F482576

General Info

Members Datasets Scaffolds Average Seq Length
828 393 827 117

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0930428|Ga0501047_0930428_218_610
Length 130
Sequence MPPLDSSGRGTKDMDKKISRTRRAAKTRARIARQEAVRLAVHRTNQHIYAQVIDAAGGKVLASASTLEKEVRSAHPKSAGKEAAAAVGKRIAEKAKAAGVTEVAFDRAGFSYHGRVKALAEAAREGGLKF

Samples

Sample ID Description Type Environment
1 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
108 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
191 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
192 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
217 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
218 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
219 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
220 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
221 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
247 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
248 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
249 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
250 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
251 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
252 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
253 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
254 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
255 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
256 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
257 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
258 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
259 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
260 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
261 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
262 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
263 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
264 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
265 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
266 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
270 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
271 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
272 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
273 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
334 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
335 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
354 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
381 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
382 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 4.35
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.23
Nodule 0.6
Rhizoplane 1.09
Rhizosphere 85.27
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10001301 3300003322 Bacteria 6102
2 Ga0007410J51695_1037205 3300003574 Bacteria 698
3 Ga0007409J51694_1026312 3300003575 Bacteria 759
4 Ga0055526_1003343 3300003771 Bacteria 10245
5 Ga0055528_1017593 3300003790 Bacteria 2470
6 Ga0055528_1057462 3300003790 Bacteria 750
7 Ga0055530_10078106 3300003791 Bacteria 700
8 Ga0055540_1051963 3300003792 Bacteria 843
9 Ga0055531_10111134 3300003794 Bacteria 547
10 Ga0058860_12218986 3300004801 Bacteria 2322
11 Ga0065165_1006303 3300005262 Bacteria 6283
12 Ga0065707_10001914 3300005295 Bacteria 6146
13 Ga0070658_10030833 3300005327 Bacteria 4307
14 Ga0070658_10061874 3300005327 Bacteria 3050
15 Ga0070658_10130450 3300005327 Bacteria 2094
16 Ga0070658_10602014 3300005327 Bacteria 952
17 Ga0070658_11996890 3300005327 Bacteria 500
18 Ga0070676_10050474 3300005328 Bacteria 2439
19 Ga0070676_10261202 3300005328 Bacteria 1159
20 Ga0070676_10429620 3300005328 Bacteria 925
21 Ga0070683_100113047 3300005329 Bacteria 2562
22 Ga0070690_100313214 3300005330 Bacteria 1129
23 Ga0070690_100391229 3300005330 Bacteria 1019
24 Ga0070670_100218635 3300005331 Bacteria 1657
25 Ga0070670_100541995 3300005331 Bacteria 1037
26 Ga0070670_100936042 3300005331 Bacteria 786
27 Ga0070677_10423163 3300005333 Bacteria 707
28 Ga0070677_10509202 3300005333 Bacteria 654
29 Ga0068869_100132145 3300005334 Bacteria 1919
30 Ga0068869_100190433 3300005334 Bacteria 1612
31 Ga0068869_100401391 3300005334 Bacteria 1128
32 Ga0070666_10540965 3300005335 Bacteria 847
33 Ga0068868_100074093 3300005338 Bacteria 2718
34 Ga0068868_100125596 3300005338 Bacteria 2095
35 Ga0068868_101196314 3300005338 Bacteria 703
36 Ga0068868_101887430 3300005338 Bacteria 566
37 Ga0070660_100818220 3300005339 Bacteria 784
38 Ga0070689_100018801 3300005340 Bacteria 5099
39 Ga0070689_100327138 3300005340 Bacteria 1281
40 Ga0070689_100436204 3300005340 Bacteria 1112
41 Ga0070689_100588585 3300005340 Bacteria 962
42 Ga0070689_100902870 3300005340 Bacteria 782
43 Ga0070687_100603249 3300005343 Bacteria 754
44 Ga0070661_100167366 3300005344 Bacteria 1668
45 Ga0070661_100606013 3300005344 Bacteria 886
46 Ga0070661_100743290 3300005344 Bacteria 802
47 Ga0070669_100034565 3300005353 Bacteria 3659
48 Ga0070669_100077546 3300005353 Bacteria 2469
49 Ga0070669_100102253 3300005353 Bacteria 2164
50 Ga0070669_100547050 3300005353 Bacteria 965
51 Ga0070675_100031032 3300005354 Bacteria 4318
52 Ga0070675_100441805 3300005354 Bacteria 1165
53 Ga0070675_100537435 3300005354 Bacteria 1056
54 Ga0070675_100572212 3300005354 Bacteria 1023
55 Ga0070675_101864937 3300005354 Bacteria 554
56 Ga0070675_102227621 3300005354 Bacteria 505
57 Ga0070671_100151546 3300005355 Bacteria 1958
58 Ga0070671_101400409 3300005355 Bacteria 618
59 Ga0070671_101549905 3300005355 Bacteria 587
60 Ga0070674_100304962 3300005356 Bacteria 1271
61 Ga0070674_100831331 3300005356 Bacteria 800
62 Ga0070674_100858675 3300005356 Bacteria 788
63 Ga0070674_100938789 3300005356 Bacteria 756
64 Ga0070673_100025135 3300005364 Bacteria 4378
65 Ga0070673_100055764 3300005364 Bacteria 3115
66 Ga0070673_100383392 3300005364 Bacteria 1254
67 Ga0070673_100532134 3300005364 Bacteria 1066
68 Ga0070688_100087995 3300005365 Bacteria 2024
69 Ga0070688_100234898 3300005365 Bacteria 1298
70 Ga0070659_100546172 3300005366 Bacteria 992
71 Ga0070659_101108230 3300005366 Bacteria 698
72 Ga0070659_101886689 3300005366 Bacteria 536
73 Ga0070667_100337290 3300005367 Bacteria 1363
74 Ga0070667_101929922 3300005367 Bacteria 556
75 Ga0070709_11263927 3300005434 Bacteria 595
76 Ga0070714_100651652 3300005435 Bacteria 1014
77 Ga0070714_101521837 3300005435 Bacteria 654
78 Ga0070701_10056180 3300005438 Bacteria 2059
79 Ga0070701_10203377 3300005438 Bacteria 1172
80 Ga0070701_10971730 3300005438 Bacteria 591
81 Ga0070701_11157601 3300005438 Bacteria 547
82 Ga0070700_101053485 3300005441 Bacteria 671
83 Ga0070694_101000994 3300005444 Bacteria 694
84 Ga0070694_101192075 3300005444 Bacteria 638
85 Ga0070708_100348288 3300005445 Bacteria 1396
86 Ga0070678_100195478 3300005456 Bacteria 1666
87 Ga0070678_100625441 3300005456 Bacteria 963
88 Ga0070678_101883788 3300005456 Bacteria 565
89 Ga0070662_100060375 3300005457 Bacteria 2765
90 Ga0070662_100347907 3300005457 Bacteria 1214
91 Ga0070662_100740980 3300005457 Bacteria 833
92 Ga0070662_100960223 3300005457 Bacteria 731
93 Ga0068867_100036184 3300005459 Bacteria 3582
94 Ga0068867_100128512 3300005459 Bacteria 1966
95 Ga0068867_100131746 3300005459 Bacteria 1944
96 Ga0068867_100152150 3300005459 Bacteria 1818
97 Ga0068867_100665931 3300005459 Bacteria 915
98 Ga0068867_101795877 3300005459 Bacteria 576
99 Ga0068867_102352674 3300005459 Bacteria 507
100 Ga0070685_10196792 3300005466 Bacteria 1308
101 Ga0070685_10316092 3300005466 Bacteria 1057
102 Ga0070685_11392732 3300005466 Bacteria 538
103 Ga0070698_100437587 3300005471 Bacteria 1243
104 Ga0070679_100468873 3300005530 Bacteria 1204
105 Ga0070684_100029158 3300005535 Bacteria 4674
106 Ga0070684_100280787 3300005535 Bacteria 1526
107 Ga0070684_100995447 3300005535 Bacteria 787
108 Ga0068853_100031768 3300005539 Bacteria 4468
109 Ga0068853_100057137 3300005539 Bacteria 3366
110 Ga0068853_100107714 3300005539 Bacteria 2471
111 Ga0070686_100047607 3300005544 Bacteria 2712
112 Ga0070695_101139468 3300005545 Bacteria 640
113 Ga0070696_101094150 3300005546 Bacteria 670
114 Ga0070693_100064126 3300005547 Bacteria 2143
115 Ga0070693_100079511 3300005547 Bacteria 1951
116 Ga0070693_100708138 3300005547 Bacteria 738
117 Ga0070693_100751721 3300005547 Bacteria 719
118 Ga0070665_100022127 3300005548 Bacteria 6394
119 Ga0070665_100047667 3300005548 Bacteria 4300
120 Ga0070665_100677110 3300005548 Bacteria 1045
121 Ga0070665_101432012 3300005548 Bacteria 700
122 Ga0070665_102025440 3300005548 Bacteria 581
123 Ga0070704_100823691 3300005549 Bacteria 831
124 Ga0068855_100029685 3300005563 Bacteria 6537
125 Ga0068855_100061581 3300005563 Bacteria 4384
126 Ga0068855_100288384 3300005563 Bacteria 1820
127 Ga0070664_100311472 3300005564 Bacteria 1425
128 Ga0070664_101353532 3300005564 Bacteria 673
129 Ga0068857_100012217 3300005577 Bacteria 7470
130 Ga0068857_100878656 3300005577 Bacteria 859
131 Ga0068854_100454288 3300005578 Bacteria 1071
132 Ga0068854_101397900 3300005578 Bacteria 633
133 Ga0068854_101411187 3300005578 Bacteria 630
134 Ga0068856_100065846 3300005614 Bacteria 3580
135 Ga0068856_102184099 3300005614 Bacteria 563
136 Ga0070702_100847935 3300005615 Bacteria 711
137 Ga0070702_100993404 3300005615 Bacteria 664
138 Ga0068852_100004380 3300005616 Bacteria 9978
139 Ga0068852_100127860 3300005616 Bacteria 2336
140 Ga0068852_100171595 3300005616 Bacteria 2033
141 Ga0068852_100272993 3300005616 Bacteria 1628
142 Ga0068852_100461237 3300005616 Bacteria 1260
143 Ga0068859_100076061 3300005617 Bacteria 3398
144 Ga0068859_100130549 3300005617 Bacteria 2584
145 Ga0068859_100821191 3300005617 Bacteria 1016
146 Ga0068859_102020051 3300005617 Bacteria 637
147 Ga0068864_100203018 3300005618 Bacteria 1822
148 Ga0068864_100629129 3300005618 Bacteria 1044
149 Ga0068864_101612366 3300005618 Bacteria 653
150 Ga0068861_100164604 3300005719 Bacteria 1833
151 Ga0068861_100311411 3300005719 Bacteria 1368
152 Ga0068861_100753593 3300005719 Bacteria 910
153 Ga0068851_10006696 3300005834 Bacteria 5270
154 Ga0068870_10034507 3300005840 Bacteria 2589
155 Ga0068870_10627050 3300005840 Bacteria 734
156 Ga0068863_100236126 3300005841 Bacteria 1764
157 Ga0068863_101109739 3300005841 Bacteria 796
158 Ga0068858_100102741 3300005842 Bacteria 2666
159 Ga0068858_100628514 3300005842 Bacteria 1043
160 Ga0068860_100241063 3300005843 Bacteria 1759
161 Ga0068860_100446321 3300005843 Bacteria 1286
162 Ga0068860_100933330 3300005843 Bacteria 885
163 Ga0068860_101303745 3300005843 Bacteria 747
164 Ga0068862_100009442 3300005844 Bacteria 8069
165 Ga0068862_100158350 3300005844 Bacteria 2020
166 Ga0081455_10356823 3300005937 Bacteria 1029
167 Ga0070717_10828554 3300006028 Bacteria 842
168 Ga0075365_10090325 3300006038 Bacteria 2086
169 Ga0075365_10473437 3300006038 Bacteria 885
170 Ga0075365_10479256 3300006038 Bacteria 879
171 Ga0075368_10467539 3300006042 Bacteria 560
172 Ga0075363_100089552 3300006048 Bacteria 1692
173 Ga0075363_100529454 3300006048 Bacteria 702
174 Ga0075363_100801874 3300006048 Bacteria 573
175 Ga0075364_10023952 3300006051 Bacteria 3870
176 Ga0075364_10033419 3300006051 Bacteria 3312
177 Ga0075364_10199708 3300006051 Bacteria 1355
178 Ga0075364_10345408 3300006051 Bacteria 1014
179 Ga0075432_10016379 3300006058 Bacteria 2529
180 Ga0070716_101262330 3300006173 Bacteria 596
181 Ga0070712_101589118 3300006175 Bacteria 572
182 Ga0070712_101755948 3300006175 Bacteria 543
183 Ga0075362_10018481 3300006177 Bacteria 2885
184 Ga0075362_10056887 3300006177 Bacteria 1761
185 Ga0075362_10119745 3300006177 Bacteria 1245
186 Ga0075362_10744937 3300006177 Bacteria 513
187 Ga0075367_10010768 3300006178 Bacteria 4815
188 Ga0075367_10021043 3300006178 Bacteria 3641
189 Ga0075367_10088726 3300006178 Bacteria 1879
190 Ga0075367_10247467 3300006178 Bacteria 1118
191 Ga0075367_10471900 3300006178 Bacteria 795
192 Ga0075369_10001295 3300006186 Bacteria 8496
193 Ga0075369_10185095 3300006186 Bacteria 959
194 Ga0075366_10005895 3300006195 Bacteria 6662
195 Ga0075366_10007118 3300006195 Bacteria 6159
196 Ga0075366_10016161 3300006195 Bacteria 4286
197 Ga0075366_10016473 3300006195 Bacteria 4249
198 Ga0075366_10138878 3300006195 Bacteria 1468
199 Ga0075366_10886917 3300006195 Bacteria 555
200 Ga0097621_100024717 3300006237 Bacteria 4694
201 Ga0097621_100203834 3300006237 Bacteria 1718
202 Ga0097621_101969892 3300006237 Bacteria 558
203 Ga0075370_10002824 3300006353 Bacteria 8149
204 Ga0075370_10139703 3300006353 Bacteria 1416
205 Ga0075370_10455856 3300006353 Bacteria 770
206 Ga0075370_10938323 3300006353 Bacteria 529
207 Ga0068871_100063147 3300006358 Bacteria 3028
208 Ga0068871_100119596 3300006358 Bacteria 2224
209 Ga0068871_100206099 3300006358 Bacteria 1699
210 Ga0068871_100331258 3300006358 Bacteria 1343
211 Ga0068871_100369183 3300006358 Bacteria 1272
212 Ga0068871_100806614 3300006358 Bacteria 865
213 Ga0075428_100074204 3300006844 Bacteria 3716
214 Ga0075433_10425694 3300006852 Bacteria 1171
215 Ga0075434_100174619 3300006871 Bacteria 2168
216 Ga0075434_101969185 3300006871 Bacteria 590
217 Ga0075429_100536246 3300006880 Bacteria 1025
218 Ga0068865_100055933 3300006881 Bacteria 2747
219 Ga0097620_100076060 3300006931 Bacteria 3398
220 Ga0097620_100130553 3300006931 Bacteria 2584
221 Ga0097620_100821210 3300006931 Bacteria 1016
222 Ga0097620_102020132 3300006931 Bacteria 637
223 Ga0099823_1000064 3300006944 Bacteria 50328
224 Ga0079104_1015591 3300006946 Bacteria 2247
225 Ga0075435_100448940 3300007076 Bacteria 1112
226 Ga0105240_10112049 3300009093 Bacteria 3299
227 Ga0105240_10390077 3300009093 Bacteria 1571
228 Ga0105240_10595644 3300009093 Bacteria 1218
229 Ga0105240_10908437 3300009093 Bacteria 947
230 Ga0105240_12369494 3300009093 Bacteria 550
231 Ga0111539_10019077 3300009094 Bacteria 8474
232 Ga0105245_10494220 3300009098 Bacteria 1239
233 Ga0105245_10760192 3300009098 Bacteria 1005
234 Ga0105245_10766638 3300009098 Bacteria 1001
235 Ga0105245_10821596 3300009098 Bacteria 968
236 Ga0105245_10893074 3300009098 Bacteria 930
237 Ga0105243_10227307 3300009148 Bacteria 1653
238 Ga0105243_10258650 3300009148 Bacteria 1558
239 Ga0105243_10411679 3300009148 Bacteria 1259
240 Ga0105243_10847435 3300009148 Bacteria 905
241 Ga0105241_11449991 3300009174 Bacteria 659
242 Ga0105242_10046258 3300009176 Bacteria 3530
243 Ga0105242_10228604 3300009176 Bacteria 1666
244 Ga0105242_10427603 3300009176 Bacteria 1242
245 Ga0105242_11230000 3300009176 Bacteria 769
246 Ga0105242_11914332 3300009176 Bacteria 634
247 Ga0105242_12544829 3300009176 Bacteria 560
248 Ga0105248_10053313 3300009177 Bacteria 4538
249 Ga0105248_10123110 3300009177 Bacteria 2926
250 Ga0105248_10527596 3300009177 Bacteria 1332
251 Ga0105248_10628678 3300009177 Bacteria 1211
252 Ga0105248_10706794 3300009177 Bacteria 1137
253 Ga0105248_10906415 3300009177 Bacteria 995
254 Ga0105248_12130156 3300009177 Bacteria 638
255 Ga0105248_12427602 3300009177 Bacteria 597
256 Ga0105237_12059128 3300009545 Bacteria 580
257 Ga0105238_10087095 3300009551 Bacteria 3110
258 Ga0105238_10162918 3300009551 Bacteria 2206
259 Ga0105238_10468863 3300009551 Bacteria 1258
260 Ga0105238_10872135 3300009551 Bacteria 918
261 Ga0105249_11452365 3300009553 Bacteria 758
262 Ga0105249_11604556 3300009553 Bacteria 723
263 Ga0105239_11647855 3300010375 Bacteria 742
264 Ga0105246_10722930 3300011119 Bacteria 875
265 Ga0105246_10880654 3300011119 Bacteria 801
266 Ga0157317_1000211 3300012475 Bacteria 2102
267 Ga0157319_1000005 3300012497 Bacteria 372810
268 Ga0157370_10281691 3300013104 Bacteria 1536
269 Ga0157370_11076397 3300013104 Bacteria 727
270 Ga0157369_10006334 3300013105 Bacteria 13736
271 Ga0157369_10167285 3300013105 Bacteria 2318
272 Ga0157369_12010765 3300013105 Bacteria 586
273 Ga0157374_10079715 3300013296 Bacteria 3104
274 Ga0157374_10711098 3300013296 Bacteria 1018
275 Ga0157374_11039074 3300013296 Bacteria 839
276 Ga0157374_11772693 3300013296 Bacteria 642
277 Ga0157378_10059479 3300013297 Bacteria 3409
278 Ga0163162_10022516 3300013306 Bacteria 6209
279 Ga0163162_10338226 3300013306 Bacteria 1638
280 Ga0163162_10677367 3300013306 Bacteria 1154
281 Ga0163162_10913966 3300013306 Bacteria 990
282 Ga0157372_10191231 3300013307 Bacteria 2371
283 Ga0157372_11188047 3300013307 Bacteria 882
284 Ga0157372_12749241 3300013307 Bacteria 564
285 Ga0157375_10359351 3300013308 Bacteria 1622
286 Ga0157375_11353360 3300013308 Bacteria 838
287 Ga0157375_11540141 3300013308 Bacteria 785
288 Ga0163163_11378123 3300014325 Bacteria 767
289 Ga0163163_11503692 3300014325 Bacteria 735
290 Ga0157380_10035459 3300014326 Bacteria 3854
291 Ga0157380_10256156 3300014326 Bacteria 1587
292 Ga0157380_10624843 3300014326 Bacteria 1070
293 Ga0157380_10911343 3300014326 Bacteria 906
294 Ga0157380_11467506 3300014326 Bacteria 734
295 Ga0157380_12420257 3300014326 Bacteria 590
296 Ga0157380_12813113 3300014326 Bacteria 553
297 Ga0157377_11269105 3300014745 Bacteria 574
298 Ga0157379_10193218 3300014968 Bacteria 1839
299 Ga0157379_10645825 3300014968 Bacteria 990
300 Ga0157379_10937838 3300014968 Bacteria 823
301 Ga0157379_11337906 3300014968 Bacteria 693
302 Ga0157376_10202712 3300014969 Bacteria 1827
303 Ga0157376_10845950 3300014969 Bacteria 930
304 Ga0157376_12278089 3300014969 Bacteria 581
305 Ga0157376_12401687 3300014969 Bacteria 567
306 Ga0163161_10134116 3300017792 Bacteria 1870
307 Ga0163161_11127643 3300017792 Bacteria 675
308 Ga0163161_11777879 3300017792 Bacteria 548
309 Ga0197907_10947458 3300020069 Bacteria 534
310 Ga0206354_10693061 3300020081 Bacteria 982
311 Ga0213872_10000091 3300021361 Bacteria 83723
312 Ga0213872_10004732 3300021361 Bacteria 7137
313 Ga0213872_10277378 3300021361 Bacteria 700
314 Ga0207425_1043363 3300025245 Bacteria 848
315 Ga0209673_1020101 3300025273 Bacteria 2374
316 Ga0209673_1024595 3300025273 Bacteria 2019
317 Ga0209675_1000220 3300025291 Bacteria 59335
318 Ga0209564_1000008 3300025295 Bacteria 953227
319 Ga0209758_1029564 3300025297 Bacteria 2287
320 Ga0209050_1013102 3300025298 Bacteria 3724
321 Ga0209256_1094210 3300025299 Bacteria 631
322 Ga0209051_1000938 3300025303 Bacteria 28786
323 Ga0209257_1105073 3300025304 Bacteria 682
324 Ga0207697_10168345 3300025315 Bacteria 958
325 Ga0207656_10001500 3300025321 Bacteria 7731
326 Ga0207656_10067697 3300025321 Bacteria 1581
327 Ga0207682_10037312 3300025893 Bacteria 1968
328 Ga0207682_10136512 3300025893 Bacteria 1098
329 Ga0207642_10201121 3300025899 Bacteria 1100
330 Ga0207642_10500803 3300025899 Bacteria 744
331 Ga0207688_10034103 3300025901 Bacteria 2817
332 Ga0207688_10586131 3300025901 Bacteria 702
333 Ga0207688_10904359 3300025901 Bacteria 559
334 Ga0207680_10333726 3300025903 Bacteria 1062
335 Ga0207685_10003543 3300025905 Bacteria 3813
336 Ga0207699_10608840 3300025906 Bacteria 796
337 Ga0207645_10050633 3300025907 Bacteria 2652
338 Ga0207645_10149288 3300025907 Bacteria 1525
339 Ga0207643_10158658 3300025908 Bacteria 1360
340 Ga0207643_10544558 3300025908 Bacteria 744
341 Ga0207705_10141765 3300025909 Bacteria 1795
342 Ga0207705_10235593 3300025909 Bacteria 1393
343 Ga0207705_10329369 3300025909 Bacteria 1174
344 Ga0207705_10538465 3300025909 Bacteria 908
345 Ga0207705_10870903 3300025909 Bacteria 698
346 Ga0207705_11036633 3300025909 Bacteria 633
347 Ga0207654_10015846 3300025911 Bacteria 3918
348 Ga0207695_10031032 3300025913 Bacteria 5872
349 Ga0207695_10560496 3300025913 Bacteria 1024
350 Ga0207695_10862452 3300025913 Bacteria 785
351 Ga0207693_11404850 3300025915 Bacteria 518
352 Ga0207660_10673904 3300025917 Bacteria 843
353 Ga0207660_10869381 3300025917 Bacteria 736
354 Ga0207662_10071217 3300025918 Bacteria 2105
355 Ga0207662_10447242 3300025918 Bacteria 883
356 Ga0207657_10618754 3300025919 Bacteria 844
357 Ga0207649_10365682 3300025920 Bacteria 1071
358 Ga0207649_10481971 3300025920 Bacteria 941
359 Ga0207649_11218994 3300025920 Bacteria 595
360 Ga0207649_11388795 3300025920 Bacteria 556
361 Ga0207681_10032331 3300025923 Bacteria 3424
362 Ga0207681_10139757 3300025923 Bacteria 1802
363 Ga0207694_10007098 3300025924 Bacteria 8511
364 Ga0207694_10136119 3300025924 Bacteria 1973
365 Ga0207694_10184725 3300025924 Bacteria 1692
366 Ga0207694_10771123 3300025924 Bacteria 812
367 Ga0207694_11115878 3300025924 Bacteria 667
368 Ga0207650_10257366 3300025925 Bacteria 1415
369 Ga0207650_10281702 3300025925 Bacteria 1354
370 Ga0207650_10381883 3300025925 Bacteria 1163
371 Ga0207650_10435230 3300025925 Bacteria 1090
372 Ga0207659_10001704 3300025926 Bacteria 13045
373 Ga0207659_10110055 3300025926 Bacteria 2093
374 Ga0207659_10338491 3300025926 Bacteria 1245
375 Ga0207659_10977508 3300025926 Bacteria 728
376 Ga0207687_10540135 3300025927 Bacteria 977
377 Ga0207687_10548898 3300025927 Bacteria 969
378 Ga0207664_10569153 3300025929 Bacteria 1017
379 Ga0207664_11214378 3300025929 Bacteria 672
380 Ga0207644_10246131 3300025931 Bacteria 1425
381 Ga0207644_10736364 3300025931 Bacteria 823
382 Ga0207644_10772513 3300025931 Bacteria 803
383 Ga0207644_11247569 3300025931 Bacteria 625
384 Ga0207690_11038971 3300025932 Bacteria 682
385 Ga0207690_11091870 3300025932 Bacteria 665
386 Ga0207706_10169030 3300025933 Bacteria 1922
387 Ga0207706_10254171 3300025933 Bacteria 1534
388 Ga0207706_10928436 3300025933 Bacteria 734
389 Ga0207706_11226015 3300025933 Bacteria 623
390 Ga0207686_10009661 3300025934 Bacteria 5239
391 Ga0207686_10016521 3300025934 Bacteria 4142
392 Ga0207686_10018299 3300025934 Bacteria 3966
393 Ga0207686_10719481 3300025934 Bacteria 795
394 Ga0207686_11657190 3300025934 Bacteria 529
395 Ga0207709_10118091 3300025935 Bacteria 1786
396 Ga0207709_10511740 3300025935 Bacteria 938
397 Ga0207709_10937155 3300025935 Bacteria 705
398 Ga0207670_10031826 3300025936 Bacteria 3386
399 Ga0207670_10055644 3300025936 Bacteria 2674
400 Ga0207670_10198354 3300025936 Bacteria 1523
401 Ga0207670_10398825 3300025936 Bacteria 1099
402 Ga0207670_10468252 3300025936 Bacteria 1018
403 Ga0207670_11209767 3300025936 Bacteria 640
404 Ga0207669_10030057 3300025937 Bacteria 3014
405 Ga0207669_10137030 3300025937 Bacteria 1692
406 Ga0207669_10149676 3300025937 Bacteria 1633
407 Ga0207669_10698827 3300025937 Bacteria 833
408 Ga0207669_10820376 3300025937 Bacteria 772
409 Ga0207669_10955518 3300025937 Bacteria 718
410 Ga0207669_11220207 3300025937 Bacteria 637
411 Ga0207669_11904987 3300025937 Bacteria 508
412 Ga0207704_10131203 3300025938 Bacteria 1735
413 Ga0207704_10803382 3300025938 Bacteria 786
414 Ga0207665_10535488 3300025939 Bacteria 908
415 Ga0207691_10008862 3300025940 Bacteria 9656
416 Ga0207691_10476398 3300025940 Bacteria 1061
417 Ga0207691_10572243 3300025940 Bacteria 957
418 Ga0207711_10068759 3300025941 Bacteria 3068
419 Ga0207711_10575921 3300025941 Bacteria 1050
420 Ga0207711_10603212 3300025941 Bacteria 1024
421 Ga0207711_11140011 3300025941 Bacteria 721
422 Ga0207689_10203269 3300025942 Bacteria 1635
423 Ga0207689_10206961 3300025942 Bacteria 1620
424 Ga0207689_10273860 3300025942 Bacteria 1397
425 Ga0207661_10072644 3300025944 Bacteria 2815
426 Ga0207661_11414794 3300025944 Bacteria 638
427 Ga0207679_10219061 3300025945 Bacteria 1600
428 Ga0207667_10175639 3300025949 Bacteria 2201
429 Ga0207667_10246512 3300025949 Bacteria 1828
430 Ga0207667_10324884 3300025949 Bacteria 1571
431 Ga0207651_10036504 3300025960 Bacteria 3209
432 Ga0207651_10059456 3300025960 Bacteria 2648
433 Ga0207651_10111768 3300025960 Bacteria 2052
434 Ga0207651_10199611 3300025960 Bacteria 1602
435 Ga0207651_10381798 3300025960 Bacteria 1194
436 Ga0207651_10670780 3300025960 Bacteria 911
437 Ga0207651_11808616 3300025960 Bacteria 550
438 Ga0207712_11546897 3300025961 Bacteria 594
439 Ga0207668_10283658 3300025972 Bacteria 1359
440 Ga0207668_11415126 3300025972 Bacteria 627
441 Ga0207640_10399967 3300025981 Bacteria 1118
442 Ga0207640_10477137 3300025981 Bacteria 1034
443 Ga0207640_10585053 3300025981 Bacteria 943
444 Ga0207640_10644569 3300025981 Bacteria 902
445 Ga0207640_11018309 3300025981 Bacteria 729
446 Ga0207640_11352102 3300025981 Bacteria 637
447 Ga0207658_10165595 3300025986 Bacteria 1816
448 Ga0207658_11242280 3300025986 Bacteria 681
449 Ga0207677_10068962 3300026023 Bacteria 2485
450 Ga0207677_10190830 3300026023 Bacteria 1620
451 Ga0207677_11183150 3300026023 Bacteria 699
452 Ga0207677_11446440 3300026023 Bacteria 634
453 Ga0207677_11460027 3300026023 Bacteria 631
454 Ga0207703_10108254 3300026035 Bacteria 2367
455 Ga0207703_10366621 3300026035 Bacteria 1330
456 Ga0207703_10565482 3300026035 Bacteria 1073
457 Ga0207639_10018858 3300026041 Bacteria 4910
458 Ga0207639_10081460 3300026041 Bacteria 2564
459 Ga0207639_10681108 3300026041 Bacteria 953
460 Ga0207708_10312632 3300026075 Bacteria 1280
461 Ga0207708_11086250 3300026075 Bacteria 697
462 Ga0207702_10114437 3300026078 Bacteria 2404
463 Ga0207702_10577157 3300026078 Bacteria 1102
464 Ga0207641_10529841 3300026088 Bacteria 1147
465 Ga0207641_10572465 3300026088 Bacteria 1103
466 Ga0207641_11930667 3300026088 Bacteria 592
467 Ga0207648_10049310 3300026089 Bacteria 3685
468 Ga0207648_10186006 3300026089 Bacteria 1840
469 Ga0207648_10577479 3300026089 Bacteria 1034
470 Ga0207648_10710905 3300026089 Bacteria 931
471 Ga0207676_10208510 3300026095 Bacteria 1732
472 Ga0207676_10309620 3300026095 Bacteria 1445
473 Ga0207676_10453884 3300026095 Bacteria 1209
474 Ga0207676_11155911 3300026095 Bacteria 766
475 Ga0207674_10022377 3300026116 Bacteria 6788
476 Ga0207675_100136832 3300026118 Bacteria 2325
477 Ga0207675_100143544 3300026118 Bacteria 2269
478 Ga0207675_100166250 3300026118 Bacteria 2107
479 Ga0207675_100306952 3300026118 Bacteria 1546
480 Ga0207675_101527272 3300026118 Bacteria 688
481 Ga0207683_10015833 3300026121 Bacteria 6420
482 Ga0207683_10119357 3300026121 Bacteria 2366
483 Ga0207683_10333372 3300026121 Bacteria 1391
484 Ga0207683_11067120 3300026121 Bacteria 749
485 Ga0207683_11144786 3300026121 Bacteria 721
486 Ga0207698_10010326 3300026142 Bacteria 5990
487 Ga0207698_10018098 3300026142 Bacteria 4794
488 Ga0207698_10158112 3300026142 Bacteria 1978
489 Ga0207698_10297306 3300026142 Bacteria 1501
490 Ga0207698_10571078 3300026142 Bacteria 1111
491 Ga0207698_11904398 3300026142 Bacteria 609
492 Ga0209281_1032441 3300027111 Bacteria 924
493 Ga0209389_1000305 3300027296 Bacteria 30534
494 Ga0209371_1008392 3300027312 Bacteria 3443
495 Ga0209968_1104408 3300027526 Bacteria 517
496 Ga0209282_1003491 3300027666 Bacteria 9346
497 Ga0209813_10387718 3300027866 Bacteria 560
498 Ga0209974_10099950 3300027876 Bacteria 1013
499 Ga0207428_10007467 3300027907 Bacteria 9965
500 Ga0268266_10012447 3300028379 Bacteria 7353
501 Ga0268266_10179478 3300028379 Bacteria 1927
502 Ga0268266_10435073 3300028379 Bacteria 1245
503 Ga0268266_10866667 3300028379 Bacteria 873
504 Ga0268265_10011028 3300028380 Bacteria 6104
505 Ga0268264_10324135 3300028381 Bacteria 1458
506 Ga0268264_10757267 3300028381 Bacteria 968
507 Ga0307515_10012540 3300028794 Bacteria 15942
508 Ga0268256_1008739 3300030500 Bacteria 3443
509 Ga0307511_10000653 3300030521 Bacteria 37038
510 Ga0307408_100037446 3300031548 Bacteria 3417
511 Ga0307408_100076942 3300031548 Bacteria 2483
512 Ga0307408_100308376 3300031548 Bacteria 1329
513 Ga0307408_100636016 3300031548 Bacteria 952
514 Ga0307408_100695165 3300031548 Bacteria 913
515 Ga0307408_101826722 3300031548 Bacteria 581
516 Ga0307405_10647771 3300031731 Bacteria 868
517 Ga0307405_10810808 3300031731 Bacteria 785
518 Ga0307413_10797045 3300031824 Bacteria 793
519 Ga0307413_11014028 3300031824 Bacteria 712
520 Ga0307413_11548899 3300031824 Bacteria 587
521 Ga0307410_10045976 3300031852 Bacteria 2910
522 Ga0307410_10516749 3300031852 Bacteria 985
523 Ga0307410_10889677 3300031852 Bacteria 762
524 Ga0307410_11540672 3300031852 Bacteria 586
525 Ga0307406_10992452 3300031901 Bacteria 720
526 Ga0307406_11483506 3300031901 Bacteria 596
527 Ga0307412_10062339 3300031911 Bacteria 2510
528 Ga0307412_10227496 3300031911 Bacteria 1434
529 Ga0307412_10528078 3300031911 Bacteria 987
530 Ga0307412_10588460 3300031911 Bacteria 940
531 Ga0307412_11247265 3300031911 Bacteria 667
532 Ga0307412_11256247 3300031911 Bacteria 665
533 Ga0307412_11740242 3300031911 Bacteria 572
534 Ga0307412_12026988 3300031911 Bacteria 533
535 Ga0307409_100530074 3300031995 Bacteria 1152
536 Ga0307409_101717297 3300031995 Bacteria 656
537 Ga0307416_100099454 3300032002 Bacteria 2526
538 Ga0307416_100235039 3300032002 Bacteria 1770
539 Ga0307416_100567651 3300032002 Bacteria 1210
540 Ga0307416_101082964 3300032002 Bacteria 906
541 Ga0307416_101457356 3300032002 Bacteria 790
542 Ga0307416_101943001 3300032002 Bacteria 691
543 Ga0307416_102238659 3300032002 Bacteria 647
544 Ga0307416_102769408 3300032002 Bacteria 586
545 Ga0307416_103306580 3300032002 Bacteria 539
546 Ga0307414_11263315 3300032004 Bacteria 684
547 Ga0307414_12021100 3300032004 Bacteria 538
548 Ga0307411_10899431 3300032005 Bacteria 786
549 Ga0307411_10958456 3300032005 Bacteria 763
550 Ga0307411_11333878 3300032005 Bacteria 655
551 Ga0307411_11460992 3300032005 Bacteria 627
552 Ga0307415_100320022 3300032126 Bacteria 1293
553 Ga0316593_10015257 3300032168 Bacteria 2308
554 Ga0373930_0072518 3300034816 Bacteria 785
555 Ga0373958_0003362 3300034819 Bacteria 2301
556 Ga0373938_0165006 3300034957 Bacteria 597
557 Ga0373929_0047864 3300035085 Bacteria 970
558 Ga0373951_0065264 3300035091 Bacteria 918
559 Ga0373952_0027225 3300035092 Bacteria 1247
560 Ga0373923_0081400 3300035111 Bacteria 1405
561 Ga0373941_0406996 3300035115 Bacteria 564
562 Ga0373956_0174331 3300035119 Bacteria 1015
563 Ga0373943_0175221 3300035170 Bacteria 1176
564 Ga0373946_0253663 3300035171 Bacteria 859
565 Ga0373955_0063660 3300035172 Bacteria 2042
566 Ga0373961_0192614 3300035241 Bacteria 716
567 Ga0373924_0082696 3300035410 Bacteria 1367
568 Ga0373924_0136652 3300035410 Bacteria 1068
569 Ga0373924_0278321 3300035410 Bacteria 742
570 Ga0373931_0020764 3300035691 Bacteria 3289
571 Ga0373931_0048480 3300035691 Bacteria 2252
572 Ga0373931_0064668 3300035691 Bacteria 1980
573 Ga0373935_1004287 3300035692 Bacteria 620
574 Ga0373927_0135268 3300035695 Bacteria 1611
575 Ga0373933_0650630 3300035724 Bacteria 693
576 Ga0373947_0154304 3300035725 Bacteria 1481
577 Ga0373947_0806441 3300035725 Bacteria 641
578 Ga0373937_0093062 3300036401 Bacteria 2794
579 Ga0373937_0210934 3300036401 Bacteria 1827
580 Ga0373937_0544753 3300036401 Bacteria 1102
581 Ga0373925_0008267 3300037068 Bacteria 7573
582 Ga0373925_0154357 3300037068 Bacteria 1805
583 Ga0373925_0798447 3300037068 Bacteria 778
584 Ga0373925_1308311 3300037068 Bacteria 595
585 Ga0395899_0135248 3300037312 Bacteria 1757
586 Ga0395900_0034072 3300037418 Bacteria 5242
587 Ga0395898_0254758 3300037466 Bacteria 1674
588 Ga0395905_0032891 3300037471 Bacteria 4875
589 Ga0395905_0048048 3300037471 Bacteria 3999
590 Ga0395905_1024976 3300037471 Bacteria 728
591 Ga0395901_0033769 3300038443 Bacteria 5283
592 Ga0436365_0531964 3300039437 Bacteria 3865
593 Ga0436365_0661840 3300039437 Bacteria 861
594 Ga0436361_0714431 3300039447 Bacteria 79592
595 Ga0436361_0815871 3300039447 Bacteria 532
596 Ga0436361_0818040 3300039447 Bacteria 529
597 Ga0436361_1155176 3300039447 Bacteria 13767
598 Ga0439461_0013318 3300041410 Bacteria 1551
599 Ga0451807_1460479 3300041486 Bacteria 2981
600 Ga0451807_2053462 3300041486 Bacteria 664
601 Ga0451839_0745541 3300041496 Bacteria 670
602 Ga0451855_0951061 3300041511 Bacteria 1307
603 Ga0439431_0076616 3300041997 Bacteria 897
604 Ga0439437_016373 3300042000 Bacteria 875
605 Ga0439437_017209 3300042000 Bacteria 858
606 Ga0439441_006145 3300042001 Bacteria 1894
607 Ga0439441_148165 3300042001 Bacteria 552
608 Ga0439442_006578 3300042002 Bacteria 2335
609 Ga0439445_0021993 3300042004 Bacteria 1605
610 Ga0439455_0101248 3300042012 Bacteria 796
611 Ga0450911_022275 3300042115 Bacteria 825
612 Ga0450919_000930 3300042121 Bacteria 3783
613 Ga0450920_013556 3300042122 Bacteria 1537
614 Ga0450922_014034 3300042124 Bacteria 787
615 Ga0450923_005700 3300042125 Bacteria 2027
616 Ga0450890_000550 3300042127 Bacteria 5489
617 Ga0450897_021614 3300042128 Bacteria 693
618 Ga0450895_001799 3300042132 Bacteria 1535
619 Ga0450896_005520 3300042133 Bacteria 1724
620 Ga0450898_006294 3300042134 Bacteria 1817
621 Ga0450898_052615 3300042134 Bacteria 789
622 Ga0450905_045023 3300042142 Bacteria 709
623 Ga0450906_005991 3300042145 Bacteria 2474
624 Ga0450910_006865 3300042147 Bacteria 1577
625 Ga0439446_0101355 3300042156 Bacteria 911
626 Ga0439446_0340317 3300042156 Bacteria 533
627 Ga0450908_002334 3300042184 Bacteria 3716
628 Ga0450909_005658 3300042185 Bacteria 1799
629 Ga0439434_0016124 3300042435 Bacteria 2231
630 Ga0439444_0023086 3300042437 Bacteria 1114
631 Ga0439459_0000309 3300042438 Bacteria 5891
632 Ga0450918_000550 3300042531 Bacteria 8018
633 Ga0451577_0312572 3300042876 Bacteria 1424
634 Ga0451577_0422547 3300042876 Bacteria 1210
635 Ga0466969_0002653 3300044656 Bacteria 9554
636 Ga0466969_0012551 3300044656 Bacteria 4465
637 Ga0466965_0018301 3300044683 Bacteria 3357
638 Ga0466966_0021693 3300044684 Bacteria 4215
639 Ga0466966_0050829 3300044684 Bacteria 2636
640 Ga0466966_0179930 3300044684 Bacteria 1283
641 Ga0466961_0026432 3300044693 Bacteria 3731
642 Ga0466961_0117869 3300044693 Bacteria 1668
643 Ga0466963_0003881 3300044694 Bacteria 8635
644 Ga0466963_0028896 3300044694 Bacteria 3564
645 Ga0466963_0941886 3300044694 Bacteria 608
646 Ga0466963_1136920 3300044694 Bacteria 549
647 Ga0466964_0003200 3300044706 Bacteria 5954
648 Ga0453684_0040166 3300044712 Bacteria 6361
649 Ga0453684_0812939 3300044712 Bacteria 1007
650 Ga0466971_0001482 3300044719 Bacteria 9910
651 Ga0466971_0112608 3300044719 Bacteria 1256
652 Ga0466968_0007045 3300044735 Bacteria 4261
653 Ga0466970_0025081 3300044765 Bacteria 3120
654 Ga0466970_0728805 3300044765 Bacteria 579
655 Ga0466957_0004472 3300044842 Bacteria 7796
656 Ga0466957_0006128 3300044842 Bacteria 6786
657 Ga0466959_0000855 3300045049 Bacteria 17985
658 Ga0466959_0194087 3300045049 Bacteria 1416
659 Ga0451576_0076007 3300045051 Bacteria 3495
660 Ga0451576_1155668 3300045051 Bacteria 809
661 Ga0451576_1697712 3300045051 Bacteria 654
662 Ga0451576_1748150 3300045051 Bacteria 643
663 Ga0466958_0022101 3300045836 Bacteria 3722
664 Ga0466958_0062229 3300045836 Bacteria 2275
665 Ga0466967_0003037 3300045976 Bacteria 10770
666 Ga0466967_1482090 3300045976 Bacteria 676
667 Ga0495592_0002591 3300046454 Bacteria 12773
668 Ga0495603_0211915 3300046455 Bacteria 1119
669 Ga0495638_0050878 3300046460 Bacteria 2587
670 Ga0495639_0328506 3300046475 Bacteria 765
671 Ga0495662_0510431 3300046476 Bacteria 589
672 Ga0495608_0037016 3300046511 Bacteria 3282
673 Ga0495618_0376514 3300046514 Bacteria 872
674 Ga0495628_0200181 3300046516 Bacteria 1505
675 Ga0495643_0220705 3300046522 Bacteria 899
676 Ga0495652_0016132 3300046529 Bacteria 6682
677 Ga0495587_0038829 3300046536 Bacteria 2852
678 Ga0495598_0009707 3300046537 Bacteria 2284
679 Ga0495598_0089281 3300046537 Bacteria 1002
680 Ga0495598_0136697 3300046537 Bacteria 845
681 Ga0495621_0003232 3300046539 Bacteria 4478
682 Ga0495621_0155953 3300046539 Bacteria 900
683 Ga0495621_0236939 3300046539 Bacteria 742
684 Ga0495621_0381284 3300046539 Bacteria 595
685 Ga0495645_0004671 3300046543 Bacteria 9348
686 Ga0495633_0491254 3300046558 Bacteria 554
687 Ga0495667_0029984 3300046559 Bacteria 3657
688 Ga0495625_0093900 3300046660 Bacteria 2070
689 Ga0495635_0032495 3300046663 Bacteria 3620
690 Ga0495635_0593245 3300046663 Bacteria 724
691 Ga0495657_0043896 3300046675 Bacteria 3045
692 Ga0495599_0215073 3300046678 Bacteria 1177
693 Ga0495623_0049231 3300046679 Bacteria 2671
694 Ga0495658_0058804 3300046683 Bacteria 2200
695 Ga0495658_0079564 3300046683 Bacteria 1921
696 Ga0495670_0131790 3300046691 Bacteria 1303
697 Ga0495649_0384555 3300046694 Bacteria 706
698 Ga0495600_0104793 3300046809 Bacteria 1843
699 Ga0495604_0346861 3300047317 Bacteria 987
700 Ga0495636_0275904 3300047318 Bacteria 782
701 Ga0495615_0055884 3300048090 Bacteria 1029
702 Ga0496104_0792125 3300048907 Bacteria 854
703 Ga0496105_0090136 3300048908 Bacteria 2533
704 Ga0496108_0254139 3300048911 Bacteria 1529
705 Ga0496109_0068230 3300048912 Bacteria 3260
706 Ga0496110_0101200 3300048913 Bacteria 2583
707 Ga0496111_0175822 3300048914 Bacteria 1591
708 Ga0496111_0639507 3300048914 Bacteria 777
709 Ga0496122_0000317 3300048925 Bacteria 105883
710 Ga0496122_0329178 3300048925 Bacteria 808
711 Ga0496123_0000264 3300048926 Bacteria 105015
712 Ga0496123_0301364 3300048926 Bacteria 765
713 Ga0496124_0018476 3300048927 Bacteria 6527
714 Ga0496124_0030272 3300048927 Bacteria 4807
715 Ga0501308_000356 3300049128 Bacteria 2885
716 Ga0501308_007699 3300049128 Bacteria 1135
717 Ga0501308_049830 3300049128 Bacteria 610
718 Ga0501309_044535 3300049129 Bacteria 685
719 Ga0501310_013780 3300049130 Bacteria 942
720 Ga0501304_004382 3300049160 Bacteria 1070
721 Ga0501304_014799 3300049160 Bacteria 725
722 Ga0501305_018600 3300049161 Bacteria 1007
723 Ga0501307_012886 3300049162 Bacteria 1002
724 Ga0501307_045179 3300049162 Bacteria 649
725 Ga0501307_054245 3300049162 Bacteria 609
726 Ga0495678_186719 3300049459 Bacteria 647
727 Ga0501299_069992 3300049522 Bacteria 760
728 Ga0501311_024495 3300049527 Bacteria 841
729 Ga0501311_045641 3300049527 Bacteria 675
730 Ga0501312_055610 3300049528 Bacteria 676
731 Ga0501312_090828 3300049528 Bacteria 563
732 Ga0501313_043838 3300049529 Bacteria 606
733 Ga0501314_001810 3300049530 Bacteria 1590
734 Ga0501314_012643 3300049530 Bacteria 811
735 Ga0501314_014200 3300049530 Bacteria 779
736 Ga0501315_005277 3300049531 Bacteria 1393
737 Ga0501316_013333 3300049532 Bacteria 971
738 Ga0501316_054783 3300049532 Bacteria 580
739 Ga0501319_013452 3300049535 Bacteria 679
740 Ga0501319_015308 3300049535 Bacteria 650
741 Ga0501320_000194 3300049536 Bacteria 3114
742 Ga0501320_005049 3300049536 Bacteria 1188
743 Ga0501320_060264 3300049536 Bacteria 533
744 Ga0501322_020921 3300049538 Bacteria 574
745 Ga0501323_011310 3300049539 Bacteria 1076
746 Ga0501031_0010546 3300049568 Bacteria 6015
747 Ga0501034_0193193 3300049571 Bacteria 1997
748 Ga0501039_1063416 3300049575 Bacteria 628
749 Ga0501047_0040997 3300049581 Bacteria 4475
750 Ga0501047_0122861 3300049581 Bacteria 2477
751 Ga0501047_0930428 3300049581 Bacteria 682
752 Ga0501069_0001064 3300049585 Bacteria 13167
753 Ga0501070_0001356 3300049586 Bacteria 21938
754 Ga0501070_0138143 3300049586 Bacteria 2012
755 Ga0501073_0000321 3300049589 Bacteria 32033
756 Ga0501073_0464001 3300049589 Bacteria 875
757 Ga0501074_0000097 3300049590 Bacteria 42311
758 Ga0501249_010598 3300049679 Bacteria 1930
759 Ga0501257_046461 3300049686 Bacteria 1076
760 Ga0501079_0009081 3300049741 Bacteria 7529
761 Ga0501080_0011166 3300049742 Bacteria 8223
762 Ga0501080_0200887 3300049742 Bacteria 1830
763 Ga0501080_0415215 3300049742 Bacteria 1209
764 Ga0501083_0004051 3300049744 Bacteria 10308
765 Ga0501262_000495 3300049759 Bacteria 4689
766 Ga0501035_0286694 3300049822 Bacteria 1390
767 Ga0501044_0083251 3300049823 Bacteria 3236
768 nmdc:mga03683_40367_c1 3300050489 Bacteria 1914
769 nmdc:mga03683_494499_c1 3300050489 Bacteria 592
770 nmdc:mga03683_89229_c1 3300050489 Bacteria 1342
771 nmdc:mga03n38_185825_c1 3300050490 Bacteria 1068
772 nmdc:mga03n38_602745_c1 3300050490 Bacteria 626
773 nmdc:mga03n38_703938_c1 3300050490 Bacteria 582
774 nmdc:mga00v17_209926_c1 3300050491 Bacteria 1260
775 nmdc:mga00v17_250937_c1 3300050491 Bacteria 1147
776 nmdc:mga00v17_5329_c1 3300050491 Bacteria 6775
777 nmdc:mga00v17_872918_c1 3300050491 Bacteria 571
778 nmdc:mga0yw44_115307_c1 3300050492 Bacteria 1725
779 nmdc:mga0yw44_60430_c1 3300050492 Bacteria 2322
780 nmdc:mga0k408_109049_c1 3300050493 Bacteria 1636
781 nmdc:mga0k408_13809_c1 3300050493 Bacteria 4436
782 nmdc:mga0k408_15566_c1 3300050493 Bacteria 4206
783 nmdc:mga0k408_1928_c1 3300050493 Bacteria 11118
784 nmdc:mga0k408_33698_c1 3300050493 Bacteria 2694
785 nmdc:mga0k408_4084_c1 3300050493 Bacteria 7751
786 nmdc:mga0k408_8663_c1 3300050493 Bacteria 5469
787 nmdc:mga06z11_157963_c1 3300050494 Bacteria 1294
788 nmdc:mga06z11_31132_c1 3300050494 Bacteria 2589
789 nmdc:mga06z11_99456_c1 3300050494 Bacteria 1593
790 nmdc:mga04h51_424623_c1 3300050495 Bacteria 559
791 nmdc:mga07m45_169196_c1 3300050496 Bacteria 1270
792 nmdc:mga07m45_2931_c1 3300050496 Bacteria 8100
793 nmdc:mga07m45_419845_c1 3300050496 Bacteria 776
794 nmdc:mga07m45_6617_c5 3300050496 Bacteria 872
795 nmdc:mga07m45_705162_c1 3300050496 Bacteria 580
796 nmdc:mga07m45_93439_c1 3300050496 Bacteria 1724
797 nmdc:mga09592_472609_c1 3300050508 Bacteria 1081
798 nmdc:mga08y16_11064_c1 3300050511 Bacteria 9474
799 nmdc:mga0n895_1150352_c1 3300050512 Bacteria 752
800 nmdc:mga0n895_286717_c1 3300050512 Bacteria 1669
801 nmdc:mga0n895_617741_c1 3300050512 Bacteria 1085
802 nmdc:mga0rr50_1608784_c1 3300050513 Bacteria 548
803 nmdc:mga0rr50_383077_c1 3300050513 Bacteria 1186
804 nmdc:mga0rr50_416377_c1 3300050513 Bacteria 1136
805 nmdc:mga0a205_116902_c1 3300050515 Bacteria 2565
806 nmdc:mga0sz30_1133_c1 3300050516 Bacteria 9551
807 nmdc:mga0sz30_225369_c1 3300050516 Bacteria 833
808 nmdc:mga0sz30_39330_c1 3300050516 Bacteria 1984
809 Ga0495595_0071547 3300053084 Bacteria 1640
810 Ga0495619_0055676 3300053085 Bacteria 2620
811 Ga0500646_0009238 3300053090 Bacteria 2523
812 Ga0500583_0484867 3300053092 Bacteria 582
813 Ga0500641_0008546 3300053096 Bacteria 3658
814 Ga0500555_046254 3300053103 Bacteria 1200
815 Ga0500621_121572 3300053126 Bacteria 1010
816 Ga0500655_002279 3300053133 Bacteria 3523
817 Ga0500568_0111278 3300053139 Bacteria 1023
818 Ga0500604_0000352 3300053151 Bacteria 12731
819 Ga0500616_0326729 3300053153 Bacteria 630
820 Ga0500622_0001316 3300053156 Bacteria 20204
821 Ga0500645_018988 3300053730 Bacteria 2142
822 Ga0501084_0021259 3300054114 Bacteria 5410
823 Ga0590071_001831 3300059421 Bacteria 5489
824 Ga0590075_178135 3300059424 Bacteria 562
825 Ga0590077_097116 3300059426 Bacteria 687
826 Ga0587106_091383 3300059605 Bacteria 608
827 Ga0466962_0014522 3300061719 Bacteria 3795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10677367 Ga0163162_106773673 95
2 3300049128 Ga0501308_049830 Ga0501308_049830_275_571 96
3 3300031911 Ga0307412_11740242 Ga0307412_117402421 103
4 3300042012 Ga0439455_0101248 Ga0439455_0101248_159_521 103
5 3300042128 Ga0450897_021614 Ga0450897_021614_145_507 103
6 3300042132 Ga0450895_001799 Ga0450895_001799_108_470 103
7 3300044735 Ga0466968_0007045 Ga0466968_0007045_3211_3576 104
8 3300049822 Ga0501035_0286694 Ga0501035_0286694_410_775 104
9 3300003575 Ga0007409J51694_1026312 Ga0007409J51694_10263122 105
10 3300032005 Ga0307411_10899431 Ga0307411_108994312 105
11 3300032168 Ga0316593_10015257 Ga0316593_100152574 105
12 3300049530 Ga0501314_012643 Ga0501314_012643_22_387 105
13 3300059424 Ga0590075_178135 Ga0590075_178135_33_386 105
14 3300005328 Ga0070676_10429620 Ga0070676_104296202 106
15 3300005333 Ga0070677_10423163 Ga0070677_104231632 106
16 3300005353 Ga0070669_100077546 Ga0070669_1000775463 106
17 3300005354 Ga0070675_100537435 Ga0070675_1005374352 106
18 3300005355 Ga0070671_100151546 Ga0070671_1001515462 106
19 3300005356 Ga0070674_100831331 Ga0070674_1008313312 106
20 3300005364 Ga0070673_100055764 Ga0070673_1000557644 106
21 3300005367 Ga0070667_100337290 Ga0070667_1003372903 106
22 3300005456 Ga0070678_100195478 Ga0070678_1001954782 106
23 3300005457 Ga0070662_100060375 Ga0070662_1000603753 106
24 3300005578 Ga0068854_101411187 Ga0068854_1014111871 106
25 3300009148 Ga0105243_10847435 Ga0105243_108474352 106
26 3300013306 Ga0163162_10913966 Ga0163162_109139661 106
27 3300025893 Ga0207682_10136512 Ga0207682_101365122 106
28 3300025901 Ga0207688_10904359 Ga0207688_109043591 106
29 3300025923 Ga0207681_10139757 Ga0207681_101397573 106
30 3300025926 Ga0207659_10338491 Ga0207659_103384913 106
31 3300025931 Ga0207644_10246131 Ga0207644_102461312 106
32 3300025933 Ga0207706_10254171 Ga0207706_102541712 106
33 3300025937 Ga0207669_10149676 Ga0207669_101496762 106
34 3300025960 Ga0207651_10059456 Ga0207651_100594564 106
35 3300025972 Ga0207668_10283658 Ga0207668_102836582 106
36 3300025981 Ga0207640_10644569 Ga0207640_106445692 106
37 3300025986 Ga0207658_10165595 Ga0207658_101655954 106
38 3300026121 Ga0207683_10119357 Ga0207683_101193572 106
39 3300046539 Ga0495621_0155953 Ga0495621_0155953_256_621 106
40 3300049528 Ga0501312_090828 Ga0501312_090828_163_528 106
41 3300049568 Ga0501031_0010546 Ga0501031_0010546_1167_1532 106
42 3300003790 Ga0055528_1017593 Ga0055528_10175933 108
43 3300005328 Ga0070676_10261202 Ga0070676_102612022 108
44 3300005331 Ga0070670_100218635 Ga0070670_1002186354 108
45 3300005333 Ga0070677_10509202 Ga0070677_105092021 108
46 3300005334 Ga0068869_100132145 Ga0068869_1001321452 108
47 3300005353 Ga0070669_100034565 Ga0070669_1000345653 108
48 3300005354 Ga0070675_101864937 Ga0070675_1018649372 108
49 3300005459 Ga0068867_100152150 Ga0068867_1001521503 108
50 3300005843 Ga0068860_100446321 Ga0068860_1004463213 108
51 3300006038 Ga0075365_10090325 Ga0075365_100903255 108
52 3300006058 Ga0075432_10016379 Ga0075432_100163795 108
53 3300006177 Ga0075362_10119745 Ga0075362_101197452 108
54 3300006178 Ga0075367_10471900 Ga0075367_104719002 108
55 3300006195 Ga0075366_10886917 Ga0075366_108869172 108
56 3300006353 Ga0075370_10938323 Ga0075370_109383232 108
57 3300006946 Ga0079104_1015591 Ga0079104_10155914 108
58 3300011119 Ga0105246_10880654 Ga0105246_108806542 108
59 3300017792 Ga0163161_11777879 Ga0163161_117778792 108
60 3300025291 Ga0209675_1000220 Ga0209675_100022060 108
61 3300025901 Ga0207688_10586131 Ga0207688_105861312 108
62 3300025907 Ga0207645_10149288 Ga0207645_101492884 108
63 3300025923 Ga0207681_10032331 Ga0207681_100323313 108
64 3300025925 Ga0207650_10281702 Ga0207650_102817022 108
65 3300025931 Ga0207644_10772513 Ga0207644_107725132 108
66 3300025942 Ga0207689_10203269 Ga0207689_102032692 108
67 3300027111 Ga0209281_1032441 Ga0209281_10324412 108
68 3300027666 Ga0209282_1003491 Ga0209282_10034918 108
69 3300028381 Ga0268264_10324135 Ga0268264_103241352 108
70 3300031548 Ga0307408_100076942 Ga0307408_1000769422 108
71 3300031824 Ga0307413_10797045 Ga0307413_107970452 108
72 3300031852 Ga0307410_10045976 Ga0307410_100459765 108
73 3300031995 Ga0307409_101717297 Ga0307409_1017172972 108
74 3300032002 Ga0307416_103306580 Ga0307416_1033065801 108
75 3300032004 Ga0307414_11263315 Ga0307414_112633152 108
76 3300032005 Ga0307411_10958456 Ga0307411_109584562 108
77 3300041410 Ga0439461_0013318 Ga0439461_0013318_984_1352 108
78 3300041511 Ga0451855_0951061 Ga0451855_0951061_848_1216 108
79 3300041997 Ga0439431_0076616 Ga0439431_0076616_298_666 108
80 3300042002 Ga0439442_006578 Ga0439442_006578_645_1013 108
81 3300042004 Ga0439445_0021993 Ga0439445_0021993_518_886 108
82 3300042115 Ga0450911_022275 Ga0450911_022275_194_562 108
83 3300042121 Ga0450919_000930 Ga0450919_000930_736_1104 108
84 3300042122 Ga0450920_013556 Ga0450920_013556_64_432 108
85 3300042124 Ga0450922_014034 Ga0450922_014034_355_723 108
86 3300042125 Ga0450923_005700 Ga0450923_005700_769_1137 108
87 3300042133 Ga0450896_005520 Ga0450896_005520_1278_1646 108
88 3300042134 Ga0450898_052615 Ga0450898_052615_152_520 108
89 3300042145 Ga0450906_005991 Ga0450906_005991_1873_2241 108
90 3300042147 Ga0450910_006865 Ga0450910_006865_439_807 108
91 3300042184 Ga0450908_002334 Ga0450908_002334_212_580 108
92 3300042185 Ga0450909_005658 Ga0450909_005658_984_1352 108
93 3300042435 Ga0439434_0016124 Ga0439434_0016124_852_1220 108
94 3300042531 Ga0450918_000550 Ga0450918_000550_1326_1694 108
95 3300046660 Ga0495625_0093900 Ga0495625_0093900_689_1057 108
96 3300048925 Ga0496122_0000317 Ga0496122_0000317_10817_11185 108
97 3300048926 Ga0496123_0000264 Ga0496123_0000264_59952_60320 108
98 3300048927 Ga0496124_0018476 Ga0496124_0018476_1015_1383 108
99 3300049162 Ga0501307_054245 Ga0501307_054245_171_539 108
100 3300049459 Ga0495678_186719 Ga0495678_186719_172_540 108
101 3300049528 Ga0501312_055610 Ga0501312_055610_33_401 108
102 3300049530 Ga0501314_001810 Ga0501314_001810_908_1276 108
103 3300049535 Ga0501319_013452 Ga0501319_013452_125_493 108
104 3300049536 Ga0501320_000194 Ga0501320_000194_403_771 108
105 3300049538 Ga0501322_020921 Ga0501322_020921_109_477 108
106 3300049539 Ga0501323_011310 Ga0501323_011310_135_503 108
107 3300049679 Ga0501249_010598 Ga0501249_010598_249_617 108
108 3300049686 Ga0501257_046461 Ga0501257_046461_565_933 108
109 3300049759 Ga0501262_000495 Ga0501262_000495_1358_1726 108
110 3300050490 nmdc:mga03n38_185825_c1 nmdc:mga03n38_185825_c1_213_581 108
111 3300050491 nmdc:mga00v17_872918_c1 nmdc:mga00v17_872918_c1_129_497 108
112 3300050492 nmdc:mga0yw44_60430_c1 nmdc:mga0yw44_60430_c1_589_957 108
113 3300050493 nmdc:mga0k408_33698_c1 nmdc:mga0k408_33698_c1_1922_2290 108
114 3300032002 Ga0307416_100099454 Ga0307416_1000994545 109
115 3300049129 Ga0501309_044535 Ga0501309_044535_239_592 109
116 3300049529 Ga0501313_043838 Ga0501313_043838_152_517 109
117 3300003574 Ga0007410J51695_1037205 Ga0007410J51695_10372052 110
118 3300005548 Ga0070665_100047667 Ga0070665_1000476675 111
119 3300025937 Ga0207669_11220207 Ga0207669_112202072 111
120 3300042876 Ga0451577_0312572 Ga0451577_0312572_400_774 111
121 3300045051 Ga0451576_0076007 Ga0451576_0076007_1990_2364 111
122 3300046522 Ga0495643_0220705 Ga0495643_0220705_456_824 111
123 3300005331 Ga0070670_100936042 Ga0070670_1009360422 113
124 3300005334 Ga0068869_100190433 Ga0068869_1001904333 113
125 3300005338 Ga0068868_100125596 Ga0068868_1001255962 113
126 3300005340 Ga0070689_100018801 Ga0070689_1000188015 113
127 3300005353 Ga0070669_100102253 Ga0070669_1001022533 113
128 3300005354 Ga0070675_100031032 Ga0070675_1000310324 113
129 3300005364 Ga0070673_100025135 Ga0070673_1000251354 113
130 3300005365 Ga0070688_100087995 Ga0070688_1000879953 113
131 3300005438 Ga0070701_10203377 Ga0070701_102033772 113
132 3300005456 Ga0070678_101883788 Ga0070678_1018837881 113
133 3300005457 Ga0070662_100347907 Ga0070662_1003479072 113
134 3300005466 Ga0070685_10316092 Ga0070685_103160922 113
135 3300005535 Ga0070684_100280787 Ga0070684_1002807873 113
136 3300005564 Ga0070664_100311472 Ga0070664_1003114722 113
137 3300005577 Ga0068857_100012217 Ga0068857_10001221712 113
138 3300005617 Ga0068859_100076061 Ga0068859_1000760615 113
139 3300005840 Ga0068870_10034507 Ga0068870_100345075 113
140 3300006931 Ga0097620_100076060 Ga0097620_1000760603 113
141 3300009098 Ga0105245_10760192 Ga0105245_107601922 113
142 3300013308 Ga0157375_11353360 Ga0157375_113533602 113
143 3300014326 Ga0157380_10911343 Ga0157380_109113432 113
144 3300014745 Ga0157377_11269105 Ga0157377_112691051 113
145 3300025315 Ga0207697_10168345 Ga0207697_101683452 113
146 3300025321 Ga0207656_10067697 Ga0207656_100676973 113
147 3300025901 Ga0207688_10034103 Ga0207688_100341033 113
148 3300025925 Ga0207650_10435230 Ga0207650_104352302 113
149 3300025926 Ga0207659_10001704 Ga0207659_1000170418 113
150 3300025936 Ga0207670_10055644 Ga0207670_100556445 113
151 3300025937 Ga0207669_10030057 Ga0207669_100300573 113
152 3300025940 Ga0207691_10008862 Ga0207691_1000886211 113
153 3300025942 Ga0207689_10206961 Ga0207689_102069612 113
154 3300025945 Ga0207679_10219061 Ga0207679_102190613 113
155 3300025960 Ga0207651_10036504 Ga0207651_100365043 113
156 3300026023 Ga0207677_11183150 Ga0207677_111831502 113
157 3300026095 Ga0207676_10208510 Ga0207676_102085102 113
158 3300026116 Ga0207674_10022377 Ga0207674_1002237714 113
159 3300026142 Ga0207698_11904398 Ga0207698_119043982 113
160 3300041486 Ga0451807_1460479 Ga0451807_1460479_832_1179 113
161 3300005459 Ga0068867_101795877 Ga0068867_1017958772 114
162 3300030521 Ga0307511_10000653 Ga0307511_1000065319 114
163 3300050516 nmdc:mga0sz30_39330_c1 nmdc:mga0sz30_39330_c1_407_757 114
164 3300053090 Ga0500646_0009238 Ga0500646_0009238_1866_2216 114
165 3300053092 Ga0500583_0484867 Ga0500583_0484867_49_399 114
166 3300053103 Ga0500555_046254 Ga0500555_046254_319_669 114
167 3300053126 Ga0500621_121572 Ga0500621_121572_259_609 114
168 3300053133 Ga0500655_002279 Ga0500655_002279_1324_1674 114
169 3300053139 Ga0500568_0111278 Ga0500568_0111278_460_810 114
170 3300053151 Ga0500604_0000352 Ga0500604_0000352_3814_4164 114
171 3300053153 Ga0500616_0326729 Ga0500616_0326729_210_560 114
172 3300053730 Ga0500645_018988 Ga0500645_018988_278_628 114
173 3300005327 Ga0070658_10030833 Ga0070658_100308337 115
174 3300005327 Ga0070658_10061874 Ga0070658_100618746 115
175 3300005327 Ga0070658_10602014 Ga0070658_106020142 115
176 3300005327 Ga0070658_11996890 Ga0070658_119968901 115
177 3300005328 Ga0070676_10050474 Ga0070676_100504745 115
178 3300005329 Ga0070683_100113047 Ga0070683_1001130475 115
179 3300005330 Ga0070690_100313214 Ga0070690_1003132142 115
180 3300005330 Ga0070690_100391229 Ga0070690_1003912292 115
181 3300005331 Ga0070670_100541995 Ga0070670_1005419952 115
182 3300005334 Ga0068869_100401391 Ga0068869_1004013912 115
183 3300005335 Ga0070666_10540965 Ga0070666_105409652 115
184 3300005338 Ga0068868_100074093 Ga0068868_1000740932 115
185 3300005338 Ga0068868_101196314 Ga0068868_1011963142 115
186 3300005338 Ga0068868_101887430 Ga0068868_1018874301 115
187 3300005339 Ga0070660_100818220 Ga0070660_1008182202 115
188 3300005340 Ga0070689_100327138 Ga0070689_1003271382 115
189 3300005340 Ga0070689_100436204 Ga0070689_1004362042 115
190 3300005340 Ga0070689_100588585 Ga0070689_1005885852 115
191 3300005343 Ga0070687_100603249 Ga0070687_1006032492 115
192 3300005344 Ga0070661_100167366 Ga0070661_1001673661 115
193 3300005344 Ga0070661_100606013 Ga0070661_1006060132 115
194 3300005344 Ga0070661_100743290 Ga0070661_1007432901 115
195 3300005353 Ga0070669_100547050 Ga0070669_1005470501 115
196 3300005354 Ga0070675_100441805 Ga0070675_1004418052 115
197 3300005354 Ga0070675_102227621 Ga0070675_1022276211 115
198 3300005355 Ga0070671_101400409 Ga0070671_1014004091 115
199 3300005355 Ga0070671_101549905 Ga0070671_1015499051 115
200 3300005356 Ga0070674_100858675 Ga0070674_1008586752 115
201 3300005356 Ga0070674_100938789 Ga0070674_1009387892 115
202 3300005364 Ga0070673_100383392 Ga0070673_1003833922 115
203 3300005364 Ga0070673_100532134 Ga0070673_1005321342 115
204 3300005365 Ga0070688_100234898 Ga0070688_1002348982 115
205 3300005366 Ga0070659_100546172 Ga0070659_1005461722 115
206 3300005366 Ga0070659_101108230 Ga0070659_1011082301 115
207 3300005366 Ga0070659_101886689 Ga0070659_1018866891 115
208 3300005367 Ga0070667_101929922 Ga0070667_1019299222 115
209 3300005434 Ga0070709_11263927 Ga0070709_112639271 115
210 3300005435 Ga0070714_100651652 Ga0070714_1006516522 115
211 3300005435 Ga0070714_101521837 Ga0070714_1015218372 115
212 3300005438 Ga0070701_10056180 Ga0070701_100561803 115
213 3300005438 Ga0070701_10971730 Ga0070701_109717301 115
214 3300005438 Ga0070701_11157601 Ga0070701_111576011 115
215 3300005441 Ga0070700_101053485 Ga0070700_1010534851 115
216 3300005444 Ga0070694_101000994 Ga0070694_1010009942 115
217 3300005445 Ga0070708_100348288 Ga0070708_1003482883 115
218 3300005456 Ga0070678_100625441 Ga0070678_1006254412 115
219 3300005457 Ga0070662_100740980 Ga0070662_1007409801 115
220 3300005457 Ga0070662_100960223 Ga0070662_1009602232 115
221 3300005459 Ga0068867_100036184 Ga0068867_1000361845 115
222 3300005459 Ga0068867_100128512 Ga0068867_1001285122 115
223 3300005459 Ga0068867_100665931 Ga0068867_1006659312 115
224 3300005459 Ga0068867_102352674 Ga0068867_1023526741 115
225 3300005466 Ga0070685_10196792 Ga0070685_101967921 115
226 3300005530 Ga0070679_100468873 Ga0070679_1004688732 115
227 3300005535 Ga0070684_100029158 Ga0070684_1000291588 115
228 3300005535 Ga0070684_100995447 Ga0070684_1009954472 115
229 3300005539 Ga0068853_100031768 Ga0068853_1000317686 115
230 3300005539 Ga0068853_100057137 Ga0068853_1000571377 115
231 3300005539 Ga0068853_100107714 Ga0068853_1001077142 115
232 3300005544 Ga0070686_100047607 Ga0070686_1000476072 115
233 3300005545 Ga0070695_101139468 Ga0070695_1011394682 115
234 3300005546 Ga0070696_101094150 Ga0070696_1010941502 115
235 3300005547 Ga0070693_100064126 Ga0070693_1000641265 115
236 3300005547 Ga0070693_100079511 Ga0070693_1000795112 115
237 3300005547 Ga0070693_100708138 Ga0070693_1007081382 115
238 3300005547 Ga0070693_100751721 Ga0070693_1007517212 115
239 3300005548 Ga0070665_100677110 Ga0070665_1006771102 115
240 3300005548 Ga0070665_101432012 Ga0070665_1014320122 115
241 3300005548 Ga0070665_102025440 Ga0070665_1020254402 115
242 3300005549 Ga0070704_100823691 Ga0070704_1008236912 115
243 3300005563 Ga0068855_100029685 Ga0068855_1000296859 115
244 3300005563 Ga0068855_100061581 Ga0068855_1000615817 115
245 3300005563 Ga0068855_100288384 Ga0068855_1002883842 115
246 3300005564 Ga0070664_101353532 Ga0070664_1013535322 115
247 3300005577 Ga0068857_100878656 Ga0068857_1008786562 115
248 3300005578 Ga0068854_100454288 Ga0068854_1004542882 115
249 3300005578 Ga0068854_101397900 Ga0068854_1013979002 115
250 3300005614 Ga0068856_100065846 Ga0068856_1000658465 115
251 3300005614 Ga0068856_102184099 Ga0068856_1021840992 115
252 3300005615 Ga0070702_100847935 Ga0070702_1008479352 115
253 3300005615 Ga0070702_100993404 Ga0070702_1009934042 115
254 3300005616 Ga0068852_100004380 Ga0068852_10000438017 115
255 3300005616 Ga0068852_100127860 Ga0068852_1001278602 115
256 3300005616 Ga0068852_100171595 Ga0068852_1001715954 115
257 3300005616 Ga0068852_100461237 Ga0068852_1004612372 115
258 3300005617 Ga0068859_100130549 Ga0068859_1001305495 115
259 3300005617 Ga0068859_100821191 Ga0068859_1008211912 115
260 3300005617 Ga0068859_102020051 Ga0068859_1020200512 115
261 3300005618 Ga0068864_100203018 Ga0068864_1002030184 115
262 3300005618 Ga0068864_100629129 Ga0068864_1006291292 115
263 3300005618 Ga0068864_101612366 Ga0068864_1016123662 115
264 3300005719 Ga0068861_100164604 Ga0068861_1001646043 115
265 3300005719 Ga0068861_100311411 Ga0068861_1003114112 115
266 3300005834 Ga0068851_10006696 Ga0068851_100066964 115
267 3300005840 Ga0068870_10627050 Ga0068870_106270502 115
268 3300005841 Ga0068863_100236126 Ga0068863_1002361264 115
269 3300005841 Ga0068863_101109739 Ga0068863_1011097392 115
270 3300005842 Ga0068858_100102741 Ga0068858_1001027415 115
271 3300005842 Ga0068858_100628514 Ga0068858_1006285142 115
272 3300005843 Ga0068860_100241063 Ga0068860_1002410634 115
273 3300005843 Ga0068860_100933330 Ga0068860_1009333302 115
274 3300005843 Ga0068860_101303745 Ga0068860_1013037452 115
275 3300006028 Ga0070717_10828554 Ga0070717_108285542 115
276 3300006038 Ga0075365_10473437 Ga0075365_104734371 115
277 3300006042 Ga0075368_10467539 Ga0075368_104675392 115
278 3300006048 Ga0075363_100089552 Ga0075363_1000895524 115
279 3300006051 Ga0075364_10033419 Ga0075364_100334197 115
280 3300006051 Ga0075364_10345408 Ga0075364_103454082 115
281 3300006173 Ga0070716_101262330 Ga0070716_1012623302 115
282 3300006175 Ga0070712_101589118 Ga0070712_1015891181 115
283 3300006177 Ga0075362_10744937 Ga0075362_107449371 115
284 3300006178 Ga0075367_10021043 Ga0075367_100210435 115
285 3300006195 Ga0075366_10005895 Ga0075366_100058953 115
286 3300006237 Ga0097621_100024717 Ga0097621_1000247179 115
287 3300006237 Ga0097621_100203834 Ga0097621_1002038342 115
288 3300006353 Ga0075370_10139703 Ga0075370_101397034 115
289 3300006353 Ga0075370_10455856 Ga0075370_104558562 115
290 3300006358 Ga0068871_100063147 Ga0068871_1000631473 115
291 3300006358 Ga0068871_100206099 Ga0068871_1002060992 115
292 3300006358 Ga0068871_100331258 Ga0068871_1003312582 115
293 3300006358 Ga0068871_100369183 Ga0068871_1003691832 115
294 3300006358 Ga0068871_100806614 Ga0068871_1008066142 115
295 3300006844 Ga0075428_100074204 Ga0075428_1000742044 115
296 3300006852 Ga0075433_10425694 Ga0075433_104256942 115
297 3300006871 Ga0075434_100174619 Ga0075434_1001746192 115
298 3300006871 Ga0075434_101969185 Ga0075434_1019691852 115
299 3300006880 Ga0075429_100536246 Ga0075429_1005362462 115
300 3300006881 Ga0068865_100055933 Ga0068865_1000559332 115
301 3300006931 Ga0097620_100130553 Ga0097620_1001305532 115
302 3300006931 Ga0097620_100821210 Ga0097620_1008212102 115
303 3300006931 Ga0097620_102020132 Ga0097620_1020201322 115
304 3300007076 Ga0075435_100448940 Ga0075435_1004489402 115
305 3300009093 Ga0105240_10112049 Ga0105240_101120492 115
306 3300009093 Ga0105240_10390077 Ga0105240_103900771 115
307 3300009093 Ga0105240_12369494 Ga0105240_123694941 115
308 3300009094 Ga0111539_10019077 Ga0111539_100190775 115
309 3300009098 Ga0105245_10494220 Ga0105245_104942202 115
310 3300009098 Ga0105245_10766638 Ga0105245_107666382 115
311 3300009098 Ga0105245_10893074 Ga0105245_108930742 115
312 3300009174 Ga0105241_11449991 Ga0105241_114499912 115
313 3300009176 Ga0105242_10228604 Ga0105242_102286042 115
314 3300009176 Ga0105242_10427603 Ga0105242_104276032 115
315 3300009176 Ga0105242_11914332 Ga0105242_119143322 115
316 3300009176 Ga0105242_12544829 Ga0105242_125448291 115
317 3300009177 Ga0105248_10053313 Ga0105248_100533135 115
318 3300009177 Ga0105248_10123110 Ga0105248_101231107 115
319 3300009177 Ga0105248_10628678 Ga0105248_106286782 115
320 3300009177 Ga0105248_10706794 Ga0105248_107067942 115
321 3300009177 Ga0105248_10906415 Ga0105248_109064152 115
322 3300009545 Ga0105237_12059128 Ga0105237_120591282 115
323 3300009551 Ga0105238_10087095 Ga0105238_100870957 115
324 3300009551 Ga0105238_10162918 Ga0105238_101629182 115
325 3300009551 Ga0105238_10872135 Ga0105238_108721352 115
326 3300013104 Ga0157370_10281691 Ga0157370_102816912 115
327 3300013105 Ga0157369_10006334 Ga0157369_1000633418 115
328 3300013105 Ga0157369_10167285 Ga0157369_101672854 115
329 3300013105 Ga0157369_12010765 Ga0157369_120107652 115
330 3300013296 Ga0157374_10079715 Ga0157374_100797152 115
331 3300013296 Ga0157374_10711098 Ga0157374_107110982 115
332 3300013296 Ga0157374_11772693 Ga0157374_117726932 115
333 3300013297 Ga0157378_10059479 Ga0157378_100594797 115
334 3300013306 Ga0163162_10022516 Ga0163162_100225163 115
335 3300013306 Ga0163162_10338226 Ga0163162_103382263 115
336 3300013307 Ga0157372_10191231 Ga0157372_101912315 115
337 3300013307 Ga0157372_11188047 Ga0157372_111880472 115
338 3300013308 Ga0157375_10359351 Ga0157375_103593511 115
339 3300014325 Ga0163163_11378123 Ga0163163_113781232 115
340 3300014326 Ga0157380_10035459 Ga0157380_100354593 115
341 3300014326 Ga0157380_10256156 Ga0157380_102561562 115
342 3300014326 Ga0157380_11467506 Ga0157380_114675062 115
343 3300014326 Ga0157380_12813113 Ga0157380_128131131 115
344 3300014968 Ga0157379_10645825 Ga0157379_106458252 115
345 3300014968 Ga0157379_10937838 Ga0157379_109378382 115
346 3300014969 Ga0157376_10202712 Ga0157376_102027124 115
347 3300014969 Ga0157376_12278089 Ga0157376_122780891 115
348 3300014969 Ga0157376_12401687 Ga0157376_124016872 115
349 3300020069 Ga0197907_10947458 Ga0197907_109474582 115
350 3300020081 Ga0206354_10693061 Ga0206354_106930612 115
351 3300025321 Ga0207656_10001500 Ga0207656_1000150012 115
352 3300025893 Ga0207682_10037312 Ga0207682_100373123 115
353 3300025899 Ga0207642_10201121 Ga0207642_102011212 115
354 3300025903 Ga0207680_10333726 Ga0207680_103337262 115
355 3300025905 Ga0207685_10003543 Ga0207685_100035435 115
356 3300025906 Ga0207699_10608840 Ga0207699_106088402 115
357 3300025907 Ga0207645_10050633 Ga0207645_100506332 115
358 3300025908 Ga0207643_10158658 Ga0207643_101586582 115
359 3300025908 Ga0207643_10544558 Ga0207643_105445582 115
360 3300025909 Ga0207705_10141765 Ga0207705_101417652 115
361 3300025909 Ga0207705_10235593 Ga0207705_102355933 115
362 3300025909 Ga0207705_10538465 Ga0207705_105384652 115
363 3300025909 Ga0207705_10870903 Ga0207705_108709032 115
364 3300025911 Ga0207654_10015846 Ga0207654_100158464 115
365 3300025913 Ga0207695_10031032 Ga0207695_100310323 115
366 3300025913 Ga0207695_10560496 Ga0207695_105604962 115
367 3300025913 Ga0207695_10862452 Ga0207695_108624522 115
368 3300025917 Ga0207660_10673904 Ga0207660_106739042 115
369 3300025917 Ga0207660_10869381 Ga0207660_108693811 115
370 3300025918 Ga0207662_10071217 Ga0207662_100712174 115
371 3300025918 Ga0207662_10447242 Ga0207662_104472422 115
372 3300025920 Ga0207649_10365682 Ga0207649_103656822 115
373 3300025920 Ga0207649_10481971 Ga0207649_104819712 115
374 3300025920 Ga0207649_11218994 Ga0207649_112189941 115
375 3300025920 Ga0207649_11388795 Ga0207649_113887952 115
376 3300025924 Ga0207694_10007098 Ga0207694_1000709817 115
377 3300025924 Ga0207694_10136119 Ga0207694_101361194 115
378 3300025924 Ga0207694_10184725 Ga0207694_101847254 115
379 3300025924 Ga0207694_10771123 Ga0207694_107711232 115
380 3300025924 Ga0207694_11115878 Ga0207694_111158782 115
381 3300025925 Ga0207650_10257366 Ga0207650_102573662 115
382 3300025925 Ga0207650_10381883 Ga0207650_103818832 115
383 3300025926 Ga0207659_10110055 Ga0207659_101100552 115
384 3300025926 Ga0207659_10977508 Ga0207659_109775082 115
385 3300025927 Ga0207687_10540135 Ga0207687_105401352 115
386 3300025927 Ga0207687_10548898 Ga0207687_105488982 115
387 3300025929 Ga0207664_10569153 Ga0207664_105691532 115
388 3300025929 Ga0207664_11214378 Ga0207664_112143782 115
389 3300025931 Ga0207644_10736364 Ga0207644_107363642 115
390 3300025931 Ga0207644_11247569 Ga0207644_112475691 115
391 3300025932 Ga0207690_11038971 Ga0207690_110389712 115
392 3300025932 Ga0207690_11091870 Ga0207690_110918702 115
393 3300025933 Ga0207706_10169030 Ga0207706_101690305 115
394 3300025933 Ga0207706_10928436 Ga0207706_109284362 115
395 3300025934 Ga0207686_10009661 Ga0207686_100096613 115
396 3300025934 Ga0207686_10016521 Ga0207686_100165215 115
397 3300025934 Ga0207686_10018299 Ga0207686_100182992 115
398 3300025934 Ga0207686_10719481 Ga0207686_107194812 115
399 3300025934 Ga0207686_11657190 Ga0207686_116571902 115
400 3300025935 Ga0207709_10937155 Ga0207709_109371552 115
401 3300025936 Ga0207670_10031826 Ga0207670_100318265 115
402 3300025936 Ga0207670_10198354 Ga0207670_101983542 115
403 3300025936 Ga0207670_10398825 Ga0207670_103988252 115
404 3300025936 Ga0207670_10468252 Ga0207670_104682522 115
405 3300025937 Ga0207669_10137030 Ga0207669_101370304 115
406 3300025937 Ga0207669_10820376 Ga0207669_108203762 115
407 3300025937 Ga0207669_10955518 Ga0207669_109555182 115
408 3300025937 Ga0207669_11904987 Ga0207669_119049872 115
409 3300025938 Ga0207704_10131203 Ga0207704_101312034 115
410 3300025939 Ga0207665_10535488 Ga0207665_105354881 115
411 3300025940 Ga0207691_10476398 Ga0207691_104763982 115
412 3300025940 Ga0207691_10572243 Ga0207691_105722431 115
413 3300025941 Ga0207711_10068759 Ga0207711_100687595 115
414 3300025941 Ga0207711_10575921 Ga0207711_105759212 115
415 3300025941 Ga0207711_10603212 Ga0207711_106032122 115
416 3300025942 Ga0207689_10273860 Ga0207689_102738602 115
417 3300025944 Ga0207661_10072644 Ga0207661_100726445 115
418 3300025944 Ga0207661_11414794 Ga0207661_114147942 115
419 3300025949 Ga0207667_10175639 Ga0207667_101756393 115
420 3300025949 Ga0207667_10246512 Ga0207667_102465124 115
421 3300025949 Ga0207667_10324884 Ga0207667_103248843 115
422 3300025960 Ga0207651_10111768 Ga0207651_101117682 115
423 3300025960 Ga0207651_10199611 Ga0207651_101996112 115
424 3300025960 Ga0207651_10381798 Ga0207651_103817983 115
425 3300025960 Ga0207651_10670780 Ga0207651_106707802 115
426 3300025960 Ga0207651_11808616 Ga0207651_118086162 115
427 3300025961 Ga0207712_11546897 Ga0207712_115468972 115
428 3300025981 Ga0207640_10399967 Ga0207640_103999672 115
429 3300025981 Ga0207640_10477137 Ga0207640_104771371 115
430 3300025981 Ga0207640_10585053 Ga0207640_105850532 115
431 3300025981 Ga0207640_11018309 Ga0207640_110183092 115
432 3300025981 Ga0207640_11352102 Ga0207640_113521022 115
433 3300025986 Ga0207658_11242280 Ga0207658_112422801 115
434 3300026023 Ga0207677_10068962 Ga0207677_100689621 115
435 3300026023 Ga0207677_10190830 Ga0207677_101908302 115
436 3300026023 Ga0207677_11446440 Ga0207677_114464402 115
437 3300026023 Ga0207677_11460027 Ga0207677_114600272 115
438 3300026035 Ga0207703_10108254 Ga0207703_101082545 115
439 3300026035 Ga0207703_10366621 Ga0207703_103666213 115
440 3300026035 Ga0207703_10565482 Ga0207703_105654823 115
441 3300026041 Ga0207639_10018858 Ga0207639_1001885811 115
442 3300026041 Ga0207639_10081460 Ga0207639_100814602 115
443 3300026041 Ga0207639_10681108 Ga0207639_106811082 115
444 3300026075 Ga0207708_10312632 Ga0207708_103126322 115
445 3300026075 Ga0207708_11086250 Ga0207708_110862502 115
446 3300026078 Ga0207702_10114437 Ga0207702_101144375 115
447 3300026078 Ga0207702_10577157 Ga0207702_105771572 115
448 3300026088 Ga0207641_10529841 Ga0207641_105298412 115
449 3300026088 Ga0207641_10572465 Ga0207641_105724652 115
450 3300026088 Ga0207641_11930667 Ga0207641_119306672 115
451 3300026089 Ga0207648_10049310 Ga0207648_100493105 115
452 3300026089 Ga0207648_10577479 Ga0207648_105774792 115
453 3300026089 Ga0207648_10710905 Ga0207648_107109052 115
454 3300026095 Ga0207676_10309620 Ga0207676_103096202 115
455 3300026095 Ga0207676_10453884 Ga0207676_104538842 115
456 3300026095 Ga0207676_11155911 Ga0207676_111559112 115
457 3300026118 Ga0207675_100136832 Ga0207675_1001368325 115
458 3300026118 Ga0207675_100306952 Ga0207675_1003069523 115
459 3300026118 Ga0207675_101527272 Ga0207675_1015272721 115
460 3300026121 Ga0207683_10015833 Ga0207683_100158332 115
461 3300026121 Ga0207683_11067120 Ga0207683_110671202 115
462 3300026121 Ga0207683_11144786 Ga0207683_111447862 115
463 3300026142 Ga0207698_10010326 Ga0207698_1001032611 115
464 3300026142 Ga0207698_10018098 Ga0207698_100180983 115
465 3300026142 Ga0207698_10158112 Ga0207698_101581124 115
466 3300026142 Ga0207698_10297306 Ga0207698_102973062 115
467 3300026142 Ga0207698_10571078 Ga0207698_105710782 115
468 3300027866 Ga0209813_10387718 Ga0209813_103877182 115
469 3300027876 Ga0209974_10099950 Ga0209974_100999502 115
470 3300027907 Ga0207428_10007467 Ga0207428_1000746713 115
471 3300028379 Ga0268266_10435073 Ga0268266_104350732 115
472 3300028379 Ga0268266_10866667 Ga0268266_108666672 115
473 3300028381 Ga0268264_10757267 Ga0268264_107572672 115
474 3300031548 Ga0307408_100308376 Ga0307408_1003083762 115
475 3300031548 Ga0307408_100636016 Ga0307408_1006360162 115
476 3300031548 Ga0307408_100695165 Ga0307408_1006951652 115
477 3300031548 Ga0307408_101826722 Ga0307408_1018267222 115
478 3300031731 Ga0307405_10647771 Ga0307405_106477711 115
479 3300031731 Ga0307405_10810808 Ga0307405_108108082 115
480 3300031824 Ga0307413_11014028 Ga0307413_110140282 115
481 3300031824 Ga0307413_11548899 Ga0307413_115488992 115
482 3300031852 Ga0307410_10516749 Ga0307410_105167492 115
483 3300031852 Ga0307410_10889677 Ga0307410_108896772 115
484 3300031852 Ga0307410_11540672 Ga0307410_115406722 115
485 3300031901 Ga0307406_10992452 Ga0307406_109924522 115
486 3300031901 Ga0307406_11483506 Ga0307406_114835062 115
487 3300031911 Ga0307412_10062339 Ga0307412_100623393 115
488 3300031911 Ga0307412_10227496 Ga0307412_102274963 115
489 3300031911 Ga0307412_10528078 Ga0307412_105280782 115
490 3300031911 Ga0307412_11256247 Ga0307412_112562472 115
491 3300031911 Ga0307412_12026988 Ga0307412_120269881 115
492 3300031995 Ga0307409_100530074 Ga0307409_1005300743 115
493 3300032002 Ga0307416_100235039 Ga0307416_1002350394 115
494 3300032002 Ga0307416_100567651 Ga0307416_1005676512 115
495 3300032002 Ga0307416_101457356 Ga0307416_1014573562 115
496 3300032002 Ga0307416_101943001 Ga0307416_1019430012 115
497 3300032002 Ga0307416_102769408 Ga0307416_1027694082 115
498 3300032004 Ga0307414_12021100 Ga0307414_120211002 115
499 3300032005 Ga0307411_11333878 Ga0307411_113338781 115
500 3300032005 Ga0307411_11460992 Ga0307411_114609922 115
501 3300032126 Ga0307415_100320022 Ga0307415_1003200222 115
502 3300034957 Ga0373938_0165006 Ga0373938_0165006_230_583 115
503 3300035091 Ga0373951_0065264 Ga0373951_0065264_546_899 115
504 3300035092 Ga0373952_0027225 Ga0373952_0027225_385_738 115
505 3300035111 Ga0373923_0081400 Ga0373923_0081400_786_1139 115
506 3300035115 Ga0373941_0406996 Ga0373941_0406996_139_492 115
507 3300035119 Ga0373956_0174331 Ga0373956_0174331_301_654 115
508 3300035170 Ga0373943_0175221 Ga0373943_0175221_665_1018 115
509 3300035171 Ga0373946_0253663 Ga0373946_0253663_476_829 115
510 3300035172 Ga0373955_0063660 Ga0373955_0063660_1229_1582 115
511 3300035410 Ga0373924_0082696 Ga0373924_0082696_939_1292 115
512 3300035410 Ga0373924_0136652 Ga0373924_0136652_523_876 115
513 3300035410 Ga0373924_0278321 Ga0373924_0278321_266_619 115
514 3300035691 Ga0373931_0064668 Ga0373931_0064668_1357_1710 115
515 3300035692 Ga0373935_1004287 Ga0373935_1004287_216_569 115
516 3300035695 Ga0373927_0135268 Ga0373927_0135268_907_1260 115
517 3300035724 Ga0373933_0650630 Ga0373933_0650630_276_629 115
518 3300035725 Ga0373947_0154304 Ga0373947_0154304_984_1337 115
519 3300036401 Ga0373937_0093062 Ga0373937_0093062_421_774 115
520 3300036401 Ga0373937_0210934 Ga0373937_0210934_678_1031 115
521 3300037068 Ga0373925_0008267 Ga0373925_0008267_5320_5673 115
522 3300037068 Ga0373925_0154357 Ga0373925_0154357_946_1299 115
523 3300037068 Ga0373925_0798447 Ga0373925_0798447_125_478 115
524 3300037068 Ga0373925_1308311 Ga0373925_1308311_83_436 115
525 3300039437 Ga0436365_0531964 Ga0436365_0531964_1733_2086 115
526 3300041496 Ga0451839_0745541 Ga0451839_0745541_76_429 115
527 3300042000 Ga0439437_016373 Ga0439437_016373_45_398 115
528 3300042001 Ga0439441_006145 Ga0439441_006145_848_1201 115
529 3300042001 Ga0439441_148165 Ga0439441_148165_178_531 115
530 3300042156 Ga0439446_0101355 Ga0439446_0101355_134_487 115
531 3300042437 Ga0439444_0023086 Ga0439444_0023086_282_635 115
532 3300042876 Ga0451577_0422547 Ga0451577_0422547_527_880 115
533 3300044684 Ga0466966_0179930 Ga0466966_0179930_779_1132 115
534 3300044712 Ga0453684_0812939 Ga0453684_0812939_217_570 115
535 3300045049 Ga0466959_0194087 Ga0466959_0194087_982_1335 115
536 3300045051 Ga0451576_1748150 Ga0451576_1748150_84_437 115
537 3300046454 Ga0495592_0002591 Ga0495592_0002591_4825_5178 115
538 3300046455 Ga0495603_0211915 Ga0495603_0211915_533_886 115
539 3300046475 Ga0495639_0328506 Ga0495639_0328506_336_689 115
540 3300046476 Ga0495662_0510431 Ga0495662_0510431_122_475 115
541 3300046511 Ga0495608_0037016 Ga0495608_0037016_2372_2725 115
542 3300046514 Ga0495618_0376514 Ga0495618_0376514_226_579 115
543 3300046516 Ga0495628_0200181 Ga0495628_0200181_1065_1418 115
544 3300046529 Ga0495652_0016132 Ga0495652_0016132_704_1057 115
545 3300046536 Ga0495587_0038829 Ga0495587_0038829_2179_2532 115
546 3300046537 Ga0495598_0009707 Ga0495598_0009707_505_858 115
547 3300046537 Ga0495598_0089281 Ga0495598_0089281_543_896 115
548 3300046539 Ga0495621_0003232 Ga0495621_0003232_1590_1943 115
549 3300046539 Ga0495621_0236939 Ga0495621_0236939_314_667 115
550 3300046543 Ga0495645_0004671 Ga0495645_0004671_672_1025 115
551 3300046558 Ga0495633_0491254 Ga0495633_0491254_34_387 115
552 3300046559 Ga0495667_0029984 Ga0495667_0029984_3036_3389 115
553 3300046663 Ga0495635_0032495 Ga0495635_0032495_1821_2174 115
554 3300046663 Ga0495635_0593245 Ga0495635_0593245_221_574 115
555 3300046675 Ga0495657_0043896 Ga0495657_0043896_1137_1490 115
556 3300046678 Ga0495599_0215073 Ga0495599_0215073_731_1084 115
557 3300046679 Ga0495623_0049231 Ga0495623_0049231_1264_1617 115
558 3300046683 Ga0495658_0058804 Ga0495658_0058804_942_1295 115
559 3300046683 Ga0495658_0079564 Ga0495658_0079564_703_1056 115
560 3300046691 Ga0495670_0131790 Ga0495670_0131790_715_1068 115
561 3300046809 Ga0495600_0104793 Ga0495600_0104793_484_837 115
562 3300047317 Ga0495604_0346861 Ga0495604_0346861_90_443 115
563 3300047318 Ga0495636_0275904 Ga0495636_0275904_237_590 115
564 3300048090 Ga0495615_0055884 Ga0495615_0055884_123_476 115
565 3300048907 Ga0496104_0792125 Ga0496104_0792125_86_439 115
566 3300048908 Ga0496105_0090136 Ga0496105_0090136_1317_1670 115
567 3300048911 Ga0496108_0254139 Ga0496108_0254139_573_926 115
568 3300048912 Ga0496109_0068230 Ga0496109_0068230_310_663 115
569 3300048913 Ga0496110_0101200 Ga0496110_0101200_2136_2489 115
570 3300048914 Ga0496111_0175822 Ga0496111_0175822_908_1261 115
571 3300049161 Ga0501305_018600 Ga0501305_018600_585_938 115
572 3300049162 Ga0501307_012886 Ga0501307_012886_416_769 115
573 3300049522 Ga0501299_069992 Ga0501299_069992_190_543 115
574 3300049571 Ga0501034_0193193 Ga0501034_0193193_50_403 115
575 3300049575 Ga0501039_1063416 Ga0501039_1063416_253_606 115
576 3300049581 Ga0501047_0040997 Ga0501047_0040997_2184_2537 115
577 3300049581 Ga0501047_0122861 Ga0501047_0122861_703_1056 115
578 3300049585 Ga0501069_0001064 Ga0501069_0001064_2738_3091 115
579 3300049586 Ga0501070_0001356 Ga0501070_0001356_13292_13645 115
580 3300049586 Ga0501070_0138143 Ga0501070_0138143_1624_1977 115
581 3300049589 Ga0501073_0000321 Ga0501073_0000321_23501_23854 115
582 3300049589 Ga0501073_0464001 Ga0501073_0464001_498_851 115
583 3300049590 Ga0501074_0000097 Ga0501074_0000097_33648_34001 115
584 3300049741 Ga0501079_0009081 Ga0501079_0009081_4415_4768 115
585 3300049742 Ga0501080_0011166 Ga0501080_0011166_3664_4017 115
586 3300049742 Ga0501080_0200887 Ga0501080_0200887_1006_1359 115
587 3300049744 Ga0501083_0004051 Ga0501083_0004051_1645_1998 115
588 3300049823 Ga0501044_0083251 Ga0501044_0083251_2688_3041 115
589 3300050491 nmdc:mga00v17_250937_c1 nmdc:mga00v17_250937_c1_124_477 115
590 3300050493 nmdc:mga0k408_13809_c1 nmdc:mga0k408_13809_c1_1282_1635 115
591 3300050493 nmdc:mga0k408_8663_c1 nmdc:mga0k408_8663_c1_1671_2024 115
592 3300050495 nmdc:mga04h51_424623_c1 nmdc:mga04h51_424623_c1_102_455 115
593 3300050496 nmdc:mga07m45_169196_c1 nmdc:mga07m45_169196_c1_801_1154 115
594 3300050496 nmdc:mga07m45_419845_c1 nmdc:mga07m45_419845_c1_258_611 115
595 3300050508 nmdc:mga09592_472609_c1 nmdc:mga09592_472609_c1_190_543 115
596 3300050511 nmdc:mga08y16_11064_c1 nmdc:mga08y16_11064_c1_6233_6586 115
597 3300050512 nmdc:mga0n895_1150352_c1 nmdc:mga0n895_1150352_c1_224_577 115
598 3300050512 nmdc:mga0n895_286717_c1 nmdc:mga0n895_286717_c1_180_533 115
599 3300050512 nmdc:mga0n895_617741_c1 nmdc:mga0n895_617741_c1_565_918 115
600 3300050513 nmdc:mga0rr50_1608784_c1 nmdc:mga0rr50_1608784_c1_30_383 115
601 3300050513 nmdc:mga0rr50_383077_c1 nmdc:mga0rr50_383077_c1_613_966 115
602 3300050513 nmdc:mga0rr50_416377_c1 nmdc:mga0rr50_416377_c1_183_536 115
603 3300050515 nmdc:mga0a205_116902_c1 nmdc:mga0a205_116902_c1_1640_1993 115
604 3300053084 Ga0495595_0071547 Ga0495595_0071547_102_455 115
605 3300053085 Ga0495619_0055676 Ga0495619_0055676_42_395 115
606 3300054114 Ga0501084_0021259 Ga0501084_0021259_2557_2910 115
607 iso_pu_bacteria 2919704043 2919708818 115
608 3300005340 Ga0070689_100902870 Ga0070689_1009028701 116
609 3300005354 Ga0070675_100572212 Ga0070675_1005722122 116
610 3300005356 Ga0070674_100304962 Ga0070674_1003049622 116
611 3300005444 Ga0070694_101192075 Ga0070694_1011920751 116
612 3300005459 Ga0068867_100131746 Ga0068867_1001317461 116
613 3300005466 Ga0070685_11392732 Ga0070685_113927321 116
614 3300005471 Ga0070698_100437587 Ga0070698_1004375872 116
615 3300005548 Ga0070665_100022127 Ga0070665_1000221272 116
616 3300006038 Ga0075365_10479256 Ga0075365_104792562 116
617 3300006048 Ga0075363_100529454 Ga0075363_1005294542 116
618 3300006051 Ga0075364_10023952 Ga0075364_100239525 116
619 3300006051 Ga0075364_10199708 Ga0075364_101997083 116
620 3300006177 Ga0075362_10056887 Ga0075362_100568874 116
621 3300006178 Ga0075367_10088726 Ga0075367_100887263 116
622 3300006178 Ga0075367_10247467 Ga0075367_102474672 116
623 3300006186 Ga0075369_10001295 Ga0075369_100012955 116
624 3300006186 Ga0075369_10185095 Ga0075369_101850952 116
625 3300006195 Ga0075366_10007118 Ga0075366_100071185 116
626 3300006237 Ga0097621_101969892 Ga0097621_1019698921 116
627 3300006358 Ga0068871_100119596 Ga0068871_1001195965 116
628 3300009093 Ga0105240_10595644 Ga0105240_105956442 116
629 3300009093 Ga0105240_10908437 Ga0105240_109084372 116
630 3300009148 Ga0105243_10227307 Ga0105243_102273072 116
631 3300009148 Ga0105243_10411679 Ga0105243_104116793 116
632 3300009176 Ga0105242_10046258 Ga0105242_100462584 116
633 3300009176 Ga0105242_11230000 Ga0105242_112300002 116
634 3300009177 Ga0105248_10527596 Ga0105248_105275963 116
635 3300009177 Ga0105248_12130156 Ga0105248_121301562 116
636 3300009177 Ga0105248_12427602 Ga0105248_124276022 116
637 3300009551 Ga0105238_10468863 Ga0105238_104688633 116
638 3300009553 Ga0105249_11604556 Ga0105249_116045562 116
639 3300010375 Ga0105239_11647855 Ga0105239_116478552 116
640 3300011119 Ga0105246_10722930 Ga0105246_107229302 116
641 3300013104 Ga0157370_11076397 Ga0157370_110763971 116
642 3300013307 Ga0157372_12749241 Ga0157372_127492412 116
643 3300013308 Ga0157375_11540141 Ga0157375_115401412 116
644 3300014325 Ga0163163_11503692 Ga0163163_115036922 116
645 3300014326 Ga0157380_10624843 Ga0157380_106248434 116
646 3300014326 Ga0157380_12420257 Ga0157380_124202571 116
647 3300014968 Ga0157379_10193218 Ga0157379_101932183 116
648 3300014968 Ga0157379_11337906 Ga0157379_113379062 116
649 3300014969 Ga0157376_10845950 Ga0157376_108459502 116
650 3300017792 Ga0163161_10134116 Ga0163161_101341162 116
651 3300017792 Ga0163161_11127643 Ga0163161_111276432 116
652 3300025899 Ga0207642_10500803 Ga0207642_105008032 116
653 3300025935 Ga0207709_10511740 Ga0207709_105117402 116
654 3300025936 Ga0207670_11209767 Ga0207670_112097672 116
655 3300025937 Ga0207669_10698827 Ga0207669_106988272 116
656 3300025938 Ga0207704_10803382 Ga0207704_108033822 116
657 3300025941 Ga0207711_11140011 Ga0207711_111400111 116
658 3300026118 Ga0207675_100143544 Ga0207675_1001435444 116
659 3300026121 Ga0207683_10333372 Ga0207683_103333723 116
660 3300027526 Ga0209968_1104408 Ga0209968_11044081 116
661 3300028379 Ga0268266_10012447 Ga0268266_1001244711 116
662 3300028379 Ga0268266_10179478 Ga0268266_101794782 116
663 3300032002 Ga0307416_102238659 Ga0307416_1022386591 116
664 3300034816 Ga0373930_0072518 Ga0373930_0072518_139_498 116
665 3300034819 Ga0373958_0003362 Ga0373958_0003362_785_1141 116
666 3300035085 Ga0373929_0047864 Ga0373929_0047864_274_633 116
667 3300035241 Ga0373961_0192614 Ga0373961_0192614_257_616 116
668 3300035691 Ga0373931_0020764 Ga0373931_0020764_1030_1389 116
669 3300035691 Ga0373931_0048480 Ga0373931_0048480_451_810 116
670 3300035725 Ga0373947_0806441 Ga0373947_0806441_103_459 116
671 3300037312 Ga0395899_0135248 Ga0395899_0135248_530_889 116
672 3300037418 Ga0395900_0034072 Ga0395900_0034072_2607_2966 116
673 3300037466 Ga0395898_0254758 Ga0395898_0254758_416_775 116
674 3300037471 Ga0395905_0048048 Ga0395905_0048048_2560_2919 116
675 3300038443 Ga0395901_0033769 Ga0395901_0033769_1726_2085 116
676 3300041486 Ga0451807_2053462 Ga0451807_2053462_253_612 116
677 3300044684 Ga0466966_0050829 Ga0466966_0050829_2151_2510 116
678 3300044693 Ga0466961_0117869 Ga0466961_0117869_1262_1621 116
679 3300044694 Ga0466963_0941886 Ga0466963_0941886_174_533 116
680 3300044694 Ga0466963_1136920 Ga0466963_1136920_26_385 116
681 3300044719 Ga0466971_0112608 Ga0466971_0112608_405_764 116
682 3300044842 Ga0466957_0004472 Ga0466957_0004472_1076_1435 116
683 3300045051 Ga0451576_1155668 Ga0451576_1155668_78_434 116
684 3300045836 Ga0466958_0062229 Ga0466958_0062229_329_688 116
685 3300045976 Ga0466967_1482090 Ga0466967_1482090_117_476 116
686 3300046537 Ga0495598_0136697 Ga0495598_0136697_220_579 116
687 3300046539 Ga0495621_0381284 Ga0495621_0381284_162_521 116
688 3300046694 Ga0495649_0384555 Ga0495649_0384555_39_395 116
689 3300049581 Ga0501047_0930428 Ga0501047_0930428_218_610 116
690 3300049742 Ga0501080_0415215 Ga0501080_0415215_392_784 116
691 3300050489 nmdc:mga03683_494499_c1 nmdc:mga03683_494499_c1_129_485 116
692 3300050490 nmdc:mga03n38_703938_c1 nmdc:mga03n38_703938_c1_80_436 116
693 3300050491 nmdc:mga00v17_209926_c1 nmdc:mga00v17_209926_c1_550_909 116
694 3300050491 nmdc:mga00v17_5329_c1 nmdc:mga00v17_5329_c1_3338_3697 116
695 3300050492 nmdc:mga0yw44_115307_c1 nmdc:mga0yw44_115307_c1_1064_1423 116
696 3300050493 nmdc:mga0k408_1928_c1 nmdc:mga0k408_1928_c1_1981_2340 116
697 3300050493 nmdc:mga0k408_4084_c1 nmdc:mga0k408_4084_c1_368_727 116
698 3300050494 nmdc:mga06z11_157963_c1 nmdc:mga06z11_157963_c1_794_1153 116
699 3300050494 nmdc:mga06z11_99456_c1 nmdc:mga06z11_99456_c1_287_646 116
700 3300050496 nmdc:mga07m45_6617_c5 nmdc:mga07m45_6617_c5_501_860 116
701 3300050496 nmdc:mga07m45_705162_c1 nmdc:mga07m45_705162_c1_63_422 116
702 3300050496 nmdc:mga07m45_93439_c1 nmdc:mga07m45_93439_c1_92_451 116
703 3300050516 nmdc:mga0sz30_1133_c1 nmdc:mga0sz30_1133_c1_5665_6024 116
704 3300050516 nmdc:mga0sz30_225369_c1 nmdc:mga0sz30_225369_c1_82_438 116
705 3300053096 Ga0500641_0008546 Ga0500641_0008546_2227_2583 116
706 3300005616 Ga0068852_100272993 Ga0068852_1002729934 118
707 3300042134 Ga0450898_006294 Ga0450898_006294_678_1034 118
708 3300003322 rootL2_10001301 rootL2_1000130111 119
709 3300003771 Ga0055526_1003343 Ga0055526_100334315 119
710 3300003790 Ga0055528_1057462 Ga0055528_10574622 119
711 3300003791 Ga0055530_10078106 Ga0055530_100781062 119
712 3300003792 Ga0055540_1051963 Ga0055540_10519632 119
713 3300003794 Ga0055531_10111134 Ga0055531_101111341 119
714 3300004801 Ga0058860_12218986 Ga0058860_122189862 119
715 3300005262 Ga0065165_1006303 Ga0065165_10063039 119
716 3300005295 Ga0065707_10001914 Ga0065707_1000191410 119
717 3300005327 Ga0070658_10130450 Ga0070658_101304505 119
718 3300005719 Ga0068861_100753593 Ga0068861_1007535932 119
719 3300005844 Ga0068862_100009442 Ga0068862_1000094428 119
720 3300005844 Ga0068862_100158350 Ga0068862_1001583504 119
721 3300005937 Ga0081455_10356823 Ga0081455_103568232 119
722 3300006048 Ga0075363_100801874 Ga0075363_1008018742 119
723 3300006175 Ga0070712_101755948 Ga0070712_1017559481 119
724 3300006177 Ga0075362_10018481 Ga0075362_100184812 119
725 3300006178 Ga0075367_10010768 Ga0075367_100107685 119
726 3300006195 Ga0075366_10016161 Ga0075366_100161612 119
727 3300006195 Ga0075366_10016473 Ga0075366_100164734 119
728 3300006195 Ga0075366_10138878 Ga0075366_101388782 119
729 3300006353 Ga0075370_10002824 Ga0075370_1000282411 119
730 3300006944 Ga0099823_1000064 Ga0099823_100006420 119
731 3300009098 Ga0105245_10821596 Ga0105245_108215962 119
732 3300009148 Ga0105243_10258650 Ga0105243_102586502 119
733 3300009553 Ga0105249_11452365 Ga0105249_114523652 119
734 3300012475 Ga0157317_1000211 Ga0157317_10002115 119
735 3300012497 Ga0157319_1000005 Ga0157319_100000520 119
736 3300013296 Ga0157374_11039074 Ga0157374_110390742 119
737 3300021361 Ga0213872_10000091 Ga0213872_1000009120 119
738 3300021361 Ga0213872_10004732 Ga0213872_100047322 119
739 3300021361 Ga0213872_10277378 Ga0213872_102773782 119
740 3300025245 Ga0207425_1043363 Ga0207425_10433632 119
741 3300025273 Ga0209673_1020101 Ga0209673_10201014 119
742 3300025273 Ga0209673_1024595 Ga0209673_10245953 119
743 3300025295 Ga0209564_1000008 Ga0209564_100000836 119
744 3300025297 Ga0209758_1029564 Ga0209758_10295645 119
745 3300025298 Ga0209050_1013102 Ga0209050_10131025 119
746 3300025299 Ga0209256_1094210 Ga0209256_10942102 119
747 3300025303 Ga0209051_1000938 Ga0209051_100093832 119
748 3300025304 Ga0209257_1105073 Ga0209257_11050732 119
749 3300025909 Ga0207705_10329369 Ga0207705_103293693 119
750 3300025909 Ga0207705_11036633 Ga0207705_110366332 119
751 3300025915 Ga0207693_11404850 Ga0207693_114048501 119
752 3300025919 Ga0207657_10618754 Ga0207657_106187541 119
753 3300025933 Ga0207706_11226015 Ga0207706_112260152 119
754 3300025935 Ga0207709_10118091 Ga0207709_101180914 119
755 3300025972 Ga0207668_11415126 Ga0207668_114151261 119
756 3300026089 Ga0207648_10186006 Ga0207648_101860062 119
757 3300026118 Ga0207675_100166250 Ga0207675_1001662503 119
758 3300027296 Ga0209389_1000305 Ga0209389_100030528 119
759 3300027312 Ga0209371_1008392 Ga0209371_10083926 119
760 3300028380 Ga0268265_10011028 Ga0268265_1001102811 119
761 3300028794 Ga0307515_10012540 Ga0307515_1001254011 119
762 3300030500 Ga0268256_1008739 Ga0268256_10087396 119
763 3300031548 Ga0307408_100037446 Ga0307408_1000374466 119
764 3300031911 Ga0307412_10588460 Ga0307412_105884602 119
765 3300031911 Ga0307412_11247265 Ga0307412_112472652 119
766 3300032002 Ga0307416_101082964 Ga0307416_1010829642 119
767 3300036401 Ga0373937_0544753 Ga0373937_0544753_188_565 119
768 3300037471 Ga0395905_0032891 Ga0395905_0032891_1063_1434 119
769 3300037471 Ga0395905_1024976 Ga0395905_1024976_211_582 119
770 3300039437 Ga0436365_0661840 Ga0436365_0661840_260_637 119
771 3300039447 Ga0436361_0714431 Ga0436361_0714431_7630_7989 119
772 3300039447 Ga0436361_0815871 Ga0436361_0815871_133_498 119
773 3300039447 Ga0436361_0818040 Ga0436361_0818040_133_495 119
774 3300039447 Ga0436361_1155176 Ga0436361_1155176_3389_3754 119
775 3300042000 Ga0439437_017209 Ga0439437_017209_337_696 119
776 3300042127 Ga0450890_000550 Ga0450890_000550_1334_1693 119
777 3300042142 Ga0450905_045023 Ga0450905_045023_53_412 119
778 3300042156 Ga0439446_0340317 Ga0439446_0340317_146_511 119
779 3300042438 Ga0439459_0000309 Ga0439459_0000309_3182_3541 119
780 3300044656 Ga0466969_0002653 Ga0466969_0002653_4826_5197 119
781 3300044656 Ga0466969_0012551 Ga0466969_0012551_503_868 119
782 3300044683 Ga0466965_0018301 Ga0466965_0018301_1312_1677 119
783 3300044684 Ga0466966_0021693 Ga0466966_0021693_211_576 119
784 3300044693 Ga0466961_0026432 Ga0466961_0026432_2130_2495 119
785 3300044694 Ga0466963_0003881 Ga0466963_0003881_7930_8295 119
786 3300044694 Ga0466963_0028896 Ga0466963_0028896_1364_1723 119
787 3300044706 Ga0466964_0003200 Ga0466964_0003200_434_799 119
788 3300044712 Ga0453684_0040166 Ga0453684_0040166_747_1106 119
789 3300044719 Ga0466971_0001482 Ga0466971_0001482_1059_1424 119
790 3300044765 Ga0466970_0025081 Ga0466970_0025081_1554_1919 119
791 3300044765 Ga0466970_0728805 Ga0466970_0728805_104_475 119
792 3300044842 Ga0466957_0006128 Ga0466957_0006128_2107_2472 119
793 3300045049 Ga0466959_0000855 Ga0466959_0000855_9032_9397 119
794 3300045051 Ga0451576_1697712 Ga0451576_1697712_166_531 119
795 3300045836 Ga0466958_0022101 Ga0466958_0022101_1315_1680 119
796 3300045976 Ga0466967_0003037 Ga0466967_0003037_6442_6807 119
797 3300046460 Ga0495638_0050878 Ga0495638_0050878_1400_1759 119
798 3300048914 Ga0496111_0639507 Ga0496111_0639507_149_517 119
799 3300048925 Ga0496122_0329178 Ga0496122_0329178_123_482 119
800 3300048926 Ga0496123_0301364 Ga0496123_0301364_143_502 119
801 3300048927 Ga0496124_0030272 Ga0496124_0030272_595_954 119
802 3300049128 Ga0501308_000356 Ga0501308_000356_842_1207 119
803 3300049128 Ga0501308_007699 Ga0501308_007699_426_791 119
804 3300049130 Ga0501310_013780 Ga0501310_013780_533_898 119
805 3300049160 Ga0501304_004382 Ga0501304_004382_155_526 119
806 3300049160 Ga0501304_014799 Ga0501304_014799_315_680 119
807 3300049162 Ga0501307_045179 Ga0501307_045179_24_392 119
808 3300049527 Ga0501311_024495 Ga0501311_024495_225_590 119
809 3300049527 Ga0501311_045641 Ga0501311_045641_287_658 119
810 3300049530 Ga0501314_014200 Ga0501314_014200_380_745 119
811 3300049531 Ga0501315_005277 Ga0501315_005277_564_929 119
812 3300049532 Ga0501316_013333 Ga0501316_013333_213_584 119
813 3300049532 Ga0501316_054783 Ga0501316_054783_193_558 119
814 3300049535 Ga0501319_015308 Ga0501319_015308_240_605 119
815 3300049536 Ga0501320_005049 Ga0501320_005049_421_786 119
816 3300049536 Ga0501320_060264 Ga0501320_060264_130_495 119
817 3300050489 nmdc:mga03683_40367_c1 nmdc:mga03683_40367_c1_928_1293 119
818 3300050489 nmdc:mga03683_89229_c1 nmdc:mga03683_89229_c1_106_465 119
819 3300050490 nmdc:mga03n38_602745_c1 nmdc:mga03n38_602745_c1_193_558 119
820 3300050493 nmdc:mga0k408_109049_c1 nmdc:mga0k408_109049_c1_1157_1522 119
821 3300050493 nmdc:mga0k408_15566_c1 nmdc:mga0k408_15566_c1_3794_4159 119
822 3300050494 nmdc:mga06z11_31132_c1 nmdc:mga06z11_31132_c1_1944_2309 119
823 3300050496 nmdc:mga07m45_2931_c1 nmdc:mga07m45_2931_c1_2843_3202 119
824 3300053156 Ga0500622_0001316 Ga0500622_0001316_10667_11026 119
825 3300059421 Ga0590071_001831 Ga0590071_001831_4641_5009 119
826 3300059426 Ga0590077_097116 Ga0590077_097116_32_400 119
827 3300059605 Ga0587106_091383 Ga0587106_091383_11_376 119
828 3300061719 Ga0466962_0014522 Ga0466962_0014522_260_625 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

14

130

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4w-assembly1.cif.gz_N a. baumannii ribosome-eravacycline complex: empty 70s 0.9477 3 119
7m4w-assembly1.cif.gz_N a. baumannii ribosome-eravacycline complex: empty 70s 0.9398 3 119
7unw-assembly1.cif.gz_Q pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9396 4 119
6v3b-assembly1.cif.gz_N cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9342 3 119
7jt1-assembly1.cif.gz_o 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) 0.9287 3 119
ID Description Score Start End Superfamily
af_B6SLT9_8_113_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9253 21 119 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9253 26 119 3.30.420.100
4pecO00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9242 3 119 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9196 22 119 3.30.420.100
4pecO00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9168 3 119 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A2N2QZF7-F1-model_v4 Large ribosomal subunit protein uL18 0.9805 23 119 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-E4PM04-F1-model_v4 Large ribosomal subunit protein uL18 0.978 18 119 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A0S2SFS5-F1-model_v4 Large ribosomal subunit protein uL18 0.9749 20 119 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7U4DEM8-F1-model_v4 Large ribosomal subunit protein uL18 0.9746 19 119 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2J4RAZ0-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.973 16 119 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.62 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map