
| 521 | 3300050515 | nmdc:mga0a205_167973_c1 | nmdc:mga0a205_167973_c1_950_1225 | 91 |
| 522 | 3300060346 | Ga0587111_0226171 | Ga0587111_0226171_25_300 | 91 |
| 523 | 3300003322 | rootL2_10005201 | rootL2_100052015 | 92 |
| 524 | 3300004799 | Ga0058863_11557338 | Ga0058863_115573381 | 92 |
| 525 | 3300004800 | Ga0058861_10031889 | Ga0058861_100318891 | 92 |
| 526 | 3300004800 | Ga0058861_11881647 | Ga0058861_118816471 | 92 |
| 527 | 3300004803 | Ga0058862_12676565 | Ga0058862_126765651 | 92 |
| 528 | 3300005329 | Ga0070683_100071707 | Ga0070683_1000717073 | 92 |
| 529 | 3300005329 | Ga0070683_102110982 | Ga0070683_1021109821 | 92 |
| 530 | 3300005330 | Ga0070690_100073158 | Ga0070690_1000731584 | 92 |
| 531 | 3300005331 | Ga0070670_100093327 | Ga0070670_1000933274 | 92 |
| 532 | 3300005335 | Ga0070666_10003541 | Ga0070666_100035415 | 92 |
| 533 | 3300005335 | Ga0070666_10050030 | Ga0070666_100500302 | 92 |
| 534 | 3300005335 | Ga0070666_10229154 | Ga0070666_102291542 | 92 |
| 535 | 3300005336 | Ga0070680_100008953 | Ga0070680_10000895311 | 92 |
| 536 | 3300005336 | Ga0070680_100035650 | Ga0070680_1000356503 | 92 |
| 537 | 3300005339 | Ga0070660_100362854 | Ga0070660_1003628543 | 92 |
| 538 | 3300005340 | Ga0070689_100509167 | Ga0070689_1005091673 | 92 |
| 539 | 3300005341 | Ga0070691_10959208 | Ga0070691_109592081 | 92 |
| 540 | 3300005355 | Ga0070671_100000151 | Ga0070671_1000001514 | 92 |
| 541 | 3300005367 | Ga0070667_100006038 | Ga0070667_10000603810 | 92 |
| 542 | 3300005367 | Ga0070667_100144166 | Ga0070667_1001441663 | 92 |
| 543 | 3300005367 | Ga0070667_101153594 | Ga0070667_1011535942 | 92 |
| 544 | 3300005434 | Ga0070709_10133822 | Ga0070709_101338223 | 92 |
| 545 | 3300005435 | Ga0070714_100099986 | Ga0070714_1000999864 | 92 |
| 546 | 3300005435 | Ga0070714_100727071 | Ga0070714_1007270712 | 92 |
| 547 | 3300005439 | Ga0070711_101165513 | Ga0070711_1011655132 | 92 |
| 548 | 3300005455 | Ga0070663_100015011 | Ga0070663_1000150113 | 92 |
| 549 | 3300005458 | Ga0070681_10024301 | Ga0070681_100243015 | 92 |
| 550 | 3300005458 | Ga0070681_10064439 | Ga0070681_100644392 | 92 |
| 551 | 3300005466 | Ga0070685_10433325 | Ga0070685_104333252 | 92 |
| 552 | 3300005467 | Ga0070706_101457542 | Ga0070706_1014575421 | 92 |
| 553 | 3300005530 | Ga0070679_100088711 | Ga0070679_1000887113 | 92 |
| 554 | 3300005530 | Ga0070679_100153605 | Ga0070679_1001536053 | 92 |
| 555 | 3300005535 | Ga0070684_100097767 | Ga0070684_1000977672 | 92 |
| 556 | 3300005535 | Ga0070684_100235917 | Ga0070684_1002359172 | 92 |
| 557 | 3300005539 | Ga0068853_100120842 | Ga0068853_1001208422 | 92 |
| 558 | 3300005544 | Ga0070686_100006579 | Ga0070686_1000065795 | 92 |
| 559 | 3300005547 | Ga0070693_100268429 | Ga0070693_1002684291 | 92 |
| 560 | 3300005548 | Ga0070665_100003611 | Ga0070665_1000036116 | 92 |
| 561 | 3300005548 | Ga0070665_100013789 | Ga0070665_1000137894 | 92 |
| 562 | 3300005548 | Ga0070665_100083403 | Ga0070665_1000834034 | 92 |
| 563 | 3300005548 | Ga0070665_100207913 | Ga0070665_1002079132 | 92 |
| 564 | 3300005548 | Ga0070665_100995694 | Ga0070665_1009956943 | 92 |
| 565 | 3300005563 | Ga0068855_100002251 | Ga0068855_10000225118 | 92 |
| 566 | 3300005563 | Ga0068855_100194400 | Ga0068855_1001944004 | 92 |
| 567 | 3300005563 | Ga0068855_100317537 | Ga0068855_1003175373 | 92 |
| 568 | 3300005563 | Ga0068855_101059198 | Ga0068855_1010591981 | 92 |
| 569 | 3300005563 | Ga0068855_101750191 | Ga0068855_1017501911 | 92 |
| 570 | 3300005563 | Ga0068855_102276696 | Ga0068855_1022766962 | 92 |
| 571 | 3300005578 | Ga0068854_100625654 | Ga0068854_1006256541 | 92 |
| 572 | 3300005614 | Ga0068856_100504036 | Ga0068856_1005040361 | 92 |
| 573 | 3300005616 | Ga0068852_100169717 | Ga0068852_1001697173 | 92 |
| 574 | 3300005616 | Ga0068852_100404967 | Ga0068852_1004049673 | 92 |
| 575 | 3300005617 | Ga0068859_100002492 | Ga0068859_10000249215 | 92 |
| 576 | 3300005617 | Ga0068859_100112422 | Ga0068859_1001124224 | 92 |
| 577 | 3300005617 | Ga0068859_102192543 | Ga0068859_1021925432 | 92 |
| 578 | 3300005719 | Ga0068861_100201276 | Ga0068861_1002012762 | 92 |
| 579 | 3300005834 | Ga0068851_10494564 | Ga0068851_104945642 | 92 |
| 580 | 3300005841 | Ga0068863_100002637 | Ga0068863_10000263710 | 92 |
| 581 | 3300005841 | Ga0068863_100237934 | Ga0068863_1002379341 | 92 |
| 582 | 3300005842 | Ga0068858_100012257 | Ga0068858_1000122574 | 92 |
| 583 | 3300005842 | Ga0068858_100044008 | Ga0068858_1000440085 | 92 |
| 584 | 3300005842 | Ga0068858_100216347 | Ga0068858_1002163473 | 92 |
| 585 | 3300005842 | Ga0068858_100910989 | Ga0068858_1009109891 | 92 |
| 586 | 3300005842 | Ga0068858_102408880 | Ga0068858_1024088801 | 92 |
| 587 | 3300005843 | Ga0068860_100000086 | Ga0068860_10000008645 | 92 |
| 588 | 3300005843 | Ga0068860_101453660 | Ga0068860_1014536601 | 92 |
| 589 | 3300006237 | Ga0097621_100014033 | Ga0097621_1000140336 | 92 |
| 590 | 3300006237 | Ga0097621_100074563 | Ga0097621_1000745635 | 92 |
| 591 | 3300006358 | Ga0068871_100018250 | Ga0068871_1000182503 | 92 |
| 592 | 3300006358 | Ga0068871_100047768 | Ga0068871_1000477684 | 92 |
| 593 | 3300006931 | Ga0097620_100002492 | Ga0097620_1000024923 | 92 |
| 594 | 3300006931 | Ga0097620_100112429 | Ga0097620_1001124294 | 92 |
| 595 | 3300006931 | Ga0097620_102192567 | Ga0097620_1021925672 | 92 |
| 596 | 3300007788 | Ga0099795_10000002 | Ga0099795_1000000255 | 92 |
| 597 | 3300009092 | Ga0105250_10442685 | Ga0105250_104426852 | 92 |
| 598 | 3300009093 | Ga0105240_10004128 | Ga0105240_1000412816 | 92 |
| 599 | 3300009093 | Ga0105240_10014216 | Ga0105240_100142161 | 92 |
| 600 | 3300009093 | Ga0105240_10020430 | Ga0105240_100204306 | 92 |
| 601 | 3300009093 | Ga0105240_10039058 | Ga0105240_100390585 | 92 |
| 602 | 3300009093 | Ga0105240_10071345 | Ga0105240_100713452 | 92 |
| 603 | 3300009093 | Ga0105240_10135285 | Ga0105240_101352852 | 92 |
| 604 | 3300009093 | Ga0105240_10249099 | Ga0105240_102490991 | 92 |
| 605 | 3300009093 | Ga0105240_10986188 | Ga0105240_109861882 | 92 |
| 606 | 3300009093 | Ga0105240_11744292 | Ga0105240_117442921 | 92 |
| 607 | 3300009093 | Ga0105240_11884654 | Ga0105240_118846541 | 92 |
| 608 | 3300009098 | Ga0105245_10160655 | Ga0105245_101606553 | 92 |
| 609 | 3300009101 | Ga0105247_10000121 | Ga0105247_100001218 | 92 |
| 610 | 3300009101 | Ga0105247_10037501 | Ga0105247_100375012 | 92 |
| 611 | 3300009101 | Ga0105247_10970141 | Ga0105247_109701412 | 92 |
| 612 | 3300009174 | Ga0105241_10250646 | Ga0105241_102506463 | 92 |
| 613 | 3300009174 | Ga0105241_11932227 | Ga0105241_119322272 | 92 |
| 614 | 3300009177 | Ga0105248_10033582 | Ga0105248_100335825 | 92 |
| 615 | 3300009177 | Ga0105248_10139556 | Ga0105248_101395564 | 92 |
| 616 | 3300009545 | Ga0105237_10001548 | Ga0105237_100015485 | 92 |
| 617 | 3300009545 | Ga0105237_10046552 | Ga0105237_100465524 | 92 |
| 618 | 3300009545 | Ga0105237_10212733 | Ga0105237_102127332 | 92 |
| 619 | 3300009545 | Ga0105237_10293400 | Ga0105237_102934002 | 92 |
| 620 | 3300009545 | Ga0105237_11169003 | Ga0105237_111690031 | 92 |
| 621 | 3300009545 | Ga0105237_11216391 | Ga0105237_112163911 | 92 |
| 622 | 3300009551 | Ga0105238_10194161 | Ga0105238_101941613 | 92 |
| 623 | 3300009551 | Ga0105238_10478239 | Ga0105238_104782392 | 92 |
| 624 | 3300009551 | Ga0105238_10786385 | Ga0105238_107863852 | 92 |
| 625 | 3300009551 | Ga0105238_11096108 | Ga0105238_110961082 | 92 |
| 626 | 3300009553 | Ga0105249_10010844 | Ga0105249_100108445 | 92 |
| 627 | 3300009553 | Ga0105249_10698940 | Ga0105249_106989403 | 92 |
| 628 | 3300010159 | Ga0099796_10000017 | Ga0099796_1000001753 | 92 |
| 629 | 3300010159 | Ga0099796_10459602 | Ga0099796_104596022 | 92 |
| 630 | 3300010375 | Ga0105239_10466297 | Ga0105239_104662971 | 92 |
| 631 | 3300010375 | Ga0105239_10639967 | Ga0105239_106399672 | 92 |
| 632 | 3300010375 | Ga0105239_11658937 | Ga0105239_116589371 | 92 |
| 633 | 3300013100 | Ga0157373_10996329 | Ga0157373_109963292 | 92 |
| 634 | 3300013100 | Ga0157373_11321647 | Ga0157373_113216472 | 92 |
| 635 | 3300013104 | Ga0157370_10557273 | Ga0157370_105572732 | 92 |
| 636 | 3300013105 | Ga0157369_10037254 | Ga0157369_100372542 | 92 |
| 637 | 3300013105 | Ga0157369_10122452 | Ga0157369_101224524 | 92 |
| 638 | 3300013105 | Ga0157369_12056973 | Ga0157369_120569731 | 92 |
| 639 | 3300013105 | Ga0157369_12272717 | Ga0157369_122727171 | 92 |
| 640 | 3300013296 | Ga0157374_10738178 | Ga0157374_107381782 | 92 |
| 641 | 3300013296 | Ga0157374_10953483 | Ga0157374_109534832 | 92 |
| 642 | 3300013306 | Ga0163162_10028264 | Ga0163162_100282645 | 92 |
| 643 | 3300013306 | Ga0163162_10309660 | Ga0163162_103096602 | 92 |
| 644 | 3300013307 | Ga0157372_10783580 | Ga0157372_107835801 | 92 |
| 645 | 3300013307 | Ga0157372_12993832 | Ga0157372_129938321 | 92 |
| 646 | 3300014325 | Ga0163163_10166862 | Ga0163163_101668622 | 92 |
| 647 | 3300014325 | Ga0163163_10279514 | Ga0163163_102795142 | 92 |
| 648 | 3300014325 | Ga0163163_10339352 | Ga0163163_103393521 | 92 |
| 649 | 3300014325 | Ga0163163_10462976 | Ga0163163_104629762 | 92 |
| 650 | 3300014968 | Ga0157379_10007334 | Ga0157379_100073345 | 92 |
| 651 | 3300014968 | Ga0157379_10041003 | Ga0157379_100410033 | 92 |
| 652 | 3300014968 | Ga0157379_10204325 | Ga0157379_102043251 | 92 |
| 653 | 3300014968 | Ga0157379_10455890 | Ga0157379_104558901 | 92 |
| 654 | 3300014968 | Ga0157379_11833126 | Ga0157379_118331262 | 92 |
| 655 | 3300014968 | Ga0157379_12120780 | Ga0157379_121207802 | 92 |
| 656 | 3300014969 | Ga0157376_11139404 | Ga0157376_111394042 | 92 |
| 657 | 3300014969 | Ga0157376_11245656 | Ga0157376_112456562 | 92 |
| 658 | 3300020069 | Ga0197907_10713066 | Ga0197907_107130661 | 92 |
| 659 | 3300020070 | Ga0206356_10181451 | Ga0206356_101814512 | 92 |
| 660 | 3300020076 | Ga0206355_1308584 | Ga0206355_13085842 | 92 |
| 661 | 3300020076 | Ga0206355_1702270 | Ga0206355_17022702 | 92 |
| 662 | 3300020082 | Ga0206353_10959879 | Ga0206353_109598791 | 92 |
| 663 | 3300020082 | Ga0206353_11943938 | Ga0206353_119439381 | 92 |
| 664 | 3300021384 | Ga0213876_10069373 | Ga0213876_100693732 | 92 |
| 665 | 3300022467 | Ga0224712_10216531 | Ga0224712_102165312 | 92 |
| 666 | 3300022467 | Ga0224712_10400429 | Ga0224712_104004292 | 92 |
| 667 | 3300025321 | Ga0207656_10232823 | Ga0207656_102328231 | 92 |
| 668 | 3300025900 | Ga0207710_10000156 | Ga0207710_1000015657 | 92 |
| 669 | 3300025900 | Ga0207710_10029645 | Ga0207710_100296451 | 92 |
| 670 | 3300025903 | Ga0207680_10127325 | Ga0207680_101273253 | 92 |
| 671 | 3300025903 | Ga0207680_11058820 | Ga0207680_110588201 | 92 |
| 672 | 3300025906 | Ga0207699_10101861 | Ga0207699_101018612 | 92 |
| 673 | 3300025906 | Ga0207699_10472644 | Ga0207699_104726441 | 92 |
| 674 | 3300025911 | Ga0207654_10160065 | Ga0207654_101600653 | 92 |
| 675 | 3300025912 | Ga0207707_10063322 | Ga0207707_100633224 | 92 |
| 676 | 3300025912 | Ga0207707_10796962 | Ga0207707_107969622 | 92 |
| 677 | 3300025913 | Ga0207695_10023762 | Ga0207695_100237625 | 92 |
| 678 | 3300025913 | Ga0207695_10025453 | Ga0207695_100254539 | 92 |
| 679 | 3300025913 | Ga0207695_10069998 | Ga0207695_100699982 | 92 |
| 680 | 3300025913 | Ga0207695_10115487 | Ga0207695_101154874 | 92 |
| 681 | 3300025913 | Ga0207695_10232450 | Ga0207695_102324502 | 92 |
| 682 | 3300025914 | Ga0207671_10053442 | Ga0207671_100534422 | 92 |
| 683 | 3300025914 | Ga0207671_10112900 | Ga0207671_101129003 | 92 |
| 684 | 3300025914 | Ga0207671_10546284 | Ga0207671_105462842 | 92 |
| 685 | 3300025914 | Ga0207671_10575061 | Ga0207671_105750612 | 92 |
| 686 | 3300025916 | Ga0207663_10379568 | Ga0207663_103795682 | 92 |
| 687 | 3300025917 | Ga0207660_10148443 | Ga0207660_101484432 | 92 |
| 688 | 3300025917 | Ga0207660_11559893 | Ga0207660_115598931 | 92 |
| 689 | 3300025921 | Ga0207652_10144509 | Ga0207652_101445093 | 92 |
| 690 | 3300025921 | Ga0207652_10214999 | Ga0207652_102149991 | 92 |
| 691 | 3300025924 | Ga0207694_10146747 | Ga0207694_101467471 | 92 |
| 692 | 3300025924 | Ga0207694_10279351 | Ga0207694_102793512 | 92 |
| 693 | 3300025924 | Ga0207694_11681863 | Ga0207694_116818631 | 92 |
| 694 | 3300025925 | Ga0207650_10260539 | Ga0207650_102605392 | 92 |
| 695 | 3300025927 | Ga0207687_10411665 | Ga0207687_104116652 | 92 |
| 696 | 3300025929 | Ga0207664_10263658 | Ga0207664_102636582 | 92 |
| 697 | 3300025931 | Ga0207644_10003342 | Ga0207644_100033424 | 92 |
| 698 | 3300025931 | Ga0207644_10147761 | Ga0207644_101477612 | 92 |
| 699 | 3300025941 | Ga0207711_10062029 | Ga0207711_100620294 | 92 |
| 700 | 3300025941 | Ga0207711_10091677 | Ga0207711_100916772 | 92 |
| 701 | 3300025944 | Ga0207661_10035722 | Ga0207661_100357223 | 92 |
| 702 | 3300025945 | Ga0207679_10651199 | Ga0207679_106511992 | 92 |
| 703 | 3300025949 | Ga0207667_10007515 | Ga0207667_100075158 | 92 |
| 704 | 3300025949 | Ga0207667_10041325 | Ga0207667_100413255 | 92 |
| 705 | 3300025949 | Ga0207667_10235472 | Ga0207667_102354722 | 92 |
| 706 | 3300025949 | Ga0207667_10563922 | Ga0207667_105639222 | 92 |
| 707 | 3300025961 | Ga0207712_10340677 | Ga0207712_103406773 | 92 |
| 708 | 3300025981 | Ga0207640_10609488 | Ga0207640_106094882 | 92 |
| 709 | 3300025986 | Ga0207658_10009137 | Ga0207658_100091375 | 92 |
| 710 | 3300025986 | Ga0207658_10072403 | Ga0207658_100724033 | 92 |
| 711 | 3300025986 | Ga0207658_10364093 | Ga0207658_103640933 | 92 |
| 712 | 3300025986 | Ga0207658_10485839 | Ga0207658_104858391 | 92 |
| 713 | 3300026035 | Ga0207703_10001045 | Ga0207703_1000104517 | 92 |
| 714 | 3300026035 | Ga0207703_10006750 | Ga0207703_100067505 | 92 |
| 715 | 3300026035 | Ga0207703_10159232 | Ga0207703_101592323 | 92 |
| 716 | 3300026035 | Ga0207703_10635699 | Ga0207703_106356992 | 92 |
| 717 | 3300026035 | Ga0207703_12295672 | Ga0207703_122956721 | 92 |
| 718 | 3300026041 | Ga0207639_10405368 | Ga0207639_104053683 | 92 |
| 719 | 3300026041 | Ga0207639_10863439 | Ga0207639_108634392 | 92 |
| 720 | 3300026067 | Ga0207678_10008217 | Ga0207678_100082176 | 92 |
| 721 | 3300026078 | Ga0207702_10272412 | Ga0207702_102724122 | 92 |
| 722 | 3300026078 | Ga0207702_11415981 | Ga0207702_114159812 | 92 |
| 723 | 3300026088 | Ga0207641_10000411 | Ga0207641_1000041141 | 92 |
| 724 | 3300026088 | Ga0207641_10044965 | Ga0207641_100449652 | 92 |
| 725 | 3300026118 | Ga0207675_100344003 | Ga0207675_1003440033 | 92 |
| 726 | 3300026142 | Ga0207698_10250314 | Ga0207698_102503143 | 92 |
| 727 | 3300026142 | Ga0207698_11081785 | Ga0207698_110817851 | 92 |
| 728 | 3300027512 | Ga0209179_1000003 | Ga0209179_100000311 | 92 |
| 729 | 3300028379 | Ga0268266_10000891 | Ga0268266_1000089122 | 92 |
| 730 | 3300028379 | Ga0268266_10015611 | Ga0268266_100156117 | 92 |
| 731 | 3300028379 | Ga0268266_10150760 | Ga0268266_101507603 | 92 |
| 732 | 3300028379 | Ga0268266_10164591 | Ga0268266_101645912 | 92 |
| 733 | 3300028381 | Ga0268264_10000044 | Ga0268264_1000004440 | 92 |
| 734 | 3300028381 | Ga0268264_10011423 | Ga0268264_100114232 | 92 |
| 735 | 3300030521 | Ga0307511_10002869 | Ga0307511_1000286919 | 92 |
| 736 | 3300030521 | Ga0307511_10023554 | Ga0307511_100235546 | 92 |
| 737 | 3300030878 | Ga0265770_1075597 | Ga0265770_10755972 | 92 |
| 738 | 3300031247 | Ga0265340_10472822 | Ga0265340_104728222 | 92 |
| 739 | 3300031507 | Ga0307509_10000162 | Ga0307509_100001629 | 92 |
| 740 | 3300031595 | Ga0265313_10401338 | Ga0265313_104013382 | 92 |
| 741 | 3300033179 | Ga0307507_10288646 | Ga0307507_102886462 | 92 |
| 742 | 3300033179 | Ga0307507_10313842 | Ga0307507_103138421 | 92 |
| 743 | 3300033180 | Ga0307510_10000011 | Ga0307510_10000011277 | 92 |
| 744 | 3300033180 | Ga0307510_10014196 | Ga0307510_100141967 | 92 |
| 745 | 3300035111 | Ga0373923_0413665 | Ga0373923_0413665_16_294 | 92 |
| 746 | 3300035112 | Ga0373932_0117943 | Ga0373932_0117943_517_807 | 92 |
| 747 | 3300035113 | Ga0373936_0007238 | Ga0373936_0007238_2380_2697 | 92 |
| 748 | 3300035695 | Ga0373927_0087723 | Ga0373927_0087723_210_488 | 92 |
| 749 | 3300037418 | Ga0395900_0379087 | Ga0395900_0379087_1007_1303 | 92 |
| 750 | 3300037418 | Ga0395900_0434309 | Ga0395900_0434309_677_973 | 92 |
| 751 | 3300037466 | Ga0395898_0006120 | Ga0395898_0006120_8450_8746 | 92 |
| 752 | 3300037466 | Ga0395898_0058585 | Ga0395898_0058585_146_442 | 92 |
| 753 | 3300037471 | Ga0395905_0262396 | Ga0395905_0262396_748_1032 | 92 |
| 754 | 3300037853 | Ga0436364_0434002 | Ga0436364_0434002_250_531 | 92 |
| 755 | 3300037853 | Ga0436364_0894341 | Ga0436364_0894341_77_382 | 92 |
| 756 | 3300038443 | Ga0395901_1135576 | Ga0395901_1135576_96_392 | 92 |
| 757 | 3300039437 | Ga0436365_0521742 | Ga0436365_0521742_1522_1815 | 92 |
| 758 | 3300039437 | Ga0436365_1254679 | Ga0436365_1254679_360_662 | 92 |
| 759 | 3300039450 | Ga0436363_0594067 | Ga0436363_0594067_858_1151 | 92 |
| 760 | 3300039450 | Ga0436363_1183369 | Ga0436363_1183369_54_332 | 92 |
| 761 | 3300044656 | Ga0466969_0003022 | Ga0466969_0003022_6691_6972 | 92 |
| 762 | 3300044684 | Ga0466966_0194261 | Ga0466966_0194261_722_1018 | 92 |
| 763 | 3300044693 | Ga0466961_0567678 | Ga0466961_0567678_123_404 | 92 |
| 764 | 3300044765 | Ga0466970_0332022 | Ga0466970_0332022_24_305 | 92 |
| 765 | 3300045049 | Ga0466959_0003023 | Ga0466959_0003023_1646_1927 | 92 |
| 766 | 3300045049 | Ga0466959_0022104 | Ga0466959_0022104_163_459 | 92 |
| 767 | 3300045049 | Ga0466959_0040209 | Ga0466959_0040209_2898_3179 | 92 |
| 768 | 3300045049 | Ga0466959_0085349 | Ga0466959_0085349_992_1273 | 92 |
| 769 | 3300045976 | Ga0466967_1628117 | Ga0466967_1628117_259_555 | 92 |
| 770 | 3300046507 | Ga0495606_0074410 | Ga0495606_0074410_1393_1671 | 92 |
| 771 | 3300046507 | Ga0495606_0111138 | Ga0495606_0111138_204_482 | 92 |
| 772 | 3300046507 | Ga0495606_0189216 | Ga0495606_0189216_691_969 | 92 |
| 773 | 3300046517 | Ga0495630_0695145 | Ga0495630_0695145_320_598 | 92 |
| 774 | 3300046538 | Ga0495609_0283392 | Ga0495609_0283392_304_582 | 92 |
| 775 | 3300046616 | Ga0495668_0446443 | Ga0495668_0446443_360_644 | 92 |
| 776 | 3300047323 | Ga0495683_0463189 | Ga0495683_0463189_183_461 | 92 |
| 777 | 3300047443 | Ga0495687_063656 | Ga0495687_063656_1006_1284 | 92 |
| 778 | 3300048903 | Ga0496100_0051687 | Ga0496100_0051687_1647_1925 | 92 |
| 779 | 3300048903 | Ga0496100_0143826 | Ga0496100_0143826_610_888 | 92 |
| 780 | 3300048905 | Ga0496102_0008678 | Ga0496102_0008678_5575_5853 | 92 |
| 781 | 3300048905 | Ga0496102_0028338 | Ga0496102_0028338_4523_4801 | 92 |
| 782 | 3300048906 | Ga0496103_0084215 | Ga0496103_0084215_1099_1377 | 92 |
| 783 | 3300048908 | Ga0496105_1074160 | Ga0496105_1074160_292_570 | 92 |
| 784 | 3300048909 | Ga0496106_0478667 | Ga0496106_0478667_552_830 | 92 |
| 785 | 3300048911 | Ga0496108_0406564 | Ga0496108_0406564_447_725 | 92 |
| 786 | 3300048912 | Ga0496109_0215623 | Ga0496109_0215623_1099_1377 | 92 |
| 787 | 3300048915 | Ga0496112_0044032 | Ga0496112_0044032_1136_1414 | 92 |
| 788 | 3300048917 | Ga0496114_0590398 | Ga0496114_0590398_484_762 | 92 |
| 789 | 3300048918 | Ga0496115_0129568 | Ga0496115_0129568_65_343 | 92 |
| 790 | 3300048919 | Ga0496116_0077357 | Ga0496116_0077357_1028_1306 | 92 |
| 791 | 3300048920 | Ga0496117_0000373 | Ga0496117_0000373_27907_28185 | 92 |
| 792 | 3300048920 | Ga0496117_0273991 | Ga0496117_0273991_582_860 | 92 |
| 793 | 3300048921 | Ga0496118_0000021 | Ga0496118_0000021_32729_33007 | 92 |
| 794 | 3300048921 | Ga0496118_0160497 | Ga0496118_0160497_201_479 | 92 |
| 795 | 3300048922 | Ga0496119_0001387 | Ga0496119_0001387_28896_29174 | 92 |
| 796 | 3300048922 | Ga0496119_0002294 | Ga0496119_0002294_18079_18357 | 92 |
| 797 | 3300048922 | Ga0496119_0223536 | Ga0496119_0223536_173_451 | 92 |
| 798 | 3300048923 | Ga0496120_0002163 | Ga0496120_0002163_2500_2778 | 92 |
| 799 | 3300048923 | Ga0496120_0022135 | Ga0496120_0022135_1721_1999 | 92 |
| 800 | 3300048924 | Ga0496121_0000547 | Ga0496121_0000547_63564_63842 | 92 |
| 801 | 3300048924 | Ga0496121_0002740 | Ga0496121_0002740_1570_1848 | 92 |
| 802 | 3300048924 | Ga0496121_0831529 | Ga0496121_0831529_213_491 | 92 |
| 803 | 3300048927 | Ga0496124_0250666 | Ga0496124_0250666_91_369 | 92 |
| 804 | 3300048928 | Ga0496125_0000112 | Ga0496125_0000112_176504_176782 | 92 |
| 805 | 3300048928 | Ga0496125_0023886 | Ga0496125_0023886_3668_3946 | 92 |
| 806 | 3300048928 | Ga0496125_0764482 | Ga0496125_0764482_196_477 | 92 |
| 807 | 3300048929 | Ga0496126_0006924 | Ga0496126_0006924_9585_9866 | 92 |
| 808 | 3300048929 | Ga0496126_0038813 | Ga0496126_0038813_3499_3777 | 92 |
| 809 | 3300048929 | Ga0496126_0148783 | Ga0496126_0148783_779_1057 | 92 |
| 810 | 3300049460 | Ga0495682_0064478 | Ga0495682_0064478_752_1030 | 92 |
| 811 | 3300049460 | Ga0495682_0145824 | Ga0495682_0145824_278_556 | 92 |
| 812 | 3300053092 | Ga0500583_0021011 | Ga0500583_0021011_605_883 | 92 |
| 813 | 3300053092 | Ga0500583_0102333 | Ga0500583_0102333_915_1193 | 92 |
| 814 | 3300053095 | Ga0500640_112928 | Ga0500640_112928_167_445 | 92 |
| 815 | 3300053098 | Ga0500650_0280864 | Ga0500650_0280864_404_682 | 92 |
| 816 | 3300053098 | Ga0500650_0443130 | Ga0500650_0443130_175_453 | 92 |
| 817 | 3300053111 | Ga0500572_004051 | Ga0500572_004051_1861_2139 | 92 |
| 818 | 3300053130 | Ga0500642_0189537 | Ga0500642_0189537_244_522 | 92 |
| 819 | 3300053133 | Ga0500655_013178 | Ga0500655_013178_1049_1327 | 92 |
| 820 | 3300053136 | Ga0500559_0131199 | Ga0500559_0131199_610_888 | 92 |
| 821 | 3300053148 | Ga0500590_083952 | Ga0500590_083952_795_1073 | 92 |
| 822 | 3300053159 | Ga0500630_108203 | Ga0500630_108203_520_798 | 92 |
| 823 | 3300053163 | Ga0500639_139624 | Ga0500639_139624_764_1042 | 92 |
| 824 | 3300053163 | Ga0500639_289168 | Ga0500639_289168_87_368 | 92 |
| 825 | 3300053178 | Ga0500637_0238906 | Ga0500637_0238906_463_741 | 92 |
| 826 | 3300053178 | Ga0500637_0352663 | Ga0500637_0352663_436_714 | 92 |
| 827 | 3300059641 | Ga0587068_093285 | Ga0587068_093285_210_491 | 92 |
| 828 | 3300060344 | Ga0587071_131600 | Ga0587071_131600_35_313 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.8854 | 20 | 84 |
| 8apo-assembly1.cif.gz_Au | structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites | 0.8791 | 26 | 87 |
| 7o9k-assembly1.cif.gz_W | human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu | 0.8767 | 22 | 84 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.8757 | 18 | 85 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.874 | 18 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8854 | 20 | 84 | 2.40.50.100 |
| 2ba1A01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8714 | 30 | 85 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8653 | 29 | 83 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8481 | 20 | 84 | 2.40.50.100 |
| af_Q9VKJ4_10_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8371 | 31 | 82 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5N5K3-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9729 | 29 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A484PSD2-F1-model_v4 | LSU ribosomal protein L27p | 0.9689 | 26 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A5C8B9S1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9686 | 26 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A455UVJ5-F1-model_v4 | deleted | 0.9477 | 24 | 84 |
|
| AF-A0A0A8XHI5-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9389 | 22 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar