F482671

General Info

Members Datasets Scaffolds Average Seq Length
830 444 1660 85

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0037009|Ga0500568_0037009_1458_1745
Length 95
Sequence MAQKKGGGSTRNGRDSQPKMLGVKAYGGQLVSAGSIIVRQRGTRFHAGQNVGMGRDHTLFALVDGKISFTIKGVQSHKFVVVTPVDAPVTVAAEA

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
15 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
33 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
108 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
109 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
110 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
197 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
220 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
222 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
243 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
244 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
245 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
248 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
249 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
253 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
254 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
255 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
256 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
257 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
258 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
259 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
262 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
265 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
266 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
267 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
268 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
269 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
270 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
273 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
274 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
275 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
276 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
277 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
278 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
279 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
280 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
281 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
282 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
283 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
284 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
287 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
288 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
299 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
300 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
301 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
319 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
349 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
375 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
376 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
377 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
378 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
381 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
382 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
394 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
397 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
398 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
399 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
400 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
401 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
402 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
403 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
404 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
405 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
406 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
407 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
408 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
409 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
412 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
413 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
414 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
417 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
418 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
421 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
422 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
423 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
424 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
436 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
437 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
438 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
439 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
440 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
441 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
442 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
443 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
444 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.87
Metatranscriptomes 12.05
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.33
Nodule 0.24
Rhizoplane 4.7
Rhizosphere 67.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0037009 3300053139 Bacteria 1982
2 SwRhRL3b_contig_638870 2162886006 Bacteria 934
3 JGI24740J21852_10035537 3300001979 Bacteria 1557
4 JGI24735J21928_10185972 3300002067 Bacteria 602
5 JGI24744J21845_10075619 3300002077 Bacteria 614
6 JGI25152J39213_1000892 3300002773 Bacteria 14659
7 JGI25150J39212_1002313 3300002774 Bacteria 4795
8 Ga0006778J45830_1018330 3300003162 Bacteria 699
9 Ga0006759J45824_1013933 3300003163 Bacteria 664
10 Ga0006759J45824_1017103 3300003163 Bacteria 699
11 Ga0006759J45824_1023259 3300003163 Bacteria 622
12 JGI25153J46596_10000420 3300003215 Bacteria 27768
13 Ga0006770J48903_1013780 3300003305 Bacteria 699
14 rootH1_10043230 3300003316 Bacteria 1924
15 rootL2_10005413 3300003322 Bacteria 3367
16 rootL2_10083805 3300003322 Bacteria 2725
17 JGI26128J50194_1000218 3300003347 Bacteria 2744
18 JGI26145J50221_1002388 3300003371 Bacteria 1477
19 Ga0007417J51691_1011360 3300003544 Bacteria 666
20 Ga0007417J51691_1011711 3300003544 Bacteria 699
21 Ga0007417J51691_1017103 3300003544 Bacteria 613
22 Ga0007417J51691_1045595 3300003544 Bacteria 733
23 Ga0007417J51691_1114763 3300003544 Bacteria 634
24 Ga0007427J51700_112861 3300003559 Bacteria 699
25 Ga0007410J51695_1004507 3300003574 Bacteria 1438
26 Ga0007410J51695_1011000 3300003574 Bacteria 667
27 Ga0007410J51695_1022391 3300003574 Bacteria 699
28 Ga0007409J51694_1012913 3300003575 Bacteria 598
29 Ga0007409J51694_1014513 3300003575 Bacteria 706
30 Ga0007409J51694_1027825 3300003575 Bacteria 662
31 Ga0007416J51690_1023874 3300003577 Bacteria 759
32 Ga0007416J51690_1026130 3300003577 Bacteria 611
33 Ga0007416J51690_1065410 3300003577 Bacteria 552
34 Ga0007429J51699_1012803 3300003579 Bacteria 598
35 Ga0007411J51799_105540 3300003611 Bacteria 710
36 Ga0007411J51799_112204 3300003611 Bacteria 566
37 Ga0007415J51800_103902 3300003613 Bacteria 713
38 Ga0032354_1016521 3300003693 Bacteria 766
39 Ga0032354_1024639 3300003693 Bacteria 697
40 Ga0032354_1031837 3300003693 Bacteria 646
41 Ga0032354_1037179 3300003693 Bacteria 826
42 Ga0006780_1017431 3300003735 Bacteria 639
43 Ga0055539_1012687 3300003752 Bacteria 1035
44 Ga0055526_1014626 3300003771 Bacteria 3211
45 Ga0055524_1000109 3300003775 Bacteria 100308
46 Ga0055530_10003385 3300003791 Bacteria 9105
47 Ga0055530_10034055 3300003791 Bacteria 1305
48 Ga0055540_1000013 3300003792 Bacteria 262274
49 Ga0055540_1009236 3300003792 Bacteria 3430
50 Ga0055540_1017082 3300003792 Bacteria 2037
51 Ga0055540_1095489 3300003792 Bacteria 558
52 Ga0055540_1112322 3300003792 Bacteria 502
53 Ga0055531_10000158 3300003794 Bacteria 77918
54 Ga0055531_10005660 3300003794 Bacteria 7260
55 Ga0058859_11701938 3300004798 Bacteria 662
56 Ga0058859_11819676 3300004798 Bacteria 766
57 Ga0058859_11829144 3300004798 Bacteria 590
58 Ga0058863_10004931 3300004799 Bacteria 597
59 Ga0058863_11886072 3300004799 Bacteria 721
60 Ga0058861_12046980 3300004800 Bacteria 576
61 Ga0058860_10070410 3300004801 Bacteria 653
62 Ga0058860_12216250 3300004801 Bacteria 863
63 Ga0065165_1002013 3300005262 Bacteria 18978
64 Ga0065165_1080711 3300005262 Bacteria 845
65 Ga0065704_10527730 3300005289 Bacteria 648
66 Ga0065707_10082503 3300005295 Bacteria 14412
67 Ga0065707_11023718 3300005295 Bacteria 533
68 Ga0070658_10068891 3300005327 Bacteria 2893
69 Ga0070658_10320018 3300005327 Bacteria 1324
70 Ga0070658_10534964 3300005327 Bacteria 1013
71 Ga0070658_10649110 3300005327 Bacteria 915
72 Ga0070677_10087294 3300005333 Bacteria 1349
73 Ga0068869_100297442 3300005334 Bacteria 1302
74 Ga0068869_101128982 3300005334 Bacteria 687
75 Ga0070680_100134810 3300005336 Bacteria 2068
76 Ga0070682_100267190 3300005337 Bacteria 1241
77 Ga0068868_100229049 3300005338 Bacteria 1558
78 Ga0070660_100070483 3300005339 Bacteria 2728
79 Ga0070660_100108958 3300005339 Bacteria 2202
80 Ga0070660_100973026 3300005339 Bacteria 717
81 Ga0070687_101193445 3300005343 Bacteria 561
82 Ga0070661_100126267 3300005344 Bacteria 1919
83 Ga0070661_100748768 3300005344 Bacteria 799
84 Ga0070668_100128990 3300005347 Bacteria 2028
85 Ga0070669_100054025 3300005353 Bacteria 2941
86 Ga0070671_101356837 3300005355 Bacteria 628
87 Ga0070674_100113587 3300005356 Bacteria 1993
88 Ga0070674_100671121 3300005356 Bacteria 883
89 Ga0070673_101356170 3300005364 Bacteria 669
90 Ga0070659_100008466 3300005366 Bacteria 7516
91 Ga0070667_100116760 3300005367 Bacteria 2318
92 Ga0070667_100145381 3300005367 Bacteria 2079
93 Ga0070700_100058250 3300005441 Bacteria 2426
94 Ga0070663_100125498 3300005455 Bacteria 1944
95 Ga0070663_100377465 3300005455 Bacteria 1154
96 Ga0070678_100020291 3300005456 Bacteria 4357
97 Ga0070678_101574061 3300005456 Bacteria 617
98 Ga0070681_10528773 3300005458 Bacteria 1093
99 Ga0068867_100001947 3300005459 Bacteria 14386
100 Ga0068867_101294889 3300005459 Bacteria 672
101 Ga0068867_101571629 3300005459 Bacteria 614
102 Ga0070706_100002083 3300005467 Bacteria 20391
103 Ga0070706_101829860 3300005467 Bacteria 552
104 Ga0070698_100128634 3300005471 Bacteria 2489
105 Ga0070699_100243867 3300005518 Bacteria 1605
106 Ga0070679_100212564 3300005530 Bacteria 1897
107 Ga0070679_100500176 3300005530 Bacteria 1159
108 Ga0070684_101644640 3300005535 Bacteria 606
109 Ga0068853_101067456 3300005539 Bacteria 778
110 Ga0070672_101355696 3300005543 Bacteria 636
111 Ga0070665_100842570 3300005548 Bacteria 930
112 Ga0070665_100928564 3300005548 Bacteria 883
113 Ga0068855_100032613 3300005563 Bacteria 6218
114 Ga0068855_100120364 3300005563 Bacteria 3005
115 Ga0068855_100142205 3300005563 Bacteria 2733
116 Ga0068852_100089473 3300005616 Bacteria 2752
117 Ga0068852_101219474 3300005616 Bacteria 773
118 Ga0068859_101381555 3300005617 Bacteria 777
119 Ga0068864_100200723 3300005618 Bacteria 1832
120 Ga0068864_100536369 3300005618 Bacteria 1130
121 Ga0068864_101282041 3300005618 Bacteria 733
122 Ga0068866_10003673 3300005718 Bacteria 6287
123 Ga0068861_100006327 3300005719 Bacteria 8059
124 Ga0068861_101944555 3300005719 Bacteria 586
125 Ga0068863_100071767 3300005841 Bacteria 3275
126 Ga0068863_100608432 3300005841 Bacteria 1082
127 Ga0068863_101633437 3300005841 Bacteria 654
128 Ga0068858_101353515 3300005842 Bacteria 701
129 Ga0068858_102085773 3300005842 Bacteria 561
130 Ga0068860_100002278 3300005843 Bacteria 20163
131 Ga0068860_101796647 3300005843 Bacteria 635
132 Ga0068862_100673631 3300005844 Bacteria 1000
133 Ga0075365_10023056 3300006038 Bacteria 3911
134 Ga0075365_10038406 3300006038 Bacteria 3112
135 Ga0075365_10144102 3300006038 Bacteria 1655
136 Ga0075365_10146992 3300006038 Bacteria 1638
137 Ga0075365_10986743 3300006038 Bacteria 594
138 Ga0075368_10050993 3300006042 Bacteria 1645
139 Ga0075368_10084772 3300006042 Bacteria 1292
140 Ga0075368_10242439 3300006042 Bacteria 769
141 Ga0075363_100019150 3300006048 Bacteria 3420
142 Ga0075363_100054717 3300006048 Bacteria 2135
143 Ga0075363_100100193 3300006048 Bacteria 1602
144 Ga0075363_100133175 3300006048 Bacteria 1395
145 Ga0075363_100410322 3300006048 Bacteria 797
146 Ga0075363_100698830 3300006048 Bacteria 612
147 Ga0075363_100727169 3300006048 Bacteria 600
148 Ga0075364_10241644 3300006051 Bacteria 1226
149 Ga0075364_10439091 3300006051 Bacteria 892
150 Ga0075364_10944518 3300006051 Bacteria 587
151 Ga0075362_10043584 3300006177 Bacteria 1987
152 Ga0075362_10052438 3300006177 Bacteria 1828
153 Ga0075362_10057331 3300006177 Bacteria 1755
154 Ga0075362_10164527 3300006177 Bacteria 1069
155 Ga0075362_10182982 3300006177 Bacteria 1016
156 Ga0075362_10242245 3300006177 Bacteria 886
157 Ga0075362_10718003 3300006177 Bacteria 522
158 Ga0075367_10006143 3300006178 Bacteria 6043
159 Ga0075367_10007325 3300006178 Bacteria 5643
160 Ga0075367_10026991 3300006178 Bacteria 3262
161 Ga0075367_10399051 3300006178 Bacteria 870
162 Ga0075369_10021846 3300006186 Bacteria 2635
163 Ga0075369_10031196 3300006186 Bacteria 2248
164 Ga0075366_10014821 3300006195 Bacteria 4458
165 Ga0075366_10035470 3300006195 Bacteria 2940
166 Ga0075366_10041460 3300006195 Bacteria 2725
167 Ga0075366_10050690 3300006195 Bacteria 2465
168 Ga0075366_10088935 3300006195 Bacteria 1849
169 Ga0075366_10103320 3300006195 Bacteria 1711
170 Ga0075366_10127248 3300006195 Bacteria 1537
171 Ga0075366_10144411 3300006195 Bacteria 1439
172 Ga0075366_10240950 3300006195 Bacteria 1102
173 Ga0075366_10246833 3300006195 Bacteria 1089
174 Ga0075366_10254499 3300006195 Bacteria 1071
175 Ga0075366_10326500 3300006195 Bacteria 940
176 Ga0075370_10002426 3300006353 Bacteria 8638
177 Ga0075370_10002528 3300006353 Bacteria 8493
178 Ga0075370_10015050 3300006353 Bacteria 4135
179 Ga0075370_10232171 3300006353 Bacteria 1092
180 Ga0075370_10252821 3300006353 Bacteria 1045
181 Ga0068871_101698157 3300006358 Bacteria 599
182 Ga0068871_102191088 3300006358 Bacteria 527
183 Ga0075428_100473805 3300006844 Bacteria 1340
184 Ga0075430_100033190 3300006846 Bacteria 4382
185 Ga0075431_101382757 3300006847 Bacteria 664
186 Ga0075429_100074259 3300006880 Bacteria 2962
187 Ga0068865_100031867 3300006881 Bacteria 3518
188 Ga0097620_101381565 3300006931 Bacteria 777
189 Ga0079104_1000001 3300006946 Bacteria 521847
190 Ga0105240_10017122 3300009093 Bacteria 9784
191 Ga0105240_11888680 3300009093 Bacteria 621
192 Ga0111539_10608222 3300009094 Bacteria 1273
193 Ga0111539_13201018 3300009094 Bacteria 528
194 Ga0105245_10170491 3300009098 Bacteria 2072
195 Ga0105245_10311700 3300009098 Bacteria 1547
196 Ga0105245_11663801 3300009098 Bacteria 690
197 Ga0105247_10944305 3300009101 Bacteria 669
198 Ga0114129_12840635 3300009147 Bacteria 574
199 Ga0105241_10083226 3300009174 Bacteria 2510
200 Ga0105242_10469742 3300009176 Bacteria 1190
201 Ga0105248_10721083 3300009177 Bacteria 1125
202 Ga0105248_10854833 3300009177 Bacteria 1027
203 Ga0105248_11268854 3300009177 Bacteria 833
204 Ga0105237_10518801 3300009545 Bacteria 1198
205 Ga0105237_10675960 3300009545 Bacteria 1039
206 Ga0105238_10145507 3300009551 Bacteria 2346
207 Ga0105238_10594850 3300009551 Bacteria 1114
208 Ga0105238_10794777 3300009551 Bacteria 961
209 Ga0105238_10872399 3300009551 Bacteria 917
210 Ga0105249_10037455 3300009553 Bacteria 4402
211 Ga0105249_11185643 3300009553 Bacteria 834
212 Ga0105239_10804060 3300010375 Bacteria 1077
213 Ga0157319_1021801 3300012497 Bacteria 628
214 Ga0157324_1059132 3300012506 Bacteria 520
215 Ga0157327_1010021 3300012512 Bacteria 886
216 Ga0157326_1076205 3300012513 Bacteria 541
217 Ga0157374_10236650 3300013296 Bacteria 1795
218 Ga0157374_10691420 3300013296 Bacteria 1033
219 Ga0157378_10015555 3300013297 Bacteria 6664
220 Ga0157378_10206273 3300013297 Bacteria 1861
221 Ga0157378_10551355 3300013297 Bacteria 1158
222 Ga0157378_11520289 3300013297 Bacteria 714
223 Ga0157378_11659920 3300013297 Bacteria 685
224 Ga0163162_10280517 3300013306 Bacteria 1798
225 Ga0157372_12402095 3300013307 Bacteria 605
226 Ga0157372_12455151 3300013307 Bacteria 598
227 Ga0157372_12707485 3300013307 Bacteria 569
228 Ga0157375_10717041 3300013308 Bacteria 1153
229 Ga0163163_11320509 3300014325 Bacteria 783
230 Ga0182008_10401829 3300014497 Bacteria 736
231 Ga0182008_10759152 3300014497 Bacteria 559
232 Ga0157379_10591784 3300014968 Bacteria 1035
233 Ga0157379_11390960 3300014968 Bacteria 680
234 Ga0157376_10049735 3300014969 Bacteria 3473
235 Ga0157376_10531467 3300014969 Bacteria 1161
236 Ga0157376_10558338 3300014969 Bacteria 1134
237 Ga0182007_10088519 3300015262 Bacteria 1019
238 Ga0182007_10202316 3300015262 Bacteria 695
239 Ga0163161_10230509 3300017792 Bacteria 1437
240 Ga0163161_10658434 3300017792 Bacteria 868
241 Ga0197907_10563325 3300020069 Bacteria 786
242 Ga0206355_1480352 3300020076 Bacteria 720
243 Ga0213872_10038378 3300021361 Bacteria 2186
244 Ga0213872_10060580 3300021361 Bacteria 1711
245 Ga0207425_1000221 3300025245 Bacteria 44837
246 Ga0209677_107129 3300025253 Bacteria 2452
247 Ga0209129_1000012 3300025258 Bacteria 541516
248 Ga0209129_1037315 3300025258 Bacteria 783
249 Ga0209129_1059813 3300025258 Bacteria 566
250 Ga0209129_1060622 3300025258 Bacteria 560
251 Ga0209565_1007217 3300025263 Bacteria 3022
252 Ga0209673_1002136 3300025273 Bacteria 14727
253 Ga0209673_1019202 3300025273 Bacteria 2462
254 Ga0209673_1025942 3300025273 Bacteria 1937
255 Ga0209675_1093185 3300025291 Bacteria 541
256 Ga0209564_1000022 3300025295 Bacteria 555109
257 Ga0209758_1000124 3300025297 Bacteria 189933
258 Ga0209758_1000234 3300025297 Bacteria 116217
259 Ga0209758_1050104 3300025297 Bacteria 1467
260 Ga0209050_1000315 3300025298 Bacteria 98447
261 Ga0209050_1001261 3300025298 Bacteria 29214
262 Ga0209256_1000015 3300025299 Bacteria 622953
263 Ga0209256_1061637 3300025299 Bacteria 871
264 Ga0209051_1000022 3300025303 Bacteria 474879
265 Ga0209051_1000315 3300025303 Bacteria 73579
266 Ga0209051_1031528 3300025303 Bacteria 2037
267 Ga0209051_1044906 3300025303 Bacteria 1535
268 Ga0209051_1070569 3300025303 Bacteria 1053
269 Ga0209257_1000030 3300025304 Bacteria 689812
270 Ga0209257_1000309 3300025304 Bacteria 104166
271 Ga0209257_1017837 3300025304 Bacteria 2771
272 Ga0209257_1043746 3300025304 Bacteria 1311
273 Ga0209257_1149665 3300025304 Bacteria 515
274 Ga0207642_10006139 3300025899 Bacteria 3976
275 Ga0207705_10128716 3300025909 Bacteria 1883
276 Ga0207705_10451851 3300025909 Bacteria 996
277 Ga0207705_10532263 3300025909 Bacteria 913
278 Ga0207705_10708206 3300025909 Bacteria 782
279 Ga0207705_10870637 3300025909 Bacteria 698
280 Ga0207684_10004074 3300025910 Bacteria 13941
281 Ga0207684_10552915 3300025910 Bacteria 985
282 Ga0207654_10058756 3300025911 Bacteria 2240
283 Ga0207707_10242094 3300025912 Bacteria 1568
284 Ga0207707_10262963 3300025912 Bacteria 1497
285 Ga0207695_10036310 3300025913 Bacteria 5330
286 Ga0207671_10459625 3300025914 Bacteria 1014
287 Ga0207660_10235701 3300025917 Bacteria 1440
288 Ga0207662_10639229 3300025918 Bacteria 742
289 Ga0207657_10028808 3300025919 Bacteria 5060
290 Ga0207657_10118894 3300025919 Bacteria 2175
291 Ga0207657_10624643 3300025919 Bacteria 840
292 Ga0207657_10774667 3300025919 Bacteria 742
293 Ga0207657_11053164 3300025919 Bacteria 623
294 Ga0207649_10002064 3300025920 Bacteria 11416
295 Ga0207649_10628388 3300025920 Bacteria 828
296 Ga0207652_10077772 3300025921 Bacteria 2896
297 Ga0207646_10294313 3300025922 Bacteria 1467
298 Ga0207681_10603067 3300025923 Bacteria 907
299 Ga0207694_10242803 3300025924 Bacteria 1472
300 Ga0207694_10561120 3300025924 Bacteria 959
301 Ga0207687_10011249 3300025927 Bacteria 5845
302 Ga0207687_10319509 3300025927 Bacteria 1256
303 Ga0207644_10629291 3300025931 Bacteria 892
304 Ga0207690_10036483 3300025932 Bacteria 3184
305 Ga0207690_10128789 3300025932 Bacteria 1849
306 Ga0207690_11192968 3300025932 Bacteria 635
307 Ga0207690_11317780 3300025932 Bacteria 603
308 Ga0207669_10273879 3300025937 Bacteria 1269
309 Ga0207704_10001183 3300025938 Bacteria 11632
310 Ga0207665_10767968 3300025939 Bacteria 760
311 Ga0207691_10245468 3300025940 Bacteria 1547
312 Ga0207689_10119995 3300025942 Bacteria 2163
313 Ga0207689_10963758 3300025942 Bacteria 720
314 Ga0207689_11132038 3300025942 Bacteria 659
315 Ga0207679_10000671 3300025945 Bacteria 22930
316 Ga0207679_10250461 3300025945 Bacteria 1505
317 Ga0207667_10093668 3300025949 Bacteria 3102
318 Ga0207667_10154780 3300025949 Bacteria 2359
319 Ga0207667_11245366 3300025949 Bacteria 722
320 Ga0207712_10077901 3300025961 Bacteria 2404
321 Ga0207668_10108702 3300025972 Bacteria 2076
322 Ga0207668_11697051 3300025972 Bacteria 570
323 Ga0207658_10383710 3300025986 Bacteria 1231
324 Ga0207677_10074561 3300026023 Bacteria 2408
325 Ga0207677_10093561 3300026023 Bacteria 2192
326 Ga0207703_11376543 3300026035 Bacteria 679
327 Ga0207703_11460681 3300026035 Bacteria 658
328 Ga0207703_11577849 3300026035 Bacteria 631
329 Ga0207639_11879807 3300026041 Bacteria 559
330 Ga0207678_10328650 3300026067 Bacteria 1316
331 Ga0207678_10404304 3300026067 Bacteria 1182
332 Ga0207678_10665796 3300026067 Bacteria 915
333 Ga0207708_10094171 3300026075 Bacteria 2312
334 Ga0207702_10877865 3300026078 Bacteria 888
335 Ga0207641_10053268 3300026088 Bacteria 3429
336 Ga0207641_11513988 3300026088 Bacteria 673
337 Ga0207641_12351324 3300026088 Bacteria 532
338 Ga0207648_10026441 3300026089 Bacteria 5156
339 Ga0207648_10108549 3300026089 Bacteria 2436
340 Ga0207648_11932623 3300026089 Bacteria 551
341 Ga0207676_10169748 3300026095 Bacteria 1899
342 Ga0207674_10521733 3300026116 Bacteria 1148
343 Ga0207675_100021908 3300026118 Bacteria 5949
344 Ga0207675_100985369 3300026118 Bacteria 861
345 Ga0207675_101352285 3300026118 Bacteria 733
346 Ga0207675_101384761 3300026118 Bacteria 724
347 Ga0207683_10567937 3300026121 Bacteria 1049
348 Ga0207683_11310273 3300026121 Bacteria 670
349 Ga0207683_11640870 3300026121 Bacteria 592
350 Ga0207698_10010712 3300026142 Bacteria 5914
351 Ga0207698_10160408 3300026142 Bacteria 1966
352 Ga0209281_1000057 3300027111 Bacteria 307145
353 Ga0209973_1035866 3300027252 Bacteria 714
354 Ga0209969_1016260 3300027360 Bacteria 1090
355 Ga0209981_1041424 3300027378 Bacteria 689
356 Ga0209996_1000964 3300027395 Bacteria 3416
357 Ga0209995_1000738 3300027471 Bacteria 5005
358 Ga0209968_1000202 3300027526 Bacteria 10389
359 Ga0209999_1006976 3300027543 Bacteria 2031
360 Ga0209999_1052179 3300027543 Bacteria 773
361 Ga0209970_1020316 3300027614 Bacteria 1122
362 Ga0210002_1036330 3300027617 Bacteria 829
363 Ga0209966_1000017 3300027695 Bacteria 71183
364 Ga0209813_10048962 3300027866 Bacteria 1314
365 Ga0209813_10097874 3300027866 Bacteria 994
366 Ga0209813_10411064 3300027866 Bacteria 547
367 Ga0209974_10000240 3300027876 Bacteria 17737
368 Ga0209974_10081232 3300027876 Bacteria 1116
369 Ga0268266_11434181 3300028379 Bacteria 666
370 Ga0268265_10962979 3300028380 Bacteria 841
371 Ga0268264_10050685 3300028381 Bacteria 3457
372 Ga0268264_11476563 3300028381 Bacteria 690
373 Ga0307517_10060779 3300028786 Bacteria 3588
374 Ga0307517_10064548 3300028786 Bacteria 3402
375 Ga0307515_10000354 3300028794 Bacteria 112621
376 Ga0307515_10007796 3300028794 Bacteria 21069
377 Ga0307515_10022668 3300028794 Bacteria 11052
378 Ga0307512_10021785 3300030522 Bacteria 5773
379 Ga0316180_1130869 3300030736 Bacteria 605
380 Ga0265332_10007658 3300031238 Bacteria 4880
381 Ga0265328_10019266 3300031239 Bacteria 2623
382 Ga0265328_10179358 3300031239 Bacteria 801
383 Ga0265329_10039870 3300031242 Bacteria 1508
384 Ga0265327_10000056 3300031251 Bacteria 243974
385 Ga0307513_10041205 3300031456 Bacteria 5100
386 Ga0307513_10456071 3300031456 Bacteria 1002
387 Ga0307509_10022375 3300031507 Bacteria 7127
388 Ga0307509_10305886 3300031507 Bacteria 1335
389 Ga0307509_10529316 3300031507 Bacteria 859
390 Ga0307509_11003006 3300031507 Bacteria 502
391 Ga0307408_101392350 3300031548 Bacteria 660
392 Ga0307408_101930907 3300031548 Bacteria 566
393 Ga0307508_10000043 3300031616 Bacteria 143889
394 Ga0307508_10819637 3300031616 Bacteria 549
395 Ga0307514_10001251 3300031649 Bacteria 33354
396 Ga0307514_10048623 3300031649 Bacteria 3303
397 Ga0307514_10448787 3300031649 Bacteria 635
398 Ga0265314_10004112 3300031711 Bacteria 13711
399 Ga0316576_10491434 3300031727 Bacteria 903
400 Ga0316576_11080681 3300031727 Bacteria 569
401 Ga0307516_10001691 3300031730 Bacteria 30381
402 Ga0307516_10050533 3300031730 Bacteria 4079
403 Ga0307516_10098801 3300031730 Bacteria 2737
404 Ga0307516_10448454 3300031730 Bacteria 947
405 Ga0307516_10643754 3300031730 Bacteria 715
406 Ga0307405_11725080 3300031731 Bacteria 555
407 Ga0316577_10131901 3300031733 Bacteria 1406
408 Ga0307413_10482850 3300031824 Bacteria 991
409 Ga0307413_11432399 3300031824 Bacteria 609
410 Ga0307410_11245878 3300031852 Bacteria 649
411 Ga0307406_10708777 3300031901 Bacteria 841
412 Ga0307406_10776367 3300031901 Bacteria 807
413 Ga0307412_10042383 3300031911 Bacteria 2957
414 Ga0307412_10258838 3300031911 Bacteria 1355
415 Ga0307412_10394411 3300031911 Bacteria 1125
416 Ga0307412_11123125 3300031911 Bacteria 700
417 Ga0307409_102287656 3300031995 Bacteria 570
418 Ga0307416_100080904 3300032002 Bacteria 2744
419 Ga0307416_101782698 3300032002 Bacteria 720
420 Ga0307416_103122858 3300032002 Bacteria 554
421 Ga0307416_103612871 3300032002 Bacteria 518
422 Ga0307416_103739296 3300032002 Bacteria 509
423 Ga0307411_10772200 3300032005 Bacteria 844
424 Ga0316585_10170124 3300032137 Bacteria 720
425 Ga0316593_10285432 3300032168 Bacteria 622
426 Ga0307507_10033702 3300033179 Bacteria 5310
427 Ga0316588_1144172 3300033528 Bacteria 609
428 Ga0316596_1120524 3300033541 Bacteria 714
429 Ga0373944_0006303 3300035089 Bacteria 3146
430 Ga0373941_0524949 3300035115 Bacteria 507
431 Ga0373945_0136824 3300035116 Bacteria 985
432 Ga0316574_0062386 3300035398 Bacteria 2342
433 Ga0373931_0007108 3300035691 Bacteria 5263
434 Ga0373931_0262302 3300035691 Bacteria 1055
435 Ga0373927_0048447 3300035695 Bacteria 2749
436 Ga0316582_0474042 3300036647 Bacteria 863
437 Ga0316584_0159207 3300036712 Bacteria 1678
438 Ga0373925_0046159 3300037068 Bacteria 3238
439 Ga0395899_0011812 3300037312 Bacteria 6684
440 Ga0395899_0028736 3300037312 Bacteria 4184
441 Ga0395899_0037196 3300037312 Bacteria 3649
442 Ga0395899_0965304 3300037312 Bacteria 516
443 Ga0395900_0006372 3300037418 Bacteria 12301
444 Ga0395900_0035948 3300037418 Bacteria 5104
445 Ga0395900_0132373 3300037418 Bacteria 2555
446 Ga0395900_0286476 3300037418 Bacteria 1637
447 Ga0395900_0517106 3300037418 Bacteria 1142
448 Ga0395900_1754385 3300037418 Bacteria 531
449 Ga0395898_0010814 3300037466 Bacteria 9535
450 Ga0395898_0036421 3300037466 Bacteria 4885
451 Ga0395898_0058613 3300037466 Bacteria 3748
452 Ga0395898_0107134 3300037466 Bacteria 2680
453 Ga0395905_0000088 3300037471 Bacteria 152506
454 Ga0395905_0000572 3300037471 Bacteria 49936
455 Ga0395905_0011982 3300037471 Bacteria 8361
456 Ga0395905_0012026 3300037471 Bacteria 8346
457 Ga0395905_0014382 3300037471 Bacteria 7560
458 Ga0395905_0027418 3300037471 Bacteria 5371
459 Ga0395905_0059072 3300037471 Bacteria 3585
460 Ga0395905_0060108 3300037471 Bacteria 3553
461 Ga0395905_0062421 3300037471 Bacteria 3485
462 Ga0395905_0069463 3300037471 Bacteria 3299
463 Ga0395905_0967167 3300037471 Bacteria 754
464 Ga0395905_1095994 3300037471 Bacteria 699
465 Ga0395905_1101169 3300037471 Bacteria 697
466 Ga0395901_0123193 3300038443 Bacteria 2724
467 Ga0395901_0195280 3300038443 Bacteria 2122
468 Ga0395901_0352224 3300038443 Bacteria 1519
469 Ga0395901_0388373 3300038443 Bacteria 1435
470 Ga0395901_0543406 3300038443 Bacteria 1178
471 Ga0395901_1077478 3300038443 Bacteria 775
472 Ga0395901_1483466 3300038443 Bacteria 634
473 Ga0436365_0965563 3300039437 Bacteria 969
474 Ga0436365_1322651 3300039437 Bacteria 521
475 Ga0436365_1608897 3300039437 Bacteria 678
476 Ga0436361_0577382 3300039447 Bacteria 5391
477 Ga0436361_0675139 3300039447 Bacteria 672
478 Ga0436361_0701864 3300039447 Bacteria 6726
479 Ga0436361_0944371 3300039447 Bacteria 6799
480 Ga0436361_1218189 3300039447 Bacteria 9496
481 Ga0439439_0029533 3300041406 Bacteria 1391
482 Ga0439453_0002156 3300041408 Bacteria 2671
483 Ga0439453_0180403 3300041408 Bacteria 515
484 Ga0439461_0015886 3300041410 Bacteria 1447
485 Ga0439461_0078680 3300041410 Bacteria 775
486 Ga0439461_0226220 3300041410 Bacteria 512
487 Ga0439466_0154303 3300041411 Bacteria 703
488 Ga0439465_0115913 3300041413 Bacteria 936
489 Ga0451787_747456 3300041441 Bacteria 1072
490 Ga0451789_0263010 3300041443 Bacteria 535
491 Ga0451789_0994690 3300041443 Bacteria 521
492 Ga0451790_40937 3300041444 Bacteria 728
493 Ga0451792_07629 3300041445 Bacteria 737
494 Ga0451791_0119703 3300041451 Bacteria 592
495 Ga0451791_0434493 3300041451 Bacteria 1543
496 Ga0451791_1528259 3300041451 Bacteria 642
497 Ga0451793_0444831 3300041452 Bacteria 1014
498 Ga0451797_0400801 3300041453 Bacteria 553
499 Ga0451795_0317897 3300041456 Bacteria 550
500 Ga0451795_0606043 3300041456 Bacteria 1025
501 Ga0451795_0709851 3300041456 Bacteria 613
502 Ga0451803_10289 3300041457 Bacteria 769
503 Ga0451798_0906264 3300041458 Bacteria 2347
504 Ga0451798_1010413 3300041458 Bacteria 526
505 Ga0451800_1407603 3300041459 Bacteria 812
506 Ga0451802_0165900 3300041460 Bacteria 1265
507 Ga0451802_1253790 3300041460 Bacteria 1899
508 Ga0451805_035215 3300041461 Bacteria 852
509 Ga0451805_050872 3300041461 Bacteria 709
510 Ga0451805_062719 3300041461 Bacteria 687
511 Ga0451804_0524043 3300041463 Bacteria 2620
512 Ga0451808_17493 3300041464 Bacteria 639
513 Ga0451807_0330362 3300041486 Bacteria 1112
514 Ga0451807_2270138 3300041486 Bacteria 564
515 Ga0451833_0330071 3300041491 Bacteria 1534
516 Ga0451833_0655318 3300041491 Bacteria 687
517 Ga0451835_0694273 3300041492 Bacteria 999
518 Ga0451837_1774988 3300041494 Bacteria 540
519 Ga0451841_0105846 3300041498 Bacteria 888
520 Ga0451841_0671554 3300041498 Bacteria 867
521 Ga0451841_1145597 3300041498 Bacteria 755
522 Ga0451845_0164481 3300041501 Bacteria 584
523 Ga0451847_0278715 3300041503 Bacteria 879
524 Ga0451850_04492 3300041506 Bacteria 577
525 Ga0451853_1259832 3300041512 Bacteria 1233
526 Ga0451853_1473800 3300041512 Bacteria 2221
527 Ga0452268_35386 3300041907 Bacteria 821
528 Ga0439432_068608 3300042006 Bacteria 1084
529 Ga0439449_0002153 3300042007 Bacteria 7734
530 Ga0439451_041027 3300042009 Bacteria 929
531 Ga0439457_008880 3300042014 Bacteria 2355
532 Ga0439457_149134 3300042014 Bacteria 562
533 Ga0450914_028955 3300042118 Bacteria 658
534 Ga0450914_048956 3300042118 Bacteria 553
535 Ga0450919_001279 3300042121 Bacteria 3288
536 Ga0450920_139938 3300042122 Bacteria 512
537 Ga0450890_015301 3300042127 Bacteria 1009
538 Ga0450894_027161 3300042131 Bacteria 788
539 Ga0450896_034195 3300042133 Bacteria 777
540 Ga0450898_006396 3300042134 Bacteria 1807
541 Ga0450898_155362 3300042134 Bacteria 502
542 Ga0439446_0049193 3300042156 Bacteria 1256
543 Ga0439458_0032273 3300042157 Bacteria 1251
544 Ga0439458_0053237 3300042157 Bacteria 1001
545 Ga0439434_0065387 3300042435 Bacteria 1141
546 Ga0439434_0316525 3300042435 Bacteria 541
547 Ga0439459_0143401 3300042438 Bacteria 619
548 Ga0439464_0007196 3300042439 Bacteria 2908
549 Ga0450916_044966 3300042530 Bacteria 682
550 Ga0450918_000202 3300042531 Bacteria 13469
551 Ga0450893_0001535 3300042532 Bacteria 3547
552 Ga0451577_0002525 3300042876 Bacteria 21654
553 Ga0451577_0045489 3300042876 Bacteria 3929
554 Ga0451577_0056391 3300042876 Bacteria 3504
555 Ga0451577_1605171 3300042876 Bacteria 574
556 Ga0466969_0000008 3300044656 Bacteria 139607
557 Ga0466969_0003553 3300044656 Bacteria 8290
558 Ga0466969_0009510 3300044656 Bacteria 5154
559 Ga0466969_0010304 3300044656 Bacteria 4958
560 Ga0466972_0088445 3300044658 Bacteria 1470
561 Ga0453683_0002014 3300044673 Bacteria 16403
562 Ga0453683_0306702 3300044673 Bacteria 1016
563 Ga0466965_0003131 3300044683 Bacteria 7212
564 Ga0466965_0059268 3300044683 Bacteria 1910
565 Ga0466965_0113646 3300044683 Bacteria 1393
566 Ga0466965_0333402 3300044683 Bacteria 828
567 Ga0466965_0566753 3300044683 Bacteria 643
568 Ga0466965_0828532 3300044683 Bacteria 537
569 Ga0466966_0001826 3300044684 Bacteria 13814
570 Ga0466966_0007945 3300044684 Bacteria 7027
571 Ga0466966_0008926 3300044684 Bacteria 6643
572 Ga0466966_0013800 3300044684 Bacteria 5346
573 Ga0466966_0153258 3300044684 Bacteria 1405
574 Ga0466966_0178938 3300044684 Bacteria 1287
575 Ga0466966_0502399 3300044684 Bacteria 729
576 Ga0466961_0027139 3300044693 Bacteria 3681
577 Ga0466961_0041448 3300044693 Bacteria 2951
578 Ga0466963_0006900 3300044694 Bacteria 6757
579 Ga0466963_0059746 3300044694 Bacteria 2545
580 Ga0466964_0002210 3300044706 Bacteria 6882
581 Ga0466964_0007297 3300044706 Bacteria 4134
582 Ga0466964_0154962 3300044706 Bacteria 1066
583 Ga0453684_0006310 3300044712 Bacteria 22635
584 Ga0453684_0077376 3300044712 Bacteria 4171
585 Ga0453684_2081783 3300044712 Bacteria 570
586 Ga0453684_2412378 3300044712 Bacteria 521
587 Ga0466971_0019502 3300044719 Bacteria 3012
588 Ga0466971_0110556 3300044719 Bacteria 1268
589 Ga0466968_0089169 3300044735 Bacteria 1364
590 Ga0466968_0216321 3300044735 Bacteria 901
591 Ga0466970_0015667 3300044765 Bacteria 3903
592 Ga0466970_0028777 3300044765 Bacteria 2922
593 Ga0466970_0047856 3300044765 Bacteria 2279
594 Ga0466970_0174607 3300044765 Bacteria 1191
595 Ga0466957_0001869 3300044842 Bacteria 11135
596 Ga0466957_0006607 3300044842 Bacteria 6559
597 Ga0466957_0090082 3300044842 Bacteria 1921
598 Ga0466960_0106510 3300044901 Bacteria 1450
599 Ga0466960_0924585 3300044901 Bacteria 533
600 Ga0466959_0000192 3300045049 Bacteria 40028
601 Ga0466959_0001900 3300045049 Bacteria 13149
602 Ga0466959_0146563 3300045049 Bacteria 1665
603 Ga0466959_0237356 3300045049 Bacteria 1260
604 Ga0466959_0310305 3300045049 Bacteria 1079
605 Ga0466959_0349911 3300045049 Bacteria 1007
606 Ga0451576_0002088 3300045051 Bacteria 31196
607 Ga0451576_0008890 3300045051 Bacteria 11723
608 Ga0451576_1541157 3300045051 Bacteria 690
609 Ga0451576_1645678 3300045051 Bacteria 665
610 Ga0466958_0074122 3300045836 Bacteria 2085
611 Ga0466958_0083497 3300045836 Bacteria 1969
612 Ga0466958_0150775 3300045836 Bacteria 1466
613 Ga0466967_0059458 3300045976 Bacteria 3383
614 Ga0466967_0772182 3300045976 Bacteria 953
615 Ga0466967_1042550 3300045976 Bacteria 815
616 Ga0466967_1936208 3300045976 Bacteria 586
617 Ga0495638_0598691 3300046460 Bacteria 542
618 Ga0495585_0021845 3300046492 Bacteria 3674
619 Ga0495610_0117871 3300046512 Bacteria 1167
620 Ga0495620_0053358 3300046515 Bacteria 1712
621 Ga0495632_0012504 3300046519 Bacteria 4894
622 Ga0495632_0101047 3300046519 Bacteria 1359
623 Ga0495643_0101814 3300046522 Bacteria 1471
624 Ga0495666_0502507 3300046526 Bacteria 542
625 Ga0495642_0034674 3300046528 Bacteria 2033
626 Ga0495598_0082466 3300046537 Bacteria 1034
627 Ga0495621_0011477 3300046539 Bacteria 2742
628 Ga0495621_0040523 3300046539 Bacteria 1633
629 Ga0495633_0294553 3300046558 Bacteria 737
630 Ga0495656_0001651 3300046615 Bacteria 7295
631 Ga0495656_0073823 3300046615 Bacteria 1522
632 Ga0495656_0646334 3300046615 Bacteria 568
633 Ga0495625_0003495 3300046660 Bacteria 15582
634 Ga0495661_0359139 3300046665 Bacteria 716
635 Ga0495588_0374758 3300046674 Bacteria 747
636 Ga0495658_0888972 3300046683 Bacteria 570
637 Ga0495669_0409337 3300046684 Bacteria 657
638 Ga0495670_0102184 3300046691 Bacteria 1477
639 Ga0495636_0024213 3300047318 Bacteria 2461
640 Ga0495636_0539224 3300047318 Bacteria 567
641 Ga0495677_0187090 3300047445 Bacteria 803
642 Ga0495685_072880 3300047447 Bacteria 1149
643 Ga0495681_0147366 3300047470 Bacteria 990
644 Ga0495686_0246667 3300047472 Bacteria 1005
645 Ga0495602_0423707 3300048088 Bacteria 945
646 Ga0496101_0438151 3300048904 Bacteria 1031
647 Ga0496101_1454457 3300048904 Bacteria 534
648 Ga0496102_0014575 3300048905 Bacteria 6833
649 Ga0496102_0018900 3300048905 Bacteria 6063
650 Ga0496104_0573549 3300048907 Bacteria 1039
651 Ga0496105_0314580 3300048908 Bacteria 1256
652 Ga0496106_0236334 3300048909 Bacteria 1460
653 Ga0496108_1420449 3300048911 Bacteria 580
654 Ga0496109_0040141 3300048912 Bacteria 4238
655 Ga0496109_0066448 3300048912 Bacteria 3302
656 Ga0496110_0054390 3300048913 Bacteria 3521
657 Ga0496110_1658731 3300048913 Bacteria 549
658 Ga0496114_0003154 3300048917 Bacteria 12645
659 Ga0501306_027905 3300049127 Bacteria 824
660 Ga0501306_045413 3300049127 Bacteria 692
661 Ga0501306_059872 3300049127 Bacteria 626
662 Ga0501308_017892 3300049128 Bacteria 862
663 Ga0501308_042937 3300049128 Bacteria 642
664 Ga0501308_044818 3300049128 Bacteria 632
665 Ga0501310_020091 3300049130 Bacteria 827
666 Ga0501310_027621 3300049130 Bacteria 740
667 Ga0501310_052438 3300049130 Bacteria 593
668 Ga0501310_066193 3300049130 Bacteria 547
669 Ga0501341_07304 3300049131 Bacteria 690
670 Ga0501304_013717 3300049160 Bacteria 744
671 Ga0501305_042175 3300049161 Bacteria 745
672 Ga0501305_044733 3300049161 Bacteria 729
673 Ga0501305_047534 3300049161 Bacteria 713
674 Ga0501307_046115 3300049162 Bacteria 645
675 Ga0501293_017900 3300049516 Bacteria 672
676 Ga0501311_025972 3300049527 Bacteria 823
677 Ga0501312_094047 3300049528 Bacteria 556
678 Ga0501313_013402 3300049529 Bacteria 963
679 Ga0501314_019790 3300049530 Bacteria 693
680 Ga0501314_023747 3300049530 Bacteria 652
681 Ga0501315_022610 3300049531 Bacteria 858
682 Ga0501315_049781 3300049531 Bacteria 656
683 Ga0501317_019606 3300049533 Bacteria 904
684 Ga0501318_022873 3300049534 Bacteria 804
685 Ga0501319_001294 3300049535 Bacteria 1417
686 Ga0501320_012097 3300049536 Bacteria 902
687 Ga0501320_026922 3300049536 Bacteria 697
688 Ga0501320_044150 3300049536 Bacteria 592
689 Ga0501321_027612 3300049537 Bacteria 742
690 Ga0501321_033459 3300049537 Bacteria 697
691 Ga0501321_045406 3300049537 Bacteria 629
692 Ga0501322_008434 3300049538 Bacteria 765
693 Ga0501323_033620 3300049539 Bacteria 729
694 Ga0501323_061789 3300049539 Bacteria 586
695 Ga0501324_021119 3300049540 Bacteria 666
696 Ga0501327_06633 3300049543 Bacteria 707
697 Ga0501032_0164787 3300049569 Bacteria 1455
698 Ga0501033_0198515 3300049570 Bacteria 1434
699 Ga0501034_0055180 3300049571 Bacteria 3999
700 Ga0501037_0187833 3300049573 Bacteria 1464
701 Ga0501037_0619022 3300049573 Bacteria 726
702 Ga0501038_0232521 3300049574 Bacteria 1466
703 Ga0501038_0278315 3300049574 Bacteria 1318
704 Ga0501042_0929024 3300049578 Bacteria 634
705 Ga0501043_0325193 3300049579 Bacteria 1172
706 Ga0501046_0068157 3300049580 Bacteria 2769
707 Ga0501047_0070728 3300049581 Bacteria 3359
708 Ga0501047_0346872 3300049581 Bacteria 1322
709 Ga0501048_0318858 3300049582 Bacteria 1107
710 Ga0501048_0842866 3300049582 Bacteria 659
711 Ga0501074_0725442 3300049590 Bacteria 701
712 Ga0501227_197108 3300049665 Bacteria 570
713 Ga0501249_218062 3300049679 Bacteria 507
714 Ga0501252_002187 3300049682 Bacteria 1917
715 Ga0501253_149420 3300049683 Bacteria 588
716 Ga0501257_041982 3300049686 Bacteria 1125
717 Ga0501080_0171737 3300049742 Bacteria 1999
718 Ga0501080_0423952 3300049742 Bacteria 1195
719 Ga0501263_005364 3300049760 Bacteria 1446
720 Ga0501268_034714 3300049765 Bacteria 928
721 Ga0501273_033534 3300049770 Bacteria 739
722 Ga0501035_0095501 3300049822 Bacteria 2613
723 Ga0501035_0312400 3300049822 Bacteria 1322
724 Ga0501044_0099572 3300049823 Bacteria 2925
725 nmdc:mga03683_101656_c1 3300050489 Bacteria 1264
726 nmdc:mga03683_179165_c1 3300050489 Bacteria 966
727 nmdc:mga03683_319533_c1 3300050489 Bacteria 731
728 nmdc:mga03683_37471_c1 3300050489 Bacteria 1976
729 nmdc:mga03683_405020_c1 3300050489 Bacteria 652
730 nmdc:mga03683_415430_c1 3300050489 Bacteria 644
731 nmdc:mga03683_68090_c1 3300050489 Bacteria 1517
732 nmdc:mga03n38_208653_c1 3300050490 Bacteria 1014
733 nmdc:mga03n38_34562_c1 3300050490 Bacteria 2160
734 nmdc:mga03n38_365470_c1 3300050490 Bacteria 788
735 nmdc:mga03n38_606486_c1 3300050490 Bacteria 624
736 nmdc:mga00v17_749059_c1 3300050491 Bacteria 624
737 nmdc:mga0yw44_101591_c1 3300050492 Bacteria 1832
738 nmdc:mga0yw44_1030714_c1 3300050492 Bacteria 557
739 nmdc:mga0yw44_260353_c1 3300050492 Bacteria 1156
740 nmdc:mga0yw44_77764_c1 3300050492 Bacteria 2073
741 nmdc:mga0k408_110974_c1 3300050493 Bacteria 1621
742 nmdc:mga0k408_147622_c1 3300050493 Bacteria 1400
743 nmdc:mga0k408_212564_c1 3300050493 Bacteria 772
744 nmdc:mga0k408_23280_c1 3300050493 Bacteria 3493
745 nmdc:mga0k408_254_c1 3300050493 Bacteria 29029
746 nmdc:mga0k408_276575_c1 3300050493 Bacteria 1002
747 nmdc:mga0k408_331477_c1 3300050493 Bacteria 908
748 nmdc:mga0k408_33733_c1 3300050493 Bacteria 2929
749 nmdc:mga0k408_498388_c1 3300050493 Bacteria 722
750 nmdc:mga0k408_53178_c1 3300050493 Bacteria 2347
751 nmdc:mga0k408_594239_c1 3300050493 Bacteria 653
752 nmdc:mga0k408_62721_c1 3300050493 Bacteria 2162
753 nmdc:mga0k408_786658_c1 3300050493 Bacteria 555
754 nmdc:mga0k408_8413_c1 3300050493 Bacteria 5535
755 nmdc:mga06z11_287036_c1 3300050494 Bacteria 976
756 nmdc:mga06z11_36498_c1 3300050494 Bacteria 2427
757 nmdc:mga06z11_471682_c1 3300050494 Bacteria 759
758 nmdc:mga06z11_59363_c1 3300050494 Bacteria 1988
759 nmdc:mga06z11_65821_c1 3300050494 Bacteria 1903
760 nmdc:mga06z11_996267_c1 3300050494 Bacteria 511
761 nmdc:mga04h51_214891_c1 3300050495 Bacteria 760
762 nmdc:mga07m45_10255_c1 3300050496 Bacteria 4888
763 nmdc:mga07m45_13149_c1 3300050496 Bacteria 4384
764 nmdc:mga07m45_219891_c1 3300050496 Bacteria 1105
765 nmdc:mga07m45_27799_c1 3300050496 Bacteria 3120
766 nmdc:mga07m45_331718_c1 3300050496 Bacteria 884
767 nmdc:mga07m45_6340_c1 3300050496 Bacteria 5972
768 nmdc:mga0sz30_15579_c2 3300050516 Bacteria 2385
769 nmdc:mga0sz30_28442_c1 3300050516 Bacteria 2301
770 Ga0500578_0001060 3300053086 Bacteria 29908
771 Ga0500643_031661 3300053087 Bacteria 1610
772 Ga0500644_0075298 3300053088 Bacteria 1227
773 Ga0500646_0004955 3300053090 Bacteria 3379
774 Ga0500583_0098484 3300053092 Bacteria 1430
775 Ga0500651_0006266 3300053093 Bacteria 6845
776 Ga0500651_0162877 3300053093 Bacteria 1333
777 Ga0500651_0195684 3300053093 Bacteria 1195
778 Ga0500651_0499061 3300053093 Bacteria 671
779 Ga0500650_0074562 3300053098 Bacteria 1586
780 Ga0500557_085454 3300053105 Bacteria 1044
781 Ga0500562_060524 3300053108 Bacteria 1017
782 Ga0500569_018717 3300053109 Bacteria 1793
783 Ga0500593_000440 3300053117 Bacteria 16359
784 Ga0500597_185142 3300053120 Bacteria 881
785 Ga0500628_003850 3300053129 Bacteria 2478
786 Ga0500642_0000805 3300053130 Bacteria 9200
787 Ga0500652_000299 3300053131 Bacteria 18083
788 Ga0500655_005214 3300053133 Bacteria 2344
789 Ga0500658_0216462 3300053134 Bacteria 878
790 Ga0500568_0018560 3300053139 Bacteria 3040
791 Ga0500577_0002588 3300053142 Bacteria 4632
792 Ga0500579_168047 3300053143 Bacteria 902
793 Ga0500604_0056358 3300053151 Bacteria 1224
794 Ga0500604_0356510 3300053151 Bacteria 508
795 Ga0500619_000127 3300053154 Bacteria 19880
796 Ga0500622_0000125 3300053156 Bacteria 81109
797 Ga0500622_0025655 3300053156 Bacteria 3113
798 Ga0500627_0432634 3300053158 Bacteria 556
799 Ga0500636_0368352 3300053177 Bacteria 679
800 Ga0500570_032674 3300053724 Bacteria 2798
801 Ga0500570_213015 3300053724 Bacteria 566
802 Ga0500645_110615 3300053730 Bacteria 771
803 Ga0500587_000581 3300053739 Bacteria 4534
804 Ga0590071_012006 3300059421 Bacteria 2030
805 Ga0590074_078125 3300059423 Bacteria 630
806 Ga0590075_125747 3300059424 Bacteria 672
807 Ga0587077_167875 3300059493 Bacteria 586
808 Ga0587080_157362 3300059503 Bacteria 530
809 Ga0587085_143891 3300059506 Bacteria 544
810 Ga0587088_080729 3300059508 Bacteria 696
811 Ga0587088_097564 3300059508 Bacteria 652
812 Ga0587091_094417 3300059511 Bacteria 692
813 Ga0587106_061154 3300059605 Bacteria 692
814 Ga0587101_060421 3300059623 Bacteria 675
815 Ga0587109_053532 3300059624 Bacteria 833
816 Ga0587109_218585 3300059624 Bacteria 504
817 Ga0587076_079566 3300059645 Bacteria 697
818 Ga0587100_043541 3300059648 Bacteria 512
819 Ga0501082_1017924 3300060353 Bacteria 724
820 Ga0466962_0005233 3300061719 Bacteria 6233
821 Ga0466962_0014889 3300061719 Bacteria 3748
822 2587725328 2585428057 Bacteria 6737412
823 2587731313 2585428058 Bacteria 6853932
824 2587754071 2585428062 Bacteria 6842168
825 2588290069 2588253510 Bacteria 6901809
826 2643972789 2643221592 Bacteria 6608788
827 2644143364 2643221625 Bacteria 6512927
828 2644244726 2643221644 Bacteria 6865017
829 2644276199 2643221648 Bacteria 6521465
830 2644340881 2643221660 Bacteria 4208257
831 Ga0500568_0037009
832 SwRhRL3b_contig_638870
833 JGI24740J21852_10035537
834 JGI24735J21928_10185972
835 JGI24744J21845_10075619
836 JGI25152J39213_1000892
837 JGI25150J39212_1002313
838 Ga0006778J45830_1018330
839 Ga0006759J45824_1013933
840 Ga0006759J45824_1017103
841 Ga0006759J45824_1023259
842 JGI25153J46596_10000420
843 Ga0006770J48903_1013780
844 rootH1_10043230
845 rootL2_10005413
846 rootL2_10083805
847 JGI26128J50194_1000218
848 JGI26145J50221_1002388
849 Ga0007417J51691_1011360
850 Ga0007417J51691_1011711
851 Ga0007417J51691_1017103
852 Ga0007417J51691_1045595
853 Ga0007417J51691_1114763
854 Ga0007427J51700_112861
855 Ga0007410J51695_1004507
856 Ga0007410J51695_1011000
857 Ga0007410J51695_1022391
858 Ga0007409J51694_1012913
859 Ga0007409J51694_1014513
860 Ga0007409J51694_1027825
861 Ga0007416J51690_1023874
862 Ga0007416J51690_1026130
863 Ga0007416J51690_1065410
864 Ga0007429J51699_1012803
865 Ga0007411J51799_105540
866 Ga0007411J51799_112204
867 Ga0007415J51800_103902
868 Ga0032354_1016521
869 Ga0032354_1024639
870 Ga0032354_1031837
871 Ga0032354_1037179
872 Ga0006780_1017431
873 Ga0055539_1012687
874 Ga0055526_1014626
875 Ga0055524_1000109
876 Ga0055530_10003385
877 Ga0055530_10034055
878 Ga0055540_1000013
879 Ga0055540_1009236
880 Ga0055540_1017082
881 Ga0055540_1095489
882 Ga0055540_1112322
883 Ga0055531_10000158
884 Ga0055531_10005660
885 Ga0058859_11701938
886 Ga0058859_11819676
887 Ga0058859_11829144
888 Ga0058863_10004931
889 Ga0058863_11886072
890 Ga0058861_12046980
891 Ga0058860_10070410
892 Ga0058860_12216250
893 Ga0065165_1002013
894 Ga0065165_1080711
895 Ga0065704_10527730
896 Ga0065707_10082503
897 Ga0065707_11023718
898 Ga0070658_10068891
899 Ga0070658_10320018
900 Ga0070658_10534964
901 Ga0070658_10649110
902 Ga0070677_10087294
903 Ga0068869_100297442
904 Ga0068869_101128982
905 Ga0070680_100134810
906 Ga0070682_100267190
907 Ga0068868_100229049
908 Ga0070660_100070483
909 Ga0070660_100108958
910 Ga0070660_100973026
911 Ga0070687_101193445
912 Ga0070661_100126267
913 Ga0070661_100748768
914 Ga0070668_100128990
915 Ga0070669_100054025
916 Ga0070671_101356837
917 Ga0070674_100113587
918 Ga0070674_100671121
919 Ga0070673_101356170
920 Ga0070659_100008466
921 Ga0070667_100116760
922 Ga0070667_100145381
923 Ga0070700_100058250
924 Ga0070663_100125498
925 Ga0070663_100377465
926 Ga0070678_100020291
927 Ga0070678_101574061
928 Ga0070681_10528773
929 Ga0068867_100001947
930 Ga0068867_101294889
931 Ga0068867_101571629
932 Ga0070706_100002083
933 Ga0070706_101829860
934 Ga0070698_100128634
935 Ga0070699_100243867
936 Ga0070679_100212564
937 Ga0070679_100500176
938 Ga0070684_101644640
939 Ga0068853_101067456
940 Ga0070672_101355696
941 Ga0070665_100842570
942 Ga0070665_100928564
943 Ga0068855_100032613
944 Ga0068855_100120364
945 Ga0068855_100142205
946 Ga0068852_100089473
947 Ga0068852_101219474
948 Ga0068859_101381555
949 Ga0068864_100200723
950 Ga0068864_100536369
951 Ga0068864_101282041
952 Ga0068866_10003673
953 Ga0068861_100006327
954 Ga0068861_101944555
955 Ga0068863_100071767
956 Ga0068863_100608432
957 Ga0068863_101633437
958 Ga0068858_101353515
959 Ga0068858_102085773
960 Ga0068860_100002278
961 Ga0068860_101796647
962 Ga0068862_100673631
963 Ga0075365_10023056
964 Ga0075365_10038406
965 Ga0075365_10144102
966 Ga0075365_10146992
967 Ga0075365_10986743
968 Ga0075368_10050993
969 Ga0075368_10084772
970 Ga0075368_10242439
971 Ga0075363_100019150
972 Ga0075363_100054717
973 Ga0075363_100100193
974 Ga0075363_100133175
975 Ga0075363_100410322
976 Ga0075363_100698830
977 Ga0075363_100727169
978 Ga0075364_10241644
979 Ga0075364_10439091
980 Ga0075364_10944518
981 Ga0075362_10043584
982 Ga0075362_10052438
983 Ga0075362_10057331
984 Ga0075362_10164527
985 Ga0075362_10182982
986 Ga0075362_10242245
987 Ga0075362_10718003
988 Ga0075367_10006143
989 Ga0075367_10007325
990 Ga0075367_10026991
991 Ga0075367_10399051
992 Ga0075369_10021846
993 Ga0075369_10031196
994 Ga0075366_10014821
995 Ga0075366_10035470
996 Ga0075366_10041460
997 Ga0075366_10050690
998 Ga0075366_10088935
999 Ga0075366_10103320
1000 Ga0075366_10127248
1001 Ga0075366_10144411
1002 Ga0075366_10240950
1003 Ga0075366_10246833
1004 Ga0075366_10254499
1005 Ga0075366_10326500
1006 Ga0075370_10002426
1007 Ga0075370_10002528
1008 Ga0075370_10015050
1009 Ga0075370_10232171
1010 Ga0075370_10252821
1011 Ga0068871_101698157
1012 Ga0068871_102191088
1013 Ga0075428_100473805
1014 Ga0075430_100033190
1015 Ga0075431_101382757
1016 Ga0075429_100074259
1017 Ga0068865_100031867
1018 Ga0097620_101381565
1019 Ga0079104_1000001
1020 Ga0105240_10017122
1021 Ga0105240_11888680
1022 Ga0111539_10608222
1023 Ga0111539_13201018
1024 Ga0105245_10170491
1025 Ga0105245_10311700
1026 Ga0105245_11663801
1027 Ga0105247_10944305
1028 Ga0114129_12840635
1029 Ga0105241_10083226
1030 Ga0105242_10469742
1031 Ga0105248_10721083
1032 Ga0105248_10854833
1033 Ga0105248_11268854
1034 Ga0105237_10518801
1035 Ga0105237_10675960
1036 Ga0105238_10145507
1037 Ga0105238_10594850
1038 Ga0105238_10794777
1039 Ga0105238_10872399
1040 Ga0105249_10037455
1041 Ga0105249_11185643
1042 Ga0105239_10804060
1043 Ga0157319_1021801
1044 Ga0157324_1059132
1045 Ga0157327_1010021
1046 Ga0157326_1076205
1047 Ga0157374_10236650
1048 Ga0157374_10691420
1049 Ga0157378_10015555
1050 Ga0157378_10206273
1051 Ga0157378_10551355
1052 Ga0157378_11520289
1053 Ga0157378_11659920
1054 Ga0163162_10280517
1055 Ga0157372_12402095
1056 Ga0157372_12455151
1057 Ga0157372_12707485
1058 Ga0157375_10717041
1059 Ga0163163_11320509
1060 Ga0182008_10401829
1061 Ga0182008_10759152
1062 Ga0157379_10591784
1063 Ga0157379_11390960
1064 Ga0157376_10049735
1065 Ga0157376_10531467
1066 Ga0157376_10558338
1067 Ga0182007_10088519
1068 Ga0182007_10202316
1069 Ga0163161_10230509
1070 Ga0163161_10658434
1071 Ga0197907_10563325
1072 Ga0206355_1480352
1073 Ga0213872_10038378
1074 Ga0213872_10060580
1075 Ga0207425_1000221
1076 Ga0209677_107129
1077 Ga0209129_1000012
1078 Ga0209129_1037315
1079 Ga0209129_1059813
1080 Ga0209129_1060622
1081 Ga0209565_1007217
1082 Ga0209673_1002136
1083 Ga0209673_1019202
1084 Ga0209673_1025942
1085 Ga0209675_1093185
1086 Ga0209564_1000022
1087 Ga0209758_1000124
1088 Ga0209758_1000234
1089 Ga0209758_1050104
1090 Ga0209050_1000315
1091 Ga0209050_1001261
1092 Ga0209256_1000015
1093 Ga0209256_1061637
1094 Ga0209051_1000022
1095 Ga0209051_1000315
1096 Ga0209051_1031528
1097 Ga0209051_1044906
1098 Ga0209051_1070569
1099 Ga0209257_1000030
1100 Ga0209257_1000309
1101 Ga0209257_1017837
1102 Ga0209257_1043746
1103 Ga0209257_1149665
1104 Ga0207642_10006139
1105 Ga0207705_10128716
1106 Ga0207705_10451851
1107 Ga0207705_10532263
1108 Ga0207705_10708206
1109 Ga0207705_10870637
1110 Ga0207684_10004074
1111 Ga0207684_10552915
1112 Ga0207654_10058756
1113 Ga0207707_10242094
1114 Ga0207707_10262963
1115 Ga0207695_10036310
1116 Ga0207671_10459625
1117 Ga0207660_10235701
1118 Ga0207662_10639229
1119 Ga0207657_10028808
1120 Ga0207657_10118894
1121 Ga0207657_10624643
1122 Ga0207657_10774667
1123 Ga0207657_11053164
1124 Ga0207649_10002064
1125 Ga0207649_10628388
1126 Ga0207652_10077772
1127 Ga0207646_10294313
1128 Ga0207681_10603067
1129 Ga0207694_10242803
1130 Ga0207694_10561120
1131 Ga0207687_10011249
1132 Ga0207687_10319509
1133 Ga0207644_10629291
1134 Ga0207690_10036483
1135 Ga0207690_10128789
1136 Ga0207690_11192968
1137 Ga0207690_11317780
1138 Ga0207669_10273879
1139 Ga0207704_10001183
1140 Ga0207665_10767968
1141 Ga0207691_10245468
1142 Ga0207689_10119995
1143 Ga0207689_10963758
1144 Ga0207689_11132038
1145 Ga0207679_10000671
1146 Ga0207679_10250461
1147 Ga0207667_10093668
1148 Ga0207667_10154780
1149 Ga0207667_11245366
1150 Ga0207712_10077901
1151 Ga0207668_10108702
1152 Ga0207668_11697051
1153 Ga0207658_10383710
1154 Ga0207677_10074561
1155 Ga0207677_10093561
1156 Ga0207703_11376543
1157 Ga0207703_11460681
1158 Ga0207703_11577849
1159 Ga0207639_11879807
1160 Ga0207678_10328650
1161 Ga0207678_10404304
1162 Ga0207678_10665796
1163 Ga0207708_10094171
1164 Ga0207702_10877865
1165 Ga0207641_10053268
1166 Ga0207641_11513988
1167 Ga0207641_12351324
1168 Ga0207648_10026441
1169 Ga0207648_10108549
1170 Ga0207648_11932623
1171 Ga0207676_10169748
1172 Ga0207674_10521733
1173 Ga0207675_100021908
1174 Ga0207675_100985369
1175 Ga0207675_101352285
1176 Ga0207675_101384761
1177 Ga0207683_10567937
1178 Ga0207683_11310273
1179 Ga0207683_11640870
1180 Ga0207698_10010712
1181 Ga0207698_10160408
1182 Ga0209281_1000057
1183 Ga0209973_1035866
1184 Ga0209969_1016260
1185 Ga0209981_1041424
1186 Ga0209996_1000964
1187 Ga0209995_1000738
1188 Ga0209968_1000202
1189 Ga0209999_1006976
1190 Ga0209999_1052179
1191 Ga0209970_1020316
1192 Ga0210002_1036330
1193 Ga0209966_1000017
1194 Ga0209813_10048962
1195 Ga0209813_10097874
1196 Ga0209813_10411064
1197 Ga0209974_10000240
1198 Ga0209974_10081232
1199 Ga0268266_11434181
1200 Ga0268265_10962979
1201 Ga0268264_10050685
1202 Ga0268264_11476563
1203 Ga0307517_10060779
1204 Ga0307517_10064548
1205 Ga0307515_10000354
1206 Ga0307515_10007796
1207 Ga0307515_10022668
1208 Ga0307512_10021785
1209 Ga0316180_1130869
1210 Ga0265332_10007658
1211 Ga0265328_10019266
1212 Ga0265328_10179358
1213 Ga0265329_10039870
1214 Ga0265327_10000056
1215 Ga0307513_10041205
1216 Ga0307513_10456071
1217 Ga0307509_10022375
1218 Ga0307509_10305886
1219 Ga0307509_10529316
1220 Ga0307509_11003006
1221 Ga0307408_101392350
1222 Ga0307408_101930907
1223 Ga0307508_10000043
1224 Ga0307508_10819637
1225 Ga0307514_10001251
1226 Ga0307514_10048623
1227 Ga0307514_10448787
1228 Ga0265314_10004112
1229 Ga0316576_10491434
1230 Ga0316576_11080681
1231 Ga0307516_10001691
1232 Ga0307516_10050533
1233 Ga0307516_10098801
1234 Ga0307516_10448454
1235 Ga0307516_10643754
1236 Ga0307405_11725080
1237 Ga0316577_10131901
1238 Ga0307413_10482850
1239 Ga0307413_11432399
1240 Ga0307410_11245878
1241 Ga0307406_10708777
1242 Ga0307406_10776367
1243 Ga0307412_10042383
1244 Ga0307412_10258838
1245 Ga0307412_10394411
1246 Ga0307412_11123125
1247 Ga0307409_102287656
1248 Ga0307416_100080904
1249 Ga0307416_101782698
1250 Ga0307416_103122858
1251 Ga0307416_103612871
1252 Ga0307416_103739296
1253 Ga0307411_10772200
1254 Ga0316585_10170124
1255 Ga0316593_10285432
1256 Ga0307507_10033702
1257 Ga0316588_1144172
1258 Ga0316596_1120524
1259 Ga0373944_0006303
1260 Ga0373941_0524949
1261 Ga0373945_0136824
1262 Ga0316574_0062386
1263 Ga0373931_0007108
1264 Ga0373931_0262302
1265 Ga0373927_0048447
1266 Ga0316582_0474042
1267 Ga0316584_0159207
1268 Ga0373925_0046159
1269 Ga0395899_0011812
1270 Ga0395899_0028736
1271 Ga0395899_0037196
1272 Ga0395899_0965304
1273 Ga0395900_0006372
1274 Ga0395900_0035948
1275 Ga0395900_0132373
1276 Ga0395900_0286476
1277 Ga0395900_0517106
1278 Ga0395900_1754385
1279 Ga0395898_0010814
1280 Ga0395898_0036421
1281 Ga0395898_0058613
1282 Ga0395898_0107134
1283 Ga0395905_0000088
1284 Ga0395905_0000572
1285 Ga0395905_0011982
1286 Ga0395905_0012026
1287 Ga0395905_0014382
1288 Ga0395905_0027418
1289 Ga0395905_0059072
1290 Ga0395905_0060108
1291 Ga0395905_0062421
1292 Ga0395905_0069463
1293 Ga0395905_0967167
1294 Ga0395905_1095994
1295 Ga0395905_1101169
1296 Ga0395901_0123193
1297 Ga0395901_0195280
1298 Ga0395901_0352224
1299 Ga0395901_0388373
1300 Ga0395901_0543406
1301 Ga0395901_1077478
1302 Ga0395901_1483466
1303 Ga0436365_0965563
1304 Ga0436365_1322651
1305 Ga0436365_1608897
1306 Ga0436361_0577382
1307 Ga0436361_0675139
1308 Ga0436361_0701864
1309 Ga0436361_0944371
1310 Ga0436361_1218189
1311 Ga0439439_0029533
1312 Ga0439453_0002156
1313 Ga0439453_0180403
1314 Ga0439461_0015886
1315 Ga0439461_0078680
1316 Ga0439461_0226220
1317 Ga0439466_0154303
1318 Ga0439465_0115913
1319 Ga0451787_747456
1320 Ga0451789_0263010
1321 Ga0451789_0994690
1322 Ga0451790_40937
1323 Ga0451792_07629
1324 Ga0451791_0119703
1325 Ga0451791_0434493
1326 Ga0451791_1528259
1327 Ga0451793_0444831
1328 Ga0451797_0400801
1329 Ga0451795_0317897
1330 Ga0451795_0606043
1331 Ga0451795_0709851
1332 Ga0451803_10289
1333 Ga0451798_0906264
1334 Ga0451798_1010413
1335 Ga0451800_1407603
1336 Ga0451802_0165900
1337 Ga0451802_1253790
1338 Ga0451805_035215
1339 Ga0451805_050872
1340 Ga0451805_062719
1341 Ga0451804_0524043
1342 Ga0451808_17493
1343 Ga0451807_0330362
1344 Ga0451807_2270138
1345 Ga0451833_0330071
1346 Ga0451833_0655318
1347 Ga0451835_0694273
1348 Ga0451837_1774988
1349 Ga0451841_0105846
1350 Ga0451841_0671554
1351 Ga0451841_1145597
1352 Ga0451845_0164481
1353 Ga0451847_0278715
1354 Ga0451850_04492
1355 Ga0451853_1259832
1356 Ga0451853_1473800
1357 Ga0452268_35386
1358 Ga0439432_068608
1359 Ga0439449_0002153
1360 Ga0439451_041027
1361 Ga0439457_008880
1362 Ga0439457_149134
1363 Ga0450914_028955
1364 Ga0450914_048956
1365 Ga0450919_001279
1366 Ga0450920_139938
1367 Ga0450890_015301
1368 Ga0450894_027161
1369 Ga0450896_034195
1370 Ga0450898_006396
1371 Ga0450898_155362
1372 Ga0439446_0049193
1373 Ga0439458_0032273
1374 Ga0439458_0053237
1375 Ga0439434_0065387
1376 Ga0439434_0316525
1377 Ga0439459_0143401
1378 Ga0439464_0007196
1379 Ga0450916_044966
1380 Ga0450918_000202
1381 Ga0450893_0001535
1382 Ga0451577_0002525
1383 Ga0451577_0045489
1384 Ga0451577_0056391
1385 Ga0451577_1605171
1386 Ga0466969_0000008
1387 Ga0466969_0003553
1388 Ga0466969_0009510
1389 Ga0466969_0010304
1390 Ga0466972_0088445
1391 Ga0453683_0002014
1392 Ga0453683_0306702
1393 Ga0466965_0003131
1394 Ga0466965_0059268
1395 Ga0466965_0113646
1396 Ga0466965_0333402
1397 Ga0466965_0566753
1398 Ga0466965_0828532
1399 Ga0466966_0001826
1400 Ga0466966_0007945
1401 Ga0466966_0008926
1402 Ga0466966_0013800
1403 Ga0466966_0153258
1404 Ga0466966_0178938
1405 Ga0466966_0502399
1406 Ga0466961_0027139
1407 Ga0466961_0041448
1408 Ga0466963_0006900
1409 Ga0466963_0059746
1410 Ga0466964_0002210
1411 Ga0466964_0007297
1412 Ga0466964_0154962
1413 Ga0453684_0006310
1414 Ga0453684_0077376
1415 Ga0453684_2081783
1416 Ga0453684_2412378
1417 Ga0466971_0019502
1418 Ga0466971_0110556
1419 Ga0466968_0089169
1420 Ga0466968_0216321
1421 Ga0466970_0015667
1422 Ga0466970_0028777
1423 Ga0466970_0047856
1424 Ga0466970_0174607
1425 Ga0466957_0001869
1426 Ga0466957_0006607
1427 Ga0466957_0090082
1428 Ga0466960_0106510
1429 Ga0466960_0924585
1430 Ga0466959_0000192
1431 Ga0466959_0001900
1432 Ga0466959_0146563
1433 Ga0466959_0237356
1434 Ga0466959_0310305
1435 Ga0466959_0349911
1436 Ga0451576_0002088
1437 Ga0451576_0008890
1438 Ga0451576_1541157
1439 Ga0451576_1645678
1440 Ga0466958_0074122
1441 Ga0466958_0083497
1442 Ga0466958_0150775
1443 Ga0466967_0059458
1444 Ga0466967_0772182
1445 Ga0466967_1042550
1446 Ga0466967_1936208
1447 Ga0495638_0598691
1448 Ga0495585_0021845
1449 Ga0495610_0117871
1450 Ga0495620_0053358
1451 Ga0495632_0012504
1452 Ga0495632_0101047
1453 Ga0495643_0101814
1454 Ga0495666_0502507
1455 Ga0495642_0034674
1456 Ga0495598_0082466
1457 Ga0495621_0011477
1458 Ga0495621_0040523
1459 Ga0495633_0294553
1460 Ga0495656_0001651
1461 Ga0495656_0073823
1462 Ga0495656_0646334
1463 Ga0495625_0003495
1464 Ga0495661_0359139
1465 Ga0495588_0374758
1466 Ga0495658_0888972
1467 Ga0495669_0409337
1468 Ga0495670_0102184
1469 Ga0495636_0024213
1470 Ga0495636_0539224
1471 Ga0495677_0187090
1472 Ga0495685_072880
1473 Ga0495681_0147366
1474 Ga0495686_0246667
1475 Ga0495602_0423707
1476 Ga0496101_0438151
1477 Ga0496101_1454457
1478 Ga0496102_0014575
1479 Ga0496102_0018900
1480 Ga0496104_0573549
1481 Ga0496105_0314580
1482 Ga0496106_0236334
1483 Ga0496108_1420449
1484 Ga0496109_0040141
1485 Ga0496109_0066448
1486 Ga0496110_0054390
1487 Ga0496110_1658731
1488 Ga0496114_0003154
1489 Ga0501306_027905
1490 Ga0501306_045413
1491 Ga0501306_059872
1492 Ga0501308_017892
1493 Ga0501308_042937
1494 Ga0501308_044818
1495 Ga0501310_020091
1496 Ga0501310_027621
1497 Ga0501310_052438
1498 Ga0501310_066193
1499 Ga0501341_07304
1500 Ga0501304_013717
1501 Ga0501305_042175
1502 Ga0501305_044733
1503 Ga0501305_047534
1504 Ga0501307_046115
1505 Ga0501293_017900
1506 Ga0501311_025972
1507 Ga0501312_094047
1508 Ga0501313_013402
1509 Ga0501314_019790
1510 Ga0501314_023747
1511 Ga0501315_022610
1512 Ga0501315_049781
1513 Ga0501317_019606
1514 Ga0501318_022873
1515 Ga0501319_001294
1516 Ga0501320_012097
1517 Ga0501320_026922
1518 Ga0501320_044150
1519 Ga0501321_027612
1520 Ga0501321_033459
1521 Ga0501321_045406
1522 Ga0501322_008434
1523 Ga0501323_033620
1524 Ga0501323_061789
1525 Ga0501324_021119
1526 Ga0501327_06633
1527 Ga0501032_0164787
1528 Ga0501033_0198515
1529 Ga0501034_0055180
1530 Ga0501037_0187833
1531 Ga0501037_0619022
1532 Ga0501038_0232521
1533 Ga0501038_0278315
1534 Ga0501042_0929024
1535 Ga0501043_0325193
1536 Ga0501046_0068157
1537 Ga0501047_0070728
1538 Ga0501047_0346872
1539 Ga0501048_0318858
1540 Ga0501048_0842866
1541 Ga0501074_0725442
1542 Ga0501227_197108
1543 Ga0501249_218062
1544 Ga0501252_002187
1545 Ga0501253_149420
1546 Ga0501257_041982
1547 Ga0501080_0171737
1548 Ga0501080_0423952
1549 Ga0501263_005364
1550 Ga0501268_034714
1551 Ga0501273_033534
1552 Ga0501035_0095501
1553 Ga0501035_0312400
1554 Ga0501044_0099572
1555 nmdc:mga03683_101656_c1
1556 nmdc:mga03683_179165_c1
1557 nmdc:mga03683_319533_c1
1558 nmdc:mga03683_37471_c1
1559 nmdc:mga03683_405020_c1
1560 nmdc:mga03683_415430_c1
1561 nmdc:mga03683_68090_c1
1562 nmdc:mga03n38_208653_c1
1563 nmdc:mga03n38_34562_c1
1564 nmdc:mga03n38_365470_c1
1565 nmdc:mga03n38_606486_c1
1566 nmdc:mga00v17_749059_c1
1567 nmdc:mga0yw44_101591_c1
1568 nmdc:mga0yw44_1030714_c1
1569 nmdc:mga0yw44_260353_c1
1570 nmdc:mga0yw44_77764_c1
1571 nmdc:mga0k408_110974_c1
1572 nmdc:mga0k408_147622_c1
1573 nmdc:mga0k408_212564_c1
1574 nmdc:mga0k408_23280_c1
1575 nmdc:mga0k408_254_c1
1576 nmdc:mga0k408_276575_c1
1577 nmdc:mga0k408_331477_c1
1578 nmdc:mga0k408_33733_c1
1579 nmdc:mga0k408_498388_c1
1580 nmdc:mga0k408_53178_c1
1581 nmdc:mga0k408_594239_c1
1582 nmdc:mga0k408_62721_c1
1583 nmdc:mga0k408_786658_c1
1584 nmdc:mga0k408_8413_c1
1585 nmdc:mga06z11_287036_c1
1586 nmdc:mga06z11_36498_c1
1587 nmdc:mga06z11_471682_c1
1588 nmdc:mga06z11_59363_c1
1589 nmdc:mga06z11_65821_c1
1590 nmdc:mga06z11_996267_c1
1591 nmdc:mga04h51_214891_c1
1592 nmdc:mga07m45_10255_c1
1593 nmdc:mga07m45_13149_c1
1594 nmdc:mga07m45_219891_c1
1595 nmdc:mga07m45_27799_c1
1596 nmdc:mga07m45_331718_c1
1597 nmdc:mga07m45_6340_c1
1598 nmdc:mga0sz30_15579_c2
1599 nmdc:mga0sz30_28442_c1
1600 Ga0500578_0001060
1601 Ga0500643_031661
1602 Ga0500644_0075298
1603 Ga0500646_0004955
1604 Ga0500583_0098484
1605 Ga0500651_0006266
1606 Ga0500651_0162877
1607 Ga0500651_0195684
1608 Ga0500651_0499061
1609 Ga0500650_0074562
1610 Ga0500557_085454
1611 Ga0500562_060524
1612 Ga0500569_018717
1613 Ga0500593_000440
1614 Ga0500597_185142
1615 Ga0500628_003850
1616 Ga0500642_0000805
1617 Ga0500652_000299
1618 Ga0500655_005214
1619 Ga0500658_0216462
1620 Ga0500568_0018560
1621 Ga0500577_0002588
1622 Ga0500579_168047
1623 Ga0500604_0056358
1624 Ga0500604_0356510
1625 Ga0500619_000127
1626 Ga0500622_0000125
1627 Ga0500622_0025655
1628 Ga0500627_0432634
1629 Ga0500636_0368352
1630 Ga0500570_032674
1631 Ga0500570_213015
1632 Ga0500645_110615
1633 Ga0500587_000581
1634 Ga0590071_012006
1635 Ga0590074_078125
1636 Ga0590075_125747
1637 Ga0587077_167875
1638 Ga0587080_157362
1639 Ga0587085_143891
1640 Ga0587088_080729
1641 Ga0587088_097564
1642 Ga0587091_094417
1643 Ga0587106_061154
1644 Ga0587101_060421
1645 Ga0587109_053532
1646 Ga0587109_218585
1647 Ga0587076_079566
1648 Ga0587100_043541
1649 Ga0501082_1017924
1650 Ga0466962_0005233
1651 Ga0466962_0014889
1652 2587725328
1653 2587731313
1654 2587754071
1655 2588290069
1656 2643972789
1657 2644143364
1658 2644244726
1659 2644276199
1660 2644340881

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

82

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8583 22 85
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.854 22 85
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.8484 24 85
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8398 22 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8274 22 85
ID Description Score Start End Superfamily
af_Q9NDU6_129_252_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8428 22 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8274 22 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8065 29 83 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8033 22 85 2.40.50.100
af_Q9Y3B2_6_56_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7894 29 83 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2S5N5K3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9057 29 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A5C8B9S1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9039 25 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A484PSD2-F1-model_v4 LSU ribosomal protein L27p 0.9012 25 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A2D6RJT0-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.8978 31 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A455UVJ5-F1-model_v4 deleted 0.8946 24 85

Map