F482576
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 828 | 393 | 827 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0930428|Ga0501047_0930428_218_610 |
| Length | 130 |
| Sequence | MPPLDSSGRGTKDMDKKISRTRRAAKTRARIARQEAVRLAVHRTNQHIYAQVIDAAGGKVLASASTLEKEVRSAHPKSAGKEAAAAVGKRIAEKAKAAGVTEVAFDRAGFSYHGRVKALAEAAREGGLKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 218 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 219 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 247 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 248 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 249 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 250 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 251 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 252 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 253 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 254 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 255 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 256 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 257 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 258 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 259 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 260 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 261 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 262 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 263 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 264 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 265 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 266 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 267 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 268 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 269 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 270 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 271 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 272 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 273 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 276 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 335 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 354 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 378 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 379 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 382 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 392 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.53 |
| Metatranscriptomes | 4.35 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.23 |
| Nodule | 0.6 |
| Rhizoplane | 1.09 |
| Rhizosphere | 85.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10001301 | 3300003322 | Bacteria | 6102 |
| 2 | Ga0007410J51695_1037205 | 3300003574 | Bacteria | 698 |
| 3 | Ga0007409J51694_1026312 | 3300003575 | Bacteria | 759 |
| 4 | Ga0055526_1003343 | 3300003771 | Bacteria | 10245 |
| 5 | Ga0055528_1017593 | 3300003790 | Bacteria | 2470 |
| 6 | Ga0055528_1057462 | 3300003790 | Bacteria | 750 |
| 7 | Ga0055530_10078106 | 3300003791 | Bacteria | 700 |
| 8 | Ga0055540_1051963 | 3300003792 | Bacteria | 843 |
| 9 | Ga0055531_10111134 | 3300003794 | Bacteria | 547 |
| 10 | Ga0058860_12218986 | 3300004801 | Bacteria | 2322 |
| 11 | Ga0065165_1006303 | 3300005262 | Bacteria | 6283 |
| 12 | Ga0065707_10001914 | 3300005295 | Bacteria | 6146 |
| 13 | Ga0070658_10030833 | 3300005327 | Bacteria | 4307 |
| 14 | Ga0070658_10061874 | 3300005327 | Bacteria | 3050 |
| 15 | Ga0070658_10130450 | 3300005327 | Bacteria | 2094 |
| 16 | Ga0070658_10602014 | 3300005327 | Bacteria | 952 |
| 17 | Ga0070658_11996890 | 3300005327 | Bacteria | 500 |
| 18 | Ga0070676_10050474 | 3300005328 | Bacteria | 2439 |
| 19 | Ga0070676_10261202 | 3300005328 | Bacteria | 1159 |
| 20 | Ga0070676_10429620 | 3300005328 | Bacteria | 925 |
| 21 | Ga0070683_100113047 | 3300005329 | Bacteria | 2562 |
| 22 | Ga0070690_100313214 | 3300005330 | Bacteria | 1129 |
| 23 | Ga0070690_100391229 | 3300005330 | Bacteria | 1019 |
| 24 | Ga0070670_100218635 | 3300005331 | Bacteria | 1657 |
| 25 | Ga0070670_100541995 | 3300005331 | Bacteria | 1037 |
| 26 | Ga0070670_100936042 | 3300005331 | Bacteria | 786 |
| 27 | Ga0070677_10423163 | 3300005333 | Bacteria | 707 |
| 28 | Ga0070677_10509202 | 3300005333 | Bacteria | 654 |
| 29 | Ga0068869_100132145 | 3300005334 | Bacteria | 1919 |
| 30 | Ga0068869_100190433 | 3300005334 | Bacteria | 1612 |
| 31 | Ga0068869_100401391 | 3300005334 | Bacteria | 1128 |
| 32 | Ga0070666_10540965 | 3300005335 | Bacteria | 847 |
| 33 | Ga0068868_100074093 | 3300005338 | Bacteria | 2718 |
| 34 | Ga0068868_100125596 | 3300005338 | Bacteria | 2095 |
| 35 | Ga0068868_101196314 | 3300005338 | Bacteria | 703 |
| 36 | Ga0068868_101887430 | 3300005338 | Bacteria | 566 |
| 37 | Ga0070660_100818220 | 3300005339 | Bacteria | 784 |
| 38 | Ga0070689_100018801 | 3300005340 | Bacteria | 5099 |
| 39 | Ga0070689_100327138 | 3300005340 | Bacteria | 1281 |
| 40 | Ga0070689_100436204 | 3300005340 | Bacteria | 1112 |
| 41 | Ga0070689_100588585 | 3300005340 | Bacteria | 962 |
| 42 | Ga0070689_100902870 | 3300005340 | Bacteria | 782 |
| 43 | Ga0070687_100603249 | 3300005343 | Bacteria | 754 |
| 44 | Ga0070661_100167366 | 3300005344 | Bacteria | 1668 |
| 45 | Ga0070661_100606013 | 3300005344 | Bacteria | 886 |
| 46 | Ga0070661_100743290 | 3300005344 | Bacteria | 802 |
| 47 | Ga0070669_100034565 | 3300005353 | Bacteria | 3659 |
| 48 | Ga0070669_100077546 | 3300005353 | Bacteria | 2469 |
| 49 | Ga0070669_100102253 | 3300005353 | Bacteria | 2164 |
| 50 | Ga0070669_100547050 | 3300005353 | Bacteria | 965 |
| 51 | Ga0070675_100031032 | 3300005354 | Bacteria | 4318 |
| 52 | Ga0070675_100441805 | 3300005354 | Bacteria | 1165 |
| 53 | Ga0070675_100537435 | 3300005354 | Bacteria | 1056 |
| 54 | Ga0070675_100572212 | 3300005354 | Bacteria | 1023 |
| 55 | Ga0070675_101864937 | 3300005354 | Bacteria | 554 |
| 56 | Ga0070675_102227621 | 3300005354 | Bacteria | 505 |
| 57 | Ga0070671_100151546 | 3300005355 | Bacteria | 1958 |
| 58 | Ga0070671_101400409 | 3300005355 | Bacteria | 618 |
| 59 | Ga0070671_101549905 | 3300005355 | Bacteria | 587 |
| 60 | Ga0070674_100304962 | 3300005356 | Bacteria | 1271 |
| 61 | Ga0070674_100831331 | 3300005356 | Bacteria | 800 |
| 62 | Ga0070674_100858675 | 3300005356 | Bacteria | 788 |
| 63 | Ga0070674_100938789 | 3300005356 | Bacteria | 756 |
| 64 | Ga0070673_100025135 | 3300005364 | Bacteria | 4378 |
| 65 | Ga0070673_100055764 | 3300005364 | Bacteria | 3115 |
| 66 | Ga0070673_100383392 | 3300005364 | Bacteria | 1254 |
| 67 | Ga0070673_100532134 | 3300005364 | Bacteria | 1066 |
| 68 | Ga0070688_100087995 | 3300005365 | Bacteria | 2024 |
| 69 | Ga0070688_100234898 | 3300005365 | Bacteria | 1298 |
| 70 | Ga0070659_100546172 | 3300005366 | Bacteria | 992 |
| 71 | Ga0070659_101108230 | 3300005366 | Bacteria | 698 |
| 72 | Ga0070659_101886689 | 3300005366 | Bacteria | 536 |
| 73 | Ga0070667_100337290 | 3300005367 | Bacteria | 1363 |
| 74 | Ga0070667_101929922 | 3300005367 | Bacteria | 556 |
| 75 | Ga0070709_11263927 | 3300005434 | Bacteria | 595 |
| 76 | Ga0070714_100651652 | 3300005435 | Bacteria | 1014 |
| 77 | Ga0070714_101521837 | 3300005435 | Bacteria | 654 |
| 78 | Ga0070701_10056180 | 3300005438 | Bacteria | 2059 |
| 79 | Ga0070701_10203377 | 3300005438 | Bacteria | 1172 |
| 80 | Ga0070701_10971730 | 3300005438 | Bacteria | 591 |
| 81 | Ga0070701_11157601 | 3300005438 | Bacteria | 547 |
| 82 | Ga0070700_101053485 | 3300005441 | Bacteria | 671 |
| 83 | Ga0070694_101000994 | 3300005444 | Bacteria | 694 |
| 84 | Ga0070694_101192075 | 3300005444 | Bacteria | 638 |
| 85 | Ga0070708_100348288 | 3300005445 | Bacteria | 1396 |
| 86 | Ga0070678_100195478 | 3300005456 | Bacteria | 1666 |
| 87 | Ga0070678_100625441 | 3300005456 | Bacteria | 963 |
| 88 | Ga0070678_101883788 | 3300005456 | Bacteria | 565 |
| 89 | Ga0070662_100060375 | 3300005457 | Bacteria | 2765 |
| 90 | Ga0070662_100347907 | 3300005457 | Bacteria | 1214 |
| 91 | Ga0070662_100740980 | 3300005457 | Bacteria | 833 |
| 92 | Ga0070662_100960223 | 3300005457 | Bacteria | 731 |
| 93 | Ga0068867_100036184 | 3300005459 | Bacteria | 3582 |
| 94 | Ga0068867_100128512 | 3300005459 | Bacteria | 1966 |
| 95 | Ga0068867_100131746 | 3300005459 | Bacteria | 1944 |
| 96 | Ga0068867_100152150 | 3300005459 | Bacteria | 1818 |
| 97 | Ga0068867_100665931 | 3300005459 | Bacteria | 915 |
| 98 | Ga0068867_101795877 | 3300005459 | Bacteria | 576 |
| 99 | Ga0068867_102352674 | 3300005459 | Bacteria | 507 |
| 100 | Ga0070685_10196792 | 3300005466 | Bacteria | 1308 |
| 101 | Ga0070685_10316092 | 3300005466 | Bacteria | 1057 |
| 102 | Ga0070685_11392732 | 3300005466 | Bacteria | 538 |
| 103 | Ga0070698_100437587 | 3300005471 | Bacteria | 1243 |
| 104 | Ga0070679_100468873 | 3300005530 | Bacteria | 1204 |
| 105 | Ga0070684_100029158 | 3300005535 | Bacteria | 4674 |
| 106 | Ga0070684_100280787 | 3300005535 | Bacteria | 1526 |
| 107 | Ga0070684_100995447 | 3300005535 | Bacteria | 787 |
| 108 | Ga0068853_100031768 | 3300005539 | Bacteria | 4468 |
| 109 | Ga0068853_100057137 | 3300005539 | Bacteria | 3366 |
| 110 | Ga0068853_100107714 | 3300005539 | Bacteria | 2471 |
| 111 | Ga0070686_100047607 | 3300005544 | Bacteria | 2712 |
| 112 | Ga0070695_101139468 | 3300005545 | Bacteria | 640 |
| 113 | Ga0070696_101094150 | 3300005546 | Bacteria | 670 |
| 114 | Ga0070693_100064126 | 3300005547 | Bacteria | 2143 |
| 115 | Ga0070693_100079511 | 3300005547 | Bacteria | 1951 |
| 116 | Ga0070693_100708138 | 3300005547 | Bacteria | 738 |
| 117 | Ga0070693_100751721 | 3300005547 | Bacteria | 719 |
| 118 | Ga0070665_100022127 | 3300005548 | Bacteria | 6394 |
| 119 | Ga0070665_100047667 | 3300005548 | Bacteria | 4300 |
| 120 | Ga0070665_100677110 | 3300005548 | Bacteria | 1045 |
| 121 | Ga0070665_101432012 | 3300005548 | Bacteria | 700 |
| 122 | Ga0070665_102025440 | 3300005548 | Bacteria | 581 |
| 123 | Ga0070704_100823691 | 3300005549 | Bacteria | 831 |
| 124 | Ga0068855_100029685 | 3300005563 | Bacteria | 6537 |
| 125 | Ga0068855_100061581 | 3300005563 | Bacteria | 4384 |
| 126 | Ga0068855_100288384 | 3300005563 | Bacteria | 1820 |
| 127 | Ga0070664_100311472 | 3300005564 | Bacteria | 1425 |
| 128 | Ga0070664_101353532 | 3300005564 | Bacteria | 673 |
| 129 | Ga0068857_100012217 | 3300005577 | Bacteria | 7470 |
| 130 | Ga0068857_100878656 | 3300005577 | Bacteria | 859 |
| 131 | Ga0068854_100454288 | 3300005578 | Bacteria | 1071 |
| 132 | Ga0068854_101397900 | 3300005578 | Bacteria | 633 |
| 133 | Ga0068854_101411187 | 3300005578 | Bacteria | 630 |
| 134 | Ga0068856_100065846 | 3300005614 | Bacteria | 3580 |
| 135 | Ga0068856_102184099 | 3300005614 | Bacteria | 563 |
| 136 | Ga0070702_100847935 | 3300005615 | Bacteria | 711 |
| 137 | Ga0070702_100993404 | 3300005615 | Bacteria | 664 |
| 138 | Ga0068852_100004380 | 3300005616 | Bacteria | 9978 |
| 139 | Ga0068852_100127860 | 3300005616 | Bacteria | 2336 |
| 140 | Ga0068852_100171595 | 3300005616 | Bacteria | 2033 |
| 141 | Ga0068852_100272993 | 3300005616 | Bacteria | 1628 |
| 142 | Ga0068852_100461237 | 3300005616 | Bacteria | 1260 |
| 143 | Ga0068859_100076061 | 3300005617 | Bacteria | 3398 |
| 144 | Ga0068859_100130549 | 3300005617 | Bacteria | 2584 |
| 145 | Ga0068859_100821191 | 3300005617 | Bacteria | 1016 |
| 146 | Ga0068859_102020051 | 3300005617 | Bacteria | 637 |
| 147 | Ga0068864_100203018 | 3300005618 | Bacteria | 1822 |
| 148 | Ga0068864_100629129 | 3300005618 | Bacteria | 1044 |
| 149 | Ga0068864_101612366 | 3300005618 | Bacteria | 653 |
| 150 | Ga0068861_100164604 | 3300005719 | Bacteria | 1833 |
| 151 | Ga0068861_100311411 | 3300005719 | Bacteria | 1368 |
| 152 | Ga0068861_100753593 | 3300005719 | Bacteria | 910 |
| 153 | Ga0068851_10006696 | 3300005834 | Bacteria | 5270 |
| 154 | Ga0068870_10034507 | 3300005840 | Bacteria | 2589 |
| 155 | Ga0068870_10627050 | 3300005840 | Bacteria | 734 |
| 156 | Ga0068863_100236126 | 3300005841 | Bacteria | 1764 |
| 157 | Ga0068863_101109739 | 3300005841 | Bacteria | 796 |
| 158 | Ga0068858_100102741 | 3300005842 | Bacteria | 2666 |
| 159 | Ga0068858_100628514 | 3300005842 | Bacteria | 1043 |
| 160 | Ga0068860_100241063 | 3300005843 | Bacteria | 1759 |
| 161 | Ga0068860_100446321 | 3300005843 | Bacteria | 1286 |
| 162 | Ga0068860_100933330 | 3300005843 | Bacteria | 885 |
| 163 | Ga0068860_101303745 | 3300005843 | Bacteria | 747 |
| 164 | Ga0068862_100009442 | 3300005844 | Bacteria | 8069 |
| 165 | Ga0068862_100158350 | 3300005844 | Bacteria | 2020 |
| 166 | Ga0081455_10356823 | 3300005937 | Bacteria | 1029 |
| 167 | Ga0070717_10828554 | 3300006028 | Bacteria | 842 |
| 168 | Ga0075365_10090325 | 3300006038 | Bacteria | 2086 |
| 169 | Ga0075365_10473437 | 3300006038 | Bacteria | 885 |
| 170 | Ga0075365_10479256 | 3300006038 | Bacteria | 879 |
| 171 | Ga0075368_10467539 | 3300006042 | Bacteria | 560 |
| 172 | Ga0075363_100089552 | 3300006048 | Bacteria | 1692 |
| 173 | Ga0075363_100529454 | 3300006048 | Bacteria | 702 |
| 174 | Ga0075363_100801874 | 3300006048 | Bacteria | 573 |
| 175 | Ga0075364_10023952 | 3300006051 | Bacteria | 3870 |
| 176 | Ga0075364_10033419 | 3300006051 | Bacteria | 3312 |
| 177 | Ga0075364_10199708 | 3300006051 | Bacteria | 1355 |
| 178 | Ga0075364_10345408 | 3300006051 | Bacteria | 1014 |
| 179 | Ga0075432_10016379 | 3300006058 | Bacteria | 2529 |
| 180 | Ga0070716_101262330 | 3300006173 | Bacteria | 596 |
| 181 | Ga0070712_101589118 | 3300006175 | Bacteria | 572 |
| 182 | Ga0070712_101755948 | 3300006175 | Bacteria | 543 |
| 183 | Ga0075362_10018481 | 3300006177 | Bacteria | 2885 |
| 184 | Ga0075362_10056887 | 3300006177 | Bacteria | 1761 |
| 185 | Ga0075362_10119745 | 3300006177 | Bacteria | 1245 |
| 186 | Ga0075362_10744937 | 3300006177 | Bacteria | 513 |
| 187 | Ga0075367_10010768 | 3300006178 | Bacteria | 4815 |
| 188 | Ga0075367_10021043 | 3300006178 | Bacteria | 3641 |
| 189 | Ga0075367_10088726 | 3300006178 | Bacteria | 1879 |
| 190 | Ga0075367_10247467 | 3300006178 | Bacteria | 1118 |
| 191 | Ga0075367_10471900 | 3300006178 | Bacteria | 795 |
| 192 | Ga0075369_10001295 | 3300006186 | Bacteria | 8496 |
| 193 | Ga0075369_10185095 | 3300006186 | Bacteria | 959 |
| 194 | Ga0075366_10005895 | 3300006195 | Bacteria | 6662 |
| 195 | Ga0075366_10007118 | 3300006195 | Bacteria | 6159 |
| 196 | Ga0075366_10016161 | 3300006195 | Bacteria | 4286 |
| 197 | Ga0075366_10016473 | 3300006195 | Bacteria | 4249 |
| 198 | Ga0075366_10138878 | 3300006195 | Bacteria | 1468 |
| 199 | Ga0075366_10886917 | 3300006195 | Bacteria | 555 |
| 200 | Ga0097621_100024717 | 3300006237 | Bacteria | 4694 |
| 201 | Ga0097621_100203834 | 3300006237 | Bacteria | 1718 |
| 202 | Ga0097621_101969892 | 3300006237 | Bacteria | 558 |
| 203 | Ga0075370_10002824 | 3300006353 | Bacteria | 8149 |
| 204 | Ga0075370_10139703 | 3300006353 | Bacteria | 1416 |
| 205 | Ga0075370_10455856 | 3300006353 | Bacteria | 770 |
| 206 | Ga0075370_10938323 | 3300006353 | Bacteria | 529 |
| 207 | Ga0068871_100063147 | 3300006358 | Bacteria | 3028 |
| 208 | Ga0068871_100119596 | 3300006358 | Bacteria | 2224 |
| 209 | Ga0068871_100206099 | 3300006358 | Bacteria | 1699 |
| 210 | Ga0068871_100331258 | 3300006358 | Bacteria | 1343 |
| 211 | Ga0068871_100369183 | 3300006358 | Bacteria | 1272 |
| 212 | Ga0068871_100806614 | 3300006358 | Bacteria | 865 |
| 213 | Ga0075428_100074204 | 3300006844 | Bacteria | 3716 |
| 214 | Ga0075433_10425694 | 3300006852 | Bacteria | 1171 |
| 215 | Ga0075434_100174619 | 3300006871 | Bacteria | 2168 |
| 216 | Ga0075434_101969185 | 3300006871 | Bacteria | 590 |
| 217 | Ga0075429_100536246 | 3300006880 | Bacteria | 1025 |
| 218 | Ga0068865_100055933 | 3300006881 | Bacteria | 2747 |
| 219 | Ga0097620_100076060 | 3300006931 | Bacteria | 3398 |
| 220 | Ga0097620_100130553 | 3300006931 | Bacteria | 2584 |
| 221 | Ga0097620_100821210 | 3300006931 | Bacteria | 1016 |
| 222 | Ga0097620_102020132 | 3300006931 | Bacteria | 637 |
| 223 | Ga0099823_1000064 | 3300006944 | Bacteria | 50328 |
| 224 | Ga0079104_1015591 | 3300006946 | Bacteria | 2247 |
| 225 | Ga0075435_100448940 | 3300007076 | Bacteria | 1112 |
| 226 | Ga0105240_10112049 | 3300009093 | Bacteria | 3299 |
| 227 | Ga0105240_10390077 | 3300009093 | Bacteria | 1571 |
| 228 | Ga0105240_10595644 | 3300009093 | Bacteria | 1218 |
| 229 | Ga0105240_10908437 | 3300009093 | Bacteria | 947 |
| 230 | Ga0105240_12369494 | 3300009093 | Bacteria | 550 |
| 231 | Ga0111539_10019077 | 3300009094 | Bacteria | 8474 |
| 232 | Ga0105245_10494220 | 3300009098 | Bacteria | 1239 |
| 233 | Ga0105245_10760192 | 3300009098 | Bacteria | 1005 |
| 234 | Ga0105245_10766638 | 3300009098 | Bacteria | 1001 |
| 235 | Ga0105245_10821596 | 3300009098 | Bacteria | 968 |
| 236 | Ga0105245_10893074 | 3300009098 | Bacteria | 930 |
| 237 | Ga0105243_10227307 | 3300009148 | Bacteria | 1653 |
| 238 | Ga0105243_10258650 | 3300009148 | Bacteria | 1558 |
| 239 | Ga0105243_10411679 | 3300009148 | Bacteria | 1259 |
| 240 | Ga0105243_10847435 | 3300009148 | Bacteria | 905 |
| 241 | Ga0105241_11449991 | 3300009174 | Bacteria | 659 |
| 242 | Ga0105242_10046258 | 3300009176 | Bacteria | 3530 |
| 243 | Ga0105242_10228604 | 3300009176 | Bacteria | 1666 |
| 244 | Ga0105242_10427603 | 3300009176 | Bacteria | 1242 |
| 245 | Ga0105242_11230000 | 3300009176 | Bacteria | 769 |
| 246 | Ga0105242_11914332 | 3300009176 | Bacteria | 634 |
| 247 | Ga0105242_12544829 | 3300009176 | Bacteria | 560 |
| 248 | Ga0105248_10053313 | 3300009177 | Bacteria | 4538 |
| 249 | Ga0105248_10123110 | 3300009177 | Bacteria | 2926 |
| 250 | Ga0105248_10527596 | 3300009177 | Bacteria | 1332 |
| 251 | Ga0105248_10628678 | 3300009177 | Bacteria | 1211 |
| 252 | Ga0105248_10706794 | 3300009177 | Bacteria | 1137 |
| 253 | Ga0105248_10906415 | 3300009177 | Bacteria | 995 |
| 254 | Ga0105248_12130156 | 3300009177 | Bacteria | 638 |
| 255 | Ga0105248_12427602 | 3300009177 | Bacteria | 597 |
| 256 | Ga0105237_12059128 | 3300009545 | Bacteria | 580 |
| 257 | Ga0105238_10087095 | 3300009551 | Bacteria | 3110 |
| 258 | Ga0105238_10162918 | 3300009551 | Bacteria | 2206 |
| 259 | Ga0105238_10468863 | 3300009551 | Bacteria | 1258 |
| 260 | Ga0105238_10872135 | 3300009551 | Bacteria | 918 |
| 261 | Ga0105249_11452365 | 3300009553 | Bacteria | 758 |
| 262 | Ga0105249_11604556 | 3300009553 | Bacteria | 723 |
| 263 | Ga0105239_11647855 | 3300010375 | Bacteria | 742 |
| 264 | Ga0105246_10722930 | 3300011119 | Bacteria | 875 |
| 265 | Ga0105246_10880654 | 3300011119 | Bacteria | 801 |
| 266 | Ga0157317_1000211 | 3300012475 | Bacteria | 2102 |
| 267 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 268 | Ga0157370_10281691 | 3300013104 | Bacteria | 1536 |
| 269 | Ga0157370_11076397 | 3300013104 | Bacteria | 727 |
| 270 | Ga0157369_10006334 | 3300013105 | Bacteria | 13736 |
| 271 | Ga0157369_10167285 | 3300013105 | Bacteria | 2318 |
| 272 | Ga0157369_12010765 | 3300013105 | Bacteria | 586 |
| 273 | Ga0157374_10079715 | 3300013296 | Bacteria | 3104 |
| 274 | Ga0157374_10711098 | 3300013296 | Bacteria | 1018 |
| 275 | Ga0157374_11039074 | 3300013296 | Bacteria | 839 |
| 276 | Ga0157374_11772693 | 3300013296 | Bacteria | 642 |
| 277 | Ga0157378_10059479 | 3300013297 | Bacteria | 3409 |
| 278 | Ga0163162_10022516 | 3300013306 | Bacteria | 6209 |
| 279 | Ga0163162_10338226 | 3300013306 | Bacteria | 1638 |
| 280 | Ga0163162_10677367 | 3300013306 | Bacteria | 1154 |
| 281 | Ga0163162_10913966 | 3300013306 | Bacteria | 990 |
| 282 | Ga0157372_10191231 | 3300013307 | Bacteria | 2371 |
| 283 | Ga0157372_11188047 | 3300013307 | Bacteria | 882 |
| 284 | Ga0157372_12749241 | 3300013307 | Bacteria | 564 |
| 285 | Ga0157375_10359351 | 3300013308 | Bacteria | 1622 |
| 286 | Ga0157375_11353360 | 3300013308 | Bacteria | 838 |
| 287 | Ga0157375_11540141 | 3300013308 | Bacteria | 785 |
| 288 | Ga0163163_11378123 | 3300014325 | Bacteria | 767 |
| 289 | Ga0163163_11503692 | 3300014325 | Bacteria | 735 |
| 290 | Ga0157380_10035459 | 3300014326 | Bacteria | 3854 |
| 291 | Ga0157380_10256156 | 3300014326 | Bacteria | 1587 |
| 292 | Ga0157380_10624843 | 3300014326 | Bacteria | 1070 |
| 293 | Ga0157380_10911343 | 3300014326 | Bacteria | 906 |
| 294 | Ga0157380_11467506 | 3300014326 | Bacteria | 734 |
| 295 | Ga0157380_12420257 | 3300014326 | Bacteria | 590 |
| 296 | Ga0157380_12813113 | 3300014326 | Bacteria | 553 |
| 297 | Ga0157377_11269105 | 3300014745 | Bacteria | 574 |
| 298 | Ga0157379_10193218 | 3300014968 | Bacteria | 1839 |
| 299 | Ga0157379_10645825 | 3300014968 | Bacteria | 990 |
| 300 | Ga0157379_10937838 | 3300014968 | Bacteria | 823 |
| 301 | Ga0157379_11337906 | 3300014968 | Bacteria | 693 |
| 302 | Ga0157376_10202712 | 3300014969 | Bacteria | 1827 |
| 303 | Ga0157376_10845950 | 3300014969 | Bacteria | 930 |
| 304 | Ga0157376_12278089 | 3300014969 | Bacteria | 581 |
| 305 | Ga0157376_12401687 | 3300014969 | Bacteria | 567 |
| 306 | Ga0163161_10134116 | 3300017792 | Bacteria | 1870 |
| 307 | Ga0163161_11127643 | 3300017792 | Bacteria | 675 |
| 308 | Ga0163161_11777879 | 3300017792 | Bacteria | 548 |
| 309 | Ga0197907_10947458 | 3300020069 | Bacteria | 534 |
| 310 | Ga0206354_10693061 | 3300020081 | Bacteria | 982 |
| 311 | Ga0213872_10000091 | 3300021361 | Bacteria | 83723 |
| 312 | Ga0213872_10004732 | 3300021361 | Bacteria | 7137 |
| 313 | Ga0213872_10277378 | 3300021361 | Bacteria | 700 |
| 314 | Ga0207425_1043363 | 3300025245 | Bacteria | 848 |
| 315 | Ga0209673_1020101 | 3300025273 | Bacteria | 2374 |
| 316 | Ga0209673_1024595 | 3300025273 | Bacteria | 2019 |
| 317 | Ga0209675_1000220 | 3300025291 | Bacteria | 59335 |
| 318 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 319 | Ga0209758_1029564 | 3300025297 | Bacteria | 2287 |
| 320 | Ga0209050_1013102 | 3300025298 | Bacteria | 3724 |
| 321 | Ga0209256_1094210 | 3300025299 | Bacteria | 631 |
| 322 | Ga0209051_1000938 | 3300025303 | Bacteria | 28786 |
| 323 | Ga0209257_1105073 | 3300025304 | Bacteria | 682 |
| 324 | Ga0207697_10168345 | 3300025315 | Bacteria | 958 |
| 325 | Ga0207656_10001500 | 3300025321 | Bacteria | 7731 |
| 326 | Ga0207656_10067697 | 3300025321 | Bacteria | 1581 |
| 327 | Ga0207682_10037312 | 3300025893 | Bacteria | 1968 |
| 328 | Ga0207682_10136512 | 3300025893 | Bacteria | 1098 |
| 329 | Ga0207642_10201121 | 3300025899 | Bacteria | 1100 |
| 330 | Ga0207642_10500803 | 3300025899 | Bacteria | 744 |
| 331 | Ga0207688_10034103 | 3300025901 | Bacteria | 2817 |
| 332 | Ga0207688_10586131 | 3300025901 | Bacteria | 702 |
| 333 | Ga0207688_10904359 | 3300025901 | Bacteria | 559 |
| 334 | Ga0207680_10333726 | 3300025903 | Bacteria | 1062 |
| 335 | Ga0207685_10003543 | 3300025905 | Bacteria | 3813 |
| 336 | Ga0207699_10608840 | 3300025906 | Bacteria | 796 |
| 337 | Ga0207645_10050633 | 3300025907 | Bacteria | 2652 |
| 338 | Ga0207645_10149288 | 3300025907 | Bacteria | 1525 |
| 339 | Ga0207643_10158658 | 3300025908 | Bacteria | 1360 |
| 340 | Ga0207643_10544558 | 3300025908 | Bacteria | 744 |
| 341 | Ga0207705_10141765 | 3300025909 | Bacteria | 1795 |
| 342 | Ga0207705_10235593 | 3300025909 | Bacteria | 1393 |
| 343 | Ga0207705_10329369 | 3300025909 | Bacteria | 1174 |
| 344 | Ga0207705_10538465 | 3300025909 | Bacteria | 908 |
| 345 | Ga0207705_10870903 | 3300025909 | Bacteria | 698 |
| 346 | Ga0207705_11036633 | 3300025909 | Bacteria | 633 |
| 347 | Ga0207654_10015846 | 3300025911 | Bacteria | 3918 |
| 348 | Ga0207695_10031032 | 3300025913 | Bacteria | 5872 |
| 349 | Ga0207695_10560496 | 3300025913 | Bacteria | 1024 |
| 350 | Ga0207695_10862452 | 3300025913 | Bacteria | 785 |
| 351 | Ga0207693_11404850 | 3300025915 | Bacteria | 518 |
| 352 | Ga0207660_10673904 | 3300025917 | Bacteria | 843 |
| 353 | Ga0207660_10869381 | 3300025917 | Bacteria | 736 |
| 354 | Ga0207662_10071217 | 3300025918 | Bacteria | 2105 |
| 355 | Ga0207662_10447242 | 3300025918 | Bacteria | 883 |
| 356 | Ga0207657_10618754 | 3300025919 | Bacteria | 844 |
| 357 | Ga0207649_10365682 | 3300025920 | Bacteria | 1071 |
| 358 | Ga0207649_10481971 | 3300025920 | Bacteria | 941 |
| 359 | Ga0207649_11218994 | 3300025920 | Bacteria | 595 |
| 360 | Ga0207649_11388795 | 3300025920 | Bacteria | 556 |
| 361 | Ga0207681_10032331 | 3300025923 | Bacteria | 3424 |
| 362 | Ga0207681_10139757 | 3300025923 | Bacteria | 1802 |
| 363 | Ga0207694_10007098 | 3300025924 | Bacteria | 8511 |
| 364 | Ga0207694_10136119 | 3300025924 | Bacteria | 1973 |
| 365 | Ga0207694_10184725 | 3300025924 | Bacteria | 1692 |
| 366 | Ga0207694_10771123 | 3300025924 | Bacteria | 812 |
| 367 | Ga0207694_11115878 | 3300025924 | Bacteria | 667 |
| 368 | Ga0207650_10257366 | 3300025925 | Bacteria | 1415 |
| 369 | Ga0207650_10281702 | 3300025925 | Bacteria | 1354 |
| 370 | Ga0207650_10381883 | 3300025925 | Bacteria | 1163 |
| 371 | Ga0207650_10435230 | 3300025925 | Bacteria | 1090 |
| 372 | Ga0207659_10001704 | 3300025926 | Bacteria | 13045 |
| 373 | Ga0207659_10110055 | 3300025926 | Bacteria | 2093 |
| 374 | Ga0207659_10338491 | 3300025926 | Bacteria | 1245 |
| 375 | Ga0207659_10977508 | 3300025926 | Bacteria | 728 |
| 376 | Ga0207687_10540135 | 3300025927 | Bacteria | 977 |
| 377 | Ga0207687_10548898 | 3300025927 | Bacteria | 969 |
| 378 | Ga0207664_10569153 | 3300025929 | Bacteria | 1017 |
| 379 | Ga0207664_11214378 | 3300025929 | Bacteria | 672 |
| 380 | Ga0207644_10246131 | 3300025931 | Bacteria | 1425 |
| 381 | Ga0207644_10736364 | 3300025931 | Bacteria | 823 |
| 382 | Ga0207644_10772513 | 3300025931 | Bacteria | 803 |
| 383 | Ga0207644_11247569 | 3300025931 | Bacteria | 625 |
| 384 | Ga0207690_11038971 | 3300025932 | Bacteria | 682 |
| 385 | Ga0207690_11091870 | 3300025932 | Bacteria | 665 |
| 386 | Ga0207706_10169030 | 3300025933 | Bacteria | 1922 |
| 387 | Ga0207706_10254171 | 3300025933 | Bacteria | 1534 |
| 388 | Ga0207706_10928436 | 3300025933 | Bacteria | 734 |
| 389 | Ga0207706_11226015 | 3300025933 | Bacteria | 623 |
| 390 | Ga0207686_10009661 | 3300025934 | Bacteria | 5239 |
| 391 | Ga0207686_10016521 | 3300025934 | Bacteria | 4142 |
| 392 | Ga0207686_10018299 | 3300025934 | Bacteria | 3966 |
| 393 | Ga0207686_10719481 | 3300025934 | Bacteria | 795 |
| 394 | Ga0207686_11657190 | 3300025934 | Bacteria | 529 |
| 395 | Ga0207709_10118091 | 3300025935 | Bacteria | 1786 |
| 396 | Ga0207709_10511740 | 3300025935 | Bacteria | 938 |
| 397 | Ga0207709_10937155 | 3300025935 | Bacteria | 705 |
| 398 | Ga0207670_10031826 | 3300025936 | Bacteria | 3386 |
| 399 | Ga0207670_10055644 | 3300025936 | Bacteria | 2674 |
| 400 | Ga0207670_10198354 | 3300025936 | Bacteria | 1523 |
| 401 | Ga0207670_10398825 | 3300025936 | Bacteria | 1099 |
| 402 | Ga0207670_10468252 | 3300025936 | Bacteria | 1018 |
| 403 | Ga0207670_11209767 | 3300025936 | Bacteria | 640 |
| 404 | Ga0207669_10030057 | 3300025937 | Bacteria | 3014 |
| 405 | Ga0207669_10137030 | 3300025937 | Bacteria | 1692 |
| 406 | Ga0207669_10149676 | 3300025937 | Bacteria | 1633 |
| 407 | Ga0207669_10698827 | 3300025937 | Bacteria | 833 |
| 408 | Ga0207669_10820376 | 3300025937 | Bacteria | 772 |
| 409 | Ga0207669_10955518 | 3300025937 | Bacteria | 718 |
| 410 | Ga0207669_11220207 | 3300025937 | Bacteria | 637 |
| 411 | Ga0207669_11904987 | 3300025937 | Bacteria | 508 |
| 412 | Ga0207704_10131203 | 3300025938 | Bacteria | 1735 |
| 413 | Ga0207704_10803382 | 3300025938 | Bacteria | 786 |
| 414 | Ga0207665_10535488 | 3300025939 | Bacteria | 908 |
| 415 | Ga0207691_10008862 | 3300025940 | Bacteria | 9656 |
| 416 | Ga0207691_10476398 | 3300025940 | Bacteria | 1061 |
| 417 | Ga0207691_10572243 | 3300025940 | Bacteria | 957 |
| 418 | Ga0207711_10068759 | 3300025941 | Bacteria | 3068 |
| 419 | Ga0207711_10575921 | 3300025941 | Bacteria | 1050 |
| 420 | Ga0207711_10603212 | 3300025941 | Bacteria | 1024 |
| 421 | Ga0207711_11140011 | 3300025941 | Bacteria | 721 |
| 422 | Ga0207689_10203269 | 3300025942 | Bacteria | 1635 |
| 423 | Ga0207689_10206961 | 3300025942 | Bacteria | 1620 |
| 424 | Ga0207689_10273860 | 3300025942 | Bacteria | 1397 |
| 425 | Ga0207661_10072644 | 3300025944 | Bacteria | 2815 |
| 426 | Ga0207661_11414794 | 3300025944 | Bacteria | 638 |
| 427 | Ga0207679_10219061 | 3300025945 | Bacteria | 1600 |
| 428 | Ga0207667_10175639 | 3300025949 | Bacteria | 2201 |
| 429 | Ga0207667_10246512 | 3300025949 | Bacteria | 1828 |
| 430 | Ga0207667_10324884 | 3300025949 | Bacteria | 1571 |
| 431 | Ga0207651_10036504 | 3300025960 | Bacteria | 3209 |
| 432 | Ga0207651_10059456 | 3300025960 | Bacteria | 2648 |
| 433 | Ga0207651_10111768 | 3300025960 | Bacteria | 2052 |
| 434 | Ga0207651_10199611 | 3300025960 | Bacteria | 1602 |
| 435 | Ga0207651_10381798 | 3300025960 | Bacteria | 1194 |
| 436 | Ga0207651_10670780 | 3300025960 | Bacteria | 911 |
| 437 | Ga0207651_11808616 | 3300025960 | Bacteria | 550 |
| 438 | Ga0207712_11546897 | 3300025961 | Bacteria | 594 |
| 439 | Ga0207668_10283658 | 3300025972 | Bacteria | 1359 |
| 440 | Ga0207668_11415126 | 3300025972 | Bacteria | 627 |
| 441 | Ga0207640_10399967 | 3300025981 | Bacteria | 1118 |
| 442 | Ga0207640_10477137 | 3300025981 | Bacteria | 1034 |
| 443 | Ga0207640_10585053 | 3300025981 | Bacteria | 943 |
| 444 | Ga0207640_10644569 | 3300025981 | Bacteria | 902 |
| 445 | Ga0207640_11018309 | 3300025981 | Bacteria | 729 |
| 446 | Ga0207640_11352102 | 3300025981 | Bacteria | 637 |
| 447 | Ga0207658_10165595 | 3300025986 | Bacteria | 1816 |
| 448 | Ga0207658_11242280 | 3300025986 | Bacteria | 681 |
| 449 | Ga0207677_10068962 | 3300026023 | Bacteria | 2485 |
| 450 | Ga0207677_10190830 | 3300026023 | Bacteria | 1620 |
| 451 | Ga0207677_11183150 | 3300026023 | Bacteria | 699 |
| 452 | Ga0207677_11446440 | 3300026023 | Bacteria | 634 |
| 453 | Ga0207677_11460027 | 3300026023 | Bacteria | 631 |
| 454 | Ga0207703_10108254 | 3300026035 | Bacteria | 2367 |
| 455 | Ga0207703_10366621 | 3300026035 | Bacteria | 1330 |
| 456 | Ga0207703_10565482 | 3300026035 | Bacteria | 1073 |
| 457 | Ga0207639_10018858 | 3300026041 | Bacteria | 4910 |
| 458 | Ga0207639_10081460 | 3300026041 | Bacteria | 2564 |
| 459 | Ga0207639_10681108 | 3300026041 | Bacteria | 953 |
| 460 | Ga0207708_10312632 | 3300026075 | Bacteria | 1280 |
| 461 | Ga0207708_11086250 | 3300026075 | Bacteria | 697 |
| 462 | Ga0207702_10114437 | 3300026078 | Bacteria | 2404 |
| 463 | Ga0207702_10577157 | 3300026078 | Bacteria | 1102 |
| 464 | Ga0207641_10529841 | 3300026088 | Bacteria | 1147 |
| 465 | Ga0207641_10572465 | 3300026088 | Bacteria | 1103 |
| 466 | Ga0207641_11930667 | 3300026088 | Bacteria | 592 |
| 467 | Ga0207648_10049310 | 3300026089 | Bacteria | 3685 |
| 468 | Ga0207648_10186006 | 3300026089 | Bacteria | 1840 |
| 469 | Ga0207648_10577479 | 3300026089 | Bacteria | 1034 |
| 470 | Ga0207648_10710905 | 3300026089 | Bacteria | 931 |
| 471 | Ga0207676_10208510 | 3300026095 | Bacteria | 1732 |
| 472 | Ga0207676_10309620 | 3300026095 | Bacteria | 1445 |
| 473 | Ga0207676_10453884 | 3300026095 | Bacteria | 1209 |
| 474 | Ga0207676_11155911 | 3300026095 | Bacteria | 766 |
| 475 | Ga0207674_10022377 | 3300026116 | Bacteria | 6788 |
| 476 | Ga0207675_100136832 | 3300026118 | Bacteria | 2325 |
| 477 | Ga0207675_100143544 | 3300026118 | Bacteria | 2269 |
| 478 | Ga0207675_100166250 | 3300026118 | Bacteria | 2107 |
| 479 | Ga0207675_100306952 | 3300026118 | Bacteria | 1546 |
| 480 | Ga0207675_101527272 | 3300026118 | Bacteria | 688 |
| 481 | Ga0207683_10015833 | 3300026121 | Bacteria | 6420 |
| 482 | Ga0207683_10119357 | 3300026121 | Bacteria | 2366 |
| 483 | Ga0207683_10333372 | 3300026121 | Bacteria | 1391 |
| 484 | Ga0207683_11067120 | 3300026121 | Bacteria | 749 |
| 485 | Ga0207683_11144786 | 3300026121 | Bacteria | 721 |
| 486 | Ga0207698_10010326 | 3300026142 | Bacteria | 5990 |
| 487 | Ga0207698_10018098 | 3300026142 | Bacteria | 4794 |
| 488 | Ga0207698_10158112 | 3300026142 | Bacteria | 1978 |
| 489 | Ga0207698_10297306 | 3300026142 | Bacteria | 1501 |
| 490 | Ga0207698_10571078 | 3300026142 | Bacteria | 1111 |
| 491 | Ga0207698_11904398 | 3300026142 | Bacteria | 609 |
| 492 | Ga0209281_1032441 | 3300027111 | Bacteria | 924 |
| 493 | Ga0209389_1000305 | 3300027296 | Bacteria | 30534 |
| 494 | Ga0209371_1008392 | 3300027312 | Bacteria | 3443 |
| 495 | Ga0209968_1104408 | 3300027526 | Bacteria | 517 |
| 496 | Ga0209282_1003491 | 3300027666 | Bacteria | 9346 |
| 497 | Ga0209813_10387718 | 3300027866 | Bacteria | 560 |
| 498 | Ga0209974_10099950 | 3300027876 | Bacteria | 1013 |
| 499 | Ga0207428_10007467 | 3300027907 | Bacteria | 9965 |
| 500 | Ga0268266_10012447 | 3300028379 | Bacteria | 7353 |
| 501 | Ga0268266_10179478 | 3300028379 | Bacteria | 1927 |
| 502 | Ga0268266_10435073 | 3300028379 | Bacteria | 1245 |
| 503 | Ga0268266_10866667 | 3300028379 | Bacteria | 873 |
| 504 | Ga0268265_10011028 | 3300028380 | Bacteria | 6104 |
| 505 | Ga0268264_10324135 | 3300028381 | Bacteria | 1458 |
| 506 | Ga0268264_10757267 | 3300028381 | Bacteria | 968 |
| 507 | Ga0307515_10012540 | 3300028794 | Bacteria | 15942 |
| 508 | Ga0268256_1008739 | 3300030500 | Bacteria | 3443 |
| 509 | Ga0307511_10000653 | 3300030521 | Bacteria | 37038 |
| 510 | Ga0307408_100037446 | 3300031548 | Bacteria | 3417 |
| 511 | Ga0307408_100076942 | 3300031548 | Bacteria | 2483 |
| 512 | Ga0307408_100308376 | 3300031548 | Bacteria | 1329 |
| 513 | Ga0307408_100636016 | 3300031548 | Bacteria | 952 |
| 514 | Ga0307408_100695165 | 3300031548 | Bacteria | 913 |
| 515 | Ga0307408_101826722 | 3300031548 | Bacteria | 581 |
| 516 | Ga0307405_10647771 | 3300031731 | Bacteria | 868 |
| 517 | Ga0307405_10810808 | 3300031731 | Bacteria | 785 |
| 518 | Ga0307413_10797045 | 3300031824 | Bacteria | 793 |
| 519 | Ga0307413_11014028 | 3300031824 | Bacteria | 712 |
| 520 | Ga0307413_11548899 | 3300031824 | Bacteria | 587 |
| 521 | Ga0307410_10045976 | 3300031852 | Bacteria | 2910 |
| 522 | Ga0307410_10516749 | 3300031852 | Bacteria | 985 |
| 523 | Ga0307410_10889677 | 3300031852 | Bacteria | 762 |
| 524 | Ga0307410_11540672 | 3300031852 | Bacteria | 586 |
| 525 | Ga0307406_10992452 | 3300031901 | Bacteria | 720 |
| 526 | Ga0307406_11483506 | 3300031901 | Bacteria | 596 |
| 527 | Ga0307412_10062339 | 3300031911 | Bacteria | 2510 |
| 528 | Ga0307412_10227496 | 3300031911 | Bacteria | 1434 |
| 529 | Ga0307412_10528078 | 3300031911 | Bacteria | 987 |
| 530 | Ga0307412_10588460 | 3300031911 | Bacteria | 940 |
| 531 | Ga0307412_11247265 | 3300031911 | Bacteria | 667 |
| 532 | Ga0307412_11256247 | 3300031911 | Bacteria | 665 |
| 533 | Ga0307412_11740242 | 3300031911 | Bacteria | 572 |
| 534 | Ga0307412_12026988 | 3300031911 | Bacteria | 533 |
| 535 | Ga0307409_100530074 | 3300031995 | Bacteria | 1152 |
| 536 | Ga0307409_101717297 | 3300031995 | Bacteria | 656 |
| 537 | Ga0307416_100099454 | 3300032002 | Bacteria | 2526 |
| 538 | Ga0307416_100235039 | 3300032002 | Bacteria | 1770 |
| 539 | Ga0307416_100567651 | 3300032002 | Bacteria | 1210 |
| 540 | Ga0307416_101082964 | 3300032002 | Bacteria | 906 |
| 541 | Ga0307416_101457356 | 3300032002 | Bacteria | 790 |
| 542 | Ga0307416_101943001 | 3300032002 | Bacteria | 691 |
| 543 | Ga0307416_102238659 | 3300032002 | Bacteria | 647 |
| 544 | Ga0307416_102769408 | 3300032002 | Bacteria | 586 |
| 545 | Ga0307416_103306580 | 3300032002 | Bacteria | 539 |
| 546 | Ga0307414_11263315 | 3300032004 | Bacteria | 684 |
| 547 | Ga0307414_12021100 | 3300032004 | Bacteria | 538 |
| 548 | Ga0307411_10899431 | 3300032005 | Bacteria | 786 |
| 549 | Ga0307411_10958456 | 3300032005 | Bacteria | 763 |
| 550 | Ga0307411_11333878 | 3300032005 | Bacteria | 655 |
| 551 | Ga0307411_11460992 | 3300032005 | Bacteria | 627 |
| 552 | Ga0307415_100320022 | 3300032126 | Bacteria | 1293 |
| 553 | Ga0316593_10015257 | 3300032168 | Bacteria | 2308 |
| 554 | Ga0373930_0072518 | 3300034816 | Bacteria | 785 |
| 555 | Ga0373958_0003362 | 3300034819 | Bacteria | 2301 |
| 556 | Ga0373938_0165006 | 3300034957 | Bacteria | 597 |
| 557 | Ga0373929_0047864 | 3300035085 | Bacteria | 970 |
| 558 | Ga0373951_0065264 | 3300035091 | Bacteria | 918 |
| 559 | Ga0373952_0027225 | 3300035092 | Bacteria | 1247 |
| 560 | Ga0373923_0081400 | 3300035111 | Bacteria | 1405 |
| 561 | Ga0373941_0406996 | 3300035115 | Bacteria | 564 |
| 562 | Ga0373956_0174331 | 3300035119 | Bacteria | 1015 |
| 563 | Ga0373943_0175221 | 3300035170 | Bacteria | 1176 |
| 564 | Ga0373946_0253663 | 3300035171 | Bacteria | 859 |
| 565 | Ga0373955_0063660 | 3300035172 | Bacteria | 2042 |
| 566 | Ga0373961_0192614 | 3300035241 | Bacteria | 716 |
| 567 | Ga0373924_0082696 | 3300035410 | Bacteria | 1367 |
| 568 | Ga0373924_0136652 | 3300035410 | Bacteria | 1068 |
| 569 | Ga0373924_0278321 | 3300035410 | Bacteria | 742 |
| 570 | Ga0373931_0020764 | 3300035691 | Bacteria | 3289 |
| 571 | Ga0373931_0048480 | 3300035691 | Bacteria | 2252 |
| 572 | Ga0373931_0064668 | 3300035691 | Bacteria | 1980 |
| 573 | Ga0373935_1004287 | 3300035692 | Bacteria | 620 |
| 574 | Ga0373927_0135268 | 3300035695 | Bacteria | 1611 |
| 575 | Ga0373933_0650630 | 3300035724 | Bacteria | 693 |
| 576 | Ga0373947_0154304 | 3300035725 | Bacteria | 1481 |
| 577 | Ga0373947_0806441 | 3300035725 | Bacteria | 641 |
| 578 | Ga0373937_0093062 | 3300036401 | Bacteria | 2794 |
| 579 | Ga0373937_0210934 | 3300036401 | Bacteria | 1827 |
| 580 | Ga0373937_0544753 | 3300036401 | Bacteria | 1102 |
| 581 | Ga0373925_0008267 | 3300037068 | Bacteria | 7573 |
| 582 | Ga0373925_0154357 | 3300037068 | Bacteria | 1805 |
| 583 | Ga0373925_0798447 | 3300037068 | Bacteria | 778 |
| 584 | Ga0373925_1308311 | 3300037068 | Bacteria | 595 |
| 585 | Ga0395899_0135248 | 3300037312 | Bacteria | 1757 |
| 586 | Ga0395900_0034072 | 3300037418 | Bacteria | 5242 |
| 587 | Ga0395898_0254758 | 3300037466 | Bacteria | 1674 |
| 588 | Ga0395905_0032891 | 3300037471 | Bacteria | 4875 |
| 589 | Ga0395905_0048048 | 3300037471 | Bacteria | 3999 |
| 590 | Ga0395905_1024976 | 3300037471 | Bacteria | 728 |
| 591 | Ga0395901_0033769 | 3300038443 | Bacteria | 5283 |
| 592 | Ga0436365_0531964 | 3300039437 | Bacteria | 3865 |
| 593 | Ga0436365_0661840 | 3300039437 | Bacteria | 861 |
| 594 | Ga0436361_0714431 | 3300039447 | Bacteria | 79592 |
| 595 | Ga0436361_0815871 | 3300039447 | Bacteria | 532 |
| 596 | Ga0436361_0818040 | 3300039447 | Bacteria | 529 |
| 597 | Ga0436361_1155176 | 3300039447 | Bacteria | 13767 |
| 598 | Ga0439461_0013318 | 3300041410 | Bacteria | 1551 |
| 599 | Ga0451807_1460479 | 3300041486 | Bacteria | 2981 |
| 600 | Ga0451807_2053462 | 3300041486 | Bacteria | 664 |
| 601 | Ga0451839_0745541 | 3300041496 | Bacteria | 670 |
| 602 | Ga0451855_0951061 | 3300041511 | Bacteria | 1307 |
| 603 | Ga0439431_0076616 | 3300041997 | Bacteria | 897 |
| 604 | Ga0439437_016373 | 3300042000 | Bacteria | 875 |
| 605 | Ga0439437_017209 | 3300042000 | Bacteria | 858 |
| 606 | Ga0439441_006145 | 3300042001 | Bacteria | 1894 |
| 607 | Ga0439441_148165 | 3300042001 | Bacteria | 552 |
| 608 | Ga0439442_006578 | 3300042002 | Bacteria | 2335 |
| 609 | Ga0439445_0021993 | 3300042004 | Bacteria | 1605 |
| 610 | Ga0439455_0101248 | 3300042012 | Bacteria | 796 |
| 611 | Ga0450911_022275 | 3300042115 | Bacteria | 825 |
| 612 | Ga0450919_000930 | 3300042121 | Bacteria | 3783 |
| 613 | Ga0450920_013556 | 3300042122 | Bacteria | 1537 |
| 614 | Ga0450922_014034 | 3300042124 | Bacteria | 787 |
| 615 | Ga0450923_005700 | 3300042125 | Bacteria | 2027 |
| 616 | Ga0450890_000550 | 3300042127 | Bacteria | 5489 |
| 617 | Ga0450897_021614 | 3300042128 | Bacteria | 693 |
| 618 | Ga0450895_001799 | 3300042132 | Bacteria | 1535 |
| 619 | Ga0450896_005520 | 3300042133 | Bacteria | 1724 |
| 620 | Ga0450898_006294 | 3300042134 | Bacteria | 1817 |
| 621 | Ga0450898_052615 | 3300042134 | Bacteria | 789 |
| 622 | Ga0450905_045023 | 3300042142 | Bacteria | 709 |
| 623 | Ga0450906_005991 | 3300042145 | Bacteria | 2474 |
| 624 | Ga0450910_006865 | 3300042147 | Bacteria | 1577 |
| 625 | Ga0439446_0101355 | 3300042156 | Bacteria | 911 |
| 626 | Ga0439446_0340317 | 3300042156 | Bacteria | 533 |
| 627 | Ga0450908_002334 | 3300042184 | Bacteria | 3716 |
| 628 | Ga0450909_005658 | 3300042185 | Bacteria | 1799 |
| 629 | Ga0439434_0016124 | 3300042435 | Bacteria | 2231 |
| 630 | Ga0439444_0023086 | 3300042437 | Bacteria | 1114 |
| 631 | Ga0439459_0000309 | 3300042438 | Bacteria | 5891 |
| 632 | Ga0450918_000550 | 3300042531 | Bacteria | 8018 |
| 633 | Ga0451577_0312572 | 3300042876 | Bacteria | 1424 |
| 634 | Ga0451577_0422547 | 3300042876 | Bacteria | 1210 |
| 635 | Ga0466969_0002653 | 3300044656 | Bacteria | 9554 |
| 636 | Ga0466969_0012551 | 3300044656 | Bacteria | 4465 |
| 637 | Ga0466965_0018301 | 3300044683 | Bacteria | 3357 |
| 638 | Ga0466966_0021693 | 3300044684 | Bacteria | 4215 |
| 639 | Ga0466966_0050829 | 3300044684 | Bacteria | 2636 |
| 640 | Ga0466966_0179930 | 3300044684 | Bacteria | 1283 |
| 641 | Ga0466961_0026432 | 3300044693 | Bacteria | 3731 |
| 642 | Ga0466961_0117869 | 3300044693 | Bacteria | 1668 |
| 643 | Ga0466963_0003881 | 3300044694 | Bacteria | 8635 |
| 644 | Ga0466963_0028896 | 3300044694 | Bacteria | 3564 |
| 645 | Ga0466963_0941886 | 3300044694 | Bacteria | 608 |
| 646 | Ga0466963_1136920 | 3300044694 | Bacteria | 549 |
| 647 | Ga0466964_0003200 | 3300044706 | Bacteria | 5954 |
| 648 | Ga0453684_0040166 | 3300044712 | Bacteria | 6361 |
| 649 | Ga0453684_0812939 | 3300044712 | Bacteria | 1007 |
| 650 | Ga0466971_0001482 | 3300044719 | Bacteria | 9910 |
| 651 | Ga0466971_0112608 | 3300044719 | Bacteria | 1256 |
| 652 | Ga0466968_0007045 | 3300044735 | Bacteria | 4261 |
| 653 | Ga0466970_0025081 | 3300044765 | Bacteria | 3120 |
| 654 | Ga0466970_0728805 | 3300044765 | Bacteria | 579 |
| 655 | Ga0466957_0004472 | 3300044842 | Bacteria | 7796 |
| 656 | Ga0466957_0006128 | 3300044842 | Bacteria | 6786 |
| 657 | Ga0466959_0000855 | 3300045049 | Bacteria | 17985 |
| 658 | Ga0466959_0194087 | 3300045049 | Bacteria | 1416 |
| 659 | Ga0451576_0076007 | 3300045051 | Bacteria | 3495 |
| 660 | Ga0451576_1155668 | 3300045051 | Bacteria | 809 |
| 661 | Ga0451576_1697712 | 3300045051 | Bacteria | 654 |
| 662 | Ga0451576_1748150 | 3300045051 | Bacteria | 643 |
| 663 | Ga0466958_0022101 | 3300045836 | Bacteria | 3722 |
| 664 | Ga0466958_0062229 | 3300045836 | Bacteria | 2275 |
| 665 | Ga0466967_0003037 | 3300045976 | Bacteria | 10770 |
| 666 | Ga0466967_1482090 | 3300045976 | Bacteria | 676 |
| 667 | Ga0495592_0002591 | 3300046454 | Bacteria | 12773 |
| 668 | Ga0495603_0211915 | 3300046455 | Bacteria | 1119 |
| 669 | Ga0495638_0050878 | 3300046460 | Bacteria | 2587 |
| 670 | Ga0495639_0328506 | 3300046475 | Bacteria | 765 |
| 671 | Ga0495662_0510431 | 3300046476 | Bacteria | 589 |
| 672 | Ga0495608_0037016 | 3300046511 | Bacteria | 3282 |
| 673 | Ga0495618_0376514 | 3300046514 | Bacteria | 872 |
| 674 | Ga0495628_0200181 | 3300046516 | Bacteria | 1505 |
| 675 | Ga0495643_0220705 | 3300046522 | Bacteria | 899 |
| 676 | Ga0495652_0016132 | 3300046529 | Bacteria | 6682 |
| 677 | Ga0495587_0038829 | 3300046536 | Bacteria | 2852 |
| 678 | Ga0495598_0009707 | 3300046537 | Bacteria | 2284 |
| 679 | Ga0495598_0089281 | 3300046537 | Bacteria | 1002 |
| 680 | Ga0495598_0136697 | 3300046537 | Bacteria | 845 |
| 681 | Ga0495621_0003232 | 3300046539 | Bacteria | 4478 |
| 682 | Ga0495621_0155953 | 3300046539 | Bacteria | 900 |
| 683 | Ga0495621_0236939 | 3300046539 | Bacteria | 742 |
| 684 | Ga0495621_0381284 | 3300046539 | Bacteria | 595 |
| 685 | Ga0495645_0004671 | 3300046543 | Bacteria | 9348 |
| 686 | Ga0495633_0491254 | 3300046558 | Bacteria | 554 |
| 687 | Ga0495667_0029984 | 3300046559 | Bacteria | 3657 |
| 688 | Ga0495625_0093900 | 3300046660 | Bacteria | 2070 |
| 689 | Ga0495635_0032495 | 3300046663 | Bacteria | 3620 |
| 690 | Ga0495635_0593245 | 3300046663 | Bacteria | 724 |
| 691 | Ga0495657_0043896 | 3300046675 | Bacteria | 3045 |
| 692 | Ga0495599_0215073 | 3300046678 | Bacteria | 1177 |
| 693 | Ga0495623_0049231 | 3300046679 | Bacteria | 2671 |
| 694 | Ga0495658_0058804 | 3300046683 | Bacteria | 2200 |
| 695 | Ga0495658_0079564 | 3300046683 | Bacteria | 1921 |
| 696 | Ga0495670_0131790 | 3300046691 | Bacteria | 1303 |
| 697 | Ga0495649_0384555 | 3300046694 | Bacteria | 706 |
| 698 | Ga0495600_0104793 | 3300046809 | Bacteria | 1843 |
| 699 | Ga0495604_0346861 | 3300047317 | Bacteria | 987 |
| 700 | Ga0495636_0275904 | 3300047318 | Bacteria | 782 |
| 701 | Ga0495615_0055884 | 3300048090 | Bacteria | 1029 |
| 702 | Ga0496104_0792125 | 3300048907 | Bacteria | 854 |
| 703 | Ga0496105_0090136 | 3300048908 | Bacteria | 2533 |
| 704 | Ga0496108_0254139 | 3300048911 | Bacteria | 1529 |
| 705 | Ga0496109_0068230 | 3300048912 | Bacteria | 3260 |
| 706 | Ga0496110_0101200 | 3300048913 | Bacteria | 2583 |
| 707 | Ga0496111_0175822 | 3300048914 | Bacteria | 1591 |
| 708 | Ga0496111_0639507 | 3300048914 | Bacteria | 777 |
| 709 | Ga0496122_0000317 | 3300048925 | Bacteria | 105883 |
| 710 | Ga0496122_0329178 | 3300048925 | Bacteria | 808 |
| 711 | Ga0496123_0000264 | 3300048926 | Bacteria | 105015 |
| 712 | Ga0496123_0301364 | 3300048926 | Bacteria | 765 |
| 713 | Ga0496124_0018476 | 3300048927 | Bacteria | 6527 |
| 714 | Ga0496124_0030272 | 3300048927 | Bacteria | 4807 |
| 715 | Ga0501308_000356 | 3300049128 | Bacteria | 2885 |
| 716 | Ga0501308_007699 | 3300049128 | Bacteria | 1135 |
| 717 | Ga0501308_049830 | 3300049128 | Bacteria | 610 |
| 718 | Ga0501309_044535 | 3300049129 | Bacteria | 685 |
| 719 | Ga0501310_013780 | 3300049130 | Bacteria | 942 |
| 720 | Ga0501304_004382 | 3300049160 | Bacteria | 1070 |
| 721 | Ga0501304_014799 | 3300049160 | Bacteria | 725 |
| 722 | Ga0501305_018600 | 3300049161 | Bacteria | 1007 |
| 723 | Ga0501307_012886 | 3300049162 | Bacteria | 1002 |
| 724 | Ga0501307_045179 | 3300049162 | Bacteria | 649 |
| 725 | Ga0501307_054245 | 3300049162 | Bacteria | 609 |
| 726 | Ga0495678_186719 | 3300049459 | Bacteria | 647 |
| 727 | Ga0501299_069992 | 3300049522 | Bacteria | 760 |
| 728 | Ga0501311_024495 | 3300049527 | Bacteria | 841 |
| 729 | Ga0501311_045641 | 3300049527 | Bacteria | 675 |
| 730 | Ga0501312_055610 | 3300049528 | Bacteria | 676 |
| 731 | Ga0501312_090828 | 3300049528 | Bacteria | 563 |
| 732 | Ga0501313_043838 | 3300049529 | Bacteria | 606 |
| 733 | Ga0501314_001810 | 3300049530 | Bacteria | 1590 |
| 734 | Ga0501314_012643 | 3300049530 | Bacteria | 811 |
| 735 | Ga0501314_014200 | 3300049530 | Bacteria | 779 |
| 736 | Ga0501315_005277 | 3300049531 | Bacteria | 1393 |
| 737 | Ga0501316_013333 | 3300049532 | Bacteria | 971 |
| 738 | Ga0501316_054783 | 3300049532 | Bacteria | 580 |
| 739 | Ga0501319_013452 | 3300049535 | Bacteria | 679 |
| 740 | Ga0501319_015308 | 3300049535 | Bacteria | 650 |
| 741 | Ga0501320_000194 | 3300049536 | Bacteria | 3114 |
| 742 | Ga0501320_005049 | 3300049536 | Bacteria | 1188 |
| 743 | Ga0501320_060264 | 3300049536 | Bacteria | 533 |
| 744 | Ga0501322_020921 | 3300049538 | Bacteria | 574 |
| 745 | Ga0501323_011310 | 3300049539 | Bacteria | 1076 |
| 746 | Ga0501031_0010546 | 3300049568 | Bacteria | 6015 |
| 747 | Ga0501034_0193193 | 3300049571 | Bacteria | 1997 |
| 748 | Ga0501039_1063416 | 3300049575 | Bacteria | 628 |
| 749 | Ga0501047_0040997 | 3300049581 | Bacteria | 4475 |
| 750 | Ga0501047_0122861 | 3300049581 | Bacteria | 2477 |
| 751 | Ga0501047_0930428 | 3300049581 | Bacteria | 682 |
| 752 | Ga0501069_0001064 | 3300049585 | Bacteria | 13167 |
| 753 | Ga0501070_0001356 | 3300049586 | Bacteria | 21938 |
| 754 | Ga0501070_0138143 | 3300049586 | Bacteria | 2012 |
| 755 | Ga0501073_0000321 | 3300049589 | Bacteria | 32033 |
| 756 | Ga0501073_0464001 | 3300049589 | Bacteria | 875 |
| 757 | Ga0501074_0000097 | 3300049590 | Bacteria | 42311 |
| 758 | Ga0501249_010598 | 3300049679 | Bacteria | 1930 |
| 759 | Ga0501257_046461 | 3300049686 | Bacteria | 1076 |
| 760 | Ga0501079_0009081 | 3300049741 | Bacteria | 7529 |
| 761 | Ga0501080_0011166 | 3300049742 | Bacteria | 8223 |
| 762 | Ga0501080_0200887 | 3300049742 | Bacteria | 1830 |
| 763 | Ga0501080_0415215 | 3300049742 | Bacteria | 1209 |
| 764 | Ga0501083_0004051 | 3300049744 | Bacteria | 10308 |
| 765 | Ga0501262_000495 | 3300049759 | Bacteria | 4689 |
| 766 | Ga0501035_0286694 | 3300049822 | Bacteria | 1390 |
| 767 | Ga0501044_0083251 | 3300049823 | Bacteria | 3236 |
| 768 | nmdc:mga03683_40367_c1 | 3300050489 | Bacteria | 1914 |
| 769 | nmdc:mga03683_494499_c1 | 3300050489 | Bacteria | 592 |
| 770 | nmdc:mga03683_89229_c1 | 3300050489 | Bacteria | 1342 |
| 771 | nmdc:mga03n38_185825_c1 | 3300050490 | Bacteria | 1068 |
| 772 | nmdc:mga03n38_602745_c1 | 3300050490 | Bacteria | 626 |
| 773 | nmdc:mga03n38_703938_c1 | 3300050490 | Bacteria | 582 |
| 774 | nmdc:mga00v17_209926_c1 | 3300050491 | Bacteria | 1260 |
| 775 | nmdc:mga00v17_250937_c1 | 3300050491 | Bacteria | 1147 |
| 776 | nmdc:mga00v17_5329_c1 | 3300050491 | Bacteria | 6775 |
| 777 | nmdc:mga00v17_872918_c1 | 3300050491 | Bacteria | 571 |
| 778 | nmdc:mga0yw44_115307_c1 | 3300050492 | Bacteria | 1725 |
| 779 | nmdc:mga0yw44_60430_c1 | 3300050492 | Bacteria | 2322 |
| 780 | nmdc:mga0k408_109049_c1 | 3300050493 | Bacteria | 1636 |
| 781 | nmdc:mga0k408_13809_c1 | 3300050493 | Bacteria | 4436 |
| 782 | nmdc:mga0k408_15566_c1 | 3300050493 | Bacteria | 4206 |
| 783 | nmdc:mga0k408_1928_c1 | 3300050493 | Bacteria | 11118 |
| 784 | nmdc:mga0k408_33698_c1 | 3300050493 | Bacteria | 2694 |
| 785 | nmdc:mga0k408_4084_c1 | 3300050493 | Bacteria | 7751 |
| 786 | nmdc:mga0k408_8663_c1 | 3300050493 | Bacteria | 5469 |
| 787 | nmdc:mga06z11_157963_c1 | 3300050494 | Bacteria | 1294 |
| 788 | nmdc:mga06z11_31132_c1 | 3300050494 | Bacteria | 2589 |
| 789 | nmdc:mga06z11_99456_c1 | 3300050494 | Bacteria | 1593 |
| 790 | nmdc:mga04h51_424623_c1 | 3300050495 | Bacteria | 559 |
| 791 | nmdc:mga07m45_169196_c1 | 3300050496 | Bacteria | 1270 |
| 792 | nmdc:mga07m45_2931_c1 | 3300050496 | Bacteria | 8100 |
| 793 | nmdc:mga07m45_419845_c1 | 3300050496 | Bacteria | 776 |
| 794 | nmdc:mga07m45_6617_c5 | 3300050496 | Bacteria | 872 |
| 795 | nmdc:mga07m45_705162_c1 | 3300050496 | Bacteria | 580 |
| 796 | nmdc:mga07m45_93439_c1 | 3300050496 | Bacteria | 1724 |
| 797 | nmdc:mga09592_472609_c1 | 3300050508 | Bacteria | 1081 |
| 798 | nmdc:mga08y16_11064_c1 | 3300050511 | Bacteria | 9474 |
| 799 | nmdc:mga0n895_1150352_c1 | 3300050512 | Bacteria | 752 |
| 800 | nmdc:mga0n895_286717_c1 | 3300050512 | Bacteria | 1669 |
| 801 | nmdc:mga0n895_617741_c1 | 3300050512 | Bacteria | 1085 |
| 802 | nmdc:mga0rr50_1608784_c1 | 3300050513 | Bacteria | 548 |
| 803 | nmdc:mga0rr50_383077_c1 | 3300050513 | Bacteria | 1186 |
| 804 | nmdc:mga0rr50_416377_c1 | 3300050513 | Bacteria | 1136 |
| 805 | nmdc:mga0a205_116902_c1 | 3300050515 | Bacteria | 2565 |
| 806 | nmdc:mga0sz30_1133_c1 | 3300050516 | Bacteria | 9551 |
| 807 | nmdc:mga0sz30_225369_c1 | 3300050516 | Bacteria | 833 |
| 808 | nmdc:mga0sz30_39330_c1 | 3300050516 | Bacteria | 1984 |
| 809 | Ga0495595_0071547 | 3300053084 | Bacteria | 1640 |
| 810 | Ga0495619_0055676 | 3300053085 | Bacteria | 2620 |
| 811 | Ga0500646_0009238 | 3300053090 | Bacteria | 2523 |
| 812 | Ga0500583_0484867 | 3300053092 | Bacteria | 582 |
| 813 | Ga0500641_0008546 | 3300053096 | Bacteria | 3658 |
| 814 | Ga0500555_046254 | 3300053103 | Bacteria | 1200 |
| 815 | Ga0500621_121572 | 3300053126 | Bacteria | 1010 |
| 816 | Ga0500655_002279 | 3300053133 | Bacteria | 3523 |
| 817 | Ga0500568_0111278 | 3300053139 | Bacteria | 1023 |
| 818 | Ga0500604_0000352 | 3300053151 | Bacteria | 12731 |
| 819 | Ga0500616_0326729 | 3300053153 | Bacteria | 630 |
| 820 | Ga0500622_0001316 | 3300053156 | Bacteria | 20204 |
| 821 | Ga0500645_018988 | 3300053730 | Bacteria | 2142 |
| 822 | Ga0501084_0021259 | 3300054114 | Bacteria | 5410 |
| 823 | Ga0590071_001831 | 3300059421 | Bacteria | 5489 |
| 824 | Ga0590075_178135 | 3300059424 | Bacteria | 562 |
| 825 | Ga0590077_097116 | 3300059426 | Bacteria | 687 |
| 826 | Ga0587106_091383 | 3300059605 | Bacteria | 608 |
| 827 | Ga0466962_0014522 | 3300061719 | Bacteria | 3795 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10677367 | Ga0163162_106773673 | 95 |
| 2 | 3300049128 | Ga0501308_049830 | Ga0501308_049830_275_571 | 96 |
| 3 | 3300031911 | Ga0307412_11740242 | Ga0307412_117402421 | 103 |
| 4 | 3300042012 | Ga0439455_0101248 | Ga0439455_0101248_159_521 | 103 |
| 5 | 3300042128 | Ga0450897_021614 | Ga0450897_021614_145_507 | 103 |
| 6 | 3300042132 | Ga0450895_001799 | Ga0450895_001799_108_470 | 103 |
| 7 | 3300044735 | Ga0466968_0007045 | Ga0466968_0007045_3211_3576 | 104 |
| 8 | 3300049822 | Ga0501035_0286694 | Ga0501035_0286694_410_775 | 104 |
| 9 | 3300003575 | Ga0007409J51694_1026312 | Ga0007409J51694_10263122 | 105 |
| 10 | 3300032005 | Ga0307411_10899431 | Ga0307411_108994312 | 105 |
| 11 | 3300032168 | Ga0316593_10015257 | Ga0316593_100152574 | 105 |
| 12 | 3300049530 | Ga0501314_012643 | Ga0501314_012643_22_387 | 105 |
| 13 | 3300059424 | Ga0590075_178135 | Ga0590075_178135_33_386 | 105 |
| 14 | 3300005328 | Ga0070676_10429620 | Ga0070676_104296202 | 106 |
| 15 | 3300005333 | Ga0070677_10423163 | Ga0070677_104231632 | 106 |
| 16 | 3300005353 | Ga0070669_100077546 | Ga0070669_1000775463 | 106 |
| 17 | 3300005354 | Ga0070675_100537435 | Ga0070675_1005374352 | 106 |
| 18 | 3300005355 | Ga0070671_100151546 | Ga0070671_1001515462 | 106 |
| 19 | 3300005356 | Ga0070674_100831331 | Ga0070674_1008313312 | 106 |
| 20 | 3300005364 | Ga0070673_100055764 | Ga0070673_1000557644 | 106 |
| 21 | 3300005367 | Ga0070667_100337290 | Ga0070667_1003372903 | 106 |
| 22 | 3300005456 | Ga0070678_100195478 | Ga0070678_1001954782 | 106 |
| 23 | 3300005457 | Ga0070662_100060375 | Ga0070662_1000603753 | 106 |
| 24 | 3300005578 | Ga0068854_101411187 | Ga0068854_1014111871 | 106 |
| 25 | 3300009148 | Ga0105243_10847435 | Ga0105243_108474352 | 106 |
| 26 | 3300013306 | Ga0163162_10913966 | Ga0163162_109139661 | 106 |
| 27 | 3300025893 | Ga0207682_10136512 | Ga0207682_101365122 | 106 |
| 28 | 3300025901 | Ga0207688_10904359 | Ga0207688_109043591 | 106 |
| 29 | 3300025923 | Ga0207681_10139757 | Ga0207681_101397573 | 106 |
| 30 | 3300025926 | Ga0207659_10338491 | Ga0207659_103384913 | 106 |
| 31 | 3300025931 | Ga0207644_10246131 | Ga0207644_102461312 | 106 |
| 32 | 3300025933 | Ga0207706_10254171 | Ga0207706_102541712 | 106 |
| 33 | 3300025937 | Ga0207669_10149676 | Ga0207669_101496762 | 106 |
| 34 | 3300025960 | Ga0207651_10059456 | Ga0207651_100594564 | 106 |
| 35 | 3300025972 | Ga0207668_10283658 | Ga0207668_102836582 | 106 |
| 36 | 3300025981 | Ga0207640_10644569 | Ga0207640_106445692 | 106 |
| 37 | 3300025986 | Ga0207658_10165595 | Ga0207658_101655954 | 106 |
| 38 | 3300026121 | Ga0207683_10119357 | Ga0207683_101193572 | 106 |
| 39 | 3300046539 | Ga0495621_0155953 | Ga0495621_0155953_256_621 | 106 |
| 40 | 3300049528 | Ga0501312_090828 | Ga0501312_090828_163_528 | 106 |
| 41 | 3300049568 | Ga0501031_0010546 | Ga0501031_0010546_1167_1532 | 106 |
| 42 | 3300003790 | Ga0055528_1017593 | Ga0055528_10175933 | 108 |
| 43 | 3300005328 | Ga0070676_10261202 | Ga0070676_102612022 | 108 |
| 44 | 3300005331 | Ga0070670_100218635 | Ga0070670_1002186354 | 108 |
| 45 | 3300005333 | Ga0070677_10509202 | Ga0070677_105092021 | 108 |
| 46 | 3300005334 | Ga0068869_100132145 | Ga0068869_1001321452 | 108 |
| 47 | 3300005353 | Ga0070669_100034565 | Ga0070669_1000345653 | 108 |
| 48 | 3300005354 | Ga0070675_101864937 | Ga0070675_1018649372 | 108 |
| 49 | 3300005459 | Ga0068867_100152150 | Ga0068867_1001521503 | 108 |
| 50 | 3300005843 | Ga0068860_100446321 | Ga0068860_1004463213 | 108 |
| 51 | 3300006038 | Ga0075365_10090325 | Ga0075365_100903255 | 108 |
| 52 | 3300006058 | Ga0075432_10016379 | Ga0075432_100163795 | 108 |
| 53 | 3300006177 | Ga0075362_10119745 | Ga0075362_101197452 | 108 |
| 54 | 3300006178 | Ga0075367_10471900 | Ga0075367_104719002 | 108 |
| 55 | 3300006195 | Ga0075366_10886917 | Ga0075366_108869172 | 108 |
| 56 | 3300006353 | Ga0075370_10938323 | Ga0075370_109383232 | 108 |
| 57 | 3300006946 | Ga0079104_1015591 | Ga0079104_10155914 | 108 |
| 58 | 3300011119 | Ga0105246_10880654 | Ga0105246_108806542 | 108 |
| 59 | 3300017792 | Ga0163161_11777879 | Ga0163161_117778792 | 108 |
| 60 | 3300025291 | Ga0209675_1000220 | Ga0209675_100022060 | 108 |
| 61 | 3300025901 | Ga0207688_10586131 | Ga0207688_105861312 | 108 |
| 62 | 3300025907 | Ga0207645_10149288 | Ga0207645_101492884 | 108 |
| 63 | 3300025923 | Ga0207681_10032331 | Ga0207681_100323313 | 108 |
| 64 | 3300025925 | Ga0207650_10281702 | Ga0207650_102817022 | 108 |
| 65 | 3300025931 | Ga0207644_10772513 | Ga0207644_107725132 | 108 |
| 66 | 3300025942 | Ga0207689_10203269 | Ga0207689_102032692 | 108 |
| 67 | 3300027111 | Ga0209281_1032441 | Ga0209281_10324412 | 108 |
| 68 | 3300027666 | Ga0209282_1003491 | Ga0209282_10034918 | 108 |
| 69 | 3300028381 | Ga0268264_10324135 | Ga0268264_103241352 | 108 |
| 70 | 3300031548 | Ga0307408_100076942 | Ga0307408_1000769422 | 108 |
| 71 | 3300031824 | Ga0307413_10797045 | Ga0307413_107970452 | 108 |
| 72 | 3300031852 | Ga0307410_10045976 | Ga0307410_100459765 | 108 |
| 73 | 3300031995 | Ga0307409_101717297 | Ga0307409_1017172972 | 108 |
| 74 | 3300032002 | Ga0307416_103306580 | Ga0307416_1033065801 | 108 |
| 75 | 3300032004 | Ga0307414_11263315 | Ga0307414_112633152 | 108 |
| 76 | 3300032005 | Ga0307411_10958456 | Ga0307411_109584562 | 108 |
| 77 | 3300041410 | Ga0439461_0013318 | Ga0439461_0013318_984_1352 | 108 |
| 78 | 3300041511 | Ga0451855_0951061 | Ga0451855_0951061_848_1216 | 108 |
| 79 | 3300041997 | Ga0439431_0076616 | Ga0439431_0076616_298_666 | 108 |
| 80 | 3300042002 | Ga0439442_006578 | Ga0439442_006578_645_1013 | 108 |
| 81 | 3300042004 | Ga0439445_0021993 | Ga0439445_0021993_518_886 | 108 |
| 82 | 3300042115 | Ga0450911_022275 | Ga0450911_022275_194_562 | 108 |
| 83 | 3300042121 | Ga0450919_000930 | Ga0450919_000930_736_1104 | 108 |
| 84 | 3300042122 | Ga0450920_013556 | Ga0450920_013556_64_432 | 108 |
| 85 | 3300042124 | Ga0450922_014034 | Ga0450922_014034_355_723 | 108 |
| 86 | 3300042125 | Ga0450923_005700 | Ga0450923_005700_769_1137 | 108 |
| 87 | 3300042133 | Ga0450896_005520 | Ga0450896_005520_1278_1646 | 108 |
| 88 | 3300042134 | Ga0450898_052615 | Ga0450898_052615_152_520 | 108 |
| 89 | 3300042145 | Ga0450906_005991 | Ga0450906_005991_1873_2241 | 108 |
| 90 | 3300042147 | Ga0450910_006865 | Ga0450910_006865_439_807 | 108 |
| 91 | 3300042184 | Ga0450908_002334 | Ga0450908_002334_212_580 | 108 |
| 92 | 3300042185 | Ga0450909_005658 | Ga0450909_005658_984_1352 | 108 |
| 93 | 3300042435 | Ga0439434_0016124 | Ga0439434_0016124_852_1220 | 108 |
| 94 | 3300042531 | Ga0450918_000550 | Ga0450918_000550_1326_1694 | 108 |
| 95 | 3300046660 | Ga0495625_0093900 | Ga0495625_0093900_689_1057 | 108 |
| 96 | 3300048925 | Ga0496122_0000317 | Ga0496122_0000317_10817_11185 | 108 |
| 97 | 3300048926 | Ga0496123_0000264 | Ga0496123_0000264_59952_60320 | 108 |
| 98 | 3300048927 | Ga0496124_0018476 | Ga0496124_0018476_1015_1383 | 108 |
| 99 | 3300049162 | Ga0501307_054245 | Ga0501307_054245_171_539 | 108 |
| 100 | 3300049459 | Ga0495678_186719 | Ga0495678_186719_172_540 | 108 |
| 101 | 3300049528 | Ga0501312_055610 | Ga0501312_055610_33_401 | 108 |
| 102 | 3300049530 | Ga0501314_001810 | Ga0501314_001810_908_1276 | 108 |
| 103 | 3300049535 | Ga0501319_013452 | Ga0501319_013452_125_493 | 108 |
| 104 | 3300049536 | Ga0501320_000194 | Ga0501320_000194_403_771 | 108 |
| 105 | 3300049538 | Ga0501322_020921 | Ga0501322_020921_109_477 | 108 |
| 106 | 3300049539 | Ga0501323_011310 | Ga0501323_011310_135_503 | 108 |
| 107 | 3300049679 | Ga0501249_010598 | Ga0501249_010598_249_617 | 108 |
| 108 | 3300049686 | Ga0501257_046461 | Ga0501257_046461_565_933 | 108 |
| 109 | 3300049759 | Ga0501262_000495 | Ga0501262_000495_1358_1726 | 108 |
| 110 | 3300050490 | nmdc:mga03n38_185825_c1 | nmdc:mga03n38_185825_c1_213_581 | 108 |
| 111 | 3300050491 | nmdc:mga00v17_872918_c1 | nmdc:mga00v17_872918_c1_129_497 | 108 |
| 112 | 3300050492 | nmdc:mga0yw44_60430_c1 | nmdc:mga0yw44_60430_c1_589_957 | 108 |
| 113 | 3300050493 | nmdc:mga0k408_33698_c1 | nmdc:mga0k408_33698_c1_1922_2290 | 108 |
| 114 | 3300032002 | Ga0307416_100099454 | Ga0307416_1000994545 | 109 |
| 115 | 3300049129 | Ga0501309_044535 | Ga0501309_044535_239_592 | 109 |
| 116 | 3300049529 | Ga0501313_043838 | Ga0501313_043838_152_517 | 109 |
| 117 | 3300003574 | Ga0007410J51695_1037205 | Ga0007410J51695_10372052 | 110 |
| 118 | 3300005548 | Ga0070665_100047667 | Ga0070665_1000476675 | 111 |
| 119 | 3300025937 | Ga0207669_11220207 | Ga0207669_112202072 | 111 |
| 120 | 3300042876 | Ga0451577_0312572 | Ga0451577_0312572_400_774 | 111 |
| 121 | 3300045051 | Ga0451576_0076007 | Ga0451576_0076007_1990_2364 | 111 |
| 122 | 3300046522 | Ga0495643_0220705 | Ga0495643_0220705_456_824 | 111 |
| 123 | 3300005331 | Ga0070670_100936042 | Ga0070670_1009360422 | 113 |
| 124 | 3300005334 | Ga0068869_100190433 | Ga0068869_1001904333 | 113 |
| 125 | 3300005338 | Ga0068868_100125596 | Ga0068868_1001255962 | 113 |
| 126 | 3300005340 | Ga0070689_100018801 | Ga0070689_1000188015 | 113 |
| 127 | 3300005353 | Ga0070669_100102253 | Ga0070669_1001022533 | 113 |
| 128 | 3300005354 | Ga0070675_100031032 | Ga0070675_1000310324 | 113 |
| 129 | 3300005364 | Ga0070673_100025135 | Ga0070673_1000251354 | 113 |
| 130 | 3300005365 | Ga0070688_100087995 | Ga0070688_1000879953 | 113 |
| 131 | 3300005438 | Ga0070701_10203377 | Ga0070701_102033772 | 113 |
| 132 | 3300005456 | Ga0070678_101883788 | Ga0070678_1018837881 | 113 |
| 133 | 3300005457 | Ga0070662_100347907 | Ga0070662_1003479072 | 113 |
| 134 | 3300005466 | Ga0070685_10316092 | Ga0070685_103160922 | 113 |
| 135 | 3300005535 | Ga0070684_100280787 | Ga0070684_1002807873 | 113 |
| 136 | 3300005564 | Ga0070664_100311472 | Ga0070664_1003114722 | 113 |
| 137 | 3300005577 | Ga0068857_100012217 | Ga0068857_10001221712 | 113 |
| 138 | 3300005617 | Ga0068859_100076061 | Ga0068859_1000760615 | 113 |
| 139 | 3300005840 | Ga0068870_10034507 | Ga0068870_100345075 | 113 |
| 140 | 3300006931 | Ga0097620_100076060 | Ga0097620_1000760603 | 113 |
| 141 | 3300009098 | Ga0105245_10760192 | Ga0105245_107601922 | 113 |
| 142 | 3300013308 | Ga0157375_11353360 | Ga0157375_113533602 | 113 |
| 143 | 3300014326 | Ga0157380_10911343 | Ga0157380_109113432 | 113 |
| 144 | 3300014745 | Ga0157377_11269105 | Ga0157377_112691051 | 113 |
| 145 | 3300025315 | Ga0207697_10168345 | Ga0207697_101683452 | 113 |
| 146 | 3300025321 | Ga0207656_10067697 | Ga0207656_100676973 | 113 |
| 147 | 3300025901 | Ga0207688_10034103 | Ga0207688_100341033 | 113 |
| 148 | 3300025925 | Ga0207650_10435230 | Ga0207650_104352302 | 113 |
| 149 | 3300025926 | Ga0207659_10001704 | Ga0207659_1000170418 | 113 |
| 150 | 3300025936 | Ga0207670_10055644 | Ga0207670_100556445 | 113 |
| 151 | 3300025937 | Ga0207669_10030057 | Ga0207669_100300573 | 113 |
| 152 | 3300025940 | Ga0207691_10008862 | Ga0207691_1000886211 | 113 |
| 153 | 3300025942 | Ga0207689_10206961 | Ga0207689_102069612 | 113 |
| 154 | 3300025945 | Ga0207679_10219061 | Ga0207679_102190613 | 113 |
| 155 | 3300025960 | Ga0207651_10036504 | Ga0207651_100365043 | 113 |
| 156 | 3300026023 | Ga0207677_11183150 | Ga0207677_111831502 | 113 |
| 157 | 3300026095 | Ga0207676_10208510 | Ga0207676_102085102 | 113 |
| 158 | 3300026116 | Ga0207674_10022377 | Ga0207674_1002237714 | 113 |
| 159 | 3300026142 | Ga0207698_11904398 | Ga0207698_119043982 | 113 |
| 160 | 3300041486 | Ga0451807_1460479 | Ga0451807_1460479_832_1179 | 113 |
| 161 | 3300005459 | Ga0068867_101795877 | Ga0068867_1017958772 | 114 |
| 162 | 3300030521 | Ga0307511_10000653 | Ga0307511_1000065319 | 114 |
| 163 | 3300050516 | nmdc:mga0sz30_39330_c1 | nmdc:mga0sz30_39330_c1_407_757 | 114 |
| 164 | 3300053090 | Ga0500646_0009238 | Ga0500646_0009238_1866_2216 | 114 |
| 165 | 3300053092 | Ga0500583_0484867 | Ga0500583_0484867_49_399 | 114 |
| 166 | 3300053103 | Ga0500555_046254 | Ga0500555_046254_319_669 | 114 |
| 167 | 3300053126 | Ga0500621_121572 | Ga0500621_121572_259_609 | 114 |
| 168 | 3300053133 | Ga0500655_002279 | Ga0500655_002279_1324_1674 | 114 |
| 169 | 3300053139 | Ga0500568_0111278 | Ga0500568_0111278_460_810 | 114 |
| 170 | 3300053151 | Ga0500604_0000352 | Ga0500604_0000352_3814_4164 | 114 |
| 171 | 3300053153 | Ga0500616_0326729 | Ga0500616_0326729_210_560 | 114 |
| 172 | 3300053730 | Ga0500645_018988 | Ga0500645_018988_278_628 | 114 |
| 173 | 3300005327 | Ga0070658_10030833 | Ga0070658_100308337 | 115 |
| 174 | 3300005327 | Ga0070658_10061874 | Ga0070658_100618746 | 115 |
| 175 | 3300005327 | Ga0070658_10602014 | Ga0070658_106020142 | 115 |
| 176 | 3300005327 | Ga0070658_11996890 | Ga0070658_119968901 | 115 |
| 177 | 3300005328 | Ga0070676_10050474 | Ga0070676_100504745 | 115 |
| 178 | 3300005329 | Ga0070683_100113047 | Ga0070683_1001130475 | 115 |
| 179 | 3300005330 | Ga0070690_100313214 | Ga0070690_1003132142 | 115 |
| 180 | 3300005330 | Ga0070690_100391229 | Ga0070690_1003912292 | 115 |
| 181 | 3300005331 | Ga0070670_100541995 | Ga0070670_1005419952 | 115 |
| 182 | 3300005334 | Ga0068869_100401391 | Ga0068869_1004013912 | 115 |
| 183 | 3300005335 | Ga0070666_10540965 | Ga0070666_105409652 | 115 |
| 184 | 3300005338 | Ga0068868_100074093 | Ga0068868_1000740932 | 115 |
| 185 | 3300005338 | Ga0068868_101196314 | Ga0068868_1011963142 | 115 |
| 186 | 3300005338 | Ga0068868_101887430 | Ga0068868_1018874301 | 115 |
| 187 | 3300005339 | Ga0070660_100818220 | Ga0070660_1008182202 | 115 |
| 188 | 3300005340 | Ga0070689_100327138 | Ga0070689_1003271382 | 115 |
| 189 | 3300005340 | Ga0070689_100436204 | Ga0070689_1004362042 | 115 |
| 190 | 3300005340 | Ga0070689_100588585 | Ga0070689_1005885852 | 115 |
| 191 | 3300005343 | Ga0070687_100603249 | Ga0070687_1006032492 | 115 |
| 192 | 3300005344 | Ga0070661_100167366 | Ga0070661_1001673661 | 115 |
| 193 | 3300005344 | Ga0070661_100606013 | Ga0070661_1006060132 | 115 |
| 194 | 3300005344 | Ga0070661_100743290 | Ga0070661_1007432901 | 115 |
| 195 | 3300005353 | Ga0070669_100547050 | Ga0070669_1005470501 | 115 |
| 196 | 3300005354 | Ga0070675_100441805 | Ga0070675_1004418052 | 115 |
| 197 | 3300005354 | Ga0070675_102227621 | Ga0070675_1022276211 | 115 |
| 198 | 3300005355 | Ga0070671_101400409 | Ga0070671_1014004091 | 115 |
| 199 | 3300005355 | Ga0070671_101549905 | Ga0070671_1015499051 | 115 |
| 200 | 3300005356 | Ga0070674_100858675 | Ga0070674_1008586752 | 115 |
| 201 | 3300005356 | Ga0070674_100938789 | Ga0070674_1009387892 | 115 |
| 202 | 3300005364 | Ga0070673_100383392 | Ga0070673_1003833922 | 115 |
| 203 | 3300005364 | Ga0070673_100532134 | Ga0070673_1005321342 | 115 |
| 204 | 3300005365 | Ga0070688_100234898 | Ga0070688_1002348982 | 115 |
| 205 | 3300005366 | Ga0070659_100546172 | Ga0070659_1005461722 | 115 |
| 206 | 3300005366 | Ga0070659_101108230 | Ga0070659_1011082301 | 115 |
| 207 | 3300005366 | Ga0070659_101886689 | Ga0070659_1018866891 | 115 |
| 208 | 3300005367 | Ga0070667_101929922 | Ga0070667_1019299222 | 115 |
| 209 | 3300005434 | Ga0070709_11263927 | Ga0070709_112639271 | 115 |
| 210 | 3300005435 | Ga0070714_100651652 | Ga0070714_1006516522 | 115 |
| 211 | 3300005435 | Ga0070714_101521837 | Ga0070714_1015218372 | 115 |
| 212 | 3300005438 | Ga0070701_10056180 | Ga0070701_100561803 | 115 |
| 213 | 3300005438 | Ga0070701_10971730 | Ga0070701_109717301 | 115 |
| 214 | 3300005438 | Ga0070701_11157601 | Ga0070701_111576011 | 115 |
| 215 | 3300005441 | Ga0070700_101053485 | Ga0070700_1010534851 | 115 |
| 216 | 3300005444 | Ga0070694_101000994 | Ga0070694_1010009942 | 115 |
| 217 | 3300005445 | Ga0070708_100348288 | Ga0070708_1003482883 | 115 |
| 218 | 3300005456 | Ga0070678_100625441 | Ga0070678_1006254412 | 115 |
| 219 | 3300005457 | Ga0070662_100740980 | Ga0070662_1007409801 | 115 |
| 220 | 3300005457 | Ga0070662_100960223 | Ga0070662_1009602232 | 115 |
| 221 | 3300005459 | Ga0068867_100036184 | Ga0068867_1000361845 | 115 |
| 222 | 3300005459 | Ga0068867_100128512 | Ga0068867_1001285122 | 115 |
| 223 | 3300005459 | Ga0068867_100665931 | Ga0068867_1006659312 | 115 |
| 224 | 3300005459 | Ga0068867_102352674 | Ga0068867_1023526741 | 115 |
| 225 | 3300005466 | Ga0070685_10196792 | Ga0070685_101967921 | 115 |
| 226 | 3300005530 | Ga0070679_100468873 | Ga0070679_1004688732 | 115 |
| 227 | 3300005535 | Ga0070684_100029158 | Ga0070684_1000291588 | 115 |
| 228 | 3300005535 | Ga0070684_100995447 | Ga0070684_1009954472 | 115 |
| 229 | 3300005539 | Ga0068853_100031768 | Ga0068853_1000317686 | 115 |
| 230 | 3300005539 | Ga0068853_100057137 | Ga0068853_1000571377 | 115 |
| 231 | 3300005539 | Ga0068853_100107714 | Ga0068853_1001077142 | 115 |
| 232 | 3300005544 | Ga0070686_100047607 | Ga0070686_1000476072 | 115 |
| 233 | 3300005545 | Ga0070695_101139468 | Ga0070695_1011394682 | 115 |
| 234 | 3300005546 | Ga0070696_101094150 | Ga0070696_1010941502 | 115 |
| 235 | 3300005547 | Ga0070693_100064126 | Ga0070693_1000641265 | 115 |
| 236 | 3300005547 | Ga0070693_100079511 | Ga0070693_1000795112 | 115 |
| 237 | 3300005547 | Ga0070693_100708138 | Ga0070693_1007081382 | 115 |
| 238 | 3300005547 | Ga0070693_100751721 | Ga0070693_1007517212 | 115 |
| 239 | 3300005548 | Ga0070665_100677110 | Ga0070665_1006771102 | 115 |
| 240 | 3300005548 | Ga0070665_101432012 | Ga0070665_1014320122 | 115 |
| 241 | 3300005548 | Ga0070665_102025440 | Ga0070665_1020254402 | 115 |
| 242 | 3300005549 | Ga0070704_100823691 | Ga0070704_1008236912 | 115 |
| 243 | 3300005563 | Ga0068855_100029685 | Ga0068855_1000296859 | 115 |
| 244 | 3300005563 | Ga0068855_100061581 | Ga0068855_1000615817 | 115 |
| 245 | 3300005563 | Ga0068855_100288384 | Ga0068855_1002883842 | 115 |
| 246 | 3300005564 | Ga0070664_101353532 | Ga0070664_1013535322 | 115 |
| 247 | 3300005577 | Ga0068857_100878656 | Ga0068857_1008786562 | 115 |
| 248 | 3300005578 | Ga0068854_100454288 | Ga0068854_1004542882 | 115 |
| 249 | 3300005578 | Ga0068854_101397900 | Ga0068854_1013979002 | 115 |
| 250 | 3300005614 | Ga0068856_100065846 | Ga0068856_1000658465 | 115 |
| 251 | 3300005614 | Ga0068856_102184099 | Ga0068856_1021840992 | 115 |
| 252 | 3300005615 | Ga0070702_100847935 | Ga0070702_1008479352 | 115 |
| 253 | 3300005615 | Ga0070702_100993404 | Ga0070702_1009934042 | 115 |
| 254 | 3300005616 | Ga0068852_100004380 | Ga0068852_10000438017 | 115 |
| 255 | 3300005616 | Ga0068852_100127860 | Ga0068852_1001278602 | 115 |
| 256 | 3300005616 | Ga0068852_100171595 | Ga0068852_1001715954 | 115 |
| 257 | 3300005616 | Ga0068852_100461237 | Ga0068852_1004612372 | 115 |
| 258 | 3300005617 | Ga0068859_100130549 | Ga0068859_1001305495 | 115 |
| 259 | 3300005617 | Ga0068859_100821191 | Ga0068859_1008211912 | 115 |
| 260 | 3300005617 | Ga0068859_102020051 | Ga0068859_1020200512 | 115 |
| 261 | 3300005618 | Ga0068864_100203018 | Ga0068864_1002030184 | 115 |
| 262 | 3300005618 | Ga0068864_100629129 | Ga0068864_1006291292 | 115 |
| 263 | 3300005618 | Ga0068864_101612366 | Ga0068864_1016123662 | 115 |
| 264 | 3300005719 | Ga0068861_100164604 | Ga0068861_1001646043 | 115 |
| 265 | 3300005719 | Ga0068861_100311411 | Ga0068861_1003114112 | 115 |
| 266 | 3300005834 | Ga0068851_10006696 | Ga0068851_100066964 | 115 |
| 267 | 3300005840 | Ga0068870_10627050 | Ga0068870_106270502 | 115 |
| 268 | 3300005841 | Ga0068863_100236126 | Ga0068863_1002361264 | 115 |
| 269 | 3300005841 | Ga0068863_101109739 | Ga0068863_1011097392 | 115 |
| 270 | 3300005842 | Ga0068858_100102741 | Ga0068858_1001027415 | 115 |
| 271 | 3300005842 | Ga0068858_100628514 | Ga0068858_1006285142 | 115 |
| 272 | 3300005843 | Ga0068860_100241063 | Ga0068860_1002410634 | 115 |
| 273 | 3300005843 | Ga0068860_100933330 | Ga0068860_1009333302 | 115 |
| 274 | 3300005843 | Ga0068860_101303745 | Ga0068860_1013037452 | 115 |
| 275 | 3300006028 | Ga0070717_10828554 | Ga0070717_108285542 | 115 |
| 276 | 3300006038 | Ga0075365_10473437 | Ga0075365_104734371 | 115 |
| 277 | 3300006042 | Ga0075368_10467539 | Ga0075368_104675392 | 115 |
| 278 | 3300006048 | Ga0075363_100089552 | Ga0075363_1000895524 | 115 |
| 279 | 3300006051 | Ga0075364_10033419 | Ga0075364_100334197 | 115 |
| 280 | 3300006051 | Ga0075364_10345408 | Ga0075364_103454082 | 115 |
| 281 | 3300006173 | Ga0070716_101262330 | Ga0070716_1012623302 | 115 |
| 282 | 3300006175 | Ga0070712_101589118 | Ga0070712_1015891181 | 115 |
| 283 | 3300006177 | Ga0075362_10744937 | Ga0075362_107449371 | 115 |
| 284 | 3300006178 | Ga0075367_10021043 | Ga0075367_100210435 | 115 |
| 285 | 3300006195 | Ga0075366_10005895 | Ga0075366_100058953 | 115 |
| 286 | 3300006237 | Ga0097621_100024717 | Ga0097621_1000247179 | 115 |
| 287 | 3300006237 | Ga0097621_100203834 | Ga0097621_1002038342 | 115 |
| 288 | 3300006353 | Ga0075370_10139703 | Ga0075370_101397034 | 115 |
| 289 | 3300006353 | Ga0075370_10455856 | Ga0075370_104558562 | 115 |
| 290 | 3300006358 | Ga0068871_100063147 | Ga0068871_1000631473 | 115 |
| 291 | 3300006358 | Ga0068871_100206099 | Ga0068871_1002060992 | 115 |
| 292 | 3300006358 | Ga0068871_100331258 | Ga0068871_1003312582 | 115 |
| 293 | 3300006358 | Ga0068871_100369183 | Ga0068871_1003691832 | 115 |
| 294 | 3300006358 | Ga0068871_100806614 | Ga0068871_1008066142 | 115 |
| 295 | 3300006844 | Ga0075428_100074204 | Ga0075428_1000742044 | 115 |
| 296 | 3300006852 | Ga0075433_10425694 | Ga0075433_104256942 | 115 |
| 297 | 3300006871 | Ga0075434_100174619 | Ga0075434_1001746192 | 115 |
| 298 | 3300006871 | Ga0075434_101969185 | Ga0075434_1019691852 | 115 |
| 299 | 3300006880 | Ga0075429_100536246 | Ga0075429_1005362462 | 115 |
| 300 | 3300006881 | Ga0068865_100055933 | Ga0068865_1000559332 | 115 |
| 301 | 3300006931 | Ga0097620_100130553 | Ga0097620_1001305532 | 115 |
| 302 | 3300006931 | Ga0097620_100821210 | Ga0097620_1008212102 | 115 |
| 303 | 3300006931 | Ga0097620_102020132 | Ga0097620_1020201322 | 115 |
| 304 | 3300007076 | Ga0075435_100448940 | Ga0075435_1004489402 | 115 |
| 305 | 3300009093 | Ga0105240_10112049 | Ga0105240_101120492 | 115 |
| 306 | 3300009093 | Ga0105240_10390077 | Ga0105240_103900771 | 115 |
| 307 | 3300009093 | Ga0105240_12369494 | Ga0105240_123694941 | 115 |
| 308 | 3300009094 | Ga0111539_10019077 | Ga0111539_100190775 | 115 |
| 309 | 3300009098 | Ga0105245_10494220 | Ga0105245_104942202 | 115 |
| 310 | 3300009098 | Ga0105245_10766638 | Ga0105245_107666382 | 115 |
| 311 | 3300009098 | Ga0105245_10893074 | Ga0105245_108930742 | 115 |
| 312 | 3300009174 | Ga0105241_11449991 | Ga0105241_114499912 | 115 |
| 313 | 3300009176 | Ga0105242_10228604 | Ga0105242_102286042 | 115 |
| 314 | 3300009176 | Ga0105242_10427603 | Ga0105242_104276032 | 115 |
| 315 | 3300009176 | Ga0105242_11914332 | Ga0105242_119143322 | 115 |
| 316 | 3300009176 | Ga0105242_12544829 | Ga0105242_125448291 | 115 |
| 317 | 3300009177 | Ga0105248_10053313 | Ga0105248_100533135 | 115 |
| 318 | 3300009177 | Ga0105248_10123110 | Ga0105248_101231107 | 115 |
| 319 | 3300009177 | Ga0105248_10628678 | Ga0105248_106286782 | 115 |
| 320 | 3300009177 | Ga0105248_10706794 | Ga0105248_107067942 | 115 |
| 321 | 3300009177 | Ga0105248_10906415 | Ga0105248_109064152 | 115 |
| 322 | 3300009545 | Ga0105237_12059128 | Ga0105237_120591282 | 115 |
| 323 | 3300009551 | Ga0105238_10087095 | Ga0105238_100870957 | 115 |
| 324 | 3300009551 | Ga0105238_10162918 | Ga0105238_101629182 | 115 |
| 325 | 3300009551 | Ga0105238_10872135 | Ga0105238_108721352 | 115 |
| 326 | 3300013104 | Ga0157370_10281691 | Ga0157370_102816912 | 115 |
| 327 | 3300013105 | Ga0157369_10006334 | Ga0157369_1000633418 | 115 |
| 328 | 3300013105 | Ga0157369_10167285 | Ga0157369_101672854 | 115 |
| 329 | 3300013105 | Ga0157369_12010765 | Ga0157369_120107652 | 115 |
| 330 | 3300013296 | Ga0157374_10079715 | Ga0157374_100797152 | 115 |
| 331 | 3300013296 | Ga0157374_10711098 | Ga0157374_107110982 | 115 |
| 332 | 3300013296 | Ga0157374_11772693 | Ga0157374_117726932 | 115 |
| 333 | 3300013297 | Ga0157378_10059479 | Ga0157378_100594797 | 115 |
| 334 | 3300013306 | Ga0163162_10022516 | Ga0163162_100225163 | 115 |
| 335 | 3300013306 | Ga0163162_10338226 | Ga0163162_103382263 | 115 |
| 336 | 3300013307 | Ga0157372_10191231 | Ga0157372_101912315 | 115 |
| 337 | 3300013307 | Ga0157372_11188047 | Ga0157372_111880472 | 115 |
| 338 | 3300013308 | Ga0157375_10359351 | Ga0157375_103593511 | 115 |
| 339 | 3300014325 | Ga0163163_11378123 | Ga0163163_113781232 | 115 |
| 340 | 3300014326 | Ga0157380_10035459 | Ga0157380_100354593 | 115 |
| 341 | 3300014326 | Ga0157380_10256156 | Ga0157380_102561562 | 115 |
| 342 | 3300014326 | Ga0157380_11467506 | Ga0157380_114675062 | 115 |
| 343 | 3300014326 | Ga0157380_12813113 | Ga0157380_128131131 | 115 |
| 344 | 3300014968 | Ga0157379_10645825 | Ga0157379_106458252 | 115 |
| 345 | 3300014968 | Ga0157379_10937838 | Ga0157379_109378382 | 115 |
| 346 | 3300014969 | Ga0157376_10202712 | Ga0157376_102027124 | 115 |
| 347 | 3300014969 | Ga0157376_12278089 | Ga0157376_122780891 | 115 |
| 348 | 3300014969 | Ga0157376_12401687 | Ga0157376_124016872 | 115 |
| 349 | 3300020069 | Ga0197907_10947458 | Ga0197907_109474582 | 115 |
| 350 | 3300020081 | Ga0206354_10693061 | Ga0206354_106930612 | 115 |
| 351 | 3300025321 | Ga0207656_10001500 | Ga0207656_1000150012 | 115 |
| 352 | 3300025893 | Ga0207682_10037312 | Ga0207682_100373123 | 115 |
| 353 | 3300025899 | Ga0207642_10201121 | Ga0207642_102011212 | 115 |
| 354 | 3300025903 | Ga0207680_10333726 | Ga0207680_103337262 | 115 |
| 355 | 3300025905 | Ga0207685_10003543 | Ga0207685_100035435 | 115 |
| 356 | 3300025906 | Ga0207699_10608840 | Ga0207699_106088402 | 115 |
| 357 | 3300025907 | Ga0207645_10050633 | Ga0207645_100506332 | 115 |
| 358 | 3300025908 | Ga0207643_10158658 | Ga0207643_101586582 | 115 |
| 359 | 3300025908 | Ga0207643_10544558 | Ga0207643_105445582 | 115 |
| 360 | 3300025909 | Ga0207705_10141765 | Ga0207705_101417652 | 115 |
| 361 | 3300025909 | Ga0207705_10235593 | Ga0207705_102355933 | 115 |
| 362 | 3300025909 | Ga0207705_10538465 | Ga0207705_105384652 | 115 |
| 363 | 3300025909 | Ga0207705_10870903 | Ga0207705_108709032 | 115 |
| 364 | 3300025911 | Ga0207654_10015846 | Ga0207654_100158464 | 115 |
| 365 | 3300025913 | Ga0207695_10031032 | Ga0207695_100310323 | 115 |
| 366 | 3300025913 | Ga0207695_10560496 | Ga0207695_105604962 | 115 |
| 367 | 3300025913 | Ga0207695_10862452 | Ga0207695_108624522 | 115 |
| 368 | 3300025917 | Ga0207660_10673904 | Ga0207660_106739042 | 115 |
| 369 | 3300025917 | Ga0207660_10869381 | Ga0207660_108693811 | 115 |
| 370 | 3300025918 | Ga0207662_10071217 | Ga0207662_100712174 | 115 |
| 371 | 3300025918 | Ga0207662_10447242 | Ga0207662_104472422 | 115 |
| 372 | 3300025920 | Ga0207649_10365682 | Ga0207649_103656822 | 115 |
| 373 | 3300025920 | Ga0207649_10481971 | Ga0207649_104819712 | 115 |
| 374 | 3300025920 | Ga0207649_11218994 | Ga0207649_112189941 | 115 |
| 375 | 3300025920 | Ga0207649_11388795 | Ga0207649_113887952 | 115 |
| 376 | 3300025924 | Ga0207694_10007098 | Ga0207694_1000709817 | 115 |
| 377 | 3300025924 | Ga0207694_10136119 | Ga0207694_101361194 | 115 |
| 378 | 3300025924 | Ga0207694_10184725 | Ga0207694_101847254 | 115 |
| 379 | 3300025924 | Ga0207694_10771123 | Ga0207694_107711232 | 115 |
| 380 | 3300025924 | Ga0207694_11115878 | Ga0207694_111158782 | 115 |
| 381 | 3300025925 | Ga0207650_10257366 | Ga0207650_102573662 | 115 |
| 382 | 3300025925 | Ga0207650_10381883 | Ga0207650_103818832 | 115 |
| 383 | 3300025926 | Ga0207659_10110055 | Ga0207659_101100552 | 115 |
| 384 | 3300025926 | Ga0207659_10977508 | Ga0207659_109775082 | 115 |
| 385 | 3300025927 | Ga0207687_10540135 | Ga0207687_105401352 | 115 |
| 386 | 3300025927 | Ga0207687_10548898 | Ga0207687_105488982 | 115 |
| 387 | 3300025929 | Ga0207664_10569153 | Ga0207664_105691532 | 115 |
| 388 | 3300025929 | Ga0207664_11214378 | Ga0207664_112143782 | 115 |
| 389 | 3300025931 | Ga0207644_10736364 | Ga0207644_107363642 | 115 |
| 390 | 3300025931 | Ga0207644_11247569 | Ga0207644_112475691 | 115 |
| 391 | 3300025932 | Ga0207690_11038971 | Ga0207690_110389712 | 115 |
| 392 | 3300025932 | Ga0207690_11091870 | Ga0207690_110918702 | 115 |
| 393 | 3300025933 | Ga0207706_10169030 | Ga0207706_101690305 | 115 |
| 394 | 3300025933 | Ga0207706_10928436 | Ga0207706_109284362 | 115 |
| 395 | 3300025934 | Ga0207686_10009661 | Ga0207686_100096613 | 115 |
| 396 | 3300025934 | Ga0207686_10016521 | Ga0207686_100165215 | 115 |
| 397 | 3300025934 | Ga0207686_10018299 | Ga0207686_100182992 | 115 |
| 398 | 3300025934 | Ga0207686_10719481 | Ga0207686_107194812 | 115 |
| 399 | 3300025934 | Ga0207686_11657190 | Ga0207686_116571902 | 115 |
| 400 | 3300025935 | Ga0207709_10937155 | Ga0207709_109371552 | 115 |
| 401 | 3300025936 | Ga0207670_10031826 | Ga0207670_100318265 | 115 |
| 402 | 3300025936 | Ga0207670_10198354 | Ga0207670_101983542 | 115 |
| 403 | 3300025936 | Ga0207670_10398825 | Ga0207670_103988252 | 115 |
| 404 | 3300025936 | Ga0207670_10468252 | Ga0207670_104682522 | 115 |
| 405 | 3300025937 | Ga0207669_10137030 | Ga0207669_101370304 | 115 |
| 406 | 3300025937 | Ga0207669_10820376 | Ga0207669_108203762 | 115 |
| 407 | 3300025937 | Ga0207669_10955518 | Ga0207669_109555182 | 115 |
| 408 | 3300025937 | Ga0207669_11904987 | Ga0207669_119049872 | 115 |
| 409 | 3300025938 | Ga0207704_10131203 | Ga0207704_101312034 | 115 |
| 410 | 3300025939 | Ga0207665_10535488 | Ga0207665_105354881 | 115 |
| 411 | 3300025940 | Ga0207691_10476398 | Ga0207691_104763982 | 115 |
| 412 | 3300025940 | Ga0207691_10572243 | Ga0207691_105722431 | 115 |
| 413 | 3300025941 | Ga0207711_10068759 | Ga0207711_100687595 | 115 |
| 414 | 3300025941 | Ga0207711_10575921 | Ga0207711_105759212 | 115 |
| 415 | 3300025941 | Ga0207711_10603212 | Ga0207711_106032122 | 115 |
| 416 | 3300025942 | Ga0207689_10273860 | Ga0207689_102738602 | 115 |
| 417 | 3300025944 | Ga0207661_10072644 | Ga0207661_100726445 | 115 |
| 418 | 3300025944 | Ga0207661_11414794 | Ga0207661_114147942 | 115 |
| 419 | 3300025949 | Ga0207667_10175639 | Ga0207667_101756393 | 115 |
| 420 | 3300025949 | Ga0207667_10246512 | Ga0207667_102465124 | 115 |
| 421 | 3300025949 | Ga0207667_10324884 | Ga0207667_103248843 | 115 |
| 422 | 3300025960 | Ga0207651_10111768 | Ga0207651_101117682 | 115 |
| 423 | 3300025960 | Ga0207651_10199611 | Ga0207651_101996112 | 115 |
| 424 | 3300025960 | Ga0207651_10381798 | Ga0207651_103817983 | 115 |
| 425 | 3300025960 | Ga0207651_10670780 | Ga0207651_106707802 | 115 |
| 426 | 3300025960 | Ga0207651_11808616 | Ga0207651_118086162 | 115 |
| 427 | 3300025961 | Ga0207712_11546897 | Ga0207712_115468972 | 115 |
| 428 | 3300025981 | Ga0207640_10399967 | Ga0207640_103999672 | 115 |
| 429 | 3300025981 | Ga0207640_10477137 | Ga0207640_104771371 | 115 |
| 430 | 3300025981 | Ga0207640_10585053 | Ga0207640_105850532 | 115 |
| 431 | 3300025981 | Ga0207640_11018309 | Ga0207640_110183092 | 115 |
| 432 | 3300025981 | Ga0207640_11352102 | Ga0207640_113521022 | 115 |
| 433 | 3300025986 | Ga0207658_11242280 | Ga0207658_112422801 | 115 |
| 434 | 3300026023 | Ga0207677_10068962 | Ga0207677_100689621 | 115 |
| 435 | 3300026023 | Ga0207677_10190830 | Ga0207677_101908302 | 115 |
| 436 | 3300026023 | Ga0207677_11446440 | Ga0207677_114464402 | 115 |
| 437 | 3300026023 | Ga0207677_11460027 | Ga0207677_114600272 | 115 |
| 438 | 3300026035 | Ga0207703_10108254 | Ga0207703_101082545 | 115 |
| 439 | 3300026035 | Ga0207703_10366621 | Ga0207703_103666213 | 115 |
| 440 | 3300026035 | Ga0207703_10565482 | Ga0207703_105654823 | 115 |
| 441 | 3300026041 | Ga0207639_10018858 | Ga0207639_1001885811 | 115 |
| 442 | 3300026041 | Ga0207639_10081460 | Ga0207639_100814602 | 115 |
| 443 | 3300026041 | Ga0207639_10681108 | Ga0207639_106811082 | 115 |
| 444 | 3300026075 | Ga0207708_10312632 | Ga0207708_103126322 | 115 |
| 445 | 3300026075 | Ga0207708_11086250 | Ga0207708_110862502 | 115 |
| 446 | 3300026078 | Ga0207702_10114437 | Ga0207702_101144375 | 115 |
| 447 | 3300026078 | Ga0207702_10577157 | Ga0207702_105771572 | 115 |
| 448 | 3300026088 | Ga0207641_10529841 | Ga0207641_105298412 | 115 |
| 449 | 3300026088 | Ga0207641_10572465 | Ga0207641_105724652 | 115 |
| 450 | 3300026088 | Ga0207641_11930667 | Ga0207641_119306672 | 115 |
| 451 | 3300026089 | Ga0207648_10049310 | Ga0207648_100493105 | 115 |
| 452 | 3300026089 | Ga0207648_10577479 | Ga0207648_105774792 | 115 |
| 453 | 3300026089 | Ga0207648_10710905 | Ga0207648_107109052 | 115 |
| 454 | 3300026095 | Ga0207676_10309620 | Ga0207676_103096202 | 115 |
| 455 | 3300026095 | Ga0207676_10453884 | Ga0207676_104538842 | 115 |
| 456 | 3300026095 | Ga0207676_11155911 | Ga0207676_111559112 | 115 |
| 457 | 3300026118 | Ga0207675_100136832 | Ga0207675_1001368325 | 115 |
| 458 | 3300026118 | Ga0207675_100306952 | Ga0207675_1003069523 | 115 |
| 459 | 3300026118 | Ga0207675_101527272 | Ga0207675_1015272721 | 115 |
| 460 | 3300026121 | Ga0207683_10015833 | Ga0207683_100158332 | 115 |
| 461 | 3300026121 | Ga0207683_11067120 | Ga0207683_110671202 | 115 |
| 462 | 3300026121 | Ga0207683_11144786 | Ga0207683_111447862 | 115 |
| 463 | 3300026142 | Ga0207698_10010326 | Ga0207698_1001032611 | 115 |
| 464 | 3300026142 | Ga0207698_10018098 | Ga0207698_100180983 | 115 |
| 465 | 3300026142 | Ga0207698_10158112 | Ga0207698_101581124 | 115 |
| 466 | 3300026142 | Ga0207698_10297306 | Ga0207698_102973062 | 115 |
| 467 | 3300026142 | Ga0207698_10571078 | Ga0207698_105710782 | 115 |
| 468 | 3300027866 | Ga0209813_10387718 | Ga0209813_103877182 | 115 |
| 469 | 3300027876 | Ga0209974_10099950 | Ga0209974_100999502 | 115 |
| 470 | 3300027907 | Ga0207428_10007467 | Ga0207428_1000746713 | 115 |
| 471 | 3300028379 | Ga0268266_10435073 | Ga0268266_104350732 | 115 |
| 472 | 3300028379 | Ga0268266_10866667 | Ga0268266_108666672 | 115 |
| 473 | 3300028381 | Ga0268264_10757267 | Ga0268264_107572672 | 115 |
| 474 | 3300031548 | Ga0307408_100308376 | Ga0307408_1003083762 | 115 |
| 475 | 3300031548 | Ga0307408_100636016 | Ga0307408_1006360162 | 115 |
| 476 | 3300031548 | Ga0307408_100695165 | Ga0307408_1006951652 | 115 |
| 477 | 3300031548 | Ga0307408_101826722 | Ga0307408_1018267222 | 115 |
| 478 | 3300031731 | Ga0307405_10647771 | Ga0307405_106477711 | 115 |
| 479 | 3300031731 | Ga0307405_10810808 | Ga0307405_108108082 | 115 |
| 480 | 3300031824 | Ga0307413_11014028 | Ga0307413_110140282 | 115 |
| 481 | 3300031824 | Ga0307413_11548899 | Ga0307413_115488992 | 115 |
| 482 | 3300031852 | Ga0307410_10516749 | Ga0307410_105167492 | 115 |
| 483 | 3300031852 | Ga0307410_10889677 | Ga0307410_108896772 | 115 |
| 484 | 3300031852 | Ga0307410_11540672 | Ga0307410_115406722 | 115 |
| 485 | 3300031901 | Ga0307406_10992452 | Ga0307406_109924522 | 115 |
| 486 | 3300031901 | Ga0307406_11483506 | Ga0307406_114835062 | 115 |
| 487 | 3300031911 | Ga0307412_10062339 | Ga0307412_100623393 | 115 |
| 488 | 3300031911 | Ga0307412_10227496 | Ga0307412_102274963 | 115 |
| 489 | 3300031911 | Ga0307412_10528078 | Ga0307412_105280782 | 115 |
| 490 | 3300031911 | Ga0307412_11256247 | Ga0307412_112562472 | 115 |
| 491 | 3300031911 | Ga0307412_12026988 | Ga0307412_120269881 | 115 |
| 492 | 3300031995 | Ga0307409_100530074 | Ga0307409_1005300743 | 115 |
| 493 | 3300032002 | Ga0307416_100235039 | Ga0307416_1002350394 | 115 |
| 494 | 3300032002 | Ga0307416_100567651 | Ga0307416_1005676512 | 115 |
| 495 | 3300032002 | Ga0307416_101457356 | Ga0307416_1014573562 | 115 |
| 496 | 3300032002 | Ga0307416_101943001 | Ga0307416_1019430012 | 115 |
| 497 | 3300032002 | Ga0307416_102769408 | Ga0307416_1027694082 | 115 |
| 498 | 3300032004 | Ga0307414_12021100 | Ga0307414_120211002 | 115 |
| 499 | 3300032005 | Ga0307411_11333878 | Ga0307411_113338781 | 115 |
| 500 | 3300032005 | Ga0307411_11460992 | Ga0307411_114609922 | 115 |
| 501 | 3300032126 | Ga0307415_100320022 | Ga0307415_1003200222 | 115 |
| 502 | 3300034957 | Ga0373938_0165006 | Ga0373938_0165006_230_583 | 115 |
| 503 | 3300035091 | Ga0373951_0065264 | Ga0373951_0065264_546_899 | 115 |
| 504 | 3300035092 | Ga0373952_0027225 | Ga0373952_0027225_385_738 | 115 |
| 505 | 3300035111 | Ga0373923_0081400 | Ga0373923_0081400_786_1139 | 115 |
| 506 | 3300035115 | Ga0373941_0406996 | Ga0373941_0406996_139_492 | 115 |
| 507 | 3300035119 | Ga0373956_0174331 | Ga0373956_0174331_301_654 | 115 |
| 508 | 3300035170 | Ga0373943_0175221 | Ga0373943_0175221_665_1018 | 115 |
| 509 | 3300035171 | Ga0373946_0253663 | Ga0373946_0253663_476_829 | 115 |
| 510 | 3300035172 | Ga0373955_0063660 | Ga0373955_0063660_1229_1582 | 115 |
| 511 | 3300035410 | Ga0373924_0082696 | Ga0373924_0082696_939_1292 | 115 |
| 512 | 3300035410 | Ga0373924_0136652 | Ga0373924_0136652_523_876 | 115 |
| 513 | 3300035410 | Ga0373924_0278321 | Ga0373924_0278321_266_619 | 115 |
| 514 | 3300035691 | Ga0373931_0064668 | Ga0373931_0064668_1357_1710 | 115 |
| 515 | 3300035692 | Ga0373935_1004287 | Ga0373935_1004287_216_569 | 115 |
| 516 | 3300035695 | Ga0373927_0135268 | Ga0373927_0135268_907_1260 | 115 |
| 517 | 3300035724 | Ga0373933_0650630 | Ga0373933_0650630_276_629 | 115 |
| 518 | 3300035725 | Ga0373947_0154304 | Ga0373947_0154304_984_1337 | 115 |
| 519 | 3300036401 | Ga0373937_0093062 | Ga0373937_0093062_421_774 | 115 |
| 520 | 3300036401 | Ga0373937_0210934 | Ga0373937_0210934_678_1031 | 115 |
| 521 | 3300037068 | Ga0373925_0008267 | Ga0373925_0008267_5320_5673 | 115 |
| 522 | 3300037068 | Ga0373925_0154357 | Ga0373925_0154357_946_1299 | 115 |
| 523 | 3300037068 | Ga0373925_0798447 | Ga0373925_0798447_125_478 | 115 |
| 524 | 3300037068 | Ga0373925_1308311 | Ga0373925_1308311_83_436 | 115 |
| 525 | 3300039437 | Ga0436365_0531964 | Ga0436365_0531964_1733_2086 | 115 |
| 526 | 3300041496 | Ga0451839_0745541 | Ga0451839_0745541_76_429 | 115 |
| 527 | 3300042000 | Ga0439437_016373 | Ga0439437_016373_45_398 | 115 |
| 528 | 3300042001 | Ga0439441_006145 | Ga0439441_006145_848_1201 | 115 |
| 529 | 3300042001 | Ga0439441_148165 | Ga0439441_148165_178_531 | 115 |
| 530 | 3300042156 | Ga0439446_0101355 | Ga0439446_0101355_134_487 | 115 |
| 531 | 3300042437 | Ga0439444_0023086 | Ga0439444_0023086_282_635 | 115 |
| 532 | 3300042876 | Ga0451577_0422547 | Ga0451577_0422547_527_880 | 115 |
| 533 | 3300044684 | Ga0466966_0179930 | Ga0466966_0179930_779_1132 | 115 |
| 534 | 3300044712 | Ga0453684_0812939 | Ga0453684_0812939_217_570 | 115 |
| 535 | 3300045049 | Ga0466959_0194087 | Ga0466959_0194087_982_1335 | 115 |
| 536 | 3300045051 | Ga0451576_1748150 | Ga0451576_1748150_84_437 | 115 |
| 537 | 3300046454 | Ga0495592_0002591 | Ga0495592_0002591_4825_5178 | 115 |
| 538 | 3300046455 | Ga0495603_0211915 | Ga0495603_0211915_533_886 | 115 |
| 539 | 3300046475 | Ga0495639_0328506 | Ga0495639_0328506_336_689 | 115 |
| 540 | 3300046476 | Ga0495662_0510431 | Ga0495662_0510431_122_475 | 115 |
| 541 | 3300046511 | Ga0495608_0037016 | Ga0495608_0037016_2372_2725 | 115 |
| 542 | 3300046514 | Ga0495618_0376514 | Ga0495618_0376514_226_579 | 115 |
| 543 | 3300046516 | Ga0495628_0200181 | Ga0495628_0200181_1065_1418 | 115 |
| 544 | 3300046529 | Ga0495652_0016132 | Ga0495652_0016132_704_1057 | 115 |
| 545 | 3300046536 | Ga0495587_0038829 | Ga0495587_0038829_2179_2532 | 115 |
| 546 | 3300046537 | Ga0495598_0009707 | Ga0495598_0009707_505_858 | 115 |
| 547 | 3300046537 | Ga0495598_0089281 | Ga0495598_0089281_543_896 | 115 |
| 548 | 3300046539 | Ga0495621_0003232 | Ga0495621_0003232_1590_1943 | 115 |
| 549 | 3300046539 | Ga0495621_0236939 | Ga0495621_0236939_314_667 | 115 |
| 550 | 3300046543 | Ga0495645_0004671 | Ga0495645_0004671_672_1025 | 115 |
| 551 | 3300046558 | Ga0495633_0491254 | Ga0495633_0491254_34_387 | 115 |
| 552 | 3300046559 | Ga0495667_0029984 | Ga0495667_0029984_3036_3389 | 115 |
| 553 | 3300046663 | Ga0495635_0032495 | Ga0495635_0032495_1821_2174 | 115 |
| 554 | 3300046663 | Ga0495635_0593245 | Ga0495635_0593245_221_574 | 115 |
| 555 | 3300046675 | Ga0495657_0043896 | Ga0495657_0043896_1137_1490 | 115 |
| 556 | 3300046678 | Ga0495599_0215073 | Ga0495599_0215073_731_1084 | 115 |
| 557 | 3300046679 | Ga0495623_0049231 | Ga0495623_0049231_1264_1617 | 115 |
| 558 | 3300046683 | Ga0495658_0058804 | Ga0495658_0058804_942_1295 | 115 |
| 559 | 3300046683 | Ga0495658_0079564 | Ga0495658_0079564_703_1056 | 115 |
| 560 | 3300046691 | Ga0495670_0131790 | Ga0495670_0131790_715_1068 | 115 |
| 561 | 3300046809 | Ga0495600_0104793 | Ga0495600_0104793_484_837 | 115 |
| 562 | 3300047317 | Ga0495604_0346861 | Ga0495604_0346861_90_443 | 115 |
| 563 | 3300047318 | Ga0495636_0275904 | Ga0495636_0275904_237_590 | 115 |
| 564 | 3300048090 | Ga0495615_0055884 | Ga0495615_0055884_123_476 | 115 |
| 565 | 3300048907 | Ga0496104_0792125 | Ga0496104_0792125_86_439 | 115 |
| 566 | 3300048908 | Ga0496105_0090136 | Ga0496105_0090136_1317_1670 | 115 |
| 567 | 3300048911 | Ga0496108_0254139 | Ga0496108_0254139_573_926 | 115 |
| 568 | 3300048912 | Ga0496109_0068230 | Ga0496109_0068230_310_663 | 115 |
| 569 | 3300048913 | Ga0496110_0101200 | Ga0496110_0101200_2136_2489 | 115 |
| 570 | 3300048914 | Ga0496111_0175822 | Ga0496111_0175822_908_1261 | 115 |
| 571 | 3300049161 | Ga0501305_018600 | Ga0501305_018600_585_938 | 115 |
| 572 | 3300049162 | Ga0501307_012886 | Ga0501307_012886_416_769 | 115 |
| 573 | 3300049522 | Ga0501299_069992 | Ga0501299_069992_190_543 | 115 |
| 574 | 3300049571 | Ga0501034_0193193 | Ga0501034_0193193_50_403 | 115 |
| 575 | 3300049575 | Ga0501039_1063416 | Ga0501039_1063416_253_606 | 115 |
| 576 | 3300049581 | Ga0501047_0040997 | Ga0501047_0040997_2184_2537 | 115 |
| 577 | 3300049581 | Ga0501047_0122861 | Ga0501047_0122861_703_1056 | 115 |
| 578 | 3300049585 | Ga0501069_0001064 | Ga0501069_0001064_2738_3091 | 115 |
| 579 | 3300049586 | Ga0501070_0001356 | Ga0501070_0001356_13292_13645 | 115 |
| 580 | 3300049586 | Ga0501070_0138143 | Ga0501070_0138143_1624_1977 | 115 |
| 581 | 3300049589 | Ga0501073_0000321 | Ga0501073_0000321_23501_23854 | 115 |
| 582 | 3300049589 | Ga0501073_0464001 | Ga0501073_0464001_498_851 | 115 |
| 583 | 3300049590 | Ga0501074_0000097 | Ga0501074_0000097_33648_34001 | 115 |
| 584 | 3300049741 | Ga0501079_0009081 | Ga0501079_0009081_4415_4768 | 115 |
| 585 | 3300049742 | Ga0501080_0011166 | Ga0501080_0011166_3664_4017 | 115 |
| 586 | 3300049742 | Ga0501080_0200887 | Ga0501080_0200887_1006_1359 | 115 |
| 587 | 3300049744 | Ga0501083_0004051 | Ga0501083_0004051_1645_1998 | 115 |
| 588 | 3300049823 | Ga0501044_0083251 | Ga0501044_0083251_2688_3041 | 115 |
| 589 | 3300050491 | nmdc:mga00v17_250937_c1 | nmdc:mga00v17_250937_c1_124_477 | 115 |
| 590 | 3300050493 | nmdc:mga0k408_13809_c1 | nmdc:mga0k408_13809_c1_1282_1635 | 115 |
| 591 | 3300050493 | nmdc:mga0k408_8663_c1 | nmdc:mga0k408_8663_c1_1671_2024 | 115 |
| 592 | 3300050495 | nmdc:mga04h51_424623_c1 | nmdc:mga04h51_424623_c1_102_455 | 115 |
| 593 | 3300050496 | nmdc:mga07m45_169196_c1 | nmdc:mga07m45_169196_c1_801_1154 | 115 |
| 594 | 3300050496 | nmdc:mga07m45_419845_c1 | nmdc:mga07m45_419845_c1_258_611 | 115 |
| 595 | 3300050508 | nmdc:mga09592_472609_c1 | nmdc:mga09592_472609_c1_190_543 | 115 |
| 596 | 3300050511 | nmdc:mga08y16_11064_c1 | nmdc:mga08y16_11064_c1_6233_6586 | 115 |
| 597 | 3300050512 | nmdc:mga0n895_1150352_c1 | nmdc:mga0n895_1150352_c1_224_577 | 115 |
| 598 | 3300050512 | nmdc:mga0n895_286717_c1 | nmdc:mga0n895_286717_c1_180_533 | 115 |
| 599 | 3300050512 | nmdc:mga0n895_617741_c1 | nmdc:mga0n895_617741_c1_565_918 | 115 |
| 600 | 3300050513 | nmdc:mga0rr50_1608784_c1 | nmdc:mga0rr50_1608784_c1_30_383 | 115 |
| 601 | 3300050513 | nmdc:mga0rr50_383077_c1 | nmdc:mga0rr50_383077_c1_613_966 | 115 |
| 602 | 3300050513 | nmdc:mga0rr50_416377_c1 | nmdc:mga0rr50_416377_c1_183_536 | 115 |
| 603 | 3300050515 | nmdc:mga0a205_116902_c1 | nmdc:mga0a205_116902_c1_1640_1993 | 115 |
| 604 | 3300053084 | Ga0495595_0071547 | Ga0495595_0071547_102_455 | 115 |
| 605 | 3300053085 | Ga0495619_0055676 | Ga0495619_0055676_42_395 | 115 |
| 606 | 3300054114 | Ga0501084_0021259 | Ga0501084_0021259_2557_2910 | 115 |
| 607 | iso_pu_bacteria | 2919704043 | 2919708818 | 115 |
| 608 | 3300005340 | Ga0070689_100902870 | Ga0070689_1009028701 | 116 |
| 609 | 3300005354 | Ga0070675_100572212 | Ga0070675_1005722122 | 116 |
| 610 | 3300005356 | Ga0070674_100304962 | Ga0070674_1003049622 | 116 |
| 611 | 3300005444 | Ga0070694_101192075 | Ga0070694_1011920751 | 116 |
| 612 | 3300005459 | Ga0068867_100131746 | Ga0068867_1001317461 | 116 |
| 613 | 3300005466 | Ga0070685_11392732 | Ga0070685_113927321 | 116 |
| 614 | 3300005471 | Ga0070698_100437587 | Ga0070698_1004375872 | 116 |
| 615 | 3300005548 | Ga0070665_100022127 | Ga0070665_1000221272 | 116 |
| 616 | 3300006038 | Ga0075365_10479256 | Ga0075365_104792562 | 116 |
| 617 | 3300006048 | Ga0075363_100529454 | Ga0075363_1005294542 | 116 |
| 618 | 3300006051 | Ga0075364_10023952 | Ga0075364_100239525 | 116 |
| 619 | 3300006051 | Ga0075364_10199708 | Ga0075364_101997083 | 116 |
| 620 | 3300006177 | Ga0075362_10056887 | Ga0075362_100568874 | 116 |
| 621 | 3300006178 | Ga0075367_10088726 | Ga0075367_100887263 | 116 |
| 622 | 3300006178 | Ga0075367_10247467 | Ga0075367_102474672 | 116 |
| 623 | 3300006186 | Ga0075369_10001295 | Ga0075369_100012955 | 116 |
| 624 | 3300006186 | Ga0075369_10185095 | Ga0075369_101850952 | 116 |
| 625 | 3300006195 | Ga0075366_10007118 | Ga0075366_100071185 | 116 |
| 626 | 3300006237 | Ga0097621_101969892 | Ga0097621_1019698921 | 116 |
| 627 | 3300006358 | Ga0068871_100119596 | Ga0068871_1001195965 | 116 |
| 628 | 3300009093 | Ga0105240_10595644 | Ga0105240_105956442 | 116 |
| 629 | 3300009093 | Ga0105240_10908437 | Ga0105240_109084372 | 116 |
| 630 | 3300009148 | Ga0105243_10227307 | Ga0105243_102273072 | 116 |
| 631 | 3300009148 | Ga0105243_10411679 | Ga0105243_104116793 | 116 |
| 632 | 3300009176 | Ga0105242_10046258 | Ga0105242_100462584 | 116 |
| 633 | 3300009176 | Ga0105242_11230000 | Ga0105242_112300002 | 116 |
| 634 | 3300009177 | Ga0105248_10527596 | Ga0105248_105275963 | 116 |
| 635 | 3300009177 | Ga0105248_12130156 | Ga0105248_121301562 | 116 |
| 636 | 3300009177 | Ga0105248_12427602 | Ga0105248_124276022 | 116 |
| 637 | 3300009551 | Ga0105238_10468863 | Ga0105238_104688633 | 116 |
| 638 | 3300009553 | Ga0105249_11604556 | Ga0105249_116045562 | 116 |
| 639 | 3300010375 | Ga0105239_11647855 | Ga0105239_116478552 | 116 |
| 640 | 3300011119 | Ga0105246_10722930 | Ga0105246_107229302 | 116 |
| 641 | 3300013104 | Ga0157370_11076397 | Ga0157370_110763971 | 116 |
| 642 | 3300013307 | Ga0157372_12749241 | Ga0157372_127492412 | 116 |
| 643 | 3300013308 | Ga0157375_11540141 | Ga0157375_115401412 | 116 |
| 644 | 3300014325 | Ga0163163_11503692 | Ga0163163_115036922 | 116 |
| 645 | 3300014326 | Ga0157380_10624843 | Ga0157380_106248434 | 116 |
| 646 | 3300014326 | Ga0157380_12420257 | Ga0157380_124202571 | 116 |
| 647 | 3300014968 | Ga0157379_10193218 | Ga0157379_101932183 | 116 |
| 648 | 3300014968 | Ga0157379_11337906 | Ga0157379_113379062 | 116 |
| 649 | 3300014969 | Ga0157376_10845950 | Ga0157376_108459502 | 116 |
| 650 | 3300017792 | Ga0163161_10134116 | Ga0163161_101341162 | 116 |
| 651 | 3300017792 | Ga0163161_11127643 | Ga0163161_111276432 | 116 |
| 652 | 3300025899 | Ga0207642_10500803 | Ga0207642_105008032 | 116 |
| 653 | 3300025935 | Ga0207709_10511740 | Ga0207709_105117402 | 116 |
| 654 | 3300025936 | Ga0207670_11209767 | Ga0207670_112097672 | 116 |
| 655 | 3300025937 | Ga0207669_10698827 | Ga0207669_106988272 | 116 |
| 656 | 3300025938 | Ga0207704_10803382 | Ga0207704_108033822 | 116 |
| 657 | 3300025941 | Ga0207711_11140011 | Ga0207711_111400111 | 116 |
| 658 | 3300026118 | Ga0207675_100143544 | Ga0207675_1001435444 | 116 |
| 659 | 3300026121 | Ga0207683_10333372 | Ga0207683_103333723 | 116 |
| 660 | 3300027526 | Ga0209968_1104408 | Ga0209968_11044081 | 116 |
| 661 | 3300028379 | Ga0268266_10012447 | Ga0268266_1001244711 | 116 |
| 662 | 3300028379 | Ga0268266_10179478 | Ga0268266_101794782 | 116 |
| 663 | 3300032002 | Ga0307416_102238659 | Ga0307416_1022386591 | 116 |
| 664 | 3300034816 | Ga0373930_0072518 | Ga0373930_0072518_139_498 | 116 |
| 665 | 3300034819 | Ga0373958_0003362 | Ga0373958_0003362_785_1141 | 116 |
| 666 | 3300035085 | Ga0373929_0047864 | Ga0373929_0047864_274_633 | 116 |
| 667 | 3300035241 | Ga0373961_0192614 | Ga0373961_0192614_257_616 | 116 |
| 668 | 3300035691 | Ga0373931_0020764 | Ga0373931_0020764_1030_1389 | 116 |
| 669 | 3300035691 | Ga0373931_0048480 | Ga0373931_0048480_451_810 | 116 |
| 670 | 3300035725 | Ga0373947_0806441 | Ga0373947_0806441_103_459 | 116 |
| 671 | 3300037312 | Ga0395899_0135248 | Ga0395899_0135248_530_889 | 116 |
| 672 | 3300037418 | Ga0395900_0034072 | Ga0395900_0034072_2607_2966 | 116 |
| 673 | 3300037466 | Ga0395898_0254758 | Ga0395898_0254758_416_775 | 116 |
| 674 | 3300037471 | Ga0395905_0048048 | Ga0395905_0048048_2560_2919 | 116 |
| 675 | 3300038443 | Ga0395901_0033769 | Ga0395901_0033769_1726_2085 | 116 |
| 676 | 3300041486 | Ga0451807_2053462 | Ga0451807_2053462_253_612 | 116 |
| 677 | 3300044684 | Ga0466966_0050829 | Ga0466966_0050829_2151_2510 | 116 |
| 678 | 3300044693 | Ga0466961_0117869 | Ga0466961_0117869_1262_1621 | 116 |
| 679 | 3300044694 | Ga0466963_0941886 | Ga0466963_0941886_174_533 | 116 |
| 680 | 3300044694 | Ga0466963_1136920 | Ga0466963_1136920_26_385 | 116 |
| 681 | 3300044719 | Ga0466971_0112608 | Ga0466971_0112608_405_764 | 116 |
| 682 | 3300044842 | Ga0466957_0004472 | Ga0466957_0004472_1076_1435 | 116 |
| 683 | 3300045051 | Ga0451576_1155668 | Ga0451576_1155668_78_434 | 116 |
| 684 | 3300045836 | Ga0466958_0062229 | Ga0466958_0062229_329_688 | 116 |
| 685 | 3300045976 | Ga0466967_1482090 | Ga0466967_1482090_117_476 | 116 |
| 686 | 3300046537 | Ga0495598_0136697 | Ga0495598_0136697_220_579 | 116 |
| 687 | 3300046539 | Ga0495621_0381284 | Ga0495621_0381284_162_521 | 116 |
| 688 | 3300046694 | Ga0495649_0384555 | Ga0495649_0384555_39_395 | 116 |
| 689 | 3300049581 | Ga0501047_0930428 | Ga0501047_0930428_218_610 | 116 |
| 690 | 3300049742 | Ga0501080_0415215 | Ga0501080_0415215_392_784 | 116 |
| 691 | 3300050489 | nmdc:mga03683_494499_c1 | nmdc:mga03683_494499_c1_129_485 | 116 |
| 692 | 3300050490 | nmdc:mga03n38_703938_c1 | nmdc:mga03n38_703938_c1_80_436 | 116 |
| 693 | 3300050491 | nmdc:mga00v17_209926_c1 | nmdc:mga00v17_209926_c1_550_909 | 116 |
| 694 | 3300050491 | nmdc:mga00v17_5329_c1 | nmdc:mga00v17_5329_c1_3338_3697 | 116 |
| 695 | 3300050492 | nmdc:mga0yw44_115307_c1 | nmdc:mga0yw44_115307_c1_1064_1423 | 116 |
| 696 | 3300050493 | nmdc:mga0k408_1928_c1 | nmdc:mga0k408_1928_c1_1981_2340 | 116 |
| 697 | 3300050493 | nmdc:mga0k408_4084_c1 | nmdc:mga0k408_4084_c1_368_727 | 116 |
| 698 | 3300050494 | nmdc:mga06z11_157963_c1 | nmdc:mga06z11_157963_c1_794_1153 | 116 |
| 699 | 3300050494 | nmdc:mga06z11_99456_c1 | nmdc:mga06z11_99456_c1_287_646 | 116 |
| 700 | 3300050496 | nmdc:mga07m45_6617_c5 | nmdc:mga07m45_6617_c5_501_860 | 116 |
| 701 | 3300050496 | nmdc:mga07m45_705162_c1 | nmdc:mga07m45_705162_c1_63_422 | 116 |
| 702 | 3300050496 | nmdc:mga07m45_93439_c1 | nmdc:mga07m45_93439_c1_92_451 | 116 |
| 703 | 3300050516 | nmdc:mga0sz30_1133_c1 | nmdc:mga0sz30_1133_c1_5665_6024 | 116 |
| 704 | 3300050516 | nmdc:mga0sz30_225369_c1 | nmdc:mga0sz30_225369_c1_82_438 | 116 |
| 705 | 3300053096 | Ga0500641_0008546 | Ga0500641_0008546_2227_2583 | 116 |
| 706 | 3300005616 | Ga0068852_100272993 | Ga0068852_1002729934 | 118 |
| 707 | 3300042134 | Ga0450898_006294 | Ga0450898_006294_678_1034 | 118 |
| 708 | 3300003322 | rootL2_10001301 | rootL2_1000130111 | 119 |
| 709 | 3300003771 | Ga0055526_1003343 | Ga0055526_100334315 | 119 |
| 710 | 3300003790 | Ga0055528_1057462 | Ga0055528_10574622 | 119 |
| 711 | 3300003791 | Ga0055530_10078106 | Ga0055530_100781062 | 119 |
| 712 | 3300003792 | Ga0055540_1051963 | Ga0055540_10519632 | 119 |
| 713 | 3300003794 | Ga0055531_10111134 | Ga0055531_101111341 | 119 |
| 714 | 3300004801 | Ga0058860_12218986 | Ga0058860_122189862 | 119 |
| 715 | 3300005262 | Ga0065165_1006303 | Ga0065165_10063039 | 119 |
| 716 | 3300005295 | Ga0065707_10001914 | Ga0065707_1000191410 | 119 |
| 717 | 3300005327 | Ga0070658_10130450 | Ga0070658_101304505 | 119 |
| 718 | 3300005719 | Ga0068861_100753593 | Ga0068861_1007535932 | 119 |
| 719 | 3300005844 | Ga0068862_100009442 | Ga0068862_1000094428 | 119 |
| 720 | 3300005844 | Ga0068862_100158350 | Ga0068862_1001583504 | 119 |
| 721 | 3300005937 | Ga0081455_10356823 | Ga0081455_103568232 | 119 |
| 722 | 3300006048 | Ga0075363_100801874 | Ga0075363_1008018742 | 119 |
| 723 | 3300006175 | Ga0070712_101755948 | Ga0070712_1017559481 | 119 |
| 724 | 3300006177 | Ga0075362_10018481 | Ga0075362_100184812 | 119 |
| 725 | 3300006178 | Ga0075367_10010768 | Ga0075367_100107685 | 119 |
| 726 | 3300006195 | Ga0075366_10016161 | Ga0075366_100161612 | 119 |
| 727 | 3300006195 | Ga0075366_10016473 | Ga0075366_100164734 | 119 |
| 728 | 3300006195 | Ga0075366_10138878 | Ga0075366_101388782 | 119 |
| 729 | 3300006353 | Ga0075370_10002824 | Ga0075370_1000282411 | 119 |
| 730 | 3300006944 | Ga0099823_1000064 | Ga0099823_100006420 | 119 |
| 731 | 3300009098 | Ga0105245_10821596 | Ga0105245_108215962 | 119 |
| 732 | 3300009148 | Ga0105243_10258650 | Ga0105243_102586502 | 119 |
| 733 | 3300009553 | Ga0105249_11452365 | Ga0105249_114523652 | 119 |
| 734 | 3300012475 | Ga0157317_1000211 | Ga0157317_10002115 | 119 |
| 735 | 3300012497 | Ga0157319_1000005 | Ga0157319_100000520 | 119 |
| 736 | 3300013296 | Ga0157374_11039074 | Ga0157374_110390742 | 119 |
| 737 | 3300021361 | Ga0213872_10000091 | Ga0213872_1000009120 | 119 |
| 738 | 3300021361 | Ga0213872_10004732 | Ga0213872_100047322 | 119 |
| 739 | 3300021361 | Ga0213872_10277378 | Ga0213872_102773782 | 119 |
| 740 | 3300025245 | Ga0207425_1043363 | Ga0207425_10433632 | 119 |
| 741 | 3300025273 | Ga0209673_1020101 | Ga0209673_10201014 | 119 |
| 742 | 3300025273 | Ga0209673_1024595 | Ga0209673_10245953 | 119 |
| 743 | 3300025295 | Ga0209564_1000008 | Ga0209564_100000836 | 119 |
| 744 | 3300025297 | Ga0209758_1029564 | Ga0209758_10295645 | 119 |
| 745 | 3300025298 | Ga0209050_1013102 | Ga0209050_10131025 | 119 |
| 746 | 3300025299 | Ga0209256_1094210 | Ga0209256_10942102 | 119 |
| 747 | 3300025303 | Ga0209051_1000938 | Ga0209051_100093832 | 119 |
| 748 | 3300025304 | Ga0209257_1105073 | Ga0209257_11050732 | 119 |
| 749 | 3300025909 | Ga0207705_10329369 | Ga0207705_103293693 | 119 |
| 750 | 3300025909 | Ga0207705_11036633 | Ga0207705_110366332 | 119 |
| 751 | 3300025915 | Ga0207693_11404850 | Ga0207693_114048501 | 119 |
| 752 | 3300025919 | Ga0207657_10618754 | Ga0207657_106187541 | 119 |
| 753 | 3300025933 | Ga0207706_11226015 | Ga0207706_112260152 | 119 |
| 754 | 3300025935 | Ga0207709_10118091 | Ga0207709_101180914 | 119 |
| 755 | 3300025972 | Ga0207668_11415126 | Ga0207668_114151261 | 119 |
| 756 | 3300026089 | Ga0207648_10186006 | Ga0207648_101860062 | 119 |
| 757 | 3300026118 | Ga0207675_100166250 | Ga0207675_1001662503 | 119 |
| 758 | 3300027296 | Ga0209389_1000305 | Ga0209389_100030528 | 119 |
| 759 | 3300027312 | Ga0209371_1008392 | Ga0209371_10083926 | 119 |
| 760 | 3300028380 | Ga0268265_10011028 | Ga0268265_1001102811 | 119 |
| 761 | 3300028794 | Ga0307515_10012540 | Ga0307515_1001254011 | 119 |
| 762 | 3300030500 | Ga0268256_1008739 | Ga0268256_10087396 | 119 |
| 763 | 3300031548 | Ga0307408_100037446 | Ga0307408_1000374466 | 119 |
| 764 | 3300031911 | Ga0307412_10588460 | Ga0307412_105884602 | 119 |
| 765 | 3300031911 | Ga0307412_11247265 | Ga0307412_112472652 | 119 |
| 766 | 3300032002 | Ga0307416_101082964 | Ga0307416_1010829642 | 119 |
| 767 | 3300036401 | Ga0373937_0544753 | Ga0373937_0544753_188_565 | 119 |
| 768 | 3300037471 | Ga0395905_0032891 | Ga0395905_0032891_1063_1434 | 119 |
| 769 | 3300037471 | Ga0395905_1024976 | Ga0395905_1024976_211_582 | 119 |
| 770 | 3300039437 | Ga0436365_0661840 | Ga0436365_0661840_260_637 | 119 |
| 771 | 3300039447 | Ga0436361_0714431 | Ga0436361_0714431_7630_7989 | 119 |
| 772 | 3300039447 | Ga0436361_0815871 | Ga0436361_0815871_133_498 | 119 |
| 773 | 3300039447 | Ga0436361_0818040 | Ga0436361_0818040_133_495 | 119 |
| 774 | 3300039447 | Ga0436361_1155176 | Ga0436361_1155176_3389_3754 | 119 |
| 775 | 3300042000 | Ga0439437_017209 | Ga0439437_017209_337_696 | 119 |
| 776 | 3300042127 | Ga0450890_000550 | Ga0450890_000550_1334_1693 | 119 |
| 777 | 3300042142 | Ga0450905_045023 | Ga0450905_045023_53_412 | 119 |
| 778 | 3300042156 | Ga0439446_0340317 | Ga0439446_0340317_146_511 | 119 |
| 779 | 3300042438 | Ga0439459_0000309 | Ga0439459_0000309_3182_3541 | 119 |
| 780 | 3300044656 | Ga0466969_0002653 | Ga0466969_0002653_4826_5197 | 119 |
| 781 | 3300044656 | Ga0466969_0012551 | Ga0466969_0012551_503_868 | 119 |
| 782 | 3300044683 | Ga0466965_0018301 | Ga0466965_0018301_1312_1677 | 119 |
| 783 | 3300044684 | Ga0466966_0021693 | Ga0466966_0021693_211_576 | 119 |
| 784 | 3300044693 | Ga0466961_0026432 | Ga0466961_0026432_2130_2495 | 119 |
| 785 | 3300044694 | Ga0466963_0003881 | Ga0466963_0003881_7930_8295 | 119 |
| 786 | 3300044694 | Ga0466963_0028896 | Ga0466963_0028896_1364_1723 | 119 |
| 787 | 3300044706 | Ga0466964_0003200 | Ga0466964_0003200_434_799 | 119 |
| 788 | 3300044712 | Ga0453684_0040166 | Ga0453684_0040166_747_1106 | 119 |
| 789 | 3300044719 | Ga0466971_0001482 | Ga0466971_0001482_1059_1424 | 119 |
| 790 | 3300044765 | Ga0466970_0025081 | Ga0466970_0025081_1554_1919 | 119 |
| 791 | 3300044765 | Ga0466970_0728805 | Ga0466970_0728805_104_475 | 119 |
| 792 | 3300044842 | Ga0466957_0006128 | Ga0466957_0006128_2107_2472 | 119 |
| 793 | 3300045049 | Ga0466959_0000855 | Ga0466959_0000855_9032_9397 | 119 |
| 794 | 3300045051 | Ga0451576_1697712 | Ga0451576_1697712_166_531 | 119 |
| 795 | 3300045836 | Ga0466958_0022101 | Ga0466958_0022101_1315_1680 | 119 |
| 796 | 3300045976 | Ga0466967_0003037 | Ga0466967_0003037_6442_6807 | 119 |
| 797 | 3300046460 | Ga0495638_0050878 | Ga0495638_0050878_1400_1759 | 119 |
| 798 | 3300048914 | Ga0496111_0639507 | Ga0496111_0639507_149_517 | 119 |
| 799 | 3300048925 | Ga0496122_0329178 | Ga0496122_0329178_123_482 | 119 |
| 800 | 3300048926 | Ga0496123_0301364 | Ga0496123_0301364_143_502 | 119 |
| 801 | 3300048927 | Ga0496124_0030272 | Ga0496124_0030272_595_954 | 119 |
| 802 | 3300049128 | Ga0501308_000356 | Ga0501308_000356_842_1207 | 119 |
| 803 | 3300049128 | Ga0501308_007699 | Ga0501308_007699_426_791 | 119 |
| 804 | 3300049130 | Ga0501310_013780 | Ga0501310_013780_533_898 | 119 |
| 805 | 3300049160 | Ga0501304_004382 | Ga0501304_004382_155_526 | 119 |
| 806 | 3300049160 | Ga0501304_014799 | Ga0501304_014799_315_680 | 119 |
| 807 | 3300049162 | Ga0501307_045179 | Ga0501307_045179_24_392 | 119 |
| 808 | 3300049527 | Ga0501311_024495 | Ga0501311_024495_225_590 | 119 |
| 809 | 3300049527 | Ga0501311_045641 | Ga0501311_045641_287_658 | 119 |
| 810 | 3300049530 | Ga0501314_014200 | Ga0501314_014200_380_745 | 119 |
| 811 | 3300049531 | Ga0501315_005277 | Ga0501315_005277_564_929 | 119 |
| 812 | 3300049532 | Ga0501316_013333 | Ga0501316_013333_213_584 | 119 |
| 813 | 3300049532 | Ga0501316_054783 | Ga0501316_054783_193_558 | 119 |
| 814 | 3300049535 | Ga0501319_015308 | Ga0501319_015308_240_605 | 119 |
| 815 | 3300049536 | Ga0501320_005049 | Ga0501320_005049_421_786 | 119 |
| 816 | 3300049536 | Ga0501320_060264 | Ga0501320_060264_130_495 | 119 |
| 817 | 3300050489 | nmdc:mga03683_40367_c1 | nmdc:mga03683_40367_c1_928_1293 | 119 |
| 818 | 3300050489 | nmdc:mga03683_89229_c1 | nmdc:mga03683_89229_c1_106_465 | 119 |
| 819 | 3300050490 | nmdc:mga03n38_602745_c1 | nmdc:mga03n38_602745_c1_193_558 | 119 |
| 820 | 3300050493 | nmdc:mga0k408_109049_c1 | nmdc:mga0k408_109049_c1_1157_1522 | 119 |
| 821 | 3300050493 | nmdc:mga0k408_15566_c1 | nmdc:mga0k408_15566_c1_3794_4159 | 119 |
| 822 | 3300050494 | nmdc:mga06z11_31132_c1 | nmdc:mga06z11_31132_c1_1944_2309 | 119 |
| 823 | 3300050496 | nmdc:mga07m45_2931_c1 | nmdc:mga07m45_2931_c1_2843_3202 | 119 |
| 824 | 3300053156 | Ga0500622_0001316 | Ga0500622_0001316_10667_11026 | 119 |
| 825 | 3300059421 | Ga0590071_001831 | Ga0590071_001831_4641_5009 | 119 |
| 826 | 3300059426 | Ga0590077_097116 | Ga0590077_097116_32_400 | 119 |
| 827 | 3300059605 | Ga0587106_091383 | Ga0587106_091383_11_376 | 119 |
| 828 | 3300061719 | Ga0466962_0014522 | Ga0466962_0014522_260_625 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4w-assembly1.cif.gz_N | a. baumannii ribosome-eravacycline complex: empty 70s | 0.9477 | 3 | 119 |
| 7m4w-assembly1.cif.gz_N | a. baumannii ribosome-eravacycline complex: empty 70s | 0.9398 | 3 | 119 |
| 7unw-assembly1.cif.gz_Q | pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) | 0.9396 | 4 | 119 |
| 6v3b-assembly1.cif.gz_N | cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state | 0.9342 | 3 | 119 |
| 7jt1-assembly1.cif.gz_o | 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) | 0.9287 | 3 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6SLT9_8_113_3.30.420.100 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9253 | 21 | 119 | 3.30.420.100 |
| 6ddga01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9253 | 26 | 119 | 3.30.420.100 |
| 4pecO00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9242 | 3 | 119 | 3.30.420.100 |
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9196 | 22 | 119 | 3.30.420.100 |
| 4pecO00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9168 | 3 | 119 | 3.30.420.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2QZF7-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9805 | 23 | 119 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-E4PM04-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.978 | 18 | 119 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A0S2SFS5-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9749 | 20 | 119 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A7U4DEM8-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9746 | 19 | 119 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2J4RAZ0-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.973 | 16 | 119 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar