F482564

General Info

Members Datasets Scaffolds Average Seq Length
828 382 827 90

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0007238|Ga0373936_0007238_2380_2697
Length 105
Sequence MTGVIENFAGFALMAHKKAGGSTRNGRDSHSKRLGVKRFGGEFVLAGNILIRQRGTPVRAGSNVGTGTDHTLFAKVSGTVKFQKRGAEQRMYVHVFPETQAAETH

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
192 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
240 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
241 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
242 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
289 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
290 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
352 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
364 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
365 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
366 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
369 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
372 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
375 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
376 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 2.29
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 0
Rhizoplane 6.04
Rhizosphere 84.54
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10005201 3300003322 Bacteria 4801
2 Ga0058863_11557338 3300004799 Bacteria 645
3 Ga0058861_10031889 3300004800 Bacteria 1126
4 Ga0058861_11881647 3300004800 Bacteria 1360
5 Ga0058862_12676565 3300004803 Unclassified 1136
6 Ga0065712_10147864 3300005290 Bacteria 1393
7 Ga0070658_11074880 3300005327 Bacteria 700
8 Ga0070658_11135394 3300005327 Bacteria 680
9 Ga0070683_100071707 3300005329 Bacteria 3232
10 Ga0070683_102110982 3300005329 Bacteria 541
11 Ga0070690_100073158 3300005330 Bacteria 2230
12 Ga0070670_100093327 3300005331 Bacteria 2589
13 Ga0070677_10049093 3300005333 Bacteria 1698
14 Ga0068869_100953051 3300005334 Bacteria 745
15 Ga0068869_101258284 3300005334 Bacteria 652
16 Ga0068869_101539412 3300005334 Bacteria 591
17 Ga0070666_10003541 3300005335 Bacteria 9466
18 Ga0070666_10050030 3300005335 Bacteria 2810
19 Ga0070666_10060735 3300005335 Bacteria 2558
20 Ga0070666_10229154 3300005335 Bacteria 1312
21 Ga0070680_100008953 3300005336 Bacteria 7673
22 Ga0070680_100035650 3300005336 Bacteria 4017
23 Ga0070680_100220232 3300005336 Bacteria 1602
24 Ga0070682_100335930 3300005337 Bacteria 1121
25 Ga0070682_101363353 3300005337 Bacteria 605
26 Ga0068868_100113483 3300005338 Bacteria 2203
27 Ga0068868_101961260 3300005338 Bacteria 555
28 Ga0070660_100362854 3300005339 Unclassified 1194
29 Ga0070689_100509167 3300005340 Bacteria 1032
30 Ga0070691_10797072 3300005341 Bacteria 575
31 Ga0070691_10959208 3300005341 Bacteria 531
32 Ga0070661_100286571 3300005344 Bacteria 1279
33 Ga0070692_10713532 3300005345 Bacteria 676
34 Ga0070669_100324959 3300005353 Bacteria 1243
35 Ga0070675_100320816 3300005354 Bacteria 1368
36 Ga0070675_100704803 3300005354 Bacteria 919
37 Ga0070671_100000151 3300005355 Bacteria 45208
38 Ga0070671_100001600 3300005355 Bacteria 17040
39 Ga0070671_100045856 3300005355 Bacteria 3634
40 Ga0070671_100260477 3300005355 Bacteria 1474
41 Ga0070671_101184592 3300005355 Bacteria 672
42 Ga0070674_100714600 3300005356 Bacteria 858
43 Ga0070673_100002156 3300005364 Bacteria 11928
44 Ga0070673_100075636 3300005364 Bacteria 2717
45 Ga0070688_100127686 3300005365 Bacteria 1711
46 Ga0070667_100006038 3300005367 Bacteria 10063
47 Ga0070667_100065881 3300005367 Bacteria 3076
48 Ga0070667_100144166 3300005367 Bacteria 2088
49 Ga0070667_101153594 3300005367 Bacteria 725
50 Ga0070709_10004940 3300005434 Bacteria 7204
51 Ga0070709_10133822 3300005434 Bacteria 1695
52 Ga0070714_100046383 3300005435 Bacteria 3686
53 Ga0070714_100099986 3300005435 Bacteria 2553
54 Ga0070714_100727071 3300005435 Bacteria 959
55 Ga0070714_101205251 3300005435 Bacteria 738
56 Ga0070714_102235140 3300005435 Bacteria 532
57 Ga0070713_100006790 3300005436 Bacteria 7976
58 Ga0070713_100651688 3300005436 Bacteria 1003
59 Ga0070710_10003950 3300005437 Bacteria 7027
60 Ga0070711_100010223 3300005439 Bacteria 5800
61 Ga0070711_101165513 3300005439 Bacteria 666
62 Ga0070711_101392627 3300005439 Unclassified 610
63 Ga0070705_100032801 3300005440 Bacteria 2889
64 Ga0070705_100511022 3300005440 Bacteria 914
65 Ga0070694_101019668 3300005444 Bacteria 688
66 Ga0070708_101143182 3300005445 Bacteria 729
67 Ga0070663_100015011 3300005455 Bacteria 4984
68 Ga0070678_100003428 3300005456 Bacteria 8843
69 Ga0070678_101100119 3300005456 Bacteria 734
70 Ga0070662_100352551 3300005457 Bacteria 1206
71 Ga0070681_10024301 3300005458 Bacteria 6099
72 Ga0070681_10064439 3300005458 Bacteria 3635
73 Ga0070681_10155492 3300005458 Bacteria 2212
74 Ga0068867_101518976 3300005459 Bacteria 624
75 Ga0070685_10433325 3300005466 Bacteria 917
76 Ga0070706_101457542 3300005467 Bacteria 626
77 Ga0070699_100038047 3300005518 Bacteria 4166
78 Ga0070679_100088711 3300005530 Bacteria 3079
79 Ga0070679_100153605 3300005530 Bacteria 2278
80 Ga0070679_100363692 3300005530 Bacteria 1394
81 Ga0070684_100097767 3300005535 Bacteria 2618
82 Ga0070684_100235917 3300005535 Bacteria 1671
83 Ga0070697_101008717 3300005536 Bacteria 740
84 Ga0070697_101432463 3300005536 Bacteria 617
85 Ga0068853_100120842 3300005539 Bacteria 2336
86 Ga0070672_100221899 3300005543 Bacteria 1586
87 Ga0070672_100903479 3300005543 Bacteria 780
88 Ga0070686_100006579 3300005544 Bacteria 6471
89 Ga0070686_100465269 3300005544 Bacteria 975
90 Ga0070686_100526673 3300005544 Bacteria 921
91 Ga0070686_101008213 3300005544 Bacteria 683
92 Ga0070695_100050009 3300005545 Bacteria 2677
93 Ga0070695_100087477 3300005545 Bacteria 2073
94 Ga0070695_100319577 3300005545 Bacteria 1153
95 Ga0070695_100524923 3300005545 Bacteria 919
96 Ga0070696_100228535 3300005546 Bacteria 1399
97 Ga0070696_100457913 3300005546 Bacteria 1008
98 Ga0070696_100510005 3300005546 Bacteria 958
99 Ga0070696_101348236 3300005546 Bacteria 607
100 Ga0070693_100268429 3300005547 Bacteria 1138
101 Ga0070665_100003611 3300005548 Bacteria 16385
102 Ga0070665_100004871 3300005548 Bacteria 13946
103 Ga0070665_100013789 3300005548 Bacteria 8131
104 Ga0070665_100083403 3300005548 Bacteria 3201
105 Ga0070665_100207913 3300005548 Bacteria 1958
106 Ga0070665_100995694 3300005548 Bacteria 850
107 Ga0070704_100019210 3300005549 Bacteria 4388
108 Ga0070704_100055374 3300005549 Bacteria 2812
109 Ga0068855_100002251 3300005563 Bacteria 23841
110 Ga0068855_100194400 3300005563 Bacteria 2286
111 Ga0068855_100317537 3300005563 Bacteria 1723
112 Ga0068855_100453038 3300005563 Bacteria 1400
113 Ga0068855_101059198 3300005563 Bacteria 850
114 Ga0068855_101750191 3300005563 Bacteria 633
115 Ga0068855_102276696 3300005563 Bacteria 543
116 Ga0068854_100625654 3300005578 Bacteria 922
117 Ga0068854_101068171 3300005578 Bacteria 718
118 Ga0068854_101541978 3300005578 Bacteria 604
119 Ga0068856_100011130 3300005614 Bacteria 8734
120 Ga0068856_100504036 3300005614 Bacteria 1231
121 Ga0068856_101962575 3300005614 Bacteria 596
122 Ga0068852_100169717 3300005616 Bacteria 2044
123 Ga0068852_100404967 3300005616 Bacteria 1343
124 Ga0068859_100002492 3300005617 Bacteria 18727
125 Ga0068859_100097108 3300005617 Bacteria 2999
126 Ga0068859_100112422 3300005617 Bacteria 2787
127 Ga0068859_100304358 3300005617 Bacteria 1687
128 Ga0068859_102192543 3300005617 Bacteria 610
129 Ga0068864_100357428 3300005618 Bacteria 1380
130 Ga0068866_10011986 3300005718 Bacteria 3769
131 Ga0068861_100201276 3300005719 Bacteria 1672
132 Ga0068851_10494564 3300005834 Bacteria 732
133 Ga0068870_10451812 3300005840 Bacteria 847
134 Ga0068863_100002637 3300005841 Bacteria 17759
135 Ga0068863_100024954 3300005841 Bacteria 5702
136 Ga0068863_100237934 3300005841 Bacteria 1757
137 Ga0068863_100850934 3300005841 Bacteria 911
138 Ga0068863_101416778 3300005841 Bacteria 703
139 Ga0068863_101682147 3300005841 Bacteria 644
140 Ga0068858_100012257 3300005842 Bacteria 8083
141 Ga0068858_100044008 3300005842 Bacteria 4139
142 Ga0068858_100055111 3300005842 Bacteria 3675
143 Ga0068858_100216347 3300005842 Bacteria 1814
144 Ga0068858_100910989 3300005842 Bacteria 860
145 Ga0068858_102408880 3300005842 Bacteria 520
146 Ga0068860_100000086 3300005843 Bacteria 165786
147 Ga0068860_100011176 3300005843 Bacteria 8848
148 Ga0068860_100644567 3300005843 Bacteria 1067
149 Ga0068860_101453660 3300005843 Bacteria 707
150 Ga0068862_100100277 3300005844 Bacteria 2532
151 Ga0070717_10000760 3300006028 Bacteria 21071
152 Ga0070715_10002439 3300006163 Bacteria 5706
153 Ga0070715_10136337 3300006163 Bacteria 1187
154 Ga0070716_100005892 3300006173 Bacteria 5961
155 Ga0070716_100073753 3300006173 Bacteria 2014
156 Ga0070716_100261823 3300006173 Bacteria 1184
157 Ga0070716_100296973 3300006173 Bacteria 1122
158 Ga0070716_100780320 3300006173 Bacteria 738
159 Ga0070712_100030975 3300006175 Bacteria 3600
160 Ga0070712_100195131 3300006175 Bacteria 1587
161 Ga0070712_100608330 3300006175 Bacteria 926
162 Ga0097621_100014033 3300006237 Bacteria 5987
163 Ga0097621_100040451 3300006237 Bacteria 3748
164 Ga0097621_100074563 3300006237 Bacteria 2811
165 Ga0068871_100004650 3300006358 Bacteria 9587
166 Ga0068871_100018250 3300006358 Bacteria 5328
167 Ga0068871_100047768 3300006358 Bacteria 3453
168 Ga0075428_100015490 3300006844 Bacteria 8452
169 Ga0075428_100148124 3300006844 Bacteria 2551
170 Ga0075428_100855944 3300006844 Bacteria 965
171 Ga0075428_101527782 3300006844 Bacteria 699
172 Ga0075430_100303868 3300006846 Bacteria 1320
173 Ga0075433_10002778 3300006852 Bacteria 13393
174 Ga0075433_10341105 3300006852 Bacteria 1324
175 Ga0075434_100000511 3300006871 Bacteria 29418
176 Ga0075434_100190538 3300006871 Bacteria 2071
177 Ga0075429_100547744 3300006880 Bacteria 1014
178 Ga0068865_101028230 3300006881 Bacteria 723
179 Ga0075436_100064140 3300006914 Bacteria 2539
180 Ga0097620_100002492 3300006931 Bacteria 18727
181 Ga0097620_100097094 3300006931 Bacteria 2999
182 Ga0097620_100112429 3300006931 Bacteria 2787
183 Ga0097620_100304362 3300006931 Bacteria 1687
184 Ga0097620_102192567 3300006931 Bacteria 610
185 Ga0075435_100078594 3300007076 Bacteria 2706
186 Ga0075435_100535228 3300007076 Bacteria 1014
187 Ga0075435_101598602 3300007076 Bacteria 572
188 Ga0099794_10107726 3300007265 Bacteria 1394
189 Ga0099795_10000002 3300007788 Bacteria 161112
190 Ga0105251_10463151 3300009011 Bacteria 589
191 Ga0105250_10442685 3300009092 Bacteria 582
192 Ga0105240_10004128 3300009093 Bacteria 22275
193 Ga0105240_10014216 3300009093 Bacteria 10872
194 Ga0105240_10020430 3300009093 Bacteria 8833
195 Ga0105240_10039058 3300009093 Bacteria 6082
196 Ga0105240_10055791 3300009093 Bacteria 4946
197 Ga0105240_10071345 3300009093 Bacteria 4296
198 Ga0105240_10104214 3300009093 Bacteria 3445
199 Ga0105240_10135285 3300009093 Bacteria 2952
200 Ga0105240_10249099 3300009093 Bacteria 2055
201 Ga0105240_10986188 3300009093 Bacteria 902
202 Ga0105240_11744292 3300009093 Bacteria 649
203 Ga0105240_11884654 3300009093 Bacteria 622
204 Ga0111539_10005609 3300009094 Bacteria 16231
205 Ga0111539_10083250 3300009094 Bacteria 3763
206 Ga0105245_10016229 3300009098 Bacteria 6492
207 Ga0105245_10160655 3300009098 Bacteria 2132
208 Ga0105247_10000121 3300009101 Bacteria 75837
209 Ga0105247_10015518 3300009101 Bacteria 4561
210 Ga0105247_10037501 3300009101 Bacteria 2958
211 Ga0105247_10970141 3300009101 Bacteria 661
212 Ga0114129_10277066 3300009147 Bacteria 2242
213 Ga0114129_10439647 3300009147 Bacteria 1712
214 Ga0114129_13386664 3300009147 Bacteria 513
215 Ga0105243_11562036 3300009148 Bacteria 685
216 Ga0105241_10250646 3300009174 Bacteria 1501
217 Ga0105241_11932227 3300009174 Bacteria 579
218 Ga0105242_10866816 3300009176 Bacteria 900
219 Ga0105248_10025370 3300009177 Bacteria 6590
220 Ga0105248_10033582 3300009177 Bacteria 5732
221 Ga0105248_10139556 3300009177 Bacteria 2734
222 Ga0105237_10001548 3300009545 Bacteria 30012
223 Ga0105237_10046552 3300009545 Bacteria 4363
224 Ga0105237_10212733 3300009545 Bacteria 1933
225 Ga0105237_10293400 3300009545 Bacteria 1629
226 Ga0105237_10739728 3300009545 Bacteria 990
227 Ga0105237_11169003 3300009545 Bacteria 776
228 Ga0105237_11216391 3300009545 Bacteria 760
229 Ga0105237_11964051 3300009545 Bacteria 593
230 Ga0105238_10194161 3300009551 Bacteria 2006
231 Ga0105238_10478239 3300009551 Bacteria 1245
232 Ga0105238_10509300 3300009551 Bacteria 1205
233 Ga0105238_10786385 3300009551 Bacteria 967
234 Ga0105238_11096108 3300009551 Bacteria 819
235 Ga0105238_12482647 3300009551 Bacteria 554
236 Ga0105249_10010844 3300009553 Bacteria 8008
237 Ga0105249_10274888 3300009553 Bacteria 1680
238 Ga0105249_10467819 3300009553 Bacteria 1302
239 Ga0105249_10698940 3300009553 Bacteria 1074
240 Ga0105249_12398636 3300009553 Bacteria 600
241 Ga0099796_10000017 3300010159 Bacteria 48991
242 Ga0099796_10004720 3300010159 Bacteria 3329
243 Ga0099796_10459602 3300010159 Bacteria 567
244 Ga0105239_10041139 3300010375 Bacteria 5064
245 Ga0105239_10466297 3300010375 Bacteria 1434
246 Ga0105239_10506505 3300010375 Bacteria 1373
247 Ga0105239_10639967 3300010375 Bacteria 1214
248 Ga0105239_11658937 3300010375 Bacteria 740
249 Ga0157373_10996329 3300013100 Bacteria 625
250 Ga0157373_11321647 3300013100 Bacteria 546
251 Ga0157370_10557273 3300013104 Bacteria 1050
252 Ga0157369_10037254 3300013105 Bacteria 5325
253 Ga0157369_10122452 3300013105 Bacteria 2759
254 Ga0157369_12056973 3300013105 Bacteria 579
255 Ga0157369_12272717 3300013105 Bacteria 550
256 Ga0157374_10063599 3300013296 Bacteria 3461
257 Ga0157374_10738178 3300013296 Bacteria 999
258 Ga0157374_10953483 3300013296 Bacteria 876
259 Ga0157378_10004170 3300013297 Bacteria 12760
260 Ga0157378_11972821 3300013297 Bacteria 633
261 Ga0157378_12612424 3300013297 Bacteria 557
262 Ga0163162_10028264 3300013306 Bacteria 5547
263 Ga0163162_10067993 3300013306 Bacteria 3613
264 Ga0163162_10309660 3300013306 Bacteria 1711
265 Ga0163162_13353181 3300013306 Bacteria 512
266 Ga0157372_10783580 3300013307 Bacteria 1108
267 Ga0157372_10851934 3300013307 Bacteria 1058
268 Ga0157372_12993832 3300013307 Bacteria 540
269 Ga0157375_10065112 3300013308 Bacteria 3632
270 Ga0163163_10166862 3300014325 Bacteria 2248
271 Ga0163163_10279514 3300014325 Bacteria 1721
272 Ga0163163_10297117 3300014325 Bacteria 1667
273 Ga0163163_10339352 3300014325 Bacteria 1558
274 Ga0163163_10462976 3300014325 Bacteria 1328
275 Ga0157380_10001383 3300014326 Bacteria 15829
276 Ga0157380_10085969 3300014326 Bacteria 2583
277 Ga0157380_10151671 3300014326 Bacteria 2004
278 Ga0157377_10142660 3300014745 Bacteria 1473
279 Ga0157377_10955799 3300014745 Bacteria 645
280 Ga0157379_10007334 3300014968 Bacteria 9542
281 Ga0157379_10041003 3300014968 Bacteria 4133
282 Ga0157379_10043135 3300014968 Bacteria 4027
283 Ga0157379_10204325 3300014968 Bacteria 1787
284 Ga0157379_10455890 3300014968 Bacteria 1181
285 Ga0157379_10893019 3300014968 Bacteria 843
286 Ga0157379_11833126 3300014968 Bacteria 597
287 Ga0157379_12120780 3300014968 Bacteria 557
288 Ga0157376_10067583 3300014969 Bacteria 3024
289 Ga0157376_10246601 3300014969 Bacteria 1666
290 Ga0157376_11139404 3300014969 Bacteria 807
291 Ga0157376_11245656 3300014969 Bacteria 773
292 Ga0163161_11523473 3300017792 Bacteria 588
293 Ga0163161_12055211 3300017792 Bacteria 508
294 Ga0197907_10713066 3300020069 Bacteria 662
295 Ga0206356_10181451 3300020070 Bacteria 662
296 Ga0206355_1308584 3300020076 Bacteria 586
297 Ga0206355_1702270 3300020076 Bacteria 569
298 Ga0206353_10959879 3300020082 Bacteria 821
299 Ga0206353_11943938 3300020082 Bacteria 1115
300 Ga0213873_10012196 3300021358 Bacteria 1859
301 Ga0213873_10120672 3300021358 Bacteria 769
302 Ga0213874_10005551 3300021377 Bacteria 2944
303 Ga0213874_10029286 3300021377 Bacteria 1579
304 Ga0213876_10069373 3300021384 Bacteria 1862
305 Ga0213871_10033535 3300021441 Bacteria 1351
306 Ga0213871_10074139 3300021441 Bacteria 966
307 Ga0224712_10216531 3300022467 Bacteria 875
308 Ga0224712_10400429 3300022467 Bacteria 654
309 Ga0228598_1039800 3300024227 Bacteria 928
310 Ga0207656_10232823 3300025321 Bacteria 898
311 Ga0207682_10074108 3300025893 Bacteria 1447
312 Ga0207692_10009224 3300025898 Bacteria 4112
313 Ga0207642_10106921 3300025899 Bacteria 1417
314 Ga0207710_10000156 3300025900 Bacteria 73078
315 Ga0207710_10029645 3300025900 Bacteria 2382
316 Ga0207710_10556803 3300025900 Bacteria 598
317 Ga0207688_10441734 3300025901 Bacteria 810
318 Ga0207680_10127325 3300025903 Bacteria 1674
319 Ga0207680_10229957 3300025903 Bacteria 1274
320 Ga0207680_10980035 3300025903 Bacteria 606
321 Ga0207680_11058820 3300025903 Bacteria 580
322 Ga0207685_10102133 3300025905 Bacteria 1228
323 Ga0207685_10206128 3300025905 Bacteria 927
324 Ga0207685_10710040 3300025905 Bacteria 548
325 Ga0207699_10040830 3300025906 Bacteria 2676
326 Ga0207699_10094159 3300025906 Bacteria 1886
327 Ga0207699_10101861 3300025906 Bacteria 1824
328 Ga0207699_10472644 3300025906 Bacteria 902
329 Ga0207643_10607231 3300025908 Bacteria 704
330 Ga0207705_10845286 3300025909 Bacteria 710
331 Ga0207705_11463360 3300025909 Bacteria 518
332 Ga0207654_10160065 3300025911 Bacteria 1454
333 Ga0207707_10030748 3300025912 Bacteria 4697
334 Ga0207707_10063322 3300025912 Bacteria 3219
335 Ga0207707_10796962 3300025912 Bacteria 787
336 Ga0207695_10023762 3300025913 Bacteria 6917
337 Ga0207695_10025453 3300025913 Bacteria 6624
338 Ga0207695_10069998 3300025913 Bacteria 3589
339 Ga0207695_10082369 3300025913 Bacteria 3253
340 Ga0207695_10115487 3300025913 Bacteria 2659
341 Ga0207695_10209268 3300025913 Bacteria 1862
342 Ga0207695_10232450 3300025913 Bacteria 1747
343 Ga0207671_10053442 3300025914 Bacteria 2993
344 Ga0207671_10112900 3300025914 Bacteria 2069
345 Ga0207671_10546284 3300025914 Bacteria 924
346 Ga0207671_10575061 3300025914 Bacteria 898
347 Ga0207693_10001234 3300025915 Bacteria 22783
348 Ga0207693_10105161 3300025915 Bacteria 2213
349 Ga0207693_10140040 3300025915 Bacteria 1902
350 Ga0207693_10410367 3300025915 Bacteria 1059
351 Ga0207663_10006531 3300025916 Bacteria 5977
352 Ga0207663_10193450 3300025916 Bacteria 1462
353 Ga0207663_10379568 3300025916 Bacteria 1076
354 Ga0207663_10453555 3300025916 Bacteria 989
355 Ga0207663_10966220 3300025916 Bacteria 683
356 Ga0207660_10148443 3300025917 Bacteria 1799
357 Ga0207660_10238606 3300025917 Bacteria 1431
358 Ga0207660_11431983 3300025917 Bacteria 559
359 Ga0207660_11559893 3300025917 Bacteria 533
360 Ga0207662_10353526 3300025918 Bacteria 987
361 Ga0207662_10527352 3300025918 Bacteria 816
362 Ga0207649_10613714 3300025920 Bacteria 837
363 Ga0207649_11373854 3300025920 Bacteria 559
364 Ga0207652_10144509 3300025921 Bacteria 2128
365 Ga0207652_10214999 3300025921 Bacteria 1731
366 Ga0207652_11445557 3300025921 Bacteria 591
367 Ga0207681_10461414 3300025923 Bacteria 1035
368 Ga0207694_10146747 3300025924 Bacteria 1899
369 Ga0207694_10279351 3300025924 Bacteria 1371
370 Ga0207694_10820205 3300025924 Bacteria 786
371 Ga0207694_11681863 3300025924 Bacteria 534
372 Ga0207650_10260539 3300025925 Bacteria 1406
373 Ga0207659_10175073 3300025926 Bacteria 1695
374 Ga0207659_11876848 3300025926 Bacteria 508
375 Ga0207687_10060791 3300025927 Bacteria 2666
376 Ga0207687_10270485 3300025927 Bacteria 1358
377 Ga0207687_10411665 3300025927 Bacteria 1114
378 Ga0207700_10194355 3300025928 Bacteria 1706
379 Ga0207700_10333694 3300025928 Bacteria 1317
380 Ga0207700_10798771 3300025928 Bacteria 844
381 Ga0207664_10011864 3300025929 Bacteria 6216
382 Ga0207664_10263658 3300025929 Bacteria 1507
383 Ga0207664_10578554 3300025929 Bacteria 1008
384 Ga0207644_10001117 3300025931 Bacteria 17225
385 Ga0207644_10003342 3300025931 Bacteria 10348
386 Ga0207644_10015950 3300025931 Bacteria 5051
387 Ga0207644_10147761 3300025931 Bacteria 1816
388 Ga0207644_11443530 3300025931 Bacteria 578
389 Ga0207690_11451859 3300025932 Bacteria 574
390 Ga0207686_10721576 3300025934 Bacteria 794
391 Ga0207704_10529524 3300025938 Bacteria 954
392 Ga0207704_10720892 3300025938 Bacteria 827
393 Ga0207665_10004448 3300025939 Bacteria 9310
394 Ga0207665_10165087 3300025939 Bacteria 1596
395 Ga0207665_10228444 3300025939 Bacteria 1367
396 Ga0207665_11494269 3300025939 Bacteria 537
397 Ga0207691_10241382 3300025940 Bacteria 1562
398 Ga0207711_10062029 3300025941 Bacteria 3224
399 Ga0207711_10091677 3300025941 Bacteria 2673
400 Ga0207711_10119829 3300025941 Bacteria 2348
401 Ga0207689_10141841 3300025942 Bacteria 1979
402 Ga0207689_10850800 3300025942 Bacteria 770
403 Ga0207661_10035722 3300025944 Bacteria 3875
404 Ga0207679_10651199 3300025945 Bacteria 953
405 Ga0207667_10007515 3300025949 Bacteria 13083
406 Ga0207667_10041325 3300025949 Bacteria 4905
407 Ga0207667_10235472 3300025949 Bacteria 1874
408 Ga0207667_10367869 3300025949 Bacteria 1466
409 Ga0207667_10563922 3300025949 Bacteria 1151
410 Ga0207651_10051352 3300025960 Bacteria 2805
411 Ga0207651_10436874 3300025960 Bacteria 1120
412 Ga0207712_10330185 3300025961 Bacteria 1261
413 Ga0207712_10340677 3300025961 Bacteria 1243
414 Ga0207640_10609488 3300025981 Bacteria 925
415 Ga0207640_10744126 3300025981 Bacteria 845
416 Ga0207640_11924286 3300025981 Bacteria 535
417 Ga0207658_10009137 3300025986 Bacteria 6723
418 Ga0207658_10040613 3300025986 Bacteria 3364
419 Ga0207658_10072403 3300025986 Bacteria 2612
420 Ga0207658_10364093 3300025986 Bacteria 1262
421 Ga0207658_10471169 3300025986 Bacteria 1115
422 Ga0207658_10485839 3300025986 Bacteria 1098
423 Ga0207677_11313773 3300026023 Bacteria 664
424 Ga0207703_10001045 3300026035 Bacteria 26367
425 Ga0207703_10006750 3300026035 Bacteria 9152
426 Ga0207703_10143532 3300026035 Bacteria 2074
427 Ga0207703_10159232 3300026035 Bacteria 1976
428 Ga0207703_10635699 3300026035 Bacteria 1011
429 Ga0207703_12295672 3300026035 Bacteria 515
430 Ga0207639_10405368 3300026041 Bacteria 1229
431 Ga0207639_10863439 3300026041 Bacteria 845
432 Ga0207678_10008217 3300026067 Bacteria 9198
433 Ga0207702_10175164 3300026078 Bacteria 1970
434 Ga0207702_10272412 3300026078 Bacteria 1597
435 Ga0207702_11415981 3300026078 Bacteria 689
436 Ga0207702_11614864 3300026078 Bacteria 642
437 Ga0207641_10000411 3300026088 Bacteria 50003
438 Ga0207641_10044965 3300026088 Bacteria 3715
439 Ga0207641_10221982 3300026088 Bacteria 1753
440 Ga0207641_10575778 3300026088 Bacteria 1100
441 Ga0207641_11098884 3300026088 Bacteria 794
442 Ga0207641_11231562 3300026088 Bacteria 748
443 Ga0207648_10161837 3300026089 Bacteria 1976
444 Ga0207648_10556719 3300026089 Bacteria 1054
445 Ga0207676_10247113 3300026095 Bacteria 1604
446 Ga0207675_100344003 3300026118 Bacteria 1460
447 Ga0207683_10012302 3300026121 Bacteria 7304
448 Ga0207683_11209375 3300026121 Bacteria 700
449 Ga0207683_11219393 3300026121 Bacteria 697
450 Ga0207698_10250314 3300026142 Bacteria 1621
451 Ga0207698_11081785 3300026142 Bacteria 814
452 Ga0210000_1060146 3300027462 Bacteria 615
453 Ga0209179_1000003 3300027512 Bacteria 121837
454 Ga0209968_1040006 3300027526 Bacteria 800
455 Ga0207428_10043304 3300027907 Bacteria 3636
456 Ga0207428_10772990 3300027907 Bacteria 683
457 Ga0268266_10000891 3300028379 Bacteria 38646
458 Ga0268266_10015611 3300028379 Bacteria 6509
459 Ga0268266_10024405 3300028379 Bacteria 5142
460 Ga0268266_10150760 3300028379 Bacteria 2095
461 Ga0268266_10164591 3300028379 Bacteria 2008
462 Ga0268266_10347935 3300028379 Bacteria 1392
463 Ga0268265_10141141 3300028380 Bacteria 2017
464 Ga0268265_11550864 3300028380 Bacteria 667
465 Ga0268264_10000044 3300028381 Bacteria 368079
466 Ga0268264_10011423 3300028381 Bacteria 7332
467 Ga0268264_10584281 3300028381 Bacteria 1099
468 Ga0307515_10114699 3300028794 Bacteria 3111
469 Ga0307515_10382947 3300028794 Bacteria 1038
470 Ga0265338_10187301 3300028800 Bacteria 1572
471 Ga0265338_10222478 3300028800 Bacteria 1409
472 Ga0307511_10002869 3300030521 Bacteria 17883
473 Ga0307511_10023554 3300030521 Bacteria 5735
474 Ga0316176_1176152 3300030732 Bacteria 709
475 Ga0265763_1001427 3300030763 Bacteria 1703
476 Ga0265770_1075597 3300030878 Bacteria 650
477 Ga0265768_112292 3300030963 Bacteria 571
478 Ga0265320_10457119 3300031240 Bacteria 564
479 Ga0265340_10021798 3300031247 Bacteria 3282
480 Ga0265340_10213596 3300031247 Bacteria 865
481 Ga0265340_10472822 3300031247 Bacteria 552
482 Ga0265331_10109927 3300031250 Bacteria 1265
483 Ga0307513_10413620 3300031456 Bacteria 1080
484 Ga0307513_10429419 3300031456 Bacteria 1050
485 Ga0307509_10000162 3300031507 Bacteria 104449
486 Ga0265313_10257489 3300031595 Bacteria 710
487 Ga0265313_10401338 3300031595 Bacteria 538
488 Ga0316575_10083908 3300031665 Bacteria 1286
489 Ga0316576_10007759 3300031727 Bacteria 6777
490 Ga0316577_10057581 3300031733 Bacteria 2170
491 Ga0316577_10192843 3300031733 Bacteria 1151
492 Ga0316577_10232668 3300031733 Bacteria 1042
493 Ga0307413_10966564 3300031824 Bacteria 728
494 Ga0307410_11136746 3300031852 Bacteria 678
495 Ga0307407_10139544 3300031903 Bacteria 1562
496 Ga0307407_10509429 3300031903 Bacteria 883
497 Ga0307415_100590832 3300032126 Bacteria 986
498 Ga0307507_10288646 3300033179 Bacteria 1018
499 Ga0307507_10313842 3300033179 Bacteria 950
500 Ga0307510_10000011 3300033180 Bacteria 355464
501 Ga0307510_10014196 3300033180 Bacteria 9434
502 Ga0373923_0413665 3300035111 Bacteria 650
503 Ga0373932_0117943 3300035112 Bacteria 882
504 Ga0373936_0007238 3300035113 Bacteria 4177
505 Ga0373945_0041352 3300035116 Bacteria 1666
506 Ga0373954_0012268 3300035118 Bacteria 3810
507 Ga0373956_0030548 3300035119 Bacteria 2356
508 Ga0373943_0064800 3300035170 Bacteria 1836
509 Ga0373946_0098183 3300035171 Bacteria 1309
510 Ga0373955_0056144 3300035172 Bacteria 2160
511 Ga0373955_0207351 3300035172 Bacteria 1168
512 Ga0316574_0145510 3300035398 Bacteria 1527
513 Ga0373935_0800188 3300035692 Bacteria 696
514 Ga0373927_0030967 3300035695 Bacteria 3490
515 Ga0373927_0087723 3300035695 Bacteria 2020
516 Ga0373933_0322529 3300035724 Bacteria 1002
517 Ga0373937_0041733 3300036401 Bacteria 4185
518 Ga0373937_0117078 3300036401 Bacteria 2482
519 Ga0373937_0217963 3300036401 Bacteria 1796
520 Ga0373937_0555809 3300036401 Bacteria 1090
521 Ga0316584_0055643 3300036712 Bacteria 2962
522 Ga0373925_0092039 3300037068 Bacteria 2319
523 Ga0373925_0122502 3300037068 Bacteria 2020
524 Ga0395900_0379087 3300037418 Bacteria 1383
525 Ga0395900_0434309 3300037418 Bacteria 1272
526 Ga0395898_0006120 3300037466 Bacteria 12900
527 Ga0395898_0058585 3300037466 Bacteria 3749
528 Ga0395905_0262396 3300037471 Bacteria 1613
529 Ga0436364_0434002 3300037853 Bacteria 605
530 Ga0436364_0477485 3300037853 Bacteria 828
531 Ga0436364_0894341 3300037853 Bacteria 587
532 Ga0395901_1135576 3300038443 Bacteria 750
533 Ga0436365_0521742 3300039437 Bacteria 2040
534 Ga0436365_0942025 3300039437 Bacteria 4868
535 Ga0436365_1109929 3300039437 Bacteria 546
536 Ga0436365_1254679 3300039437 Bacteria 773
537 Ga0436365_1346489 3300039437 Bacteria 1621
538 Ga0436360_0086470 3300039438 Bacteria 1405
539 Ga0436360_0766596 3300039438 Bacteria 19938
540 Ga0436360_0831083 3300039438 Bacteria 3005
541 Ga0436360_0970001 3300039438 Bacteria 1646
542 Ga0436361_0477235 3300039447 Bacteria 738
543 Ga0436361_0501117 3300039447 Bacteria 786
544 Ga0436361_0654178 3300039447 Bacteria 1739
545 Ga0436361_1160407 3300039447 Bacteria 1221
546 Ga0436363_0045740 3300039450 Bacteria 3540
547 Ga0436363_0237012 3300039450 Bacteria 2015
548 Ga0436363_0269421 3300039450 Bacteria 579
549 Ga0436363_0594067 3300039450 Bacteria 1948
550 Ga0436363_0868312 3300039450 Unclassified 841
551 Ga0436363_1183369 3300039450 Bacteria 670
552 Ga0436363_1492427 3300039450 Bacteria 4711
553 Ga0436362_0063292 3300039453 Bacteria 688
554 Ga0436362_0075590 3300039453 Bacteria 1342
555 Ga0436362_0340884 3300039453 Bacteria 898
556 Ga0436362_0734099 3300039453 Bacteria 2524
557 Ga0436362_0828451 3300039453 Bacteria 1201
558 Ga0436362_0907425 3300039453 Bacteria 508
559 Ga0451789_1334491 3300041443 Bacteria 799
560 Ga0451791_0622945 3300041451 Bacteria 850
561 Ga0451793_0730076 3300041452 Bacteria 773
562 Ga0451797_1526605 3300041453 Bacteria 1183
563 Ga0451798_0071954 3300041458 Bacteria 1083
564 Ga0451800_1134045 3300041459 Bacteria 746
565 Ga0451802_1329548 3300041460 Bacteria 566
566 Ga0451807_1727859 3300041486 Bacteria 1157
567 Ga0451843_0981204 3300041509 Bacteria 540
568 Ga0451853_3495509 3300041512 Bacteria 1243
569 Ga0451577_0141707 3300042876 Bacteria 2160
570 Ga0451577_0989231 3300042876 Bacteria 756
571 Ga0466969_0003022 3300044656 Bacteria 8961
572 Ga0466969_0031684 3300044656 Bacteria 2691
573 Ga0453683_0057997 3300044673 Bacteria 2422
574 Ga0453683_0086552 3300044673 Bacteria 1963
575 Ga0466966_0194261 3300044684 Bacteria 1229
576 Ga0466961_0114113 3300044693 Bacteria 1698
577 Ga0466961_0567678 3300044693 Bacteria 683
578 Ga0453684_0038649 3300044712 Bacteria 6520
579 Ga0453684_0080604 3300044712 Bacteria 4064
580 Ga0453684_0350059 3300044712 Bacteria 1666
581 Ga0453684_0511371 3300044712 Bacteria 1328
582 Ga0453684_0878115 3300044712 Bacteria 962
583 Ga0453684_2259650 3300044712 Bacteria 542
584 Ga0466970_0332022 3300044765 Bacteria 861
585 Ga0466959_0003023 3300045049 Bacteria 10870
586 Ga0466959_0022104 3300045049 Bacteria 4700
587 Ga0466959_0040209 3300045049 Bacteria 3455
588 Ga0466959_0085349 3300045049 Bacteria 2272
589 Ga0466959_0296220 3300045049 Bacteria 1108
590 Ga0451576_0000046 3300045051 Bacteria 334064
591 Ga0451576_0015026 3300045051 Bacteria 8599
592 Ga0451576_0087654 3300045051 Bacteria 3237
593 Ga0466967_1628117 3300045976 Bacteria 643
594 Ga0495603_0188564 3300046455 Bacteria 1192
595 Ga0495603_0822176 3300046455 Bacteria 529
596 Ga0495591_045888 3300046458 Bacteria 1216
597 Ga0495629_0234037 3300046459 Bacteria 1266
598 Ga0495629_0337672 3300046459 Bacteria 1029
599 Ga0495580_0349641 3300046472 Bacteria 1001
600 Ga0495580_0414430 3300046472 Bacteria 907
601 Ga0495580_0742434 3300046472 Bacteria 640
602 Ga0495582_0113293 3300046473 Bacteria 1524
603 Ga0495639_0074366 3300046475 Bacteria 1574
604 Ga0495664_0088156 3300046477 Bacteria 1865
605 Ga0495664_0264049 3300046477 Bacteria 1041
606 Ga0495606_0074410 3300046507 Bacteria 2128
607 Ga0495606_0111138 3300046507 Bacteria 1653
608 Ga0495606_0189216 3300046507 Bacteria 1181
609 Ga0495608_0481137 3300046511 Bacteria 753
610 Ga0495618_0071963 3300046514 Bacteria 2200
611 Ga0495628_1103804 3300046516 Bacteria 542
612 Ga0495630_0067544 3300046517 Bacteria 2688
613 Ga0495630_0695145 3300046517 Bacteria 778
614 Ga0495631_0490507 3300046518 Bacteria 523
615 Ga0495632_0212921 3300046519 Bacteria 876
616 Ga0495644_0050781 3300046523 Bacteria 1557
617 Ga0495648_0312451 3300046524 Bacteria 732
618 Ga0495654_0099094 3300046530 Bacteria 1344
619 Ga0495665_0701489 3300046531 Bacteria 502
620 Ga0495586_0739713 3300046535 Bacteria 568
621 Ga0495609_0283392 3300046538 Bacteria 677
622 Ga0495621_0007215 3300046539 Bacteria 3282
623 Ga0495645_0376363 3300046543 Bacteria 909
624 Ga0495633_0197052 3300046558 Bacteria 925
625 Ga0495668_0446443 3300046616 Unclassified 712
626 Ga0495657_0271591 3300046675 Bacteria 1017
627 Ga0495623_0155348 3300046679 Bacteria 1349
628 Ga0495623_0510091 3300046679 Bacteria 634
629 Ga0495647_0018104 3300046681 Bacteria 2502
630 Ga0495647_0413604 3300046681 Bacteria 621
631 Ga0495658_0509556 3300046683 Bacteria 770
632 Ga0495613_0151126 3300046689 Bacteria 1656
633 Ga0495613_0415527 3300046689 Bacteria 916
634 Ga0495600_0470413 3300046809 Bacteria 775
635 Ga0495600_0825357 3300046809 Unclassified 551
636 Ga0495604_0175094 3300047317 Bacteria 1505
637 Ga0495674_0245065 3300047319 Bacteria 1476
638 Ga0495683_0463189 3300047323 Bacteria 519
639 Ga0495687_063656 3300047443 Bacteria 1509
640 Ga0495677_0109832 3300047445 Bacteria 1048
641 Ga0495686_0113447 3300047472 Bacteria 1623
642 Ga0495593_0292228 3300047673 Bacteria 815
643 Ga0495602_0341522 3300048088 Bacteria 1083
644 Ga0496100_0051687 3300048903 Bacteria 2669
645 Ga0496100_0053077 3300048903 Bacteria 2638
646 Ga0496100_0143826 3300048903 Bacteria 1694
647 Ga0496101_0182911 3300048904 Bacteria 1614
648 Ga0496101_0734679 3300048904 Bacteria 779
649 Ga0496102_0008678 3300048905 Bacteria 8725
650 Ga0496102_0028338 3300048905 Bacteria 5001
651 Ga0496102_0140257 3300048905 Bacteria 2266
652 Ga0496102_0146867 3300048905 Bacteria 2213
653 Ga0496102_1260356 3300048905 Bacteria 658
654 Ga0496103_0084215 3300048906 Bacteria 2003
655 Ga0496103_0090911 3300048906 Bacteria 1926
656 Ga0496104_0081925 3300048907 Bacteria 3077
657 Ga0496104_0556064 3300048907 Bacteria 1058
658 Ga0496104_1595494 3300048907 Bacteria 555
659 Ga0496105_0009915 3300048908 Bacteria 7471
660 Ga0496105_0280070 3300048908 Bacteria 1345
661 Ga0496105_1074160 3300048908 Bacteria 599
662 Ga0496106_0014237 3300048909 Bacteria 5875
663 Ga0496106_0413952 3300048909 Bacteria 1083
664 Ga0496106_0478667 3300048909 Bacteria 1000
665 Ga0496106_0651137 3300048909 Bacteria 842
666 Ga0496107_0073989 3300048910 Bacteria 2479
667 Ga0496107_0288548 3300048910 Bacteria 1221
668 Ga0496108_0060411 3300048911 Bacteria 3189
669 Ga0496108_0406564 3300048911 Bacteria 1189
670 Ga0496109_0008587 3300048912 Bacteria 8694
671 Ga0496109_0215623 3300048912 Bacteria 1805
672 Ga0496109_0276699 3300048912 Bacteria 1582
673 Ga0496110_0003769 3300048913 Bacteria 11681
674 Ga0496110_0558358 3300048913 Bacteria 1040
675 Ga0496110_1008179 3300048913 Bacteria 740
676 Ga0496111_0019260 3300048914 Bacteria 4738
677 Ga0496111_0097004 3300048914 Bacteria 2164
678 Ga0496112_0031109 3300048915 Bacteria 5173
679 Ga0496112_0044032 3300048915 Bacteria 4371
680 Ga0496112_0081124 3300048915 Bacteria 3208
681 Ga0496113_0114120 3300048916 Bacteria 2106
682 Ga0496113_0499499 3300048916 Bacteria 977
683 Ga0496114_0005168 3300048917 Bacteria 10186
684 Ga0496114_0590398 3300048917 Bacteria 980
685 Ga0496115_0129568 3300048918 Bacteria 2079
686 Ga0496116_0077357 3300048919 Bacteria 2079
687 Ga0496117_0000373 3300048920 Bacteria 77595
688 Ga0496117_0273991 3300048920 Bacteria 907
689 Ga0496118_0000021 3300048921 Bacteria 444988
690 Ga0496118_0160497 3300048921 Bacteria 1391
691 Ga0496119_0001387 3300048922 Bacteria 29399
692 Ga0496119_0002294 3300048922 Bacteria 21157
693 Ga0496119_0223536 3300048922 Bacteria 962
694 Ga0496120_0002163 3300048923 Bacteria 20906
695 Ga0496120_0022135 3300048923 Bacteria 4002
696 Ga0496121_0000547 3300048924 Bacteria 70979
697 Ga0496121_0002740 3300048924 Bacteria 26193
698 Ga0496121_0831529 3300048924 Bacteria 539
699 Ga0496123_0319298 3300048926 Bacteria 734
700 Ga0496124_0250666 3300048927 Bacteria 1310
701 Ga0496125_0000112 3300048928 Bacteria 188192
702 Ga0496125_0023886 3300048928 Bacteria 5633
703 Ga0496125_0764482 3300048928 Bacteria 504
704 Ga0496126_0006924 3300048929 Bacteria 12557
705 Ga0496126_0038813 3300048929 Bacteria 4426
706 Ga0496126_0148783 3300048929 Bacteria 2008
707 Ga0495682_0064478 3300049460 Bacteria 1321
708 Ga0495682_0145824 3300049460 Bacteria 845
709 Ga0501312_035006 3300049528 Bacteria 802
710 Ga0501031_0451789 3300049568 Bacteria 830
711 Ga0501031_0860079 3300049568 Bacteria 581
712 Ga0501033_0071202 3300049570 Bacteria 2554
713 Ga0501036_0003994 3300049572 Bacteria 11857
714 Ga0501036_1147619 3300049572 Bacteria 634
715 Ga0501037_0255173 3300049573 Bacteria 1226
716 Ga0501038_0006721 3300049574 Bacteria 10630
717 Ga0501039_0010751 3300049575 Bacteria 6968
718 Ga0501039_0189216 3300049575 Bacteria 1619
719 Ga0501039_0735362 3300049575 Bacteria 771
720 Ga0501040_0003685 3300049576 Bacteria 9929
721 Ga0501040_0004342 3300049576 Bacteria 9213
722 Ga0501040_1089110 3300049576 Bacteria 579
723 Ga0501041_0002953 3300049577 Bacteria 9749
724 Ga0501041_0012431 3300049577 Bacteria 5043
725 Ga0501041_0213463 3300049577 Bacteria 1210
726 Ga0501041_0451194 3300049577 Bacteria 816
727 Ga0501041_0610760 3300049577 Bacteria 696
728 Ga0501042_0003310 3300049578 Bacteria 10084
729 Ga0501042_0076695 3300049578 Bacteria 2393
730 Ga0501043_0573578 3300049579 Bacteria 836
731 Ga0501046_0003536 3300049580 Bacteria 14309
732 Ga0501048_0004812 3300049582 Bacteria 10288
733 Ga0501048_0067436 3300049582 Bacteria 2529
734 Ga0501048_1414785 3300049582 Bacteria 500
735 Ga0501067_0304048 3300049583 Bacteria 888
736 Ga0501068_1112498 3300049584 Bacteria 522
737 Ga0501070_1068535 3300049586 Bacteria 624
738 Ga0501071_0001540 3300049587 Bacteria 13464
739 Ga0501071_0069646 3300049587 Bacteria 2562
740 Ga0501071_0431610 3300049587 Bacteria 1007
741 Ga0501072_0012132 3300049588 Bacteria 6584
742 Ga0501072_0012597 3300049588 Bacteria 6465
743 Ga0501072_1557609 3300049588 Bacteria 510
744 Ga0501073_0175068 3300049589 Bacteria 1485
745 Ga0501073_0820955 3300049589 Bacteria 641
746 Ga0501074_0049116 3300049590 Bacteria 3046
747 Ga0501074_0073437 3300049590 Bacteria 2457
748 Ga0501074_1177059 3300049590 Bacteria 538
749 Ga0501075_0001216 3300049591 Bacteria 16684
750 Ga0501075_0076770 3300049591 Bacteria 2527
751 Ga0501075_0575092 3300049591 Bacteria 859
752 Ga0501076_0006804 3300049592 Bacteria 8296
753 Ga0501076_0155282 3300049592 Bacteria 1862
754 Ga0501076_0621292 3300049592 Bacteria 891
755 Ga0501077_0010223 3300049593 Bacteria 5843
756 Ga0501079_0002187 3300049741 Bacteria 14094
757 Ga0501079_0121281 3300049741 Bacteria 2033
758 Ga0501079_0268996 3300049741 Bacteria 1332
759 Ga0501079_0962770 3300049741 Bacteria 672
760 Ga0501080_0003675 3300049742 Bacteria 13532
761 Ga0501080_0110143 3300049742 Bacteria 2552
762 Ga0501080_0191856 3300049742 Bacteria 1877
763 Ga0501081_0002620 3300049743 Bacteria 11374
764 Ga0501081_0075009 3300049743 Bacteria 2360
765 Ga0501081_0133482 3300049743 Bacteria 1775
766 Ga0501081_0214930 3300049743 Bacteria 1397
767 Ga0501081_0472939 3300049743 Bacteria 932
768 Ga0501083_0052825 3300049744 Bacteria 2729
769 Ga0501083_0602568 3300049744 Bacteria 715
770 Ga0501083_0906977 3300049744 Bacteria 573
771 Ga0501035_0104697 3300049822 Bacteria 2481
772 Ga0501045_0002837 3300049824 Bacteria 11829
773 Ga0501045_0013189 3300049824 Bacteria 5829
774 nmdc:mga05p37_335223_c1 3300050507 Bacteria 1785
775 nmdc:mga05p37_60382_c1 3300050507 Bacteria 4668
776 nmdc:mga09592_1644125_c1 3300050508 Bacteria 519
777 nmdc:mga0qj67_384617_c1 3300050509 Bacteria 1133
778 nmdc:mga08y16_280438_c1 3300050511 Bacteria 1719
779 nmdc:mga08y16_65021_c1 3300050511 Bacteria 3808
780 nmdc:mga0n895_112570_c1 3300050512 Bacteria 2738
781 nmdc:mga0n895_141969_c1 3300050512 Bacteria 2430
782 nmdc:mga0n895_16043_c1 3300050512 Bacteria 6862
783 nmdc:mga0rr50_1356395_c1 3300050513 Bacteria 602
784 nmdc:mga0rr50_1748325_c1 3300050513 Bacteria 524
785 nmdc:mga0rr50_358444_c1 3300050513 Bacteria 1227
786 nmdc:mga0rr50_820016_c1 3300050513 Bacteria 794
787 nmdc:mga0a205_167973_c1 3300050515 Bacteria 2089
788 nmdc:mga0a205_9194_c1 3300050515 Bacteria 9021
789 Ga0495612_0032435 3300053078 Bacteria 2111
790 Ga0495612_0161196 3300053078 Bacteria 979
791 Ga0500646_0154254 3300053090 Bacteria 762
792 Ga0500583_0004150 3300053092 Bacteria 4679
793 Ga0500583_0021011 3300053092 Bacteria 2707
794 Ga0500583_0102333 3300053092 Bacteria 1404
795 Ga0500651_0057949 3300053093 Bacteria 2423
796 Ga0500640_112928 3300053095 Bacteria 1102
797 Ga0500641_0007963 3300053096 Bacteria 3779
798 Ga0500650_0280864 3300053098 Bacteria 740
799 Ga0500650_0443130 3300053098 Bacteria 557
800 Ga0500660_097501 3300053100 Bacteria 1293
801 Ga0500569_290496 3300053109 Bacteria 551
802 Ga0500572_004051 3300053111 Bacteria 3334
803 Ga0500642_0189537 3300053130 Bacteria 960
804 Ga0500652_124533 3300053131 Bacteria 1077
805 Ga0500655_013178 3300053133 Bacteria 1507
806 Ga0500559_0131199 3300053136 Bacteria 1170
807 Ga0500573_0320380 3300053140 Bacteria 766
808 Ga0500590_083952 3300053148 Bacteria 1560
809 Ga0500616_0063191 3300053153 Bacteria 1910
810 Ga0500630_108203 3300053159 Bacteria 1254
811 Ga0500639_139624 3300053163 Bacteria 1135
812 Ga0500639_289168 3300053163 Bacteria 625
813 Ga0500637_0238906 3300053178 Bacteria 1019
814 Ga0500637_0352663 3300053178 Bacteria 782
815 Ga0501084_0000340 3300054114 Bacteria 35562
816 Ga0501084_0152613 3300054114 Bacteria 1947
817 Ga0501084_0994444 3300054114 Bacteria 705
818 Ga0501084_1074353 3300054114 Bacteria 676
819 Ga0587068_093285 3300059641 Bacteria 623
820 Ga0587071_131600 3300060344 Bacteria 607
821 Ga0587111_0226171 3300060346 Bacteria 542
822 Ga0501082_0003014 3300060353 Bacteria 14716
823 Ga0501082_0082975 3300060353 Bacteria 2765
824 Ga0501082_1257324 3300060353 Bacteria 647
825 Ga0530510_0004076 3300061734 Bacteria 10084
826 Ga0530510_0026414 3300061734 Bacteria 4156
827 Ga0530510_0032714 3300061734 Bacteria 3743

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005840 Ga0068870_10451812 Ga0068870_104518122 84
2 3300006844 Ga0075428_101527782 Ga0075428_1015277822 84
3 3300031733 Ga0316577_10057581 Ga0316577_100575813 84
4 3300031733 Ga0316577_10192843 Ga0316577_101928432 84
5 3300005290 Ga0065712_10147864 Ga0065712_101478642 85
6 3300005327 Ga0070658_11135394 Ga0070658_111353941 85
7 3300005333 Ga0070677_10049093 Ga0070677_100490933 85
8 3300005334 Ga0068869_101258284 Ga0068869_1012582842 85
9 3300005337 Ga0070682_100335930 Ga0070682_1003359302 85
10 3300005341 Ga0070691_10797072 Ga0070691_107970721 85
11 3300005353 Ga0070669_100324959 Ga0070669_1003249591 85
12 3300005354 Ga0070675_100320816 Ga0070675_1003208162 85
13 3300005354 Ga0070675_100704803 Ga0070675_1007048032 85
14 3300005355 Ga0070671_101184592 Ga0070671_1011845922 85
15 3300005356 Ga0070674_100714600 Ga0070674_1007146001 85
16 3300005364 Ga0070673_100075636 Ga0070673_1000756363 85
17 3300005440 Ga0070705_100511022 Ga0070705_1005110222 85
18 3300005444 Ga0070694_101019668 Ga0070694_1010196682 85
19 3300005456 Ga0070678_101100119 Ga0070678_1011001192 85
20 3300005543 Ga0070672_100221899 Ga0070672_1002218993 85
21 3300005544 Ga0070686_101008213 Ga0070686_1010082131 85
22 3300005545 Ga0070695_100319577 Ga0070695_1003195772 85
23 3300005545 Ga0070695_100524923 Ga0070695_1005249231 85
24 3300005546 Ga0070696_100457913 Ga0070696_1004579131 85
25 3300005546 Ga0070696_101348236 Ga0070696_1013482362 85
26 3300005549 Ga0070704_100019210 Ga0070704_1000192104 85
27 3300005578 Ga0068854_101541978 Ga0068854_1015419782 85
28 3300005617 Ga0068859_100097108 Ga0068859_1000971082 85
29 3300005841 Ga0068863_101682147 Ga0068863_1016821472 85
30 3300005843 Ga0068860_100644567 Ga0068860_1006445673 85
31 3300006173 Ga0070716_100780320 Ga0070716_1007803202 85
32 3300006844 Ga0075428_100015490 Ga0075428_1000154907 85
33 3300006844 Ga0075428_100148124 Ga0075428_1001481244 85
34 3300006844 Ga0075428_100855944 Ga0075428_1008559442 85
35 3300006852 Ga0075433_10002778 Ga0075433_1000277815 85
36 3300006871 Ga0075434_100000511 Ga0075434_10000051115 85
37 3300006880 Ga0075429_100547744 Ga0075429_1005477442 85
38 3300006881 Ga0068865_101028230 Ga0068865_1010282302 85
39 3300006931 Ga0097620_100097094 Ga0097620_1000970942 85
40 3300007076 Ga0075435_100535228 Ga0075435_1005352282 85
41 3300009094 Ga0111539_10005609 Ga0111539_1000560914 85
42 3300009094 Ga0111539_10083250 Ga0111539_100832504 85
43 3300009147 Ga0114129_10439647 Ga0114129_104396473 85
44 3300009147 Ga0114129_13386664 Ga0114129_133866642 85
45 3300009148 Ga0105243_11562036 Ga0105243_115620361 85
46 3300009553 Ga0105249_12398636 Ga0105249_123986362 85
47 3300014326 Ga0157380_10001383 Ga0157380_100013831 85
48 3300014326 Ga0157380_10085969 Ga0157380_100859692 85
49 3300014326 Ga0157380_10151671 Ga0157380_101516713 85
50 3300014745 Ga0157377_10142660 Ga0157377_101426603 85
51 3300014745 Ga0157377_10955799 Ga0157377_109557992 85
52 3300014969 Ga0157376_10246601 Ga0157376_102466013 85
53 3300017792 Ga0163161_12055211 Ga0163161_120552111 85
54 3300025893 Ga0207682_10074108 Ga0207682_100741083 85
55 3300025908 Ga0207643_10607231 Ga0207643_106072311 85
56 3300025909 Ga0207705_11463360 Ga0207705_114633601 85
57 3300025918 Ga0207662_10527352 Ga0207662_105273522 85
58 3300025923 Ga0207681_10461414 Ga0207681_104614141 85
59 3300025926 Ga0207659_10175073 Ga0207659_101750732 85
60 3300025926 Ga0207659_11876848 Ga0207659_118768482 85
61 3300025931 Ga0207644_11443530 Ga0207644_114435302 85
62 3300025940 Ga0207691_10241382 Ga0207691_102413823 85
63 3300025942 Ga0207689_10141841 Ga0207689_101418413 85
64 3300025960 Ga0207651_10436874 Ga0207651_104368742 85
65 3300025981 Ga0207640_11924286 Ga0207640_119242862 85
66 3300025986 Ga0207658_10471169 Ga0207658_104711691 85
67 3300026088 Ga0207641_11098884 Ga0207641_110988842 85
68 3300026089 Ga0207648_10556719 Ga0207648_105567192 85
69 3300026121 Ga0207683_11209375 Ga0207683_112093752 85
70 3300027462 Ga0210000_1060146 Ga0210000_10601462 85
71 3300027526 Ga0209968_1040006 Ga0209968_10400062 85
72 3300027907 Ga0207428_10043304 Ga0207428_100433044 85
73 3300027907 Ga0207428_10772990 Ga0207428_107729902 85
74 3300028380 Ga0268265_11550864 Ga0268265_115508641 85
75 3300031240 Ga0265320_10457119 Ga0265320_104571191 85
76 3300031250 Ga0265331_10109927 Ga0265331_101099271 85
77 3300031456 Ga0307513_10429419 Ga0307513_104294191 85
78 3300031727 Ga0316576_10007759 Ga0316576_100077594 85
79 3300031733 Ga0316577_10232668 Ga0316577_102326682 85
80 3300031903 Ga0307407_10509429 Ga0307407_105094292 85
81 3300035398 Ga0316574_0145510 Ga0316574_0145510_705_962 85
82 3300036401 Ga0373937_0117078 Ga0373937_0117078_269_526 85
83 3300036401 Ga0373937_0555809 Ga0373937_0555809_512_769 85
84 3300036712 Ga0316584_0055643 Ga0316584_0055643_1596_1853 85
85 3300041443 Ga0451789_1334491 Ga0451789_1334491_233_490 85
86 3300041451 Ga0451791_0622945 Ga0451791_0622945_51_308 85
87 3300041452 Ga0451793_0730076 Ga0451793_0730076_399_656 85
88 3300041453 Ga0451797_1526605 Ga0451797_1526605_423_680 85
89 3300041458 Ga0451798_0071954 Ga0451798_0071954_540_797 85
90 3300041459 Ga0451800_1134045 Ga0451800_1134045_219_476 85
91 3300041460 Ga0451802_1329548 Ga0451802_1329548_23_280 85
92 3300041486 Ga0451807_1727859 Ga0451807_1727859_871_1128 85
93 3300041509 Ga0451843_0981204 Ga0451843_0981204_150_407 85
94 3300046455 Ga0495603_0188564 Ga0495603_0188564_61_318 85
95 3300046455 Ga0495603_0822176 Ga0495603_0822176_25_282 85
96 3300046458 Ga0495591_045888 Ga0495591_045888_129_386 85
97 3300046459 Ga0495629_0234037 Ga0495629_0234037_30_287 85
98 3300046459 Ga0495629_0337672 Ga0495629_0337672_17_274 85
99 3300046472 Ga0495580_0414430 Ga0495580_0414430_624_881 85
100 3300046472 Ga0495580_0742434 Ga0495580_0742434_285_542 85
101 3300046475 Ga0495639_0074366 Ga0495639_0074366_778_1035 85
102 3300046477 Ga0495664_0088156 Ga0495664_0088156_643_900 85
103 3300046518 Ga0495631_0490507 Ga0495631_0490507_149_406 85
104 3300046523 Ga0495644_0050781 Ga0495644_0050781_241_498 85
105 3300046524 Ga0495648_0312451 Ga0495648_0312451_362_619 85
106 3300046530 Ga0495654_0099094 Ga0495654_0099094_307_564 85
107 3300046535 Ga0495586_0739713 Ga0495586_0739713_34_291 85
108 3300046539 Ga0495621_0007215 Ga0495621_0007215_2290_2547 85
109 3300046558 Ga0495633_0197052 Ga0495633_0197052_436_693 85
110 3300046681 Ga0495647_0018104 Ga0495647_0018104_981_1238 85
111 3300046689 Ga0495613_0151126 Ga0495613_0151126_627_884 85
112 3300046689 Ga0495613_0415527 Ga0495613_0415527_537_794 85
113 3300046809 Ga0495600_0470413 Ga0495600_0470413_175_432 85
114 3300047319 Ga0495674_0245065 Ga0495674_0245065_881_1138 85
115 3300047445 Ga0495677_0109832 Ga0495677_0109832_322_579 85
116 3300047472 Ga0495686_0113447 Ga0495686_0113447_1220_1477 85
117 3300047673 Ga0495593_0292228 Ga0495593_0292228_520_777 85
118 3300048913 Ga0496110_1008179 Ga0496110_1008179_93_350 85
119 3300049568 Ga0501031_0451789 Ga0501031_0451789_197_454 85
120 3300049568 Ga0501031_0860079 Ga0501031_0860079_76_333 85
121 3300049570 Ga0501033_0071202 Ga0501033_0071202_1315_1572 85
122 3300049572 Ga0501036_0003994 Ga0501036_0003994_2198_2455 85
123 3300049572 Ga0501036_1147619 Ga0501036_1147619_10_267 85
124 3300049573 Ga0501037_0255173 Ga0501037_0255173_830_1087 85
125 3300049574 Ga0501038_0006721 Ga0501038_0006721_9035_9292 85
126 3300049575 Ga0501039_0010751 Ga0501039_0010751_6028_6285 85
127 3300049575 Ga0501039_0735362 Ga0501039_0735362_53_310 85
128 3300049576 Ga0501040_0003685 Ga0501040_0003685_6729_6986 85
129 3300049576 Ga0501040_0004342 Ga0501040_0004342_6142_6399 85
130 3300049576 Ga0501040_1089110 Ga0501040_1089110_202_459 85
131 3300049577 Ga0501041_0002953 Ga0501041_0002953_1068_1325 85
132 3300049577 Ga0501041_0012431 Ga0501041_0012431_60_317 85
133 3300049577 Ga0501041_0213463 Ga0501041_0213463_718_975 85
134 3300049577 Ga0501041_0451194 Ga0501041_0451194_372_629 85
135 3300049578 Ga0501042_0003310 Ga0501042_0003310_3378_3635 85
136 3300049578 Ga0501042_0076695 Ga0501042_0076695_2008_2265 85
137 3300049579 Ga0501043_0573578 Ga0501043_0573578_487_744 85
138 3300049580 Ga0501046_0003536 Ga0501046_0003536_5021_5278 85
139 3300049582 Ga0501048_0004812 Ga0501048_0004812_6806_7063 85
140 3300049582 Ga0501048_0067436 Ga0501048_0067436_642_899 85
141 3300049582 Ga0501048_1414785 Ga0501048_1414785_213_470 85
142 3300049584 Ga0501068_1112498 Ga0501068_1112498_166_423 85
143 3300049586 Ga0501070_1068535 Ga0501070_1068535_298_555 85
144 3300049587 Ga0501071_0001540 Ga0501071_0001540_3906_4163 85
145 3300049587 Ga0501071_0069646 Ga0501071_0069646_1966_2223 85
146 3300049587 Ga0501071_0431610 Ga0501071_0431610_205_462 85
147 3300049588 Ga0501072_0012132 Ga0501072_0012132_2208_2465 85
148 3300049588 Ga0501072_0012597 Ga0501072_0012597_5572_5829 85
149 3300049589 Ga0501073_0175068 Ga0501073_0175068_516_773 85
150 3300049589 Ga0501073_0820955 Ga0501073_0820955_200_457 85
151 3300049590 Ga0501074_0049116 Ga0501074_0049116_807_1064 85
152 3300049590 Ga0501074_0073437 Ga0501074_0073437_67_324 85
153 3300049590 Ga0501074_1177059 Ga0501074_1177059_248_505 85
154 3300049591 Ga0501075_0001216 Ga0501075_0001216_10217_10474 85
155 3300049591 Ga0501075_0076770 Ga0501075_0076770_1172_1429 85
156 3300049591 Ga0501075_0575092 Ga0501075_0575092_100_357 85
157 3300049592 Ga0501076_0006804 Ga0501076_0006804_7216_7473 85
158 3300049592 Ga0501076_0155282 Ga0501076_0155282_1059_1316 85
159 3300049592 Ga0501076_0621292 Ga0501076_0621292_517_774 85
160 3300049593 Ga0501077_0010223 Ga0501077_0010223_1998_2255 85
161 3300049741 Ga0501079_0002187 Ga0501079_0002187_2593_2850 85
162 3300049741 Ga0501079_0121281 Ga0501079_0121281_1646_1903 85
163 3300049741 Ga0501079_0268996 Ga0501079_0268996_717_974 85
164 3300049741 Ga0501079_0962770 Ga0501079_0962770_44_301 85
165 3300049742 Ga0501080_0003675 Ga0501080_0003675_3722_3979 85
166 3300049742 Ga0501080_0110143 Ga0501080_0110143_1946_2203 85
167 3300049742 Ga0501080_0191856 Ga0501080_0191856_1231_1488 85
168 3300049743 Ga0501081_0002620 Ga0501081_0002620_10369_10626 85
169 3300049743 Ga0501081_0075009 Ga0501081_0075009_282_539 85
170 3300049743 Ga0501081_0133482 Ga0501081_0133482_1138_1395 85
171 3300049743 Ga0501081_0214930 Ga0501081_0214930_666_923 85
172 3300049743 Ga0501081_0472939 Ga0501081_0472939_662_919 85
173 3300049744 Ga0501083_0052825 Ga0501083_0052825_2040_2297 85
174 3300049744 Ga0501083_0602568 Ga0501083_0602568_206_463 85
175 3300049744 Ga0501083_0906977 Ga0501083_0906977_264_521 85
176 3300049822 Ga0501035_0104697 Ga0501035_0104697_1141_1398 85
177 3300049824 Ga0501045_0002837 Ga0501045_0002837_10657_10914 85
178 3300049824 Ga0501045_0013189 Ga0501045_0013189_4950_5207 85
179 3300050507 nmdc:mga05p37_60382_c1 nmdc:mga05p37_60382_c1_278_535 85
180 3300050508 nmdc:mga09592_1644125_c1 nmdc:mga09592_1644125_c1_145_402 85
181 3300050511 nmdc:mga08y16_280438_c1 nmdc:mga08y16_280438_c1_362_619 85
182 3300050511 nmdc:mga08y16_65021_c1 nmdc:mga08y16_65021_c1_915_1172 85
183 3300050512 nmdc:mga0n895_16043_c1 nmdc:mga0n895_16043_c1_4481_4738 85
184 3300050513 nmdc:mga0rr50_820016_c1 nmdc:mga0rr50_820016_c1_409_666 85
185 3300050515 nmdc:mga0a205_9194_c1 nmdc:mga0a205_9194_c1_7691_7948 85
186 3300054114 Ga0501084_0000340 Ga0501084_0000340_34408_34665 85
187 3300054114 Ga0501084_0152613 Ga0501084_0152613_145_402 85
188 3300054114 Ga0501084_0994444 Ga0501084_0994444_112_369 85
189 3300054114 Ga0501084_1074353 Ga0501084_1074353_88_345 85
190 3300060353 Ga0501082_0003014 Ga0501082_0003014_6521_6778 85
191 3300060353 Ga0501082_0082975 Ga0501082_0082975_470_727 85
192 3300060353 Ga0501082_1257324 Ga0501082_1257324_187_444 85
193 3300061734 Ga0530510_0004076 Ga0530510_0004076_7311_7568 85
194 3300061734 Ga0530510_0026414 Ga0530510_0026414_3345_3602 85
195 3300061734 Ga0530510_0032714 Ga0530510_0032714_3282_3539 85
196 iso_pu_bacteria 2574179768 2574431107 85
197 3300005841 Ga0068863_101416778 Ga0068863_1014167782 86
198 3300026088 Ga0207641_11231562 Ga0207641_112315622 86
199 3300028794 Ga0307515_10114699 Ga0307515_101146993 86
200 3300031665 Ga0316575_10083908 Ga0316575_100839082 86
201 3300041512 Ga0451853_3495509 Ga0451853_3495509_367_630 86
202 3300042876 Ga0451577_0141707 Ga0451577_0141707_870_1130 86
203 3300044673 Ga0453683_0057997 Ga0453683_0057997_873_1133 86
204 3300044712 Ga0453684_0080604 Ga0453684_0080604_1187_1447 86
205 3300045051 Ga0451576_0087654 Ga0451576_0087654_1618_1878 86
206 3300049583 Ga0501067_0304048 Ga0501067_0304048_404_664 86
207 3300053140 Ga0500573_0320380 Ga0500573_0320380_343_603 86
208 3300053153 Ga0500616_0063191 Ga0500616_0063191_1619_1879 86
209 3300005336 Ga0070680_100220232 Ga0070680_1002202323 87
210 3300005435 Ga0070714_100046383 Ga0070714_1000463835 87
211 3300005435 Ga0070714_101205251 Ga0070714_1012052511 87
212 3300005435 Ga0070714_102235140 Ga0070714_1022351401 87
213 3300005436 Ga0070713_100651688 Ga0070713_1006516881 87
214 3300005439 Ga0070711_101392627 Ga0070711_1013926272 87
215 3300005445 Ga0070708_101143182 Ga0070708_1011431822 87
216 3300005458 Ga0070681_10155492 Ga0070681_101554923 87
217 3300005518 Ga0070699_100038047 Ga0070699_1000380472 87
218 3300005536 Ga0070697_101432463 Ga0070697_1014324632 87
219 3300005545 Ga0070695_100050009 Ga0070695_1000500094 87
220 3300005546 Ga0070696_100228535 Ga0070696_1002285352 87
221 3300005614 Ga0068856_101962575 Ga0068856_1019625751 87
222 3300006028 Ga0070717_10000760 Ga0070717_100007604 87
223 3300006163 Ga0070715_10136337 Ga0070715_101363371 87
224 3300006173 Ga0070716_100073753 Ga0070716_1000737533 87
225 3300006173 Ga0070716_100261823 Ga0070716_1002618232 87
226 3300006173 Ga0070716_100296973 Ga0070716_1002969732 87
227 3300006175 Ga0070712_100195131 Ga0070712_1001951311 87
228 3300006175 Ga0070712_100608330 Ga0070712_1006083302 87
229 3300006846 Ga0075430_100303868 Ga0075430_1003038682 87
230 3300006871 Ga0075434_100190538 Ga0075434_1001905382 87
231 3300006914 Ga0075436_100064140 Ga0075436_1000641402 87
232 3300007076 Ga0075435_100078594 Ga0075435_1000785944 87
233 3300007265 Ga0099794_10107726 Ga0099794_101077262 87
234 3300010159 Ga0099796_10004720 Ga0099796_100047205 87
235 3300013306 Ga0163162_13353181 Ga0163162_133531811 87
236 3300021358 Ga0213873_10120672 Ga0213873_101206721 87
237 3300021377 Ga0213874_10029286 Ga0213874_100292863 87
238 3300021441 Ga0213871_10033535 Ga0213871_100335352 87
239 3300021441 Ga0213871_10074139 Ga0213871_100741391 87
240 3300025905 Ga0207685_10206128 Ga0207685_102061282 87
241 3300025905 Ga0207685_10710040 Ga0207685_107100402 87
242 3300025906 Ga0207699_10040830 Ga0207699_100408301 87
243 3300025912 Ga0207707_10030748 Ga0207707_100307485 87
244 3300025915 Ga0207693_10105161 Ga0207693_101051612 87
245 3300025915 Ga0207693_10140040 Ga0207693_101400402 87
246 3300025915 Ga0207693_10410367 Ga0207693_104103672 87
247 3300025916 Ga0207663_10193450 Ga0207663_101934502 87
248 3300025916 Ga0207663_10966220 Ga0207663_109662202 87
249 3300025917 Ga0207660_10238606 Ga0207660_102386062 87
250 3300025928 Ga0207700_10333694 Ga0207700_103336942 87
251 3300025928 Ga0207700_10798771 Ga0207700_107987711 87
252 3300025929 Ga0207664_10011864 Ga0207664_100118645 87
253 3300025939 Ga0207665_10165087 Ga0207665_101650872 87
254 3300025939 Ga0207665_10228444 Ga0207665_102284442 87
255 3300025939 Ga0207665_11494269 Ga0207665_114942692 87
256 3300026078 Ga0207702_11614864 Ga0207702_116148641 87
257 3300028794 Ga0307515_10382947 Ga0307515_103829472 87
258 3300028800 Ga0265338_10187301 Ga0265338_101873012 87
259 3300030763 Ga0265763_1001427 Ga0265763_10014272 87
260 3300030963 Ga0265768_112292 Ga0265768_1122922 87
261 3300031456 Ga0307513_10413620 Ga0307513_104136202 87
262 3300031595 Ga0265313_10257489 Ga0265313_102574891 87
263 3300035172 Ga0373955_0056144 Ga0373955_0056144_1535_1798 87
264 3300036401 Ga0373937_0041733 Ga0373937_0041733_3099_3362 87
265 3300037853 Ga0436364_0477485 Ga0436364_0477485_324_587 87
266 3300039438 Ga0436360_0086470 Ga0436360_0086470_195_458 87
267 3300039438 Ga0436360_0766596 Ga0436360_0766596_15450_15713 87
268 3300039438 Ga0436360_0831083 Ga0436360_0831083_945_1208 87
269 3300039438 Ga0436360_0970001 Ga0436360_0970001_464_727 87
270 3300039447 Ga0436361_0477235 Ga0436361_0477235_165_428 87
271 3300039447 Ga0436361_0501117 Ga0436361_0501117_346_609 87
272 3300039447 Ga0436361_0654178 Ga0436361_0654178_810_1073 87
273 3300039447 Ga0436361_1160407 Ga0436361_1160407_781_1044 87
274 3300039450 Ga0436363_0045740 Ga0436363_0045740_596_859 87
275 3300039450 Ga0436363_0237012 Ga0436363_0237012_70_333 87
276 3300039450 Ga0436363_0868312 Ga0436363_0868312_22_285 87
277 3300039453 Ga0436362_0063292 Ga0436362_0063292_147_410 87
278 3300039453 Ga0436362_0075590 Ga0436362_0075590_999_1262 87
279 3300039453 Ga0436362_0340884 Ga0436362_0340884_399_662 87
280 3300039453 Ga0436362_0828451 Ga0436362_0828451_444_707 87
281 3300039453 Ga0436362_0907425 Ga0436362_0907425_136_399 87
282 3300042876 Ga0451577_0989231 Ga0451577_0989231_303_575 87
283 3300044656 Ga0466969_0031684 Ga0466969_0031684_210_473 87
284 3300044673 Ga0453683_0086552 Ga0453683_0086552_64_336 87
285 3300044712 Ga0453684_0511371 Ga0453684_0511371_1019_1291 87
286 3300044712 Ga0453684_0878115 Ga0453684_0878115_641_913 87
287 3300044712 Ga0453684_2259650 Ga0453684_2259650_240_512 87
288 3300045051 Ga0451576_0000046 Ga0451576_0000046_140835_141107 87
289 3300045051 Ga0451576_0015026 Ga0451576_0015026_3304_3576 87
290 3300046516 Ga0495628_1103804 Ga0495628_1103804_95_358 87
291 3300046519 Ga0495632_0212921 Ga0495632_0212921_205_468 87
292 3300046543 Ga0495645_0376363 Ga0495645_0376363_51_314 87
293 3300046679 Ga0495623_0155348 Ga0495623_0155348_484_747 87
294 3300046679 Ga0495623_0510091 Ga0495623_0510091_41_304 87
295 3300046809 Ga0495600_0825357 Ga0495600_0825357_249_512 87
296 3300047317 Ga0495604_0175094 Ga0495604_0175094_1174_1437 87
297 3300048088 Ga0495602_0341522 Ga0495602_0341522_426_689 87
298 3300048905 Ga0496102_1260356 Ga0496102_1260356_318_581 87
299 3300048907 Ga0496104_0556064 Ga0496104_0556064_503_766 87
300 3300048907 Ga0496104_1595494 Ga0496104_1595494_190_453 87
301 3300048908 Ga0496105_0280070 Ga0496105_0280070_772_1035 87
302 3300048909 Ga0496106_0651137 Ga0496106_0651137_407_670 87
303 3300048916 Ga0496113_0499499 Ga0496113_0499499_595_858 87
304 3300049575 Ga0501039_0189216 Ga0501039_0189216_1257_1520 87
305 3300050509 nmdc:mga0qj67_384617_c1 nmdc:mga0qj67_384617_c1_358_621 87
306 3300050512 nmdc:mga0n895_141969_c1 nmdc:mga0n895_141969_c1_1698_1961 87
307 3300050513 nmdc:mga0rr50_358444_c1 nmdc:mga0rr50_358444_c1_434_697 87
308 3300053078 Ga0495612_0032435 Ga0495612_0032435_866_1129 87
309 3300053078 Ga0495612_0161196 Ga0495612_0161196_674_937 87
310 3300053090 Ga0500646_0154254 Ga0500646_0154254_383_646 87
311 3300053092 Ga0500583_0004150 Ga0500583_0004150_837_1100 87
312 3300053096 Ga0500641_0007963 Ga0500641_0007963_3458_3721 87
313 3300053100 Ga0500660_097501 Ga0500660_097501_560_823 87
314 3300053109 Ga0500569_290496 Ga0500569_290496_167_430 87
315 3300053131 Ga0500652_124533 Ga0500652_124533_327_590 87
316 3300005355 Ga0070671_100001600 Ga0070671_1000016008 88
317 3300005365 Ga0070688_100127686 Ga0070688_1001276862 88
318 3300005544 Ga0070686_100465269 Ga0070686_1004652692 88
319 3300005841 Ga0068863_100850934 Ga0068863_1008509342 88
320 3300009176 Ga0105242_10866816 Ga0105242_108668162 88
321 3300013297 Ga0157378_12612424 Ga0157378_126124241 88
322 3300025901 Ga0207688_10441734 Ga0207688_104417341 88
323 3300025903 Ga0207680_10980035 Ga0207680_109800352 88
324 3300025916 Ga0207663_10453555 Ga0207663_104535551 88
325 3300025918 Ga0207662_10353526 Ga0207662_103535261 88
326 3300025931 Ga0207644_10001117 Ga0207644_1000111711 88
327 3300025934 Ga0207686_10721576 Ga0207686_107215762 88
328 3300026088 Ga0207641_10221982 Ga0207641_102219822 88
329 3300044712 Ga0453684_0350059 Ga0453684_0350059_1085_1360 88
330 3300053093 Ga0500651_0057949 Ga0500651_0057949_958_1224 88
331 3300005334 Ga0068869_100953051 Ga0068869_1009530512 89
332 3300005335 Ga0070666_10060735 Ga0070666_100607353 89
333 3300005338 Ga0068868_100113483 Ga0068868_1001134831 89
334 3300005355 Ga0070671_100045856 Ga0070671_1000458561 89
335 3300005364 Ga0070673_100002156 Ga0070673_1000021568 89
336 3300005367 Ga0070667_100065881 Ga0070667_1000658811 89
337 3300005434 Ga0070709_10004940 Ga0070709_100049401 89
338 3300005436 Ga0070713_100006790 Ga0070713_1000067906 89
339 3300005437 Ga0070710_10003950 Ga0070710_100039503 89
340 3300005439 Ga0070711_100010223 Ga0070711_1000102235 89
341 3300005440 Ga0070705_100032801 Ga0070705_1000328012 89
342 3300005456 Ga0070678_100003428 Ga0070678_1000034283 89
343 3300005459 Ga0068867_101518976 Ga0068867_1015189761 89
344 3300005543 Ga0070672_100903479 Ga0070672_1009034792 89
345 3300005544 Ga0070686_100526673 Ga0070686_1005266732 89
346 3300005545 Ga0070695_100087477 Ga0070695_1000874772 89
347 3300005546 Ga0070696_100510005 Ga0070696_1005100052 89
348 3300005548 Ga0070665_100004871 Ga0070665_10000487110 89
349 3300005563 Ga0068855_100453038 Ga0068855_1004530383 89
350 3300005614 Ga0068856_100011130 Ga0068856_1000111307 89
351 3300005617 Ga0068859_100304358 Ga0068859_1003043583 89
352 3300005718 Ga0068866_10011986 Ga0068866_100119862 89
353 3300005841 Ga0068863_100024954 Ga0068863_1000249545 89
354 3300005842 Ga0068858_100055111 Ga0068858_1000551112 89
355 3300005843 Ga0068860_100011176 Ga0068860_1000111763 89
356 3300006163 Ga0070715_10002439 Ga0070715_100024397 89
357 3300006173 Ga0070716_100005892 Ga0070716_1000058926 89
358 3300006175 Ga0070712_100030975 Ga0070712_1000309751 89
359 3300006237 Ga0097621_100040451 Ga0097621_1000404513 89
360 3300006358 Ga0068871_100004650 Ga0068871_1000046506 89
361 3300006931 Ga0097620_100304362 Ga0097620_1003043622 89
362 3300009011 Ga0105251_10463151 Ga0105251_104631512 89
363 3300009098 Ga0105245_10016229 Ga0105245_100162295 89
364 3300009101 Ga0105247_10015518 Ga0105247_100155183 89
365 3300009177 Ga0105248_10025370 Ga0105248_100253706 89
366 3300009545 Ga0105237_10739728 Ga0105237_107397281 89
367 3300009551 Ga0105238_12482647 Ga0105238_124826472 89
368 3300009553 Ga0105249_10274888 Ga0105249_102748883 89
369 3300010375 Ga0105239_10041139 Ga0105239_100411394 89
370 3300013296 Ga0157374_10063599 Ga0157374_100635993 89
371 3300013297 Ga0157378_10004170 Ga0157378_100041707 89
372 3300013306 Ga0163162_10067993 Ga0163162_100679932 89
373 3300013307 Ga0157372_10851934 Ga0157372_108519342 89
374 3300013308 Ga0157375_10065112 Ga0157375_100651125 89
375 3300014968 Ga0157379_10043135 Ga0157379_100431353 89
376 3300014969 Ga0157376_10067583 Ga0157376_100675832 89
377 3300017792 Ga0163161_11523473 Ga0163161_115234731 89
378 3300021358 Ga0213873_10012196 Ga0213873_100121962 89
379 3300021377 Ga0213874_10005551 Ga0213874_100055512 89
380 3300024227 Ga0228598_1039800 Ga0228598_10398001 89
381 3300025898 Ga0207692_10009224 Ga0207692_100092243 89
382 3300025899 Ga0207642_10106921 Ga0207642_101069212 89
383 3300025900 Ga0207710_10556803 Ga0207710_105568032 89
384 3300025903 Ga0207680_10229957 Ga0207680_102299572 89
385 3300025905 Ga0207685_10102133 Ga0207685_101021333 89
386 3300025906 Ga0207699_10094159 Ga0207699_100941592 89
387 3300025915 Ga0207693_10001234 Ga0207693_1000123413 89
388 3300025916 Ga0207663_10006531 Ga0207663_100065318 89
389 3300025927 Ga0207687_10060791 Ga0207687_100607912 89
390 3300025928 Ga0207700_10194355 Ga0207700_101943553 89
391 3300025929 Ga0207664_10578554 Ga0207664_105785541 89
392 3300025931 Ga0207644_10015950 Ga0207644_100159504 89
393 3300025938 Ga0207704_10720892 Ga0207704_107208922 89
394 3300025939 Ga0207665_10004448 Ga0207665_100044486 89
395 3300025941 Ga0207711_10119829 Ga0207711_101198294 89
396 3300025942 Ga0207689_10850800 Ga0207689_108508002 89
397 3300025949 Ga0207667_10367869 Ga0207667_103678692 89
398 3300025960 Ga0207651_10051352 Ga0207651_100513522 89
399 3300025986 Ga0207658_10040613 Ga0207658_100406132 89
400 3300026023 Ga0207677_11313773 Ga0207677_113137731 89
401 3300026035 Ga0207703_10143532 Ga0207703_101435321 89
402 3300026078 Ga0207702_10175164 Ga0207702_101751641 89
403 3300026088 Ga0207641_10575778 Ga0207641_105757782 89
404 3300026089 Ga0207648_10161837 Ga0207648_101618372 89
405 3300026095 Ga0207676_10247113 Ga0207676_102471131 89
406 3300026121 Ga0207683_10012302 Ga0207683_100123026 89
407 3300028379 Ga0268266_10347935 Ga0268266_103479352 89
408 3300028381 Ga0268264_10584281 Ga0268264_105842811 89
409 3300030732 Ga0316176_1176152 Ga0316176_11761522 89
410 3300031824 Ga0307413_10966564 Ga0307413_109665643 89
411 3300031852 Ga0307410_11136746 Ga0307410_111367462 89
412 3300031903 Ga0307407_10139544 Ga0307407_101395442 89
413 3300032126 Ga0307415_100590832 Ga0307415_1005908322 89
414 3300035116 Ga0373945_0041352 Ga0373945_0041352_199_468 89
415 3300035118 Ga0373954_0012268 Ga0373954_0012268_1833_2102 89
416 3300035119 Ga0373956_0030548 Ga0373956_0030548_1737_2006 89
417 3300035170 Ga0373943_0064800 Ga0373943_0064800_478_747 89
418 3300035171 Ga0373946_0098183 Ga0373946_0098183_286_555 89
419 3300035172 Ga0373955_0207351 Ga0373955_0207351_692_961 89
420 3300035692 Ga0373935_0800188 Ga0373935_0800188_406_675 89
421 3300035695 Ga0373927_0030967 Ga0373927_0030967_740_1009 89
422 3300035724 Ga0373933_0322529 Ga0373933_0322529_35_304 89
423 3300036401 Ga0373937_0217963 Ga0373937_0217963_348_617 89
424 3300037068 Ga0373925_0092039 Ga0373925_0092039_115_384 89
425 3300037068 Ga0373925_0122502 Ga0373925_0122502_1621_1890 89
426 3300039437 Ga0436365_0942025 Ga0436365_0942025_2932_3201 89
427 3300039437 Ga0436365_1109929 Ga0436365_1109929_181_450 89
428 3300039437 Ga0436365_1346489 Ga0436365_1346489_152_421 89
429 3300039450 Ga0436363_0269421 Ga0436363_0269421_42_311 89
430 3300039450 Ga0436363_1492427 Ga0436363_1492427_1507_1776 89
431 3300039453 Ga0436362_0734099 Ga0436362_0734099_1702_1971 89
432 3300046472 Ga0495580_0349641 Ga0495580_0349641_149_418 89
433 3300046473 Ga0495582_0113293 Ga0495582_0113293_754_1023 89
434 3300046477 Ga0495664_0264049 Ga0495664_0264049_481_750 89
435 3300046511 Ga0495608_0481137 Ga0495608_0481137_101_370 89
436 3300046514 Ga0495618_0071963 Ga0495618_0071963_1603_1872 89
437 3300046517 Ga0495630_0067544 Ga0495630_0067544_2374_2643 89
438 3300046531 Ga0495665_0701489 Ga0495665_0701489_199_468 89
439 3300046675 Ga0495657_0271591 Ga0495657_0271591_254_523 89
440 3300046681 Ga0495647_0413604 Ga0495647_0413604_334_603 89
441 3300046683 Ga0495658_0509556 Ga0495658_0509556_465_734 89
442 3300048903 Ga0496100_0053077 Ga0496100_0053077_572_841 89
443 3300048904 Ga0496101_0182911 Ga0496101_0182911_1331_1600 89
444 3300048906 Ga0496103_0090911 Ga0496103_0090911_196_465 89
445 3300048907 Ga0496104_0081925 Ga0496104_0081925_1354_1623 89
446 3300048908 Ga0496105_0009915 Ga0496105_0009915_1729_1998 89
447 3300048909 Ga0496106_0014237 Ga0496106_0014237_2595_2864 89
448 3300048910 Ga0496107_0073989 Ga0496107_0073989_1660_1929 89
449 3300048911 Ga0496108_0060411 Ga0496108_0060411_2611_2880 89
450 3300048912 Ga0496109_0008587 Ga0496109_0008587_1916_2185 89
451 3300048913 Ga0496110_0003769 Ga0496110_0003769_3035_3304 89
452 3300048914 Ga0496111_0019260 Ga0496111_0019260_2518_2787 89
453 3300048915 Ga0496112_0031109 Ga0496112_0031109_2291_2560 89
454 3300048916 Ga0496113_0114120 Ga0496113_0114120_1727_1996 89
455 3300048917 Ga0496114_0005168 Ga0496114_0005168_5809_6078 89
456 3300049528 Ga0501312_035006 Ga0501312_035006_396_668 89
457 3300049577 Ga0501041_0610760 Ga0501041_0610760_363_632 89
458 3300049588 Ga0501072_1557609 Ga0501072_1557609_64_333 89
459 3300050513 nmdc:mga0rr50_1748325_c1 nmdc:mga0rr50_1748325_c1_237_506 89
460 3300005327 Ga0070658_11074880 Ga0070658_110748802 90
461 3300005344 Ga0070661_100286571 Ga0070661_1002865712 90
462 3300005618 Ga0068864_100357428 Ga0068864_1003574282 90
463 3300005844 Ga0068862_100100277 Ga0068862_1001002772 90
464 3300009093 Ga0105240_10055791 Ga0105240_100557914 90
465 3300009093 Ga0105240_10104214 Ga0105240_101042145 90
466 3300009545 Ga0105237_11964051 Ga0105237_119640511 90
467 3300009551 Ga0105238_10509300 Ga0105238_105093002 90
468 3300009553 Ga0105249_10467819 Ga0105249_104678192 90
469 3300014325 Ga0163163_10297117 Ga0163163_102971172 90
470 3300014968 Ga0157379_10893019 Ga0157379_108930192 90
471 3300025909 Ga0207705_10845286 Ga0207705_108452862 90
472 3300025913 Ga0207695_10082369 Ga0207695_100823692 90
473 3300025913 Ga0207695_10209268 Ga0207695_102092683 90
474 3300025920 Ga0207649_10613714 Ga0207649_106137142 90
475 3300025924 Ga0207694_10820205 Ga0207694_108202052 90
476 3300025961 Ga0207712_10330185 Ga0207712_103301852 90
477 3300028379 Ga0268266_10024405 Ga0268266_100244053 90
478 3300028380 Ga0268265_10141141 Ga0268265_101411413 90
479 3300044693 Ga0466961_0114113 Ga0466961_0114113_1384_1659 90
480 3300044712 Ga0453684_0038649 Ga0453684_0038649_288_560 90
481 3300045049 Ga0466959_0296220 Ga0466959_0296220_52_327 90
482 3300048926 Ga0496123_0319298 Ga0496123_0319298_56_343 90
483 3300005334 Ga0068869_101539412 Ga0068869_1015394121 91
484 3300005337 Ga0070682_101363353 Ga0070682_1013633532 91
485 3300005338 Ga0068868_101961260 Ga0068868_1019612601 91
486 3300005345 Ga0070692_10713532 Ga0070692_107135321 91
487 3300005355 Ga0070671_100260477 Ga0070671_1002604773 91
488 3300005457 Ga0070662_100352551 Ga0070662_1003525511 91
489 3300005530 Ga0070679_100363692 Ga0070679_1003636921 91
490 3300005536 Ga0070697_101008717 Ga0070697_1010087172 91
491 3300005549 Ga0070704_100055374 Ga0070704_1000553742 91
492 3300005578 Ga0068854_101068171 Ga0068854_1010681712 91
493 3300006852 Ga0075433_10341105 Ga0075433_103411052 91
494 3300007076 Ga0075435_101598602 Ga0075435_1015986022 91
495 3300009147 Ga0114129_10277066 Ga0114129_102770663 91
496 3300010375 Ga0105239_10506505 Ga0105239_105065052 91
497 3300013297 Ga0157378_11972821 Ga0157378_119728212 91
498 3300025917 Ga0207660_11431983 Ga0207660_114319832 91
499 3300025920 Ga0207649_11373854 Ga0207649_113738542 91
500 3300025921 Ga0207652_11445557 Ga0207652_114455572 91
501 3300025927 Ga0207687_10270485 Ga0207687_102704852 91
502 3300025932 Ga0207690_11451859 Ga0207690_114518592 91
503 3300025938 Ga0207704_10529524 Ga0207704_105295242 91
504 3300025981 Ga0207640_10744126 Ga0207640_107441262 91
505 3300026121 Ga0207683_11219393 Ga0207683_112193932 91
506 3300028800 Ga0265338_10222478 Ga0265338_102224782 91
507 3300031247 Ga0265340_10021798 Ga0265340_100217985 91
508 3300031247 Ga0265340_10213596 Ga0265340_102135961 91
509 3300048904 Ga0496101_0734679 Ga0496101_0734679_389_664 91
510 3300048905 Ga0496102_0140257 Ga0496102_0140257_1876_2151 91
511 3300048905 Ga0496102_0146867 Ga0496102_0146867_1899_2174 91
512 3300048909 Ga0496106_0413952 Ga0496106_0413952_719_994 91
513 3300048910 Ga0496107_0288548 Ga0496107_0288548_839_1114 91
514 3300048912 Ga0496109_0276699 Ga0496109_0276699_977_1252 91
515 3300048913 Ga0496110_0558358 Ga0496110_0558358_123_398 91
516 3300048914 Ga0496111_0097004 Ga0496111_0097004_371_646 91
517 3300048915 Ga0496112_0081124 Ga0496112_0081124_1063_1338 91
518 3300050507 nmdc:mga05p37_335223_c1 nmdc:mga05p37_335223_c1_1010_1285 91
519 3300050512 nmdc:mga0n895_112570_c1 nmdc:mga0n895_112570_c1_2058_2333 91
520 3300050513 nmdc:mga0rr50_1356395_c1 nmdc:mga0rr50_1356395_c1_208_483 91
521 3300050515 nmdc:mga0a205_167973_c1 nmdc:mga0a205_167973_c1_950_1225 91
522 3300060346 Ga0587111_0226171 Ga0587111_0226171_25_300 91
523 3300003322 rootL2_10005201 rootL2_100052015 92
524 3300004799 Ga0058863_11557338 Ga0058863_115573381 92
525 3300004800 Ga0058861_10031889 Ga0058861_100318891 92
526 3300004800 Ga0058861_11881647 Ga0058861_118816471 92
527 3300004803 Ga0058862_12676565 Ga0058862_126765651 92
528 3300005329 Ga0070683_100071707 Ga0070683_1000717073 92
529 3300005329 Ga0070683_102110982 Ga0070683_1021109821 92
530 3300005330 Ga0070690_100073158 Ga0070690_1000731584 92
531 3300005331 Ga0070670_100093327 Ga0070670_1000933274 92
532 3300005335 Ga0070666_10003541 Ga0070666_100035415 92
533 3300005335 Ga0070666_10050030 Ga0070666_100500302 92
534 3300005335 Ga0070666_10229154 Ga0070666_102291542 92
535 3300005336 Ga0070680_100008953 Ga0070680_10000895311 92
536 3300005336 Ga0070680_100035650 Ga0070680_1000356503 92
537 3300005339 Ga0070660_100362854 Ga0070660_1003628543 92
538 3300005340 Ga0070689_100509167 Ga0070689_1005091673 92
539 3300005341 Ga0070691_10959208 Ga0070691_109592081 92
540 3300005355 Ga0070671_100000151 Ga0070671_1000001514 92
541 3300005367 Ga0070667_100006038 Ga0070667_10000603810 92
542 3300005367 Ga0070667_100144166 Ga0070667_1001441663 92
543 3300005367 Ga0070667_101153594 Ga0070667_1011535942 92
544 3300005434 Ga0070709_10133822 Ga0070709_101338223 92
545 3300005435 Ga0070714_100099986 Ga0070714_1000999864 92
546 3300005435 Ga0070714_100727071 Ga0070714_1007270712 92
547 3300005439 Ga0070711_101165513 Ga0070711_1011655132 92
548 3300005455 Ga0070663_100015011 Ga0070663_1000150113 92
549 3300005458 Ga0070681_10024301 Ga0070681_100243015 92
550 3300005458 Ga0070681_10064439 Ga0070681_100644392 92
551 3300005466 Ga0070685_10433325 Ga0070685_104333252 92
552 3300005467 Ga0070706_101457542 Ga0070706_1014575421 92
553 3300005530 Ga0070679_100088711 Ga0070679_1000887113 92
554 3300005530 Ga0070679_100153605 Ga0070679_1001536053 92
555 3300005535 Ga0070684_100097767 Ga0070684_1000977672 92
556 3300005535 Ga0070684_100235917 Ga0070684_1002359172 92
557 3300005539 Ga0068853_100120842 Ga0068853_1001208422 92
558 3300005544 Ga0070686_100006579 Ga0070686_1000065795 92
559 3300005547 Ga0070693_100268429 Ga0070693_1002684291 92
560 3300005548 Ga0070665_100003611 Ga0070665_1000036116 92
561 3300005548 Ga0070665_100013789 Ga0070665_1000137894 92
562 3300005548 Ga0070665_100083403 Ga0070665_1000834034 92
563 3300005548 Ga0070665_100207913 Ga0070665_1002079132 92
564 3300005548 Ga0070665_100995694 Ga0070665_1009956943 92
565 3300005563 Ga0068855_100002251 Ga0068855_10000225118 92
566 3300005563 Ga0068855_100194400 Ga0068855_1001944004 92
567 3300005563 Ga0068855_100317537 Ga0068855_1003175373 92
568 3300005563 Ga0068855_101059198 Ga0068855_1010591981 92
569 3300005563 Ga0068855_101750191 Ga0068855_1017501911 92
570 3300005563 Ga0068855_102276696 Ga0068855_1022766962 92
571 3300005578 Ga0068854_100625654 Ga0068854_1006256541 92
572 3300005614 Ga0068856_100504036 Ga0068856_1005040361 92
573 3300005616 Ga0068852_100169717 Ga0068852_1001697173 92
574 3300005616 Ga0068852_100404967 Ga0068852_1004049673 92
575 3300005617 Ga0068859_100002492 Ga0068859_10000249215 92
576 3300005617 Ga0068859_100112422 Ga0068859_1001124224 92
577 3300005617 Ga0068859_102192543 Ga0068859_1021925432 92
578 3300005719 Ga0068861_100201276 Ga0068861_1002012762 92
579 3300005834 Ga0068851_10494564 Ga0068851_104945642 92
580 3300005841 Ga0068863_100002637 Ga0068863_10000263710 92
581 3300005841 Ga0068863_100237934 Ga0068863_1002379341 92
582 3300005842 Ga0068858_100012257 Ga0068858_1000122574 92
583 3300005842 Ga0068858_100044008 Ga0068858_1000440085 92
584 3300005842 Ga0068858_100216347 Ga0068858_1002163473 92
585 3300005842 Ga0068858_100910989 Ga0068858_1009109891 92
586 3300005842 Ga0068858_102408880 Ga0068858_1024088801 92
587 3300005843 Ga0068860_100000086 Ga0068860_10000008645 92
588 3300005843 Ga0068860_101453660 Ga0068860_1014536601 92
589 3300006237 Ga0097621_100014033 Ga0097621_1000140336 92
590 3300006237 Ga0097621_100074563 Ga0097621_1000745635 92
591 3300006358 Ga0068871_100018250 Ga0068871_1000182503 92
592 3300006358 Ga0068871_100047768 Ga0068871_1000477684 92
593 3300006931 Ga0097620_100002492 Ga0097620_1000024923 92
594 3300006931 Ga0097620_100112429 Ga0097620_1001124294 92
595 3300006931 Ga0097620_102192567 Ga0097620_1021925672 92
596 3300007788 Ga0099795_10000002 Ga0099795_1000000255 92
597 3300009092 Ga0105250_10442685 Ga0105250_104426852 92
598 3300009093 Ga0105240_10004128 Ga0105240_1000412816 92
599 3300009093 Ga0105240_10014216 Ga0105240_100142161 92
600 3300009093 Ga0105240_10020430 Ga0105240_100204306 92
601 3300009093 Ga0105240_10039058 Ga0105240_100390585 92
602 3300009093 Ga0105240_10071345 Ga0105240_100713452 92
603 3300009093 Ga0105240_10135285 Ga0105240_101352852 92
604 3300009093 Ga0105240_10249099 Ga0105240_102490991 92
605 3300009093 Ga0105240_10986188 Ga0105240_109861882 92
606 3300009093 Ga0105240_11744292 Ga0105240_117442921 92
607 3300009093 Ga0105240_11884654 Ga0105240_118846541 92
608 3300009098 Ga0105245_10160655 Ga0105245_101606553 92
609 3300009101 Ga0105247_10000121 Ga0105247_100001218 92
610 3300009101 Ga0105247_10037501 Ga0105247_100375012 92
611 3300009101 Ga0105247_10970141 Ga0105247_109701412 92
612 3300009174 Ga0105241_10250646 Ga0105241_102506463 92
613 3300009174 Ga0105241_11932227 Ga0105241_119322272 92
614 3300009177 Ga0105248_10033582 Ga0105248_100335825 92
615 3300009177 Ga0105248_10139556 Ga0105248_101395564 92
616 3300009545 Ga0105237_10001548 Ga0105237_100015485 92
617 3300009545 Ga0105237_10046552 Ga0105237_100465524 92
618 3300009545 Ga0105237_10212733 Ga0105237_102127332 92
619 3300009545 Ga0105237_10293400 Ga0105237_102934002 92
620 3300009545 Ga0105237_11169003 Ga0105237_111690031 92
621 3300009545 Ga0105237_11216391 Ga0105237_112163911 92
622 3300009551 Ga0105238_10194161 Ga0105238_101941613 92
623 3300009551 Ga0105238_10478239 Ga0105238_104782392 92
624 3300009551 Ga0105238_10786385 Ga0105238_107863852 92
625 3300009551 Ga0105238_11096108 Ga0105238_110961082 92
626 3300009553 Ga0105249_10010844 Ga0105249_100108445 92
627 3300009553 Ga0105249_10698940 Ga0105249_106989403 92
628 3300010159 Ga0099796_10000017 Ga0099796_1000001753 92
629 3300010159 Ga0099796_10459602 Ga0099796_104596022 92
630 3300010375 Ga0105239_10466297 Ga0105239_104662971 92
631 3300010375 Ga0105239_10639967 Ga0105239_106399672 92
632 3300010375 Ga0105239_11658937 Ga0105239_116589371 92
633 3300013100 Ga0157373_10996329 Ga0157373_109963292 92
634 3300013100 Ga0157373_11321647 Ga0157373_113216472 92
635 3300013104 Ga0157370_10557273 Ga0157370_105572732 92
636 3300013105 Ga0157369_10037254 Ga0157369_100372542 92
637 3300013105 Ga0157369_10122452 Ga0157369_101224524 92
638 3300013105 Ga0157369_12056973 Ga0157369_120569731 92
639 3300013105 Ga0157369_12272717 Ga0157369_122727171 92
640 3300013296 Ga0157374_10738178 Ga0157374_107381782 92
641 3300013296 Ga0157374_10953483 Ga0157374_109534832 92
642 3300013306 Ga0163162_10028264 Ga0163162_100282645 92
643 3300013306 Ga0163162_10309660 Ga0163162_103096602 92
644 3300013307 Ga0157372_10783580 Ga0157372_107835801 92
645 3300013307 Ga0157372_12993832 Ga0157372_129938321 92
646 3300014325 Ga0163163_10166862 Ga0163163_101668622 92
647 3300014325 Ga0163163_10279514 Ga0163163_102795142 92
648 3300014325 Ga0163163_10339352 Ga0163163_103393521 92
649 3300014325 Ga0163163_10462976 Ga0163163_104629762 92
650 3300014968 Ga0157379_10007334 Ga0157379_100073345 92
651 3300014968 Ga0157379_10041003 Ga0157379_100410033 92
652 3300014968 Ga0157379_10204325 Ga0157379_102043251 92
653 3300014968 Ga0157379_10455890 Ga0157379_104558901 92
654 3300014968 Ga0157379_11833126 Ga0157379_118331262 92
655 3300014968 Ga0157379_12120780 Ga0157379_121207802 92
656 3300014969 Ga0157376_11139404 Ga0157376_111394042 92
657 3300014969 Ga0157376_11245656 Ga0157376_112456562 92
658 3300020069 Ga0197907_10713066 Ga0197907_107130661 92
659 3300020070 Ga0206356_10181451 Ga0206356_101814512 92
660 3300020076 Ga0206355_1308584 Ga0206355_13085842 92
661 3300020076 Ga0206355_1702270 Ga0206355_17022702 92
662 3300020082 Ga0206353_10959879 Ga0206353_109598791 92
663 3300020082 Ga0206353_11943938 Ga0206353_119439381 92
664 3300021384 Ga0213876_10069373 Ga0213876_100693732 92
665 3300022467 Ga0224712_10216531 Ga0224712_102165312 92
666 3300022467 Ga0224712_10400429 Ga0224712_104004292 92
667 3300025321 Ga0207656_10232823 Ga0207656_102328231 92
668 3300025900 Ga0207710_10000156 Ga0207710_1000015657 92
669 3300025900 Ga0207710_10029645 Ga0207710_100296451 92
670 3300025903 Ga0207680_10127325 Ga0207680_101273253 92
671 3300025903 Ga0207680_11058820 Ga0207680_110588201 92
672 3300025906 Ga0207699_10101861 Ga0207699_101018612 92
673 3300025906 Ga0207699_10472644 Ga0207699_104726441 92
674 3300025911 Ga0207654_10160065 Ga0207654_101600653 92
675 3300025912 Ga0207707_10063322 Ga0207707_100633224 92
676 3300025912 Ga0207707_10796962 Ga0207707_107969622 92
677 3300025913 Ga0207695_10023762 Ga0207695_100237625 92
678 3300025913 Ga0207695_10025453 Ga0207695_100254539 92
679 3300025913 Ga0207695_10069998 Ga0207695_100699982 92
680 3300025913 Ga0207695_10115487 Ga0207695_101154874 92
681 3300025913 Ga0207695_10232450 Ga0207695_102324502 92
682 3300025914 Ga0207671_10053442 Ga0207671_100534422 92
683 3300025914 Ga0207671_10112900 Ga0207671_101129003 92
684 3300025914 Ga0207671_10546284 Ga0207671_105462842 92
685 3300025914 Ga0207671_10575061 Ga0207671_105750612 92
686 3300025916 Ga0207663_10379568 Ga0207663_103795682 92
687 3300025917 Ga0207660_10148443 Ga0207660_101484432 92
688 3300025917 Ga0207660_11559893 Ga0207660_115598931 92
689 3300025921 Ga0207652_10144509 Ga0207652_101445093 92
690 3300025921 Ga0207652_10214999 Ga0207652_102149991 92
691 3300025924 Ga0207694_10146747 Ga0207694_101467471 92
692 3300025924 Ga0207694_10279351 Ga0207694_102793512 92
693 3300025924 Ga0207694_11681863 Ga0207694_116818631 92
694 3300025925 Ga0207650_10260539 Ga0207650_102605392 92
695 3300025927 Ga0207687_10411665 Ga0207687_104116652 92
696 3300025929 Ga0207664_10263658 Ga0207664_102636582 92
697 3300025931 Ga0207644_10003342 Ga0207644_100033424 92
698 3300025931 Ga0207644_10147761 Ga0207644_101477612 92
699 3300025941 Ga0207711_10062029 Ga0207711_100620294 92
700 3300025941 Ga0207711_10091677 Ga0207711_100916772 92
701 3300025944 Ga0207661_10035722 Ga0207661_100357223 92
702 3300025945 Ga0207679_10651199 Ga0207679_106511992 92
703 3300025949 Ga0207667_10007515 Ga0207667_100075158 92
704 3300025949 Ga0207667_10041325 Ga0207667_100413255 92
705 3300025949 Ga0207667_10235472 Ga0207667_102354722 92
706 3300025949 Ga0207667_10563922 Ga0207667_105639222 92
707 3300025961 Ga0207712_10340677 Ga0207712_103406773 92
708 3300025981 Ga0207640_10609488 Ga0207640_106094882 92
709 3300025986 Ga0207658_10009137 Ga0207658_100091375 92
710 3300025986 Ga0207658_10072403 Ga0207658_100724033 92
711 3300025986 Ga0207658_10364093 Ga0207658_103640933 92
712 3300025986 Ga0207658_10485839 Ga0207658_104858391 92
713 3300026035 Ga0207703_10001045 Ga0207703_1000104517 92
714 3300026035 Ga0207703_10006750 Ga0207703_100067505 92
715 3300026035 Ga0207703_10159232 Ga0207703_101592323 92
716 3300026035 Ga0207703_10635699 Ga0207703_106356992 92
717 3300026035 Ga0207703_12295672 Ga0207703_122956721 92
718 3300026041 Ga0207639_10405368 Ga0207639_104053683 92
719 3300026041 Ga0207639_10863439 Ga0207639_108634392 92
720 3300026067 Ga0207678_10008217 Ga0207678_100082176 92
721 3300026078 Ga0207702_10272412 Ga0207702_102724122 92
722 3300026078 Ga0207702_11415981 Ga0207702_114159812 92
723 3300026088 Ga0207641_10000411 Ga0207641_1000041141 92
724 3300026088 Ga0207641_10044965 Ga0207641_100449652 92
725 3300026118 Ga0207675_100344003 Ga0207675_1003440033 92
726 3300026142 Ga0207698_10250314 Ga0207698_102503143 92
727 3300026142 Ga0207698_11081785 Ga0207698_110817851 92
728 3300027512 Ga0209179_1000003 Ga0209179_100000311 92
729 3300028379 Ga0268266_10000891 Ga0268266_1000089122 92
730 3300028379 Ga0268266_10015611 Ga0268266_100156117 92
731 3300028379 Ga0268266_10150760 Ga0268266_101507603 92
732 3300028379 Ga0268266_10164591 Ga0268266_101645912 92
733 3300028381 Ga0268264_10000044 Ga0268264_1000004440 92
734 3300028381 Ga0268264_10011423 Ga0268264_100114232 92
735 3300030521 Ga0307511_10002869 Ga0307511_1000286919 92
736 3300030521 Ga0307511_10023554 Ga0307511_100235546 92
737 3300030878 Ga0265770_1075597 Ga0265770_10755972 92
738 3300031247 Ga0265340_10472822 Ga0265340_104728222 92
739 3300031507 Ga0307509_10000162 Ga0307509_100001629 92
740 3300031595 Ga0265313_10401338 Ga0265313_104013382 92
741 3300033179 Ga0307507_10288646 Ga0307507_102886462 92
742 3300033179 Ga0307507_10313842 Ga0307507_103138421 92
743 3300033180 Ga0307510_10000011 Ga0307510_10000011277 92
744 3300033180 Ga0307510_10014196 Ga0307510_100141967 92
745 3300035111 Ga0373923_0413665 Ga0373923_0413665_16_294 92
746 3300035112 Ga0373932_0117943 Ga0373932_0117943_517_807 92
747 3300035113 Ga0373936_0007238 Ga0373936_0007238_2380_2697 92
748 3300035695 Ga0373927_0087723 Ga0373927_0087723_210_488 92
749 3300037418 Ga0395900_0379087 Ga0395900_0379087_1007_1303 92
750 3300037418 Ga0395900_0434309 Ga0395900_0434309_677_973 92
751 3300037466 Ga0395898_0006120 Ga0395898_0006120_8450_8746 92
752 3300037466 Ga0395898_0058585 Ga0395898_0058585_146_442 92
753 3300037471 Ga0395905_0262396 Ga0395905_0262396_748_1032 92
754 3300037853 Ga0436364_0434002 Ga0436364_0434002_250_531 92
755 3300037853 Ga0436364_0894341 Ga0436364_0894341_77_382 92
756 3300038443 Ga0395901_1135576 Ga0395901_1135576_96_392 92
757 3300039437 Ga0436365_0521742 Ga0436365_0521742_1522_1815 92
758 3300039437 Ga0436365_1254679 Ga0436365_1254679_360_662 92
759 3300039450 Ga0436363_0594067 Ga0436363_0594067_858_1151 92
760 3300039450 Ga0436363_1183369 Ga0436363_1183369_54_332 92
761 3300044656 Ga0466969_0003022 Ga0466969_0003022_6691_6972 92
762 3300044684 Ga0466966_0194261 Ga0466966_0194261_722_1018 92
763 3300044693 Ga0466961_0567678 Ga0466961_0567678_123_404 92
764 3300044765 Ga0466970_0332022 Ga0466970_0332022_24_305 92
765 3300045049 Ga0466959_0003023 Ga0466959_0003023_1646_1927 92
766 3300045049 Ga0466959_0022104 Ga0466959_0022104_163_459 92
767 3300045049 Ga0466959_0040209 Ga0466959_0040209_2898_3179 92
768 3300045049 Ga0466959_0085349 Ga0466959_0085349_992_1273 92
769 3300045976 Ga0466967_1628117 Ga0466967_1628117_259_555 92
770 3300046507 Ga0495606_0074410 Ga0495606_0074410_1393_1671 92
771 3300046507 Ga0495606_0111138 Ga0495606_0111138_204_482 92
772 3300046507 Ga0495606_0189216 Ga0495606_0189216_691_969 92
773 3300046517 Ga0495630_0695145 Ga0495630_0695145_320_598 92
774 3300046538 Ga0495609_0283392 Ga0495609_0283392_304_582 92
775 3300046616 Ga0495668_0446443 Ga0495668_0446443_360_644 92
776 3300047323 Ga0495683_0463189 Ga0495683_0463189_183_461 92
777 3300047443 Ga0495687_063656 Ga0495687_063656_1006_1284 92
778 3300048903 Ga0496100_0051687 Ga0496100_0051687_1647_1925 92
779 3300048903 Ga0496100_0143826 Ga0496100_0143826_610_888 92
780 3300048905 Ga0496102_0008678 Ga0496102_0008678_5575_5853 92
781 3300048905 Ga0496102_0028338 Ga0496102_0028338_4523_4801 92
782 3300048906 Ga0496103_0084215 Ga0496103_0084215_1099_1377 92
783 3300048908 Ga0496105_1074160 Ga0496105_1074160_292_570 92
784 3300048909 Ga0496106_0478667 Ga0496106_0478667_552_830 92
785 3300048911 Ga0496108_0406564 Ga0496108_0406564_447_725 92
786 3300048912 Ga0496109_0215623 Ga0496109_0215623_1099_1377 92
787 3300048915 Ga0496112_0044032 Ga0496112_0044032_1136_1414 92
788 3300048917 Ga0496114_0590398 Ga0496114_0590398_484_762 92
789 3300048918 Ga0496115_0129568 Ga0496115_0129568_65_343 92
790 3300048919 Ga0496116_0077357 Ga0496116_0077357_1028_1306 92
791 3300048920 Ga0496117_0000373 Ga0496117_0000373_27907_28185 92
792 3300048920 Ga0496117_0273991 Ga0496117_0273991_582_860 92
793 3300048921 Ga0496118_0000021 Ga0496118_0000021_32729_33007 92
794 3300048921 Ga0496118_0160497 Ga0496118_0160497_201_479 92
795 3300048922 Ga0496119_0001387 Ga0496119_0001387_28896_29174 92
796 3300048922 Ga0496119_0002294 Ga0496119_0002294_18079_18357 92
797 3300048922 Ga0496119_0223536 Ga0496119_0223536_173_451 92
798 3300048923 Ga0496120_0002163 Ga0496120_0002163_2500_2778 92
799 3300048923 Ga0496120_0022135 Ga0496120_0022135_1721_1999 92
800 3300048924 Ga0496121_0000547 Ga0496121_0000547_63564_63842 92
801 3300048924 Ga0496121_0002740 Ga0496121_0002740_1570_1848 92
802 3300048924 Ga0496121_0831529 Ga0496121_0831529_213_491 92
803 3300048927 Ga0496124_0250666 Ga0496124_0250666_91_369 92
804 3300048928 Ga0496125_0000112 Ga0496125_0000112_176504_176782 92
805 3300048928 Ga0496125_0023886 Ga0496125_0023886_3668_3946 92
806 3300048928 Ga0496125_0764482 Ga0496125_0764482_196_477 92
807 3300048929 Ga0496126_0006924 Ga0496126_0006924_9585_9866 92
808 3300048929 Ga0496126_0038813 Ga0496126_0038813_3499_3777 92
809 3300048929 Ga0496126_0148783 Ga0496126_0148783_779_1057 92
810 3300049460 Ga0495682_0064478 Ga0495682_0064478_752_1030 92
811 3300049460 Ga0495682_0145824 Ga0495682_0145824_278_556 92
812 3300053092 Ga0500583_0021011 Ga0500583_0021011_605_883 92
813 3300053092 Ga0500583_0102333 Ga0500583_0102333_915_1193 92
814 3300053095 Ga0500640_112928 Ga0500640_112928_167_445 92
815 3300053098 Ga0500650_0280864 Ga0500650_0280864_404_682 92
816 3300053098 Ga0500650_0443130 Ga0500650_0443130_175_453 92
817 3300053111 Ga0500572_004051 Ga0500572_004051_1861_2139 92
818 3300053130 Ga0500642_0189537 Ga0500642_0189537_244_522 92
819 3300053133 Ga0500655_013178 Ga0500655_013178_1049_1327 92
820 3300053136 Ga0500559_0131199 Ga0500559_0131199_610_888 92
821 3300053148 Ga0500590_083952 Ga0500590_083952_795_1073 92
822 3300053159 Ga0500630_108203 Ga0500630_108203_520_798 92
823 3300053163 Ga0500639_139624 Ga0500639_139624_764_1042 92
824 3300053163 Ga0500639_289168 Ga0500639_289168_87_368 92
825 3300053178 Ga0500637_0238906 Ga0500637_0238906_463_741 92
826 3300053178 Ga0500637_0352663 Ga0500637_0352663_436_714 92
827 3300059641 Ga0587068_093285 Ga0587068_093285_210_491 92
828 3300060344 Ga0587071_131600 Ga0587071_131600_35_313 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

15

95

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8854 20 84
8apo-assembly1.cif.gz_Au structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.8791 26 87
7o9k-assembly1.cif.gz_W human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu 0.8767 22 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8757 18 85
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.874 18 85
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8854 20 84 2.40.50.100
2ba1A01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8714 30 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8653 29 83 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8481 20 84 2.40.50.100
af_Q9VKJ4_10_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8371 31 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2S5N5K3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9729 29 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A484PSD2-F1-model_v4 LSU ribosomal protein L27p 0.9689 26 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A5C8B9S1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9686 26 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A455UVJ5-F1-model_v4 deleted 0.9477 24 84
AF-A0A0A8XHI5-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9389 22 84 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
76.67 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map