F482689
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 831 | 312 | 831 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10000535|Ga0157369_1000053524 |
| Length | 177 |
| Sequence | MTSTFVVHVENKPGVLNRVASLFRRRAFNIESLTVGHTDKPGISRMTIVVEANLYKLVNVLRVDNITNQSSVFRDLAIIKVATTPESRAEIMQLAHVFRARVVDVTGESMVLETTGAEDKIDGLVEVLRPYGILEMARTGRVAMTRGASKQSDIQLDRRPVASATDPLDDEPVSYSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 178 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 218 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 219 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 220 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 223 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 224 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 4.21 |
| Rhizosphere | 95.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10028134 | 3300005290 | Bacteria | 1800 |
| 2 | Ga0065712_10088104 | 3300005290 | Bacteria | 2538 |
| 3 | Ga0065715_10123025 | 3300005293 | Bacteria | 2189 |
| 4 | Ga0065715_10222596 | 3300005293 | Bacteria | 1266 |
| 5 | Ga0065715_10263739 | 3300005293 | Unclassified | 1130 |
| 6 | Ga0065715_10359783 | 3300005293 | Bacteria | 937 |
| 7 | Ga0065715_10523175 | 3300005293 | Unclassified | 692 |
| 8 | Ga0065707_10495927 | 3300005295 | Unclassified | 761 |
| 9 | Ga0070676_10016794 | 3300005328 | Bacteria | 4046 |
| 10 | Ga0070683_101095220 | 3300005329 | Bacteria | 765 |
| 11 | Ga0070683_101228410 | 3300005329 | Unclassified | 720 |
| 12 | Ga0070690_100049633 | 3300005330 | Bacteria | 2676 |
| 13 | Ga0070690_100400749 | 3300005330 | Bacteria | 1008 |
| 14 | Ga0070670_100082999 | 3300005331 | Bacteria | 2754 |
| 15 | Ga0070670_100265915 | 3300005331 | Bacteria | 1496 |
| 16 | Ga0070670_100287138 | 3300005331 | Bacteria | 1437 |
| 17 | Ga0070670_100287351 | 3300005331 | Bacteria | 1436 |
| 18 | Ga0070670_100440446 | 3300005331 | Bacteria | 1154 |
| 19 | Ga0070677_10138642 | 3300005333 | Bacteria | 1119 |
| 20 | Ga0070677_10177799 | 3300005333 | Unclassified | 1011 |
| 21 | Ga0068869_100297242 | 3300005334 | Bacteria | 1303 |
| 22 | Ga0068869_100554170 | 3300005334 | Bacteria | 966 |
| 23 | Ga0070666_10152319 | 3300005335 | Bacteria | 1613 |
| 24 | Ga0070666_10358225 | 3300005335 | Bacteria | 1045 |
| 25 | Ga0070680_100470311 | 3300005336 | Bacteria | 1074 |
| 26 | Ga0068868_100093500 | 3300005338 | Bacteria | 2424 |
| 27 | Ga0068868_100102243 | 3300005338 | Bacteria | 2320 |
| 28 | Ga0070660_100040847 | 3300005339 | Bacteria | 3533 |
| 29 | Ga0070660_101156038 | 3300005339 | Unclassified | 656 |
| 30 | Ga0070689_100209031 | 3300005340 | Bacteria | 1596 |
| 31 | Ga0070689_100325822 | 3300005340 | Bacteria | 1284 |
| 32 | Ga0070691_10077586 | 3300005341 | Bacteria | 1621 |
| 33 | Ga0070687_100075395 | 3300005343 | Bacteria | 1824 |
| 34 | Ga0070661_100154456 | 3300005344 | Bacteria | 1736 |
| 35 | Ga0070661_100295756 | 3300005344 | Bacteria | 1259 |
| 36 | Ga0070692_10523771 | 3300005345 | Bacteria | 772 |
| 37 | Ga0070668_100168944 | 3300005347 | Bacteria | 1779 |
| 38 | Ga0070668_100226196 | 3300005347 | Bacteria | 1545 |
| 39 | Ga0070668_100403117 | 3300005347 | Bacteria | 1168 |
| 40 | Ga0070669_100027284 | 3300005353 | Bacteria | 4110 |
| 41 | Ga0070669_100030171 | 3300005353 | Bacteria | 3911 |
| 42 | Ga0070669_100081178 | 3300005353 | Bacteria | 2415 |
| 43 | Ga0070675_100000055 | 3300005354 | Bacteria | 68147 |
| 44 | Ga0070675_100031874 | 3300005354 | Bacteria | 4263 |
| 45 | Ga0070675_100060766 | 3300005354 | Bacteria | 3119 |
| 46 | Ga0070675_100240442 | 3300005354 | Bacteria | 1582 |
| 47 | Ga0070675_100322365 | 3300005354 | Bacteria | 1365 |
| 48 | Ga0070675_100349560 | 3300005354 | Bacteria | 1311 |
| 49 | Ga0070675_100390799 | 3300005354 | Bacteria | 1239 |
| 50 | Ga0070675_101132164 | 3300005354 | Bacteria | 720 |
| 51 | Ga0070671_100058300 | 3300005355 | Bacteria | 3214 |
| 52 | Ga0070671_100403894 | 3300005355 | Bacteria | 1169 |
| 53 | Ga0070671_100708167 | 3300005355 | Bacteria | 874 |
| 54 | Ga0070674_100002222 | 3300005356 | Bacteria | 10676 |
| 55 | Ga0070674_100092876 | 3300005356 | Bacteria | 2182 |
| 56 | Ga0070673_100007433 | 3300005364 | Bacteria | 7224 |
| 57 | Ga0070673_100199091 | 3300005364 | Bacteria | 1724 |
| 58 | Ga0070673_100317694 | 3300005364 | Bacteria | 1375 |
| 59 | Ga0070673_100657483 | 3300005364 | Bacteria | 960 |
| 60 | Ga0070688_100017585 | 3300005365 | Bacteria | 4106 |
| 61 | Ga0070688_100027256 | 3300005365 | Bacteria | 3402 |
| 62 | Ga0070667_100796677 | 3300005367 | Bacteria | 877 |
| 63 | Ga0070703_10155481 | 3300005406 | Bacteria | 863 |
| 64 | Ga0070709_10443042 | 3300005434 | Unclassified | 977 |
| 65 | Ga0070713_100222638 | 3300005436 | Bacteria | 1712 |
| 66 | Ga0070710_10673034 | 3300005437 | Bacteria | 728 |
| 67 | Ga0070701_10079196 | 3300005438 | Bacteria | 1775 |
| 68 | Ga0070701_10728502 | 3300005438 | Bacteria | 670 |
| 69 | Ga0070711_100704796 | 3300005439 | Bacteria | 850 |
| 70 | Ga0070705_100950133 | 3300005440 | Bacteria | 694 |
| 71 | Ga0070700_100002552 | 3300005441 | Bacteria | 9292 |
| 72 | Ga0070694_100008007 | 3300005444 | Bacteria | 6458 |
| 73 | Ga0070694_100167594 | 3300005444 | Bacteria | 1616 |
| 74 | Ga0070694_100417898 | 3300005444 | Bacteria | 1053 |
| 75 | Ga0070708_100185259 | 3300005445 | Bacteria | 1947 |
| 76 | Ga0070708_100505708 | 3300005445 | Bacteria | 1140 |
| 77 | Ga0070708_100821152 | 3300005445 | Bacteria | 874 |
| 78 | Ga0070678_100006004 | 3300005456 | Bacteria | 7079 |
| 79 | Ga0070678_100355349 | 3300005456 | Bacteria | 1261 |
| 80 | Ga0070678_100571548 | 3300005456 | Bacteria | 1006 |
| 81 | Ga0070678_100794180 | 3300005456 | Bacteria | 859 |
| 82 | Ga0070678_101106805 | 3300005456 | Bacteria | 732 |
| 83 | Ga0070662_100254206 | 3300005457 | Bacteria | 1414 |
| 84 | Ga0070662_100949411 | 3300005457 | Unclassified | 735 |
| 85 | Ga0070681_10139148 | 3300005458 | Bacteria | 2357 |
| 86 | Ga0070681_10142616 | 3300005458 | Bacteria | 2325 |
| 87 | Ga0070681_10145441 | 3300005458 | Bacteria | 2300 |
| 88 | Ga0070681_10236447 | 3300005458 | Bacteria | 1741 |
| 89 | Ga0070681_10574785 | 3300005458 | Bacteria | 1041 |
| 90 | Ga0070681_10592507 | 3300005458 | Bacteria | 1023 |
| 91 | Ga0070681_10885115 | 3300005458 | Bacteria | 811 |
| 92 | Ga0068867_100013308 | 3300005459 | Bacteria | 5828 |
| 93 | Ga0068867_100050115 | 3300005459 | Bacteria | 3076 |
| 94 | Ga0068867_100348555 | 3300005459 | Bacteria | 1235 |
| 95 | Ga0068867_100426367 | 3300005459 | Bacteria | 1125 |
| 96 | Ga0068867_100703347 | 3300005459 | Bacteria | 892 |
| 97 | Ga0068867_100858810 | 3300005459 | Bacteria | 814 |
| 98 | Ga0070685_10009755 | 3300005466 | Bacteria | 4976 |
| 99 | Ga0070706_100008764 | 3300005467 | Bacteria | 9424 |
| 100 | Ga0070706_100266451 | 3300005467 | Bacteria | 1599 |
| 101 | Ga0070706_100366713 | 3300005467 | Bacteria | 1342 |
| 102 | Ga0070706_101096955 | 3300005467 | Bacteria | 733 |
| 103 | Ga0070707_100155102 | 3300005468 | Bacteria | 2231 |
| 104 | Ga0070707_100968494 | 3300005468 | Bacteria | 816 |
| 105 | Ga0070707_101418963 | 3300005468 | Unclassified | 661 |
| 106 | Ga0070698_100068978 | 3300005471 | Bacteria | 3552 |
| 107 | Ga0070698_100258498 | 3300005471 | Bacteria | 1674 |
| 108 | Ga0070698_100377123 | 3300005471 | Bacteria | 1351 |
| 109 | Ga0070698_100494236 | 3300005471 | Bacteria | 1161 |
| 110 | Ga0070698_100554566 | 3300005471 | Bacteria | 1089 |
| 111 | Ga0070698_100649775 | 3300005471 | Bacteria | 996 |
| 112 | Ga0070699_100029670 | 3300005518 | Bacteria | 4716 |
| 113 | Ga0070699_100149832 | 3300005518 | Bacteria | 2063 |
| 114 | Ga0070699_100181668 | 3300005518 | Bacteria | 1867 |
| 115 | Ga0070699_100498816 | 3300005518 | Bacteria | 1106 |
| 116 | Ga0070699_100530642 | 3300005518 | Bacteria | 1070 |
| 117 | Ga0070699_100761591 | 3300005518 | Bacteria | 886 |
| 118 | Ga0070679_100031445 | 3300005530 | Bacteria | 5243 |
| 119 | Ga0070679_100109149 | 3300005530 | Bacteria | 2753 |
| 120 | Ga0070679_100395577 | 3300005530 | Bacteria | 1328 |
| 121 | Ga0070684_100276843 | 3300005535 | Bacteria | 1537 |
| 122 | Ga0070684_100321305 | 3300005535 | Bacteria | 1422 |
| 123 | Ga0070684_101149231 | 3300005535 | Bacteria | 730 |
| 124 | Ga0070697_100000183 | 3300005536 | Bacteria | 51905 |
| 125 | Ga0070697_100008131 | 3300005536 | Bacteria | 8185 |
| 126 | Ga0070697_100217771 | 3300005536 | Bacteria | 1627 |
| 127 | Ga0070697_100289369 | 3300005536 | Bacteria | 1407 |
| 128 | Ga0070697_100366502 | 3300005536 | Bacteria | 1246 |
| 129 | Ga0070697_101187959 | 3300005536 | Unclassified | 680 |
| 130 | Ga0068853_100520292 | 3300005539 | Bacteria | 1125 |
| 131 | Ga0070672_100007912 | 3300005543 | Bacteria | 7259 |
| 132 | Ga0070672_100091827 | 3300005543 | Bacteria | 2450 |
| 133 | Ga0070672_100269793 | 3300005543 | Bacteria | 1436 |
| 134 | Ga0070672_100554949 | 3300005543 | Bacteria | 998 |
| 135 | Ga0070672_100561505 | 3300005543 | Bacteria | 992 |
| 136 | Ga0070672_101350045 | 3300005543 | Bacteria | 637 |
| 137 | Ga0070686_100019068 | 3300005544 | Bacteria | 4036 |
| 138 | Ga0070686_100032957 | 3300005544 | Bacteria | 3180 |
| 139 | Ga0070686_100199450 | 3300005544 | Bacteria | 1433 |
| 140 | Ga0070686_100403686 | 3300005544 | Bacteria | 1040 |
| 141 | Ga0070695_100009349 | 3300005545 | Bacteria | 5831 |
| 142 | Ga0070695_100060928 | 3300005545 | Bacteria | 2446 |
| 143 | Ga0070695_100197478 | 3300005545 | Bacteria | 1435 |
| 144 | Ga0070695_100353988 | 3300005545 | Bacteria | 1101 |
| 145 | Ga0070696_100058403 | 3300005546 | Bacteria | 2694 |
| 146 | Ga0070696_100137584 | 3300005546 | Bacteria | 1782 |
| 147 | Ga0070696_100911756 | 3300005546 | Bacteria | 730 |
| 148 | Ga0070696_101022863 | 3300005546 | Unclassified | 691 |
| 149 | Ga0070693_100804050 | 3300005547 | Bacteria | 697 |
| 150 | Ga0070665_100039958 | 3300005548 | Bacteria | 4717 |
| 151 | Ga0070665_100043475 | 3300005548 | Bacteria | 4515 |
| 152 | Ga0070665_100147040 | 3300005548 | Bacteria | 2359 |
| 153 | Ga0070665_100774343 | 3300005548 | Bacteria | 972 |
| 154 | Ga0070665_101175684 | 3300005548 | Bacteria | 778 |
| 155 | Ga0070704_100003291 | 3300005549 | Bacteria | 9237 |
| 156 | Ga0070704_100134913 | 3300005549 | Bacteria | 1919 |
| 157 | Ga0070704_100747192 | 3300005549 | Bacteria | 871 |
| 158 | Ga0070704_100900635 | 3300005549 | Bacteria | 796 |
| 159 | Ga0068855_100065284 | 3300005563 | Bacteria | 4243 |
| 160 | Ga0070664_100524930 | 3300005564 | Bacteria | 1093 |
| 161 | Ga0070664_100586764 | 3300005564 | Bacteria | 1033 |
| 162 | Ga0070664_100708397 | 3300005564 | Bacteria | 938 |
| 163 | Ga0070664_101042540 | 3300005564 | Bacteria | 769 |
| 164 | Ga0068857_100200162 | 3300005577 | Bacteria | 1821 |
| 165 | Ga0068857_100210369 | 3300005577 | Bacteria | 1775 |
| 166 | Ga0068857_100462823 | 3300005577 | Bacteria | 1187 |
| 167 | Ga0068854_100711666 | 3300005578 | Bacteria | 868 |
| 168 | Ga0068856_100039480 | 3300005614 | Bacteria | 4635 |
| 169 | Ga0070702_100179897 | 3300005615 | Bacteria | 1383 |
| 170 | Ga0070702_100650997 | 3300005615 | Bacteria | 797 |
| 171 | Ga0068852_100403215 | 3300005616 | Bacteria | 1345 |
| 172 | Ga0068852_100941417 | 3300005616 | Unclassified | 882 |
| 173 | Ga0068859_100002955 | 3300005617 | Bacteria | 17241 |
| 174 | Ga0068859_100157307 | 3300005617 | Bacteria | 2350 |
| 175 | Ga0068859_100354151 | 3300005617 | Bacteria | 1563 |
| 176 | Ga0068859_100822033 | 3300005617 | Unclassified | 1016 |
| 177 | Ga0068859_100868094 | 3300005617 | Bacteria | 988 |
| 178 | Ga0068864_100010173 | 3300005618 | Bacteria | 7766 |
| 179 | Ga0068864_100412681 | 3300005618 | Bacteria | 1285 |
| 180 | Ga0068864_100492805 | 3300005618 | Bacteria | 1178 |
| 181 | Ga0068864_101097997 | 3300005618 | Bacteria | 792 |
| 182 | Ga0068866_10079689 | 3300005718 | Bacteria | 1755 |
| 183 | Ga0068866_10382751 | 3300005718 | Bacteria | 903 |
| 184 | Ga0068866_10620423 | 3300005718 | Unclassified | 732 |
| 185 | Ga0068861_101334175 | 3300005719 | Bacteria | 699 |
| 186 | Ga0068851_10118415 | 3300005834 | Bacteria | 1421 |
| 187 | Ga0068870_10493834 | 3300005840 | Bacteria | 815 |
| 188 | Ga0068863_100170185 | 3300005841 | Bacteria | 2089 |
| 189 | Ga0068863_100186126 | 3300005841 | Bacteria | 1995 |
| 190 | Ga0068863_100352264 | 3300005841 | Bacteria | 1434 |
| 191 | Ga0068863_100900118 | 3300005841 | Bacteria | 885 |
| 192 | Ga0068858_100096867 | 3300005842 | Bacteria | 2750 |
| 193 | Ga0068858_100182805 | 3300005842 | Bacteria | 1980 |
| 194 | Ga0068858_100183774 | 3300005842 | Bacteria | 1974 |
| 195 | Ga0068858_100295136 | 3300005842 | Bacteria | 1546 |
| 196 | Ga0068858_100307671 | 3300005842 | Bacteria | 1513 |
| 197 | Ga0068858_100423180 | 3300005842 | Bacteria | 1281 |
| 198 | Ga0068858_100559380 | 3300005842 | Bacteria | 1107 |
| 199 | Ga0068858_101226003 | 3300005842 | Bacteria | 738 |
| 200 | Ga0068858_101691431 | 3300005842 | Bacteria | 625 |
| 201 | Ga0068860_100228036 | 3300005843 | Bacteria | 1810 |
| 202 | Ga0068860_100339990 | 3300005843 | Bacteria | 1476 |
| 203 | Ga0068860_100419758 | 3300005843 | Bacteria | 1326 |
| 204 | Ga0068860_100631847 | 3300005843 | Bacteria | 1078 |
| 205 | Ga0068860_100831201 | 3300005843 | Unclassified | 938 |
| 206 | Ga0068862_100016873 | 3300005844 | Bacteria | 6076 |
| 207 | Ga0068862_100083941 | 3300005844 | Bacteria | 2767 |
| 208 | Ga0068862_100203507 | 3300005844 | Bacteria | 1786 |
| 209 | Ga0081455_10052704 | 3300005937 | Bacteria | 3481 |
| 210 | Ga0081455_10067100 | 3300005937 | Bacteria | 2991 |
| 211 | Ga0081455_10435669 | 3300005937 | Bacteria | 900 |
| 212 | Ga0081539_10010495 | 3300005985 | Bacteria | 7512 |
| 213 | Ga0081539_10200232 | 3300005985 | Bacteria | 923 |
| 214 | Ga0070717_10326941 | 3300006028 | Bacteria | 1367 |
| 215 | Ga0075432_10065960 | 3300006058 | Bacteria | 1295 |
| 216 | Ga0070716_100142150 | 3300006173 | Bacteria | 1532 |
| 217 | Ga0070716_100627900 | 3300006173 | Bacteria | 812 |
| 218 | Ga0097621_100003570 | 3300006237 | Bacteria | 10750 |
| 219 | Ga0097621_100006929 | 3300006237 | Bacteria | 8068 |
| 220 | Ga0097621_100031556 | 3300006237 | Bacteria | 4205 |
| 221 | Ga0097621_100073190 | 3300006237 | Bacteria | 2836 |
| 222 | Ga0097621_100437125 | 3300006237 | Bacteria | 1177 |
| 223 | Ga0097621_100484859 | 3300006237 | Bacteria | 1118 |
| 224 | Ga0075370_10519002 | 3300006353 | Bacteria | 720 |
| 225 | Ga0068871_100030849 | 3300006358 | Bacteria | 4225 |
| 226 | Ga0068871_100041326 | 3300006358 | Bacteria | 3697 |
| 227 | Ga0068871_100054112 | 3300006358 | Bacteria | 3255 |
| 228 | Ga0068871_100120424 | 3300006358 | Bacteria | 2216 |
| 229 | Ga0068871_100159232 | 3300006358 | Bacteria | 1930 |
| 230 | Ga0068871_100267807 | 3300006358 | Bacteria | 1492 |
| 231 | Ga0068871_100719785 | 3300006358 | Bacteria | 915 |
| 232 | Ga0068871_100919632 | 3300006358 | Bacteria | 811 |
| 233 | Ga0075428_100558654 | 3300006844 | Bacteria | 1223 |
| 234 | Ga0075428_100711794 | 3300006844 | Bacteria | 1069 |
| 235 | Ga0075431_100043842 | 3300006847 | Bacteria | 4613 |
| 236 | Ga0075433_10107599 | 3300006852 | Bacteria | 2472 |
| 237 | Ga0075433_10154090 | 3300006852 | Bacteria | 2044 |
| 238 | Ga0075433_10206021 | 3300006852 | Bacteria | 1748 |
| 239 | Ga0075433_10363199 | 3300006852 | Bacteria | 1279 |
| 240 | Ga0075434_100091700 | 3300006871 | Bacteria | 3040 |
| 241 | Ga0075434_100189701 | 3300006871 | Bacteria | 2076 |
| 242 | Ga0075434_100400293 | 3300006871 | Bacteria | 1394 |
| 243 | Ga0075434_100466636 | 3300006871 | Bacteria | 1284 |
| 244 | Ga0075434_100624961 | 3300006871 | Bacteria | 1096 |
| 245 | Ga0075434_100863765 | 3300006871 | Bacteria | 920 |
| 246 | Ga0068865_100113304 | 3300006881 | Bacteria | 2004 |
| 247 | Ga0068865_100558884 | 3300006881 | Unclassified | 962 |
| 248 | Ga0075436_100022674 | 3300006914 | Bacteria | 4314 |
| 249 | Ga0075436_100022932 | 3300006914 | Bacteria | 4288 |
| 250 | Ga0075436_100026842 | 3300006914 | Bacteria | 3965 |
| 251 | Ga0075436_100066077 | 3300006914 | Bacteria | 2499 |
| 252 | Ga0097620_100002955 | 3300006931 | Bacteria | 17241 |
| 253 | Ga0097620_100157303 | 3300006931 | Bacteria | 2350 |
| 254 | Ga0097620_100354142 | 3300006931 | Bacteria | 1563 |
| 255 | Ga0097620_100822048 | 3300006931 | Unclassified | 1016 |
| 256 | Ga0097620_100868119 | 3300006931 | Bacteria | 988 |
| 257 | Ga0075435_100000982 | 3300007076 | Bacteria | 18062 |
| 258 | Ga0075435_100004535 | 3300007076 | Bacteria | 9549 |
| 259 | Ga0075435_100008984 | 3300007076 | Bacteria | 7207 |
| 260 | Ga0075435_100012947 | 3300007076 | Bacteria | 6187 |
| 261 | Ga0075435_100064630 | 3300007076 | Bacteria | 2973 |
| 262 | Ga0075435_100099384 | 3300007076 | Bacteria | 2409 |
| 263 | Ga0075435_100118023 | 3300007076 | Bacteria | 2212 |
| 264 | Ga0075435_100165371 | 3300007076 | Bacteria | 1865 |
| 265 | Ga0075435_100744299 | 3300007076 | Bacteria | 853 |
| 266 | Ga0075435_100814850 | 3300007076 | Bacteria | 813 |
| 267 | Ga0105240_10178768 | 3300009093 | Bacteria | 2506 |
| 268 | Ga0105240_11185799 | 3300009093 | Bacteria | 809 |
| 269 | Ga0105240_11964780 | 3300009093 | Bacteria | 608 |
| 270 | Ga0111539_10028824 | 3300009094 | Bacteria | 6770 |
| 271 | Ga0111539_10088494 | 3300009094 | Bacteria | 3638 |
| 272 | Ga0111539_10153878 | 3300009094 | Bacteria | 2691 |
| 273 | Ga0111539_10403179 | 3300009094 | Bacteria | 1593 |
| 274 | Ga0111539_10736539 | 3300009094 | Bacteria | 1147 |
| 275 | Ga0111539_10867767 | 3300009094 | Bacteria | 1050 |
| 276 | Ga0111539_11159044 | 3300009094 | Bacteria | 898 |
| 277 | Ga0105245_10035083 | 3300009098 | Bacteria | 4451 |
| 278 | Ga0105245_10041645 | 3300009098 | Bacteria | 4094 |
| 279 | Ga0105245_10324400 | 3300009098 | Bacteria | 1518 |
| 280 | Ga0105245_10619704 | 3300009098 | Bacteria | 1110 |
| 281 | Ga0105245_10795086 | 3300009098 | Bacteria | 984 |
| 282 | Ga0105247_10008843 | 3300009101 | Bacteria | 6139 |
| 283 | Ga0105247_10123436 | 3300009101 | Bacteria | 1680 |
| 284 | Ga0105247_10568984 | 3300009101 | Bacteria | 836 |
| 285 | Ga0105247_11304512 | 3300009101 | Bacteria | 583 |
| 286 | Ga0114129_10010381 | 3300009147 | Bacteria | 13281 |
| 287 | Ga0114129_10011848 | 3300009147 | Bacteria | 12402 |
| 288 | Ga0114129_10028993 | 3300009147 | Bacteria | 7840 |
| 289 | Ga0114129_10029006 | 3300009147 | Bacteria | 7838 |
| 290 | Ga0114129_10079890 | 3300009147 | Bacteria | 4547 |
| 291 | Ga0114129_10106535 | 3300009147 | Bacteria | 3872 |
| 292 | Ga0114129_10165420 | 3300009147 | Bacteria | 3019 |
| 293 | Ga0114129_10324109 | 3300009147 | Bacteria | 2047 |
| 294 | Ga0114129_10396837 | 3300009147 | Bacteria | 1819 |
| 295 | Ga0114129_10399358 | 3300009147 | Bacteria | 1812 |
| 296 | Ga0114129_11152612 | 3300009147 | Bacteria | 968 |
| 297 | Ga0114129_11566788 | 3300009147 | Unclassified | 808 |
| 298 | Ga0105243_10161109 | 3300009148 | Bacteria | 1934 |
| 299 | Ga0105243_10201697 | 3300009148 | Bacteria | 1745 |
| 300 | Ga0105243_10602166 | 3300009148 | Bacteria | 1058 |
| 301 | Ga0105243_11198788 | 3300009148 | Bacteria | 772 |
| 302 | Ga0105241_10305154 | 3300009174 | Bacteria | 1367 |
| 303 | Ga0105241_10537928 | 3300009174 | Bacteria | 1047 |
| 304 | Ga0105242_10021080 | 3300009176 | Bacteria | 5114 |
| 305 | Ga0105242_10203318 | 3300009176 | Bacteria | 1760 |
| 306 | Ga0105242_10206044 | 3300009176 | Bacteria | 1749 |
| 307 | Ga0105242_10424778 | 3300009176 | Bacteria | 1246 |
| 308 | Ga0105242_10640460 | 3300009176 | Bacteria | 1032 |
| 309 | Ga0105242_10715420 | 3300009176 | Bacteria | 981 |
| 310 | Ga0105242_10807308 | 3300009176 | Bacteria | 929 |
| 311 | Ga0105248_10005653 | 3300009177 | Bacteria | 13734 |
| 312 | Ga0105248_10007812 | 3300009177 | Bacteria | 11743 |
| 313 | Ga0105248_10011297 | 3300009177 | Bacteria | 9846 |
| 314 | Ga0105248_10027045 | 3300009177 | Bacteria | 6382 |
| 315 | Ga0105248_10121507 | 3300009177 | Bacteria | 2946 |
| 316 | Ga0105248_10359038 | 3300009177 | Bacteria | 1640 |
| 317 | Ga0105248_10442687 | 3300009177 | Bacteria | 1464 |
| 318 | Ga0105248_10482458 | 3300009177 | Bacteria | 1397 |
| 319 | Ga0105248_10848019 | 3300009177 | Bacteria | 1031 |
| 320 | Ga0105248_11079895 | 3300009177 | Bacteria | 907 |
| 321 | Ga0105248_11231595 | 3300009177 | Bacteria | 846 |
| 322 | Ga0105237_10648600 | 3300009545 | Bacteria | 1062 |
| 323 | Ga0105238_10569141 | 3300009551 | Bacteria | 1138 |
| 324 | Ga0105238_11691954 | 3300009551 | Unclassified | 664 |
| 325 | Ga0105249_10044597 | 3300009553 | Bacteria | 4031 |
| 326 | Ga0105249_10187100 | 3300009553 | Bacteria | 2018 |
| 327 | Ga0105249_10607899 | 3300009553 | Bacteria | 1148 |
| 328 | Ga0105249_11303145 | 3300009553 | Bacteria | 798 |
| 329 | Ga0105239_11509220 | 3300010375 | Bacteria | 777 |
| 330 | Ga0105246_10131282 | 3300011119 | Bacteria | 1871 |
| 331 | Ga0157369_10000535 | 3300013105 | Bacteria | 50270 |
| 332 | Ga0157374_10021328 | 3300013296 | Bacteria | 5763 |
| 333 | Ga0157374_10254783 | 3300013296 | Bacteria | 1728 |
| 334 | Ga0157374_10886338 | 3300013296 | Bacteria | 910 |
| 335 | Ga0157378_10004694 | 3300013297 | Bacteria | 11989 |
| 336 | Ga0157378_10438723 | 3300013297 | Bacteria | 1294 |
| 337 | Ga0157378_11549450 | 3300013297 | Bacteria | 708 |
| 338 | Ga0163162_10017908 | 3300013306 | Bacteria | 6931 |
| 339 | Ga0163162_10378521 | 3300013306 | Bacteria | 1549 |
| 340 | Ga0163162_11306328 | 3300013306 | Bacteria | 824 |
| 341 | Ga0163162_11631134 | 3300013306 | Bacteria | 736 |
| 342 | Ga0157375_10110326 | 3300013308 | Bacteria | 2848 |
| 343 | Ga0157375_10188271 | 3300013308 | Bacteria | 2218 |
| 344 | Ga0157375_10491558 | 3300013308 | Bacteria | 1392 |
| 345 | Ga0157375_10494202 | 3300013308 | Bacteria | 1388 |
| 346 | Ga0157375_11214937 | 3300013308 | Unclassified | 884 |
| 347 | Ga0157375_11287010 | 3300013308 | Bacteria | 859 |
| 348 | Ga0157375_11490877 | 3300013308 | Unclassified | 798 |
| 349 | Ga0163163_10004562 | 3300014325 | Bacteria | 11825 |
| 350 | Ga0163163_10053731 | 3300014325 | Bacteria | 3977 |
| 351 | Ga0163163_10177578 | 3300014325 | Bacteria | 2176 |
| 352 | Ga0163163_10970033 | 3300014325 | Bacteria | 913 |
| 353 | Ga0163163_11025509 | 3300014325 | Bacteria | 888 |
| 354 | Ga0157380_10031422 | 3300014326 | Bacteria | 4076 |
| 355 | Ga0157380_10114323 | 3300014326 | Bacteria | 2274 |
| 356 | Ga0157380_10126530 | 3300014326 | Bacteria | 2172 |
| 357 | Ga0157380_10249218 | 3300014326 | Bacteria | 1606 |
| 358 | Ga0157380_10419568 | 3300014326 | Bacteria | 1276 |
| 359 | Ga0157380_11489736 | 3300014326 | Bacteria | 729 |
| 360 | Ga0157377_10018695 | 3300014745 | Bacteria | 3606 |
| 361 | Ga0157379_10019746 | 3300014968 | Bacteria | 5955 |
| 362 | Ga0157379_10056109 | 3300014968 | Bacteria | 3520 |
| 363 | Ga0157379_10217435 | 3300014968 | Bacteria | 1731 |
| 364 | Ga0157379_10660466 | 3300014968 | Unclassified | 979 |
| 365 | Ga0157379_11246994 | 3300014968 | Bacteria | 716 |
| 366 | Ga0157376_10017840 | 3300014969 | Bacteria | 5425 |
| 367 | Ga0157376_10173723 | 3300014969 | Bacteria | 1964 |
| 368 | Ga0157376_10256817 | 3300014969 | Bacteria | 1635 |
| 369 | Ga0157376_10513640 | 3300014969 | Bacteria | 1180 |
| 370 | Ga0157376_10606233 | 3300014969 | Bacteria | 1090 |
| 371 | Ga0157376_10708893 | 3300014969 | Bacteria | 1012 |
| 372 | Ga0157376_11188491 | 3300014969 | Bacteria | 790 |
| 373 | Ga0163161_10105378 | 3300017792 | Bacteria | 2103 |
| 374 | Ga0213876_10071763 | 3300021384 | Bacteria | 1828 |
| 375 | Ga0207697_10106579 | 3300025315 | Bacteria | 1198 |
| 376 | Ga0207653_10049650 | 3300025885 | Bacteria | 1393 |
| 377 | Ga0207682_10053288 | 3300025893 | Bacteria | 1678 |
| 378 | Ga0207692_10562501 | 3300025898 | Bacteria | 730 |
| 379 | Ga0207642_10081113 | 3300025899 | Bacteria | 1575 |
| 380 | Ga0207710_10005396 | 3300025900 | Bacteria | 5512 |
| 381 | Ga0207710_10048765 | 3300025900 | Bacteria | 1896 |
| 382 | Ga0207680_10093938 | 3300025903 | Bacteria | 1914 |
| 383 | Ga0207680_10116783 | 3300025903 | Bacteria | 1739 |
| 384 | Ga0207647_10350199 | 3300025904 | Bacteria | 836 |
| 385 | Ga0207699_10007807 | 3300025906 | Bacteria | 5243 |
| 386 | Ga0207645_10005828 | 3300025907 | Bacteria | 8881 |
| 387 | Ga0207645_10500498 | 3300025907 | Bacteria | 823 |
| 388 | Ga0207643_10138433 | 3300025908 | Bacteria | 1453 |
| 389 | Ga0207643_10316694 | 3300025908 | Bacteria | 973 |
| 390 | Ga0207705_10777142 | 3300025909 | Unclassified | 744 |
| 391 | Ga0207684_10035016 | 3300025910 | Bacteria | 4264 |
| 392 | Ga0207684_10499743 | 3300025910 | Bacteria | 1042 |
| 393 | Ga0207707_10095448 | 3300025912 | Bacteria | 2599 |
| 394 | Ga0207707_10280198 | 3300025912 | Bacteria | 1444 |
| 395 | Ga0207707_10356677 | 3300025912 | Bacteria | 1259 |
| 396 | Ga0207707_10795300 | 3300025912 | Bacteria | 788 |
| 397 | Ga0207695_10191244 | 3300025913 | Bacteria | 1964 |
| 398 | Ga0207693_10270581 | 3300025915 | Unclassified | 1331 |
| 399 | Ga0207662_10690516 | 3300025918 | Unclassified | 715 |
| 400 | Ga0207657_10052141 | 3300025919 | Bacteria | 3552 |
| 401 | Ga0207649_10069334 | 3300025920 | Bacteria | 2245 |
| 402 | Ga0207649_10212637 | 3300025920 | Bacteria | 1373 |
| 403 | Ga0207649_10630931 | 3300025920 | Bacteria | 826 |
| 404 | Ga0207649_10692320 | 3300025920 | Unclassified | 790 |
| 405 | Ga0207652_10089413 | 3300025921 | Bacteria | 2704 |
| 406 | Ga0207652_10482256 | 3300025921 | Bacteria | 1117 |
| 407 | Ga0207646_10075158 | 3300025922 | Bacteria | 3019 |
| 408 | Ga0207646_10225443 | 3300025922 | Bacteria | 1693 |
| 409 | Ga0207646_10232494 | 3300025922 | Bacteria | 1666 |
| 410 | Ga0207646_10455607 | 3300025922 | Bacteria | 1154 |
| 411 | Ga0207646_11123642 | 3300025922 | Unclassified | 691 |
| 412 | Ga0207681_10039330 | 3300025923 | Bacteria | 3139 |
| 413 | Ga0207681_10118780 | 3300025923 | Bacteria | 1936 |
| 414 | Ga0207681_10156649 | 3300025923 | Bacteria | 1712 |
| 415 | Ga0207681_10227138 | 3300025923 | Bacteria | 1447 |
| 416 | Ga0207650_10146594 | 3300025925 | Bacteria | 1860 |
| 417 | Ga0207650_10147551 | 3300025925 | Bacteria | 1854 |
| 418 | Ga0207650_10232978 | 3300025925 | Bacteria | 1486 |
| 419 | Ga0207650_10280784 | 3300025925 | Bacteria | 1356 |
| 420 | Ga0207650_10287158 | 3300025925 | Bacteria | 1341 |
| 421 | Ga0207650_10300057 | 3300025925 | Bacteria | 1312 |
| 422 | Ga0207650_10375507 | 3300025925 | Bacteria | 1173 |
| 423 | Ga0207659_10001583 | 3300025926 | Bacteria | 13492 |
| 424 | Ga0207659_10009341 | 3300025926 | Bacteria | 6123 |
| 425 | Ga0207659_10280573 | 3300025926 | Bacteria | 1362 |
| 426 | Ga0207659_10418444 | 3300025926 | Bacteria | 1123 |
| 427 | Ga0207659_10681566 | 3300025926 | Bacteria | 880 |
| 428 | Ga0207659_11144104 | 3300025926 | Bacteria | 669 |
| 429 | Ga0207687_10031081 | 3300025927 | Bacteria | 3607 |
| 430 | Ga0207687_10260912 | 3300025927 | Bacteria | 1381 |
| 431 | Ga0207687_10334828 | 3300025927 | Bacteria | 1229 |
| 432 | Ga0207700_10023717 | 3300025928 | Bacteria | 4237 |
| 433 | Ga0207644_10009889 | 3300025931 | Bacteria | 6275 |
| 434 | Ga0207644_10511048 | 3300025931 | Bacteria | 992 |
| 435 | Ga0207690_10248881 | 3300025932 | Bacteria | 1372 |
| 436 | Ga0207690_11040034 | 3300025932 | Bacteria | 682 |
| 437 | Ga0207690_11222926 | 3300025932 | Bacteria | 627 |
| 438 | Ga0207706_10088113 | 3300025933 | Bacteria | 2729 |
| 439 | Ga0207706_10282016 | 3300025933 | Bacteria | 1449 |
| 440 | Ga0207686_10015837 | 3300025934 | Bacteria | 4224 |
| 441 | Ga0207686_10042044 | 3300025934 | Bacteria | 2791 |
| 442 | Ga0207686_10079551 | 3300025934 | Bacteria | 2135 |
| 443 | Ga0207686_10888266 | 3300025934 | Bacteria | 718 |
| 444 | Ga0207686_11200363 | 3300025934 | Unclassified | 621 |
| 445 | Ga0207709_10254819 | 3300025935 | Bacteria | 1284 |
| 446 | Ga0207670_10188595 | 3300025936 | Bacteria | 1559 |
| 447 | Ga0207670_10259611 | 3300025936 | Bacteria | 1346 |
| 448 | Ga0207669_10163677 | 3300025937 | Bacteria | 1575 |
| 449 | Ga0207704_10004287 | 3300025938 | Bacteria | 6517 |
| 450 | Ga0207704_10484842 | 3300025938 | Unclassified | 993 |
| 451 | Ga0207665_10536443 | 3300025939 | Bacteria | 908 |
| 452 | Ga0207691_10051210 | 3300025940 | Bacteria | 3776 |
| 453 | Ga0207691_10183103 | 3300025940 | Bacteria | 1830 |
| 454 | Ga0207691_10205776 | 3300025940 | Bacteria | 1711 |
| 455 | Ga0207691_10269977 | 3300025940 | Bacteria | 1465 |
| 456 | Ga0207691_10616099 | 3300025940 | Bacteria | 918 |
| 457 | Ga0207711_10008211 | 3300025941 | Bacteria | 8738 |
| 458 | Ga0207711_10012271 | 3300025941 | Bacteria | 7124 |
| 459 | Ga0207711_10160489 | 3300025941 | Bacteria | 2034 |
| 460 | Ga0207711_10351520 | 3300025941 | Bacteria | 1365 |
| 461 | Ga0207711_10419410 | 3300025941 | Bacteria | 1245 |
| 462 | Ga0207711_10472957 | 3300025941 | Bacteria | 1167 |
| 463 | Ga0207711_10948906 | 3300025941 | Bacteria | 799 |
| 464 | Ga0207689_10542798 | 3300025942 | Unclassified | 976 |
| 465 | Ga0207689_10678505 | 3300025942 | Bacteria | 868 |
| 466 | Ga0207661_11116385 | 3300025944 | Unclassified | 726 |
| 467 | Ga0207661_11121162 | 3300025944 | Bacteria | 724 |
| 468 | Ga0207679_10493835 | 3300025945 | Bacteria | 1091 |
| 469 | Ga0207679_10577089 | 3300025945 | Bacteria | 1011 |
| 470 | Ga0207679_10838057 | 3300025945 | Bacteria | 839 |
| 471 | Ga0207667_11283812 | 3300025949 | Unclassified | 709 |
| 472 | Ga0207651_10015397 | 3300025960 | Bacteria | 4443 |
| 473 | Ga0207651_10056524 | 3300025960 | Bacteria | 2701 |
| 474 | Ga0207651_10076797 | 3300025960 | Bacteria | 2389 |
| 475 | Ga0207651_10111454 | 3300025960 | Bacteria | 2055 |
| 476 | Ga0207651_10409635 | 3300025960 | Bacteria | 1155 |
| 477 | Ga0207651_10447422 | 3300025960 | Bacteria | 1108 |
| 478 | Ga0207651_10642570 | 3300025960 | Unclassified | 931 |
| 479 | Ga0207651_10833295 | 3300025960 | Unclassified | 819 |
| 480 | Ga0207651_11380495 | 3300025960 | Bacteria | 634 |
| 481 | Ga0207712_10070741 | 3300025961 | Bacteria | 2507 |
| 482 | Ga0207712_10450251 | 3300025961 | Bacteria | 1092 |
| 483 | Ga0207668_10110058 | 3300025972 | Bacteria | 2065 |
| 484 | Ga0207668_10200435 | 3300025972 | Bacteria | 1589 |
| 485 | Ga0207668_10321112 | 3300025972 | Bacteria | 1285 |
| 486 | Ga0207668_10871922 | 3300025972 | Bacteria | 800 |
| 487 | Ga0207640_10042422 | 3300025981 | Bacteria | 2900 |
| 488 | Ga0207640_10127195 | 3300025981 | Bacteria | 1836 |
| 489 | Ga0207640_10338163 | 3300025981 | Bacteria | 1205 |
| 490 | Ga0207658_10011360 | 3300025986 | Bacteria | 6060 |
| 491 | Ga0207658_10419894 | 3300025986 | Bacteria | 1179 |
| 492 | Ga0207677_10141763 | 3300026023 | Bacteria | 1841 |
| 493 | Ga0207703_10066805 | 3300026035 | Bacteria | 2959 |
| 494 | Ga0207703_10089972 | 3300026035 | Bacteria | 2578 |
| 495 | Ga0207703_10115837 | 3300026035 | Bacteria | 2293 |
| 496 | Ga0207703_10128427 | 3300026035 | Bacteria | 2186 |
| 497 | Ga0207703_10158107 | 3300026035 | Bacteria | 1983 |
| 498 | Ga0207703_10358993 | 3300026035 | Bacteria | 1343 |
| 499 | Ga0207703_11366459 | 3300026035 | Bacteria | 681 |
| 500 | Ga0207708_10014324 | 3300026075 | Bacteria | 5933 |
| 501 | Ga0207708_10115747 | 3300026075 | Bacteria | 2085 |
| 502 | Ga0207708_10159967 | 3300026075 | Bacteria | 1778 |
| 503 | Ga0207708_10637460 | 3300026075 | Bacteria | 906 |
| 504 | Ga0207708_10698468 | 3300026075 | Bacteria | 867 |
| 505 | Ga0207708_10861093 | 3300026075 | Bacteria | 783 |
| 506 | Ga0207702_10025917 | 3300026078 | Bacteria | 4868 |
| 507 | Ga0207641_10007357 | 3300026088 | Bacteria | 9166 |
| 508 | Ga0207648_10045119 | 3300026089 | Bacteria | 3867 |
| 509 | Ga0207648_10080951 | 3300026089 | Bacteria | 2833 |
| 510 | Ga0207648_10167183 | 3300026089 | Bacteria | 1944 |
| 511 | Ga0207648_10189219 | 3300026089 | Bacteria | 1823 |
| 512 | Ga0207648_10209830 | 3300026089 | Bacteria | 1728 |
| 513 | Ga0207648_10381295 | 3300026089 | Bacteria | 1275 |
| 514 | Ga0207648_10404642 | 3300026089 | Bacteria | 1237 |
| 515 | Ga0207648_10455909 | 3300026089 | Bacteria | 1165 |
| 516 | Ga0207648_10477631 | 3300026089 | Bacteria | 1138 |
| 517 | Ga0207676_10749814 | 3300026095 | Bacteria | 949 |
| 518 | Ga0207676_11028952 | 3300026095 | Bacteria | 812 |
| 519 | Ga0207674_10107111 | 3300026116 | Bacteria | 2772 |
| 520 | Ga0207674_10213752 | 3300026116 | Bacteria | 1877 |
| 521 | Ga0207674_10939923 | 3300026116 | Bacteria | 833 |
| 522 | Ga0207675_100043855 | 3300026118 | Bacteria | 4178 |
| 523 | Ga0207675_101080479 | 3300026118 | Unclassified | 822 |
| 524 | Ga0207675_101230191 | 3300026118 | Bacteria | 769 |
| 525 | Ga0207683_10006801 | 3300026121 | Bacteria | 9793 |
| 526 | Ga0207683_10179174 | 3300026121 | Bacteria | 1921 |
| 527 | Ga0207683_10521715 | 3300026121 | Bacteria | 1098 |
| 528 | Ga0207683_10692321 | 3300026121 | Bacteria | 945 |
| 529 | Ga0207698_10725525 | 3300026142 | Bacteria | 991 |
| 530 | Ga0207428_10033901 | 3300027907 | Bacteria | 4188 |
| 531 | Ga0268266_10121845 | 3300028379 | Bacteria | 2321 |
| 532 | Ga0268265_10017900 | 3300028380 | Bacteria | 4900 |
| 533 | Ga0268265_10159475 | 3300028380 | Bacteria | 1914 |
| 534 | Ga0268265_10294476 | 3300028380 | Bacteria | 1458 |
| 535 | Ga0268265_10361190 | 3300028380 | Bacteria | 1329 |
| 536 | Ga0268265_10514531 | 3300028380 | Bacteria | 1130 |
| 537 | Ga0268265_10656582 | 3300028380 | Bacteria | 1009 |
| 538 | Ga0268265_11038552 | 3300028380 | Bacteria | 811 |
| 539 | Ga0268265_11412587 | 3300028380 | Unclassified | 698 |
| 540 | Ga0268264_10159730 | 3300028381 | Bacteria | 2029 |
| 541 | Ga0268264_10343825 | 3300028381 | Bacteria | 1418 |
| 542 | Ga0268264_10345126 | 3300028381 | Bacteria | 1415 |
| 543 | Ga0268264_10478855 | 3300028381 | Bacteria | 1210 |
| 544 | Ga0268264_10649787 | 3300028381 | Bacteria | 1044 |
| 545 | Ga0268264_10743494 | 3300028381 | Unclassified | 977 |
| 546 | Ga0307511_10106184 | 3300030521 | Bacteria | 1814 |
| 547 | Ga0265760_10012055 | 3300031090 | Bacteria | 2471 |
| 548 | Ga0265331_10086526 | 3300031250 | Bacteria | 1452 |
| 549 | Ga0307408_100197579 | 3300031548 | Bacteria | 1625 |
| 550 | Ga0307408_100679469 | 3300031548 | Bacteria | 923 |
| 551 | Ga0265314_10038673 | 3300031711 | Bacteria | 3444 |
| 552 | Ga0265314_10148437 | 3300031711 | Bacteria | 1441 |
| 553 | Ga0307413_10383379 | 3300031824 | Unclassified | 1096 |
| 554 | Ga0307409_100176555 | 3300031995 | Bacteria | 1886 |
| 555 | Ga0307416_100175300 | 3300032002 | Bacteria | 2002 |
| 556 | Ga0307416_100759321 | 3300032002 | Bacteria | 1063 |
| 557 | Ga0307411_10411742 | 3300032005 | Bacteria | 1120 |
| 558 | Ga0307415_101282646 | 3300032126 | Unclassified | 693 |
| 559 | Ga0316593_10159833 | 3300032168 | Bacteria | 822 |
| 560 | Ga0373930_0001039 | 3300034816 | Bacteria | 3995 |
| 561 | Ga0373948_0003611 | 3300034817 | Bacteria | 2391 |
| 562 | Ga0373950_0007534 | 3300034818 | Bacteria | 1692 |
| 563 | Ga0373958_0059178 | 3300034819 | Bacteria | 826 |
| 564 | Ga0373958_0099560 | 3300034819 | Bacteria | 680 |
| 565 | Ga0373959_0002937 | 3300034820 | Bacteria | 2705 |
| 566 | Ga0373940_0001597 | 3300035088 | Bacteria | 4162 |
| 567 | Ga0373949_0002049 | 3300035090 | Bacteria | 5334 |
| 568 | Ga0373949_0130997 | 3300035090 | Bacteria | 712 |
| 569 | Ga0373951_0010193 | 3300035091 | Bacteria | 2109 |
| 570 | Ga0373952_0004034 | 3300035092 | Bacteria | 2652 |
| 571 | Ga0373952_0156845 | 3300035092 | Bacteria | 642 |
| 572 | Ga0373932_0011931 | 3300035112 | Bacteria | 2132 |
| 573 | Ga0373941_0008907 | 3300035115 | Bacteria | 2513 |
| 574 | Ga0373941_0014275 | 3300035115 | Bacteria | 2117 |
| 575 | Ga0373956_0363148 | 3300035119 | Bacteria | 690 |
| 576 | Ga0373960_0000007 | 3300035121 | Bacteria | 26901 |
| 577 | Ga0373943_0065497 | 3300035170 | Bacteria | 1827 |
| 578 | Ga0373943_0244533 | 3300035170 | Bacteria | 1006 |
| 579 | Ga0373955_0026296 | 3300035172 | Bacteria | 2997 |
| 580 | Ga0373955_0160464 | 3300035172 | Unclassified | 1327 |
| 581 | Ga0373955_0584454 | 3300035172 | Bacteria | 684 |
| 582 | Ga0373942_0000144 | 3300035207 | Bacteria | 16957 |
| 583 | Ga0373961_0001062 | 3300035241 | Bacteria | 8844 |
| 584 | Ga0373961_0199554 | 3300035241 | Bacteria | 705 |
| 585 | Ga0373962_0009438 | 3300035242 | Bacteria | 2418 |
| 586 | Ga0373931_0009351 | 3300035691 | Bacteria | 4683 |
| 587 | Ga0373931_0340294 | 3300035691 | Unclassified | 937 |
| 588 | Ga0373935_0129470 | 3300035692 | Bacteria | 1695 |
| 589 | Ga0373927_0728767 | 3300035695 | Bacteria | 655 |
| 590 | Ga0373933_0373417 | 3300035724 | Bacteria | 928 |
| 591 | Ga0373937_0065621 | 3300036401 | Bacteria | 3342 |
| 592 | Ga0373937_0120683 | 3300036401 | Bacteria | 2443 |
| 593 | Ga0373937_0286481 | 3300036401 | Bacteria | 1556 |
| 594 | Ga0373937_0387378 | 3300036401 | Bacteria | 1326 |
| 595 | Ga0373937_0397056 | 3300036401 | Bacteria | 1308 |
| 596 | Ga0373937_0451230 | 3300036401 | Bacteria | 1221 |
| 597 | Ga0373937_0923021 | 3300036401 | Bacteria | 822 |
| 598 | Ga0373937_1544026 | 3300036401 | Bacteria | 611 |
| 599 | Ga0316584_0023699 | 3300036712 | Bacteria | 4486 |
| 600 | Ga0373925_0096732 | 3300037068 | Bacteria | 2264 |
| 601 | Ga0373925_0536071 | 3300037068 | Bacteria | 962 |
| 602 | Ga0395905_0395185 | 3300037471 | Bacteria | 1277 |
| 603 | Ga0395905_0607884 | 3300037471 | Unclassified | 995 |
| 604 | Ga0436365_1014920 | 3300039437 | Bacteria | 1061 |
| 605 | Ga0436360_0946107 | 3300039438 | Unclassified | 856 |
| 606 | Ga0436363_1364936 | 3300039450 | Unclassified | 677 |
| 607 | Ga0439436_0027191 | 3300041404 | Bacteria | 1675 |
| 608 | Ga0439453_0052883 | 3300041408 | Bacteria | 825 |
| 609 | Ga0439462_0004597 | 3300042015 | Bacteria | 3378 |
| 610 | Ga0439446_0037817 | 3300042156 | Bacteria | 1414 |
| 611 | Ga0439434_0210453 | 3300042435 | Bacteria | 658 |
| 612 | Ga0439435_0008363 | 3300042436 | Bacteria | 2398 |
| 613 | Ga0439435_0034788 | 3300042436 | Bacteria | 1386 |
| 614 | Ga0439460_0114596 | 3300042461 | Bacteria | 877 |
| 615 | Ga0450916_025143 | 3300042530 | Bacteria | 840 |
| 616 | Ga0451577_0126528 | 3300042876 | Bacteria | 2290 |
| 617 | Ga0453683_0337052 | 3300044673 | Bacteria | 968 |
| 618 | Ga0453684_0012417 | 3300044712 | Bacteria | 14049 |
| 619 | Ga0453684_0240918 | 3300044712 | Bacteria | 2082 |
| 620 | Ga0453684_0351786 | 3300044712 | Bacteria | 1661 |
| 621 | Ga0453684_0704764 | 3300044712 | Bacteria | 1097 |
| 622 | Ga0453684_0847613 | 3300044712 | Bacteria | 982 |
| 623 | Ga0453684_1082138 | 3300044712 | Bacteria | 848 |
| 624 | Ga0453684_1270950 | 3300044712 | Unclassified | 769 |
| 625 | Ga0453684_1289510 | 3300044712 | Bacteria | 762 |
| 626 | Ga0466957_0309256 | 3300044842 | Bacteria | 1064 |
| 627 | Ga0466959_0753365 | 3300045049 | Bacteria | 652 |
| 628 | Ga0451576_0060074 | 3300045051 | Bacteria | 3966 |
| 629 | Ga0451576_0311039 | 3300045051 | Bacteria | 1648 |
| 630 | Ga0495629_0687620 | 3300046459 | Bacteria | 680 |
| 631 | Ga0495580_0593989 | 3300046472 | Unclassified | 732 |
| 632 | Ga0495608_0032472 | 3300046511 | Bacteria | 3528 |
| 633 | Ga0495628_0200898 | 3300046516 | Bacteria | 1502 |
| 634 | Ga0495628_0744515 | 3300046516 | Bacteria | 689 |
| 635 | Ga0495630_0001261 | 3300046517 | Bacteria | 17462 |
| 636 | Ga0495642_0229553 | 3300046528 | Bacteria | 811 |
| 637 | Ga0495640_0058597 | 3300046533 | Bacteria | 2626 |
| 638 | Ga0495640_0265528 | 3300046533 | Bacteria | 1071 |
| 639 | Ga0495640_0320742 | 3300046533 | Bacteria | 960 |
| 640 | Ga0495586_0430889 | 3300046535 | Unclassified | 760 |
| 641 | Ga0495587_0103928 | 3300046536 | Bacteria | 1635 |
| 642 | Ga0495587_0326267 | 3300046536 | Bacteria | 857 |
| 643 | Ga0495621_0049700 | 3300046539 | Bacteria | 1497 |
| 644 | Ga0495645_0001445 | 3300046543 | Bacteria | 16045 |
| 645 | Ga0495645_0003703 | 3300046543 | Bacteria | 10388 |
| 646 | Ga0495645_0399841 | 3300046543 | Bacteria | 876 |
| 647 | Ga0495667_0131666 | 3300046559 | Bacteria | 1613 |
| 648 | Ga0495667_0655823 | 3300046559 | Unclassified | 652 |
| 649 | Ga0495634_0296754 | 3300046642 | Bacteria | 978 |
| 650 | Ga0495634_0601735 | 3300046642 | Bacteria | 638 |
| 651 | Ga0495635_0045658 | 3300046663 | Bacteria | 3023 |
| 652 | Ga0495659_0384898 | 3300046664 | Unclassified | 604 |
| 653 | Ga0495599_0493938 | 3300046678 | Bacteria | 721 |
| 654 | Ga0495647_0051787 | 3300046681 | Bacteria | 1597 |
| 655 | Ga0495658_0041589 | 3300046683 | Bacteria | 2561 |
| 656 | Ga0495658_0184788 | 3300046683 | Bacteria | 1294 |
| 657 | Ga0495669_0063262 | 3300046684 | Bacteria | 1678 |
| 658 | Ga0495669_0218129 | 3300046684 | Bacteria | 914 |
| 659 | Ga0495613_0002821 | 3300046689 | Bacteria | 13042 |
| 660 | Ga0495600_0326728 | 3300046809 | Bacteria | 964 |
| 661 | Ga0495581_0235484 | 3300047315 | Bacteria | 1071 |
| 662 | Ga0495604_0026092 | 3300047317 | Bacteria | 4652 |
| 663 | Ga0495674_0053305 | 3300047319 | Bacteria | 3556 |
| 664 | Ga0495684_0000682 | 3300047471 | Bacteria | 27327 |
| 665 | Ga0495602_0068417 | 3300048088 | Bacteria | 3049 |
| 666 | Ga0495614_0366864 | 3300048089 | Archaea | 673 |
| 667 | Ga0496100_0001533 | 3300048903 | Bacteria | 11332 |
| 668 | Ga0496101_0006897 | 3300048904 | Bacteria | 7332 |
| 669 | Ga0496103_0526264 | 3300048906 | Bacteria | 756 |
| 670 | Ga0496104_0017217 | 3300048907 | Bacteria | 6576 |
| 671 | Ga0496104_0033960 | 3300048907 | Bacteria | 4755 |
| 672 | Ga0496104_0132020 | 3300048907 | Bacteria | 2399 |
| 673 | Ga0496105_0072751 | 3300048908 | Bacteria | 2841 |
| 674 | Ga0496105_0212906 | 3300048908 | Bacteria | 1574 |
| 675 | Ga0496105_0632752 | 3300048908 | Bacteria | 827 |
| 676 | Ga0496105_0662297 | 3300048908 | Bacteria | 805 |
| 677 | Ga0496105_0762376 | 3300048908 | Bacteria | 738 |
| 678 | Ga0496106_0036620 | 3300048909 | Bacteria | 3670 |
| 679 | Ga0496106_0067690 | 3300048909 | Bacteria | 2723 |
| 680 | Ga0496106_0075618 | 3300048909 | Bacteria | 2580 |
| 681 | Ga0496106_0616180 | 3300048909 | Bacteria | 869 |
| 682 | Ga0496106_0621194 | 3300048909 | Bacteria | 865 |
| 683 | Ga0496107_0928689 | 3300048910 | Unclassified | 633 |
| 684 | Ga0496108_0008779 | 3300048911 | Bacteria | 8194 |
| 685 | Ga0496108_0192001 | 3300048911 | Bacteria | 1770 |
| 686 | Ga0496109_0490426 | 3300048912 | Bacteria | 1160 |
| 687 | Ga0496110_0806984 | 3300048913 | Bacteria | 843 |
| 688 | Ga0496111_0420167 | 3300048914 | Bacteria | 988 |
| 689 | Ga0496112_0006594 | 3300048915 | Bacteria | 10214 |
| 690 | Ga0496112_0017015 | 3300048915 | Bacteria | 6825 |
| 691 | Ga0496112_0135408 | 3300048915 | Bacteria | 2434 |
| 692 | Ga0496112_0812191 | 3300048915 | Bacteria | 860 |
| 693 | Ga0496112_1124251 | 3300048915 | Bacteria | 703 |
| 694 | Ga0496113_0083404 | 3300048916 | Bacteria | 2452 |
| 695 | Ga0496113_0352338 | 3300048916 | Bacteria | 1181 |
| 696 | Ga0496114_0069418 | 3300048917 | Bacteria | 2959 |
| 697 | Ga0496114_0156997 | 3300048917 | Bacteria | 1976 |
| 698 | Ga0496114_0179591 | 3300048917 | Bacteria | 1848 |
| 699 | Ga0496114_0259810 | 3300048917 | Bacteria | 1529 |
| 700 | Ga0496115_0112495 | 3300048918 | Bacteria | 2237 |
| 701 | Ga0496115_0157689 | 3300048918 | Bacteria | 1875 |
| 702 | Ga0501033_0012882 | 3300049570 | Bacteria | 6379 |
| 703 | Ga0501034_0040753 | 3300049571 | Bacteria | 4699 |
| 704 | Ga0501034_0099532 | 3300049571 | Bacteria | 2902 |
| 705 | Ga0501036_0046736 | 3300049572 | Bacteria | 3665 |
| 706 | Ga0501036_0097367 | 3300049572 | Bacteria | 2487 |
| 707 | Ga0501036_0529829 | 3300049572 | Bacteria | 979 |
| 708 | Ga0501038_0128728 | 3300049574 | Bacteria | 2081 |
| 709 | Ga0501038_0451611 | 3300049574 | Bacteria | 988 |
| 710 | Ga0501039_0044997 | 3300049575 | Bacteria | 3409 |
| 711 | Ga0501039_0062686 | 3300049575 | Bacteria | 2881 |
| 712 | Ga0501039_0186959 | 3300049575 | Bacteria | 1629 |
| 713 | Ga0501040_0001751 | 3300049576 | Bacteria | 13950 |
| 714 | Ga0501041_0075541 | 3300049577 | Bacteria | 2072 |
| 715 | Ga0501041_0084346 | 3300049577 | Bacteria | 1958 |
| 716 | Ga0501042_0005260 | 3300049578 | Bacteria | 8316 |
| 717 | Ga0501042_0015393 | 3300049578 | Bacteria | 5237 |
| 718 | Ga0501042_0087723 | 3300049578 | Bacteria | 2232 |
| 719 | Ga0501043_0171388 | 3300049579 | Bacteria | 1693 |
| 720 | Ga0501046_0008978 | 3300049580 | Bacteria | 8680 |
| 721 | Ga0501048_0096860 | 3300049582 | Bacteria | 2081 |
| 722 | Ga0501048_0418578 | 3300049582 | Bacteria | 958 |
| 723 | Ga0501048_0474770 | 3300049582 | Unclassified | 896 |
| 724 | Ga0501067_0192240 | 3300049583 | Bacteria | 1137 |
| 725 | Ga0501068_0425683 | 3300049584 | Unclassified | 857 |
| 726 | Ga0501068_0594089 | 3300049584 | Bacteria | 721 |
| 727 | Ga0501071_0040725 | 3300049587 | Bacteria | 3325 |
| 728 | Ga0501071_0330638 | 3300049587 | Bacteria | 1158 |
| 729 | Ga0501071_0835522 | 3300049587 | Bacteria | 710 |
| 730 | Ga0501072_0010677 | 3300049588 | Bacteria | 6993 |
| 731 | Ga0501072_0038436 | 3300049588 | Bacteria | 3756 |
| 732 | Ga0501072_0064467 | 3300049588 | Bacteria | 2889 |
| 733 | Ga0501072_0609308 | 3300049588 | Bacteria | 861 |
| 734 | Ga0501073_0035438 | 3300049589 | Bacteria | 3548 |
| 735 | Ga0501073_0067833 | 3300049589 | Bacteria | 2487 |
| 736 | Ga0501073_0262281 | 3300049589 | Bacteria | 1192 |
| 737 | Ga0501074_0021554 | 3300049590 | Bacteria | 4679 |
| 738 | Ga0501074_0211742 | 3300049590 | Bacteria | 1381 |
| 739 | Ga0501075_0004548 | 3300049591 | Bacteria | 9401 |
| 740 | Ga0501075_0050742 | 3300049591 | Bacteria | 3119 |
| 741 | Ga0501075_0292262 | 3300049591 | Bacteria | 1241 |
| 742 | Ga0501076_0012693 | 3300049592 | Bacteria | 6307 |
| 743 | Ga0501076_0177813 | 3300049592 | Bacteria | 1734 |
| 744 | Ga0501076_0281600 | 3300049592 | Bacteria | 1362 |
| 745 | Ga0501077_0005464 | 3300049593 | Bacteria | 7737 |
| 746 | Ga0501077_0259619 | 3300049593 | Bacteria | 1105 |
| 747 | Ga0501225_0034063 | 3300049705 | Bacteria | 1402 |
| 748 | Ga0501079_0094378 | 3300049741 | Bacteria | 2318 |
| 749 | Ga0501080_0011276 | 3300049742 | Bacteria | 8182 |
| 750 | Ga0501080_0053548 | 3300049742 | Bacteria | 3757 |
| 751 | Ga0501080_0191547 | 3300049742 | Bacteria | 1879 |
| 752 | Ga0501080_0524951 | 3300049742 | Bacteria | 1056 |
| 753 | Ga0501080_1087256 | 3300049742 | Bacteria | 691 |
| 754 | Ga0501081_0000624 | 3300049743 | Bacteria | 20161 |
| 755 | Ga0501081_0417550 | 3300049743 | Bacteria | 994 |
| 756 | Ga0501083_0216227 | 3300049744 | Bacteria | 1249 |
| 757 | Ga0501035_0118995 | 3300049822 | Bacteria | 2310 |
| 758 | Ga0501044_0025835 | 3300049823 | Bacteria | 6225 |
| 759 | Ga0501045_0014008 | 3300049824 | Bacteria | 5676 |
| 760 | Ga0501045_0051903 | 3300049824 | Bacteria | 2993 |
| 761 | Ga0501045_0120737 | 3300049824 | Bacteria | 1946 |
| 762 | Ga0501045_0938853 | 3300049824 | Bacteria | 635 |
| 763 | nmdc:mga05p37_1031475_c1 | 3300050507 | Bacteria | 870 |
| 764 | nmdc:mga05p37_1090426_c1 | 3300050507 | Bacteria | 837 |
| 765 | nmdc:mga05p37_15317_c1 | 3300050507 | Bacteria | 9211 |
| 766 | nmdc:mga05p37_16647_c1 | 3300050507 | Bacteria | 8857 |
| 767 | nmdc:mga05p37_38590_c1 | 3300050507 | Bacteria | 5859 |
| 768 | nmdc:mga05p37_729641_c1 | 3300050507 | Bacteria | 1096 |
| 769 | nmdc:mga05p37_7530_c1 | 3300050507 | Bacteria | 12835 |
| 770 | nmdc:mga05p37_97789_c1 | 3300050507 | Bacteria | 3616 |
| 771 | nmdc:mga08y16_16490_c2 | 3300050511 | Bacteria | 6371 |
| 772 | nmdc:mga08y16_182547_c1 | 3300050511 | Bacteria | 2178 |
| 773 | nmdc:mga08y16_21673_c1 | 3300050511 | Bacteria | 6783 |
| 774 | nmdc:mga08y16_261089_c1 | 3300050511 | Bacteria | 1789 |
| 775 | nmdc:mga08y16_5107_c1 | 3300050511 | Bacteria | 13711 |
| 776 | nmdc:mga08y16_661762_c1 | 3300050511 | Bacteria | 1047 |
| 777 | nmdc:mga08y16_899649_c1 | 3300050511 | Bacteria | 871 |
| 778 | nmdc:mga0n895_103239_c1 | 3300050512 | Bacteria | 2862 |
| 779 | nmdc:mga0n895_1537346_c1 | 3300050512 | Bacteria | 631 |
| 780 | nmdc:mga0n895_257182_c1 | 3300050512 | Bacteria | 1772 |
| 781 | nmdc:mga0n895_280586_c1 | 3300050512 | Bacteria | 1689 |
| 782 | nmdc:mga0n895_310555_c1 | 3300050512 | Bacteria | 1598 |
| 783 | nmdc:mga0n895_390941_c1 | 3300050512 | Bacteria | 1407 |
| 784 | nmdc:mga0n895_428690_c1 | 3300050512 | Bacteria | 1336 |
| 785 | nmdc:mga0n895_616694_c1 | 3300050512 | Bacteria | 1086 |
| 786 | nmdc:mga0n895_676153_c1 | 3300050512 | Bacteria | 1030 |
| 787 | nmdc:mga0n895_67_c1 | 3300050512 | Bacteria | 61603 |
| 788 | nmdc:mga0n895_957354_c1 | 3300050512 | Bacteria | 839 |
| 789 | nmdc:mga0rr50_106311_c1 | 3300050513 | Bacteria | 2214 |
| 790 | nmdc:mga0rr50_114_c1 | 3300050513 | Bacteria | 44678 |
| 791 | nmdc:mga0rr50_117144_c1 | 3300050513 | Bacteria | 2115 |
| 792 | nmdc:mga0rr50_295238_c1 | 3300050513 | Bacteria | 1355 |
| 793 | nmdc:mga0rr50_3192_c1 | 3300050513 | Bacteria | 9370 |
| 794 | nmdc:mga0rr50_619962_c1 | 3300050513 | Bacteria | 923 |
| 795 | nmdc:mga0rr50_697828_c1 | 3300050513 | Bacteria | 866 |
| 796 | nmdc:mga0rr50_8855_c1 | 3300050513 | Bacteria | 6285 |
| 797 | nmdc:mga08x19_103783_c1 | 3300050514 | Bacteria | 1889 |
| 798 | nmdc:mga08x19_129116_c1 | 3300050514 | Bacteria | 1699 |
| 799 | nmdc:mga08x19_138697_c1 | 3300050514 | Bacteria | 1641 |
| 800 | nmdc:mga08x19_175118_c1 | 3300050514 | Bacteria | 1463 |
| 801 | nmdc:mga08x19_2465_c1 | 3300050514 | Bacteria | 11258 |
| 802 | nmdc:mga0a205_27073_c1 | 3300050515 | Bacteria | 5473 |
| 803 | nmdc:mga0a205_36758_c1 | 3300050515 | Bacteria | 4707 |
| 804 | nmdc:mga0a205_440193_c1 | 3300050515 | Bacteria | 1164 |
| 805 | nmdc:mga0a205_575132_c1 | 3300050515 | Bacteria | 981 |
| 806 | nmdc:mga0a205_575787_c1 | 3300050515 | Bacteria | 980 |
| 807 | nmdc:mga0a205_76377_c1 | 3300050515 | Bacteria | 3237 |
| 808 | nmdc:mga0a205_9408_c1 | 3300050515 | Bacteria | 8932 |
| 809 | nmdc:mga0a205_95048_c1 | 3300050515 | Bacteria | 2879 |
| 810 | Ga0495601_0020931 | 3300053077 | Bacteria | 3999 |
| 811 | Ga0495601_0154615 | 3300053077 | Bacteria | 1498 |
| 812 | Ga0495601_0244394 | 3300053077 | Bacteria | 1172 |
| 813 | Ga0495601_0428872 | 3300053077 | Bacteria | 856 |
| 814 | Ga0495595_0391000 | 3300053084 | Bacteria | 704 |
| 815 | Ga0495595_0520115 | 3300053084 | Bacteria | 607 |
| 816 | Ga0495619_0024195 | 3300053085 | Bacteria | 3895 |
| 817 | Ga0495619_0030540 | 3300053085 | Bacteria | 3488 |
| 818 | Ga0495619_0093133 | 3300053085 | Bacteria | 2042 |
| 819 | Ga0495619_0351401 | 3300053085 | Bacteria | 1020 |
| 820 | Ga0501084_0018300 | 3300054114 | Bacteria | 5834 |
| 821 | Ga0501084_0029871 | 3300054114 | Bacteria | 4559 |
| 822 | Ga0501084_0112407 | 3300054114 | Bacteria | 2289 |
| 823 | Ga0501084_0348518 | 3300054114 | Bacteria | 1251 |
| 824 | Ga0501082_0025547 | 3300060353 | Bacteria | 5089 |
| 825 | Ga0501082_0281256 | 3300060353 | Bacteria | 1448 |
| 826 | Ga0501082_0408722 | 3300060353 | Bacteria | 1185 |
| 827 | Ga0501082_0828576 | 3300060353 | Bacteria | 809 |
| 828 | Ga0501082_0877351 | 3300060353 | Bacteria | 785 |
| 829 | Ga0530510_0029745 | 3300061734 | Bacteria | 3921 |
| 830 | Ga0530510_0032762 | 3300061734 | Bacteria | 3740 |
| 831 | Ga0530510_0143239 | 3300061734 | Bacteria | 1762 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_1270950 | Ga0453684_1270950_36_554 | 157 |
| 2 | 3300036712 | Ga0316584_0023699 | Ga0316584_0023699_558_1073 | 159 |
| 3 | 3300005459 | Ga0068867_100348555 | Ga0068867_1003485552 | 162 |
| 4 | 3300049824 | Ga0501045_0938853 | Ga0501045_0938853_13_564 | 162 |
| 5 | 3300050512 | nmdc:mga0n895_957354_c1 | nmdc:mga0n895_957354_c1_27_542 | 162 |
| 6 | 3300005354 | Ga0070675_100031874 | Ga0070675_1000318743 | 163 |
| 7 | 3300005456 | Ga0070678_101106805 | Ga0070678_1011068051 | 163 |
| 8 | 3300009094 | Ga0111539_11159044 | Ga0111539_111590442 | 163 |
| 9 | 3300025926 | Ga0207659_10009341 | Ga0207659_100093412 | 163 |
| 10 | 3300025937 | Ga0207669_10163677 | Ga0207669_101636772 | 163 |
| 11 | 3300025940 | Ga0207691_10205776 | Ga0207691_102057762 | 163 |
| 12 | 3300025960 | Ga0207651_10447422 | Ga0207651_104474222 | 163 |
| 13 | 3300050511 | nmdc:mga08y16_899649_c1 | nmdc:mga08y16_899649_c1_90_650 | 163 |
| 14 | 3300005345 | Ga0070692_10523771 | Ga0070692_105237711 | 165 |
| 15 | 3300013105 | Ga0157369_10000535 | Ga0157369_1000053524 | 165 |
| 16 | 3300050515 | nmdc:mga0a205_575132_c1 | nmdc:mga0a205_575132_c1_240_791 | 165 |
| 17 | 3300005293 | Ga0065715_10523175 | Ga0065715_105231751 | 166 |
| 18 | 3300005456 | Ga0070678_100355349 | Ga0070678_1003553491 | 166 |
| 19 | 3300009098 | Ga0105245_10324400 | Ga0105245_103244002 | 166 |
| 20 | 3300009176 | Ga0105242_10206044 | Ga0105242_102060441 | 166 |
| 21 | 3300009177 | Ga0105248_10007812 | Ga0105248_100078127 | 166 |
| 22 | 3300013308 | Ga0157375_10188271 | Ga0157375_101882713 | 166 |
| 23 | 3300014969 | Ga0157376_10173723 | Ga0157376_101737232 | 166 |
| 24 | 3300025927 | Ga0207687_10334828 | Ga0207687_103348282 | 166 |
| 25 | 3300005546 | Ga0070696_101022863 | Ga0070696_1010228631 | 167 |
| 26 | 3300032168 | Ga0316593_10159833 | Ga0316593_101598331 | 167 |
| 27 | 3300049590 | Ga0501074_0211742 | Ga0501074_0211742_74_616 | 167 |
| 28 | 3300049743 | Ga0501081_0417550 | Ga0501081_0417550_128_670 | 167 |
| 29 | 3300005293 | Ga0065715_10359783 | Ga0065715_103597831 | 168 |
| 30 | 3300005295 | Ga0065707_10495927 | Ga0065707_104959271 | 168 |
| 31 | 3300005330 | Ga0070690_100049633 | Ga0070690_1000496332 | 168 |
| 32 | 3300005331 | Ga0070670_100440446 | Ga0070670_1004404462 | 168 |
| 33 | 3300005336 | Ga0070680_100470311 | Ga0070680_1004703111 | 168 |
| 34 | 3300005339 | Ga0070660_100040847 | Ga0070660_1000408472 | 168 |
| 35 | 3300005444 | Ga0070694_100417898 | Ga0070694_1004178982 | 168 |
| 36 | 3300005458 | Ga0070681_10236447 | Ga0070681_102364472 | 168 |
| 37 | 3300005530 | Ga0070679_100395577 | Ga0070679_1003955772 | 168 |
| 38 | 3300005539 | Ga0068853_100520292 | Ga0068853_1005202922 | 168 |
| 39 | 3300005577 | Ga0068857_100210369 | Ga0068857_1002103692 | 168 |
| 40 | 3300005617 | Ga0068859_100868094 | Ga0068859_1008680941 | 168 |
| 41 | 3300006847 | Ga0075431_100043842 | Ga0075431_1000438422 | 168 |
| 42 | 3300006931 | Ga0097620_100868119 | Ga0097620_1008681192 | 168 |
| 43 | 3300009177 | Ga0105248_10482458 | Ga0105248_104824581 | 168 |
| 44 | 3300009553 | Ga0105249_10187100 | Ga0105249_101871002 | 168 |
| 45 | 3300013308 | Ga0157375_11214937 | Ga0157375_112149372 | 168 |
| 46 | 3300025909 | Ga0207705_10777142 | Ga0207705_107771421 | 168 |
| 47 | 3300025912 | Ga0207707_10095448 | Ga0207707_100954482 | 168 |
| 48 | 3300025919 | Ga0207657_10052141 | Ga0207657_100521412 | 168 |
| 49 | 3300025925 | Ga0207650_10146594 | Ga0207650_101465942 | 168 |
| 50 | 3300025945 | Ga0207679_10493835 | Ga0207679_104938352 | 168 |
| 51 | 3300025972 | Ga0207668_10871922 | Ga0207668_108719222 | 168 |
| 52 | 3300026035 | Ga0207703_10358993 | Ga0207703_103589932 | 168 |
| 53 | 3300026075 | Ga0207708_10861093 | Ga0207708_108610932 | 168 |
| 54 | 3300026116 | Ga0207674_10213752 | Ga0207674_102137522 | 168 |
| 55 | 3300031824 | Ga0307413_10383379 | Ga0307413_103833792 | 168 |
| 56 | 3300035170 | Ga0373943_0065497 | Ga0373943_0065497_43_594 | 168 |
| 57 | 3300035172 | Ga0373955_0160464 | Ga0373955_0160464_420_971 | 168 |
| 58 | 3300035692 | Ga0373935_0129470 | Ga0373935_0129470_966_1517 | 168 |
| 59 | 3300035695 | Ga0373927_0728767 | Ga0373927_0728767_53_604 | 168 |
| 60 | 3300036401 | Ga0373937_0286481 | Ga0373937_0286481_919_1470 | 168 |
| 61 | 3300042436 | Ga0439435_0034788 | Ga0439435_0034788_832_1368 | 168 |
| 62 | 3300046516 | Ga0495628_0200898 | Ga0495628_0200898_457_1008 | 168 |
| 63 | 3300046536 | Ga0495587_0326267 | Ga0495587_0326267_45_596 | 168 |
| 64 | 3300048907 | Ga0496104_0017217 | Ga0496104_0017217_5246_5794 | 168 |
| 65 | 3300048908 | Ga0496105_0662297 | Ga0496105_0662297_238_786 | 168 |
| 66 | 3300048915 | Ga0496112_0017015 | Ga0496112_0017015_89_637 | 168 |
| 67 | 3300048916 | Ga0496113_0352338 | Ga0496113_0352338_109_657 | 168 |
| 68 | 3300049572 | Ga0501036_0046736 | Ga0501036_0046736_2026_2544 | 168 |
| 69 | 3300049574 | Ga0501038_0451611 | Ga0501038_0451611_230_748 | 168 |
| 70 | 3300049575 | Ga0501039_0062686 | Ga0501039_0062686_1209_1727 | 168 |
| 71 | 3300049578 | Ga0501042_0087723 | Ga0501042_0087723_666_1184 | 168 |
| 72 | 3300049582 | Ga0501048_0096860 | Ga0501048_0096860_752_1270 | 168 |
| 73 | 3300049587 | Ga0501071_0040725 | Ga0501071_0040725_2265_2783 | 168 |
| 74 | 3300049588 | Ga0501072_0064467 | Ga0501072_0064467_165_683 | 168 |
| 75 | 3300049592 | Ga0501076_0012693 | Ga0501076_0012693_1226_1744 | 168 |
| 76 | 3300049741 | Ga0501079_0094378 | Ga0501079_0094378_411_929 | 168 |
| 77 | 3300049742 | Ga0501080_0011276 | Ga0501080_0011276_4992_5510 | 168 |
| 78 | 3300049744 | Ga0501083_0216227 | Ga0501083_0216227_505_1023 | 168 |
| 79 | 3300049824 | Ga0501045_0051903 | Ga0501045_0051903_2030_2548 | 168 |
| 80 | 3300050512 | nmdc:mga0n895_280586_c1 | nmdc:mga0n895_280586_c1_1083_1631 | 168 |
| 81 | 3300053077 | Ga0495601_0244394 | Ga0495601_0244394_95_646 | 168 |
| 82 | 3300053077 | Ga0495601_0428872 | Ga0495601_0428872_240_791 | 168 |
| 83 | 3300053084 | Ga0495595_0520115 | Ga0495595_0520115_65_592 | 168 |
| 84 | 3300053085 | Ga0495619_0093133 | Ga0495619_0093133_1314_1865 | 168 |
| 85 | 3300060353 | Ga0501082_0828576 | Ga0501082_0828576_168_719 | 168 |
| 86 | 3300061734 | Ga0530510_0143239 | Ga0530510_0143239_43_561 | 168 |
| 87 | 3300005457 | Ga0070662_100949411 | Ga0070662_1009494111 | 169 |
| 88 | 3300005536 | Ga0070697_100366502 | Ga0070697_1003665021 | 169 |
| 89 | 3300005841 | Ga0068863_100900118 | Ga0068863_1009001182 | 169 |
| 90 | 3300031090 | Ga0265760_10012055 | Ga0265760_100120553 | 169 |
| 91 | 3300031548 | Ga0307408_100679469 | Ga0307408_1006794692 | 169 |
| 92 | 3300042015 | Ga0439462_0004597 | Ga0439462_0004597_2379_2927 | 169 |
| 93 | 3300042156 | Ga0439446_0037817 | Ga0439446_0037817_370_918 | 169 |
| 94 | 3300048089 | Ga0495614_0366864 | Ga0495614_0366864_96_626 | 169 |
| 95 | 3300005364 | Ga0070673_100199091 | Ga0070673_1001990911 | 170 |
| 96 | 3300005563 | Ga0068855_100065284 | Ga0068855_1000652846 | 170 |
| 97 | 3300009094 | Ga0111539_10403179 | Ga0111539_104031792 | 170 |
| 98 | 3300009177 | Ga0105248_10005653 | Ga0105248_1000565310 | 170 |
| 99 | 3300013306 | Ga0163162_11306328 | Ga0163162_113063281 | 170 |
| 100 | 3300013308 | Ga0157375_11490877 | Ga0157375_114908771 | 170 |
| 101 | 3300014969 | Ga0157376_11188491 | Ga0157376_111884911 | 170 |
| 102 | 3300025949 | Ga0207667_11283812 | Ga0207667_112838121 | 170 |
| 103 | 3300025960 | Ga0207651_10833295 | Ga0207651_108332952 | 170 |
| 104 | 3300027907 | Ga0207428_10033901 | Ga0207428_100339013 | 170 |
| 105 | 3300031250 | Ga0265331_10086526 | Ga0265331_100865262 | 170 |
| 106 | 3300039438 | Ga0436360_0946107 | Ga0436360_0946107_53_625 | 170 |
| 107 | 3300041404 | Ga0439436_0027191 | Ga0439436_0027191_344_895 | 170 |
| 108 | 3300042876 | Ga0451577_0126528 | Ga0451577_0126528_1687_2214 | 170 |
| 109 | 3300044712 | Ga0453684_0012417 | Ga0453684_0012417_11678_12208 | 170 |
| 110 | 3300044712 | Ga0453684_0240918 | Ga0453684_0240918_1007_1534 | 170 |
| 111 | 3300044712 | Ga0453684_0847613 | Ga0453684_0847613_284_811 | 170 |
| 112 | 3300044712 | Ga0453684_1082138 | Ga0453684_1082138_173_703 | 170 |
| 113 | 3300044712 | Ga0453684_1289510 | Ga0453684_1289510_176_706 | 170 |
| 114 | 3300048909 | Ga0496106_0075618 | Ga0496106_0075618_1872_2417 | 170 |
| 115 | 3300049577 | Ga0501041_0084346 | Ga0501041_0084346_149_700 | 170 |
| 116 | 3300049588 | Ga0501072_0038436 | Ga0501072_0038436_1070_1621 | 170 |
| 117 | 3300049589 | Ga0501073_0067833 | Ga0501073_0067833_145_678 | 170 |
| 118 | 3300049591 | Ga0501075_0292262 | Ga0501075_0292262_107_658 | 170 |
| 119 | 3300049592 | Ga0501076_0281600 | Ga0501076_0281600_99_650 | 170 |
| 120 | 3300049705 | Ga0501225_0034063 | Ga0501225_0034063_20_568 | 170 |
| 121 | 3300050511 | nmdc:mga08y16_21673_c1 | nmdc:mga08y16_21673_c1_370_930 | 170 |
| 122 | 3300050513 | nmdc:mga0rr50_106311_c1 | nmdc:mga0rr50_106311_c1_1549_2082 | 170 |
| 123 | 3300054114 | Ga0501084_0348518 | Ga0501084_0348518_170_721 | 170 |
| 124 | 3300060353 | Ga0501082_0408722 | Ga0501082_0408722_10_561 | 170 |
| 125 | 3300005467 | Ga0070706_100008764 | Ga0070706_1000087641 | 171 |
| 126 | 3300005518 | Ga0070699_100761591 | Ga0070699_1007615911 | 171 |
| 127 | 3300005546 | Ga0070696_100058403 | Ga0070696_1000584032 | 171 |
| 128 | 3300005547 | Ga0070693_100804050 | Ga0070693_1008040501 | 171 |
| 129 | 3300005844 | Ga0068862_100203507 | Ga0068862_1002035072 | 171 |
| 130 | 3300006852 | Ga0075433_10154090 | Ga0075433_101540903 | 171 |
| 131 | 3300009094 | Ga0111539_10028824 | Ga0111539_100288242 | 171 |
| 132 | 3300009147 | Ga0114129_10106535 | Ga0114129_101065351 | 171 |
| 133 | 3300009147 | Ga0114129_10165420 | Ga0114129_101654202 | 171 |
| 134 | 3300009177 | Ga0105248_10359038 | Ga0105248_103590381 | 171 |
| 135 | 3300025910 | Ga0207684_10035016 | Ga0207684_100350163 | 171 |
| 136 | 3300025922 | Ga0207646_10232494 | Ga0207646_102324942 | 171 |
| 137 | 3300025941 | Ga0207711_10351520 | Ga0207711_103515202 | 171 |
| 138 | 3300026075 | Ga0207708_10698468 | Ga0207708_106984682 | 171 |
| 139 | 3300031711 | Ga0265314_10148437 | Ga0265314_101484372 | 171 |
| 140 | 3300044712 | Ga0453684_0704764 | Ga0453684_0704764_182_754 | 171 |
| 141 | 3300050507 | nmdc:mga05p37_1031475_c1 | nmdc:mga05p37_1031475_c1_306_842 | 171 |
| 142 | 3300050511 | nmdc:mga08y16_16490_c2 | nmdc:mga08y16_16490_c2_5106_5657 | 171 |
| 143 | 3300050514 | nmdc:mga08x19_138697_c1 | nmdc:mga08x19_138697_c1_777_1313 | 171 |
| 144 | 3300050515 | nmdc:mga0a205_9408_c1 | nmdc:mga0a205_9408_c1_1384_1920 | 171 |
| 145 | 3300005329 | Ga0070683_101228410 | Ga0070683_1012284101 | 172 |
| 146 | 3300005344 | Ga0070661_100154456 | Ga0070661_1001544562 | 172 |
| 147 | 3300005535 | Ga0070684_100276843 | Ga0070684_1002768432 | 172 |
| 148 | 3300005564 | Ga0070664_100708397 | Ga0070664_1007083972 | 172 |
| 149 | 3300005614 | Ga0068856_100039480 | Ga0068856_1000394802 | 172 |
| 150 | 3300009093 | Ga0105240_10178768 | Ga0105240_101787682 | 172 |
| 151 | 3300025913 | Ga0207695_10191244 | Ga0207695_101912441 | 172 |
| 152 | 3300025920 | Ga0207649_10069334 | Ga0207649_100693341 | 172 |
| 153 | 3300025944 | Ga0207661_11116385 | Ga0207661_111163851 | 172 |
| 154 | 3300025945 | Ga0207679_10838057 | Ga0207679_108380571 | 172 |
| 155 | 3300026078 | Ga0207702_10025917 | Ga0207702_100259176 | 172 |
| 156 | 3300026142 | Ga0207698_10725525 | Ga0207698_107255252 | 172 |
| 157 | 3300028380 | Ga0268265_11038552 | Ga0268265_110385521 | 172 |
| 158 | 3300031995 | Ga0307409_100176555 | Ga0307409_1001765552 | 172 |
| 159 | 3300032005 | Ga0307411_10411742 | Ga0307411_104117421 | 172 |
| 160 | 3300036401 | Ga0373937_0120683 | Ga0373937_0120683_1510_2067 | 172 |
| 161 | 3300044712 | Ga0453684_0351786 | Ga0453684_0351786_254_793 | 172 |
| 162 | 3300049572 | Ga0501036_0097367 | Ga0501036_0097367_1056_1613 | 172 |
| 163 | 3300049574 | Ga0501038_0128728 | Ga0501038_0128728_32_589 | 172 |
| 164 | 3300049575 | Ga0501039_0186959 | Ga0501039_0186959_994_1551 | 172 |
| 165 | 3300049578 | Ga0501042_0005260 | Ga0501042_0005260_406_963 | 172 |
| 166 | 3300049582 | Ga0501048_0418578 | Ga0501048_0418578_187_744 | 172 |
| 167 | 3300049584 | Ga0501068_0594089 | Ga0501068_0594089_49_606 | 172 |
| 168 | 3300049587 | Ga0501071_0330638 | Ga0501071_0330638_326_883 | 172 |
| 169 | 3300049591 | Ga0501075_0050742 | Ga0501075_0050742_1349_1906 | 172 |
| 170 | 3300049592 | Ga0501076_0177813 | Ga0501076_0177813_1130_1687 | 172 |
| 171 | 3300049593 | Ga0501077_0259619 | Ga0501077_0259619_198_755 | 172 |
| 172 | 3300049742 | Ga0501080_0191547 | Ga0501080_0191547_1233_1790 | 172 |
| 173 | 3300054114 | Ga0501084_0018300 | Ga0501084_0018300_1271_1828 | 172 |
| 174 | 3300005445 | Ga0070708_100821152 | Ga0070708_1008211521 | 173 |
| 175 | 3300006237 | Ga0097621_100006929 | Ga0097621_1000069293 | 173 |
| 176 | 3300006358 | Ga0068871_100719785 | Ga0068871_1007197852 | 173 |
| 177 | 3300007076 | Ga0075435_100814850 | Ga0075435_1008148501 | 173 |
| 178 | 3300045049 | Ga0466959_0753365 | Ga0466959_0753365_30_581 | 173 |
| 179 | 3300048913 | Ga0496110_0806984 | Ga0496110_0806984_147_695 | 173 |
| 180 | 3300050513 | nmdc:mga0rr50_697828_c1 | nmdc:mga0rr50_697828_c1_205_756 | 173 |
| 181 | 3300005293 | Ga0065715_10222596 | Ga0065715_102225961 | 174 |
| 182 | 3300005331 | Ga0070670_100082999 | Ga0070670_1000829993 | 174 |
| 183 | 3300005331 | Ga0070670_100265915 | Ga0070670_1002659152 | 174 |
| 184 | 3300005331 | Ga0070670_100287138 | Ga0070670_1002871382 | 174 |
| 185 | 3300005335 | Ga0070666_10152319 | Ga0070666_101523192 | 174 |
| 186 | 3300005344 | Ga0070661_100295756 | Ga0070661_1002957561 | 174 |
| 187 | 3300005347 | Ga0070668_100168944 | Ga0070668_1001689442 | 174 |
| 188 | 3300005347 | Ga0070668_100403117 | Ga0070668_1004031171 | 174 |
| 189 | 3300005353 | Ga0070669_100081178 | Ga0070669_1000811782 | 174 |
| 190 | 3300005354 | Ga0070675_100000055 | Ga0070675_10000005510 | 174 |
| 191 | 3300005354 | Ga0070675_100060766 | Ga0070675_1000607662 | 174 |
| 192 | 3300005354 | Ga0070675_100322365 | Ga0070675_1003223651 | 174 |
| 193 | 3300005356 | Ga0070674_100092876 | Ga0070674_1000928762 | 174 |
| 194 | 3300005364 | Ga0070673_100317694 | Ga0070673_1003176942 | 174 |
| 195 | 3300005367 | Ga0070667_100796677 | Ga0070667_1007966771 | 174 |
| 196 | 3300005439 | Ga0070711_100704796 | Ga0070711_1007047961 | 174 |
| 197 | 3300005456 | Ga0070678_100006004 | Ga0070678_1000060045 | 174 |
| 198 | 3300005456 | Ga0070678_100794180 | Ga0070678_1007941801 | 174 |
| 199 | 3300005458 | Ga0070681_10592507 | Ga0070681_105925071 | 174 |
| 200 | 3300005459 | Ga0068867_100703347 | Ga0068867_1007033471 | 174 |
| 201 | 3300005459 | Ga0068867_100858810 | Ga0068867_1008588101 | 174 |
| 202 | 3300005471 | Ga0070698_100068978 | Ga0070698_1000689783 | 174 |
| 203 | 3300005471 | Ga0070698_100554566 | Ga0070698_1005545662 | 174 |
| 204 | 3300005518 | Ga0070699_100029670 | Ga0070699_1000296703 | 174 |
| 205 | 3300005518 | Ga0070699_100530642 | Ga0070699_1005306421 | 174 |
| 206 | 3300005543 | Ga0070672_100554949 | Ga0070672_1005549491 | 174 |
| 207 | 3300005543 | Ga0070672_101350045 | Ga0070672_1013500451 | 174 |
| 208 | 3300005564 | Ga0070664_100524930 | Ga0070664_1005249302 | 174 |
| 209 | 3300005564 | Ga0070664_100586764 | Ga0070664_1005867641 | 174 |
| 210 | 3300005616 | Ga0068852_100403215 | Ga0068852_1004032151 | 174 |
| 211 | 3300005616 | Ga0068852_100941417 | Ga0068852_1009414172 | 174 |
| 212 | 3300005718 | Ga0068866_10620423 | Ga0068866_106204231 | 174 |
| 213 | 3300005985 | Ga0081539_10010495 | Ga0081539_100104951 | 174 |
| 214 | 3300005985 | Ga0081539_10200232 | Ga0081539_102002322 | 174 |
| 215 | 3300006237 | Ga0097621_100031556 | Ga0097621_1000315562 | 174 |
| 216 | 3300006358 | Ga0068871_100041326 | Ga0068871_1000413264 | 174 |
| 217 | 3300006358 | Ga0068871_100267807 | Ga0068871_1002678072 | 174 |
| 218 | 3300006844 | Ga0075428_100711794 | Ga0075428_1007117942 | 174 |
| 219 | 3300006852 | Ga0075433_10107599 | Ga0075433_101075992 | 174 |
| 220 | 3300006852 | Ga0075433_10363199 | Ga0075433_103631992 | 174 |
| 221 | 3300006871 | Ga0075434_100624961 | Ga0075434_1006249612 | 174 |
| 222 | 3300006881 | Ga0068865_100558884 | Ga0068865_1005588842 | 174 |
| 223 | 3300006914 | Ga0075436_100026842 | Ga0075436_1000268422 | 174 |
| 224 | 3300007076 | Ga0075435_100064630 | Ga0075435_1000646303 | 174 |
| 225 | 3300009094 | Ga0111539_10736539 | Ga0111539_107365392 | 174 |
| 226 | 3300009094 | Ga0111539_10867767 | Ga0111539_108677671 | 174 |
| 227 | 3300009101 | Ga0105247_10568984 | Ga0105247_105689841 | 174 |
| 228 | 3300009147 | Ga0114129_10324109 | Ga0114129_103241092 | 174 |
| 229 | 3300009147 | Ga0114129_10396837 | Ga0114129_103968372 | 174 |
| 230 | 3300009147 | Ga0114129_11566788 | Ga0114129_115667881 | 174 |
| 231 | 3300009148 | Ga0105243_10602166 | Ga0105243_106021662 | 174 |
| 232 | 3300009176 | Ga0105242_10203318 | Ga0105242_102033182 | 174 |
| 233 | 3300009176 | Ga0105242_10424778 | Ga0105242_104247782 | 174 |
| 234 | 3300009553 | Ga0105249_11303145 | Ga0105249_113031452 | 174 |
| 235 | 3300013297 | Ga0157378_11549450 | Ga0157378_115494501 | 174 |
| 236 | 3300013308 | Ga0157375_11287010 | Ga0157375_112870101 | 174 |
| 237 | 3300014326 | Ga0157380_10249218 | Ga0157380_102492182 | 174 |
| 238 | 3300014326 | Ga0157380_10419568 | Ga0157380_104195682 | 174 |
| 239 | 3300014326 | Ga0157380_11489736 | Ga0157380_114897361 | 174 |
| 240 | 3300014745 | Ga0157377_10018695 | Ga0157377_100186952 | 174 |
| 241 | 3300014968 | Ga0157379_10660466 | Ga0157379_106604662 | 174 |
| 242 | 3300014968 | Ga0157379_11246994 | Ga0157379_112469941 | 174 |
| 243 | 3300014969 | Ga0157376_10513640 | Ga0157376_105136403 | 174 |
| 244 | 3300025315 | Ga0207697_10106579 | Ga0207697_101065792 | 174 |
| 245 | 3300025903 | Ga0207680_10116783 | Ga0207680_101167832 | 174 |
| 246 | 3300025904 | Ga0207647_10350199 | Ga0207647_103501991 | 174 |
| 247 | 3300025908 | Ga0207643_10138433 | Ga0207643_101384332 | 174 |
| 248 | 3300025920 | Ga0207649_10630931 | Ga0207649_106309311 | 174 |
| 249 | 3300025922 | Ga0207646_10225443 | Ga0207646_102254431 | 174 |
| 250 | 3300025923 | Ga0207681_10227138 | Ga0207681_102271382 | 174 |
| 251 | 3300025925 | Ga0207650_10147551 | Ga0207650_101475512 | 174 |
| 252 | 3300025925 | Ga0207650_10232978 | Ga0207650_102329782 | 174 |
| 253 | 3300025925 | Ga0207650_10300057 | Ga0207650_103000572 | 174 |
| 254 | 3300025925 | Ga0207650_10375507 | Ga0207650_103755071 | 174 |
| 255 | 3300025926 | Ga0207659_10001583 | Ga0207659_100015832 | 174 |
| 256 | 3300025926 | Ga0207659_10681566 | Ga0207659_106815662 | 174 |
| 257 | 3300025938 | Ga0207704_10484842 | Ga0207704_104848422 | 174 |
| 258 | 3300025940 | Ga0207691_10183103 | Ga0207691_101831032 | 174 |
| 259 | 3300025940 | Ga0207691_10616099 | Ga0207691_106160992 | 174 |
| 260 | 3300025945 | Ga0207679_10577089 | Ga0207679_105770892 | 174 |
| 261 | 3300025960 | Ga0207651_10076797 | Ga0207651_100767972 | 174 |
| 262 | 3300025960 | Ga0207651_11380495 | Ga0207651_113804951 | 174 |
| 263 | 3300025972 | Ga0207668_10200435 | Ga0207668_102004352 | 174 |
| 264 | 3300025972 | Ga0207668_10321112 | Ga0207668_103211122 | 174 |
| 265 | 3300025986 | Ga0207658_10419894 | Ga0207658_104198941 | 174 |
| 266 | 3300026035 | Ga0207703_11366459 | Ga0207703_113664591 | 174 |
| 267 | 3300026075 | Ga0207708_10637460 | Ga0207708_106374601 | 174 |
| 268 | 3300026089 | Ga0207648_10080951 | Ga0207648_100809511 | 174 |
| 269 | 3300026089 | Ga0207648_10404642 | Ga0207648_104046422 | 174 |
| 270 | 3300026089 | Ga0207648_10455909 | Ga0207648_104559092 | 174 |
| 271 | 3300026118 | Ga0207675_101080479 | Ga0207675_1010804792 | 174 |
| 272 | 3300026121 | Ga0207683_10006801 | Ga0207683_1000680110 | 174 |
| 273 | 3300026121 | Ga0207683_10692321 | Ga0207683_106923211 | 174 |
| 274 | 3300028380 | Ga0268265_10656582 | Ga0268265_106565821 | 174 |
| 275 | 3300028380 | Ga0268265_11412587 | Ga0268265_114125871 | 174 |
| 276 | 3300031548 | Ga0307408_100197579 | Ga0307408_1001975791 | 174 |
| 277 | 3300035090 | Ga0373949_0130997 | Ga0373949_0130997_106_660 | 174 |
| 278 | 3300035115 | Ga0373941_0008907 | Ga0373941_0008907_1450_2001 | 174 |
| 279 | 3300035119 | Ga0373956_0363148 | Ga0373956_0363148_41_586 | 174 |
| 280 | 3300035724 | Ga0373933_0373417 | Ga0373933_0373417_73_618 | 174 |
| 281 | 3300036401 | Ga0373937_0065621 | Ga0373937_0065621_1937_2482 | 174 |
| 282 | 3300036401 | Ga0373937_0451230 | Ga0373937_0451230_49_594 | 174 |
| 283 | 3300036401 | Ga0373937_0923021 | Ga0373937_0923021_118_669 | 174 |
| 284 | 3300036401 | Ga0373937_1544026 | Ga0373937_1544026_41_586 | 174 |
| 285 | 3300037068 | Ga0373925_0536071 | Ga0373925_0536071_63_608 | 174 |
| 286 | 3300039450 | Ga0436363_1364936 | Ga0436363_1364936_90_650 | 174 |
| 287 | 3300046533 | Ga0495640_0058597 | Ga0495640_0058597_839_1390 | 174 |
| 288 | 3300046533 | Ga0495640_0320742 | Ga0495640_0320742_395_940 | 174 |
| 289 | 3300046539 | Ga0495621_0049700 | Ga0495621_0049700_910_1458 | 174 |
| 290 | 3300046543 | Ga0495645_0399841 | Ga0495645_0399841_280_831 | 174 |
| 291 | 3300046642 | Ga0495634_0601735 | Ga0495634_0601735_20_571 | 174 |
| 292 | 3300046681 | Ga0495647_0051787 | Ga0495647_0051787_428_973 | 174 |
| 293 | 3300048903 | Ga0496100_0001533 | Ga0496100_0001533_10329_10874 | 174 |
| 294 | 3300048904 | Ga0496101_0006897 | Ga0496101_0006897_4329_4874 | 174 |
| 295 | 3300048906 | Ga0496103_0526264 | Ga0496103_0526264_103_654 | 174 |
| 296 | 3300048907 | Ga0496104_0033960 | Ga0496104_0033960_1215_1760 | 174 |
| 297 | 3300048908 | Ga0496105_0072751 | Ga0496105_0072751_1209_1754 | 174 |
| 298 | 3300048909 | Ga0496106_0036620 | Ga0496106_0036620_2687_3232 | 174 |
| 299 | 3300048909 | Ga0496106_0067690 | Ga0496106_0067690_1483_2034 | 174 |
| 300 | 3300048910 | Ga0496107_0928689 | Ga0496107_0928689_19_564 | 174 |
| 301 | 3300048911 | Ga0496108_0192001 | Ga0496108_0192001_877_1428 | 174 |
| 302 | 3300048918 | Ga0496115_0157689 | Ga0496115_0157689_262_807 | 174 |
| 303 | 3300050511 | nmdc:mga08y16_661762_c1 | nmdc:mga08y16_661762_c1_464_1009 | 174 |
| 304 | 3300050515 | nmdc:mga0a205_27073_c1 | nmdc:mga0a205_27073_c1_1163_1714 | 174 |
| 305 | 3300053085 | Ga0495619_0351401 | Ga0495619_0351401_342_893 | 174 |
| 306 | 3300005293 | Ga0065715_10123025 | Ga0065715_101230252 | 175 |
| 307 | 3300005355 | Ga0070671_100708167 | Ga0070671_1007081671 | 175 |
| 308 | 3300005364 | Ga0070673_100007433 | Ga0070673_1000074333 | 175 |
| 309 | 3300005437 | Ga0070710_10673034 | Ga0070710_106730341 | 175 |
| 310 | 3300005445 | Ga0070708_100185259 | Ga0070708_1001852592 | 175 |
| 311 | 3300005445 | Ga0070708_100505708 | Ga0070708_1005057082 | 175 |
| 312 | 3300005467 | Ga0070706_100366713 | Ga0070706_1003667132 | 175 |
| 313 | 3300005471 | Ga0070698_100258498 | Ga0070698_1002584981 | 175 |
| 314 | 3300005471 | Ga0070698_100649775 | Ga0070698_1006497752 | 175 |
| 315 | 3300005548 | Ga0070665_100774343 | Ga0070665_1007743432 | 175 |
| 316 | 3300005548 | Ga0070665_101175684 | Ga0070665_1011756842 | 175 |
| 317 | 3300005615 | Ga0070702_100650997 | Ga0070702_1006509971 | 175 |
| 318 | 3300005617 | Ga0068859_100354151 | Ga0068859_1003541512 | 175 |
| 319 | 3300005842 | Ga0068858_100182805 | Ga0068858_1001828052 | 175 |
| 320 | 3300005842 | Ga0068858_100183774 | Ga0068858_1001837742 | 175 |
| 321 | 3300005842 | Ga0068858_100423180 | Ga0068858_1004231802 | 175 |
| 322 | 3300005843 | Ga0068860_100631847 | Ga0068860_1006318471 | 175 |
| 323 | 3300005843 | Ga0068860_100831201 | Ga0068860_1008312012 | 175 |
| 324 | 3300006173 | Ga0070716_100627900 | Ga0070716_1006279001 | 175 |
| 325 | 3300006358 | Ga0068871_100919632 | Ga0068871_1009196321 | 175 |
| 326 | 3300006914 | Ga0075436_100022932 | Ga0075436_1000229322 | 175 |
| 327 | 3300006931 | Ga0097620_100354142 | Ga0097620_1003541422 | 175 |
| 328 | 3300007076 | Ga0075435_100012947 | Ga0075435_1000129477 | 175 |
| 329 | 3300009098 | Ga0105245_10619704 | Ga0105245_106197042 | 175 |
| 330 | 3300009101 | Ga0105247_10123436 | Ga0105247_101234362 | 175 |
| 331 | 3300009101 | Ga0105247_11304512 | Ga0105247_113045121 | 175 |
| 332 | 3300009147 | Ga0114129_10011848 | Ga0114129_100118486 | 175 |
| 333 | 3300009147 | Ga0114129_10399358 | Ga0114129_103993582 | 175 |
| 334 | 3300009147 | Ga0114129_11152612 | Ga0114129_111526121 | 175 |
| 335 | 3300009177 | Ga0105248_10121507 | Ga0105248_101215072 | 175 |
| 336 | 3300009177 | Ga0105248_10848019 | Ga0105248_108480191 | 175 |
| 337 | 3300009177 | Ga0105248_11079895 | Ga0105248_110798952 | 175 |
| 338 | 3300013297 | Ga0157378_10438723 | Ga0157378_104387232 | 175 |
| 339 | 3300014325 | Ga0163163_10053731 | Ga0163163_100537313 | 175 |
| 340 | 3300014968 | Ga0157379_10056109 | Ga0157379_100561094 | 175 |
| 341 | 3300014968 | Ga0157379_10217435 | Ga0157379_102174352 | 175 |
| 342 | 3300025900 | Ga0207710_10048765 | Ga0207710_100487652 | 175 |
| 343 | 3300025918 | Ga0207662_10690516 | Ga0207662_106905161 | 175 |
| 344 | 3300025927 | Ga0207687_10260912 | Ga0207687_102609122 | 175 |
| 345 | 3300025939 | Ga0207665_10536443 | Ga0207665_105364432 | 175 |
| 346 | 3300025941 | Ga0207711_10008211 | Ga0207711_100082114 | 175 |
| 347 | 3300025942 | Ga0207689_10542798 | Ga0207689_105427981 | 175 |
| 348 | 3300025960 | Ga0207651_10015397 | Ga0207651_100153974 | 175 |
| 349 | 3300026035 | Ga0207703_10089972 | Ga0207703_100899722 | 175 |
| 350 | 3300026035 | Ga0207703_10128427 | Ga0207703_101284272 | 175 |
| 351 | 3300026035 | Ga0207703_10158107 | Ga0207703_101581072 | 175 |
| 352 | 3300028381 | Ga0268264_10159730 | Ga0268264_101597301 | 175 |
| 353 | 3300028381 | Ga0268264_10345126 | Ga0268264_103451261 | 175 |
| 354 | 3300028381 | Ga0268264_10743494 | Ga0268264_107434941 | 175 |
| 355 | 3300036401 | Ga0373937_0387378 | Ga0373937_0387378_552_1100 | 175 |
| 356 | 3300042530 | Ga0450916_025143 | Ga0450916_025143_184_741 | 175 |
| 357 | 3300045051 | Ga0451576_0311039 | Ga0451576_0311039_737_1300 | 175 |
| 358 | 3300046459 | Ga0495629_0687620 | Ga0495629_0687620_58_606 | 175 |
| 359 | 3300046535 | Ga0495586_0430889 | Ga0495586_0430889_175_723 | 175 |
| 360 | 3300048915 | Ga0496112_0812191 | Ga0496112_0812191_198_752 | 175 |
| 361 | 3300048917 | Ga0496114_0259810 | Ga0496114_0259810_119_667 | 175 |
| 362 | 3300049571 | Ga0501034_0040753 | Ga0501034_0040753_1652_2212 | 175 |
| 363 | 3300049571 | Ga0501034_0099532 | Ga0501034_0099532_1992_2552 | 175 |
| 364 | 3300049587 | Ga0501071_0835522 | Ga0501071_0835522_18_563 | 175 |
| 365 | 3300049588 | Ga0501072_0609308 | Ga0501072_0609308_10_573 | 175 |
| 366 | 3300049742 | Ga0501080_0524951 | Ga0501080_0524951_59_604 | 175 |
| 367 | 3300049742 | Ga0501080_1087256 | Ga0501080_1087256_77_637 | 175 |
| 368 | 3300049823 | Ga0501044_0025835 | Ga0501044_0025835_2432_2992 | 175 |
| 369 | 3300049824 | Ga0501045_0120737 | Ga0501045_0120737_1378_1923 | 175 |
| 370 | 3300050507 | nmdc:mga05p37_1090426_c1 | nmdc:mga05p37_1090426_c1_267_824 | 175 |
| 371 | 3300050507 | nmdc:mga05p37_7530_c1 | nmdc:mga05p37_7530_c1_5543_6097 | 175 |
| 372 | 3300050512 | nmdc:mga0n895_1537346_c1 | nmdc:mga0n895_1537346_c1_90_617 | 175 |
| 373 | 3300050512 | nmdc:mga0n895_676153_c1 | nmdc:mga0n895_676153_c1_350_904 | 175 |
| 374 | 3300050513 | nmdc:mga0rr50_8855_c1 | nmdc:mga0rr50_8855_c1_2985_3539 | 175 |
| 375 | 3300050514 | nmdc:mga08x19_129116_c1 | nmdc:mga08x19_129116_c1_511_1068 | 175 |
| 376 | 3300060353 | Ga0501082_0877351 | Ga0501082_0877351_80_640 | 175 |
| 377 | 3300061734 | Ga0530510_0032762 | Ga0530510_0032762_1805_2350 | 175 |
| 378 | 3300005290 | Ga0065712_10088104 | Ga0065712_100881042 | 176 |
| 379 | 3300005293 | Ga0065715_10263739 | Ga0065715_102637391 | 176 |
| 380 | 3300005328 | Ga0070676_10016794 | Ga0070676_100167944 | 176 |
| 381 | 3300005330 | Ga0070690_100400749 | Ga0070690_1004007492 | 176 |
| 382 | 3300005331 | Ga0070670_100287351 | Ga0070670_1002873512 | 176 |
| 383 | 3300005333 | Ga0070677_10177799 | Ga0070677_101777991 | 176 |
| 384 | 3300005334 | Ga0068869_100297242 | Ga0068869_1002972422 | 176 |
| 385 | 3300005335 | Ga0070666_10358225 | Ga0070666_103582252 | 176 |
| 386 | 3300005338 | Ga0068868_100093500 | Ga0068868_1000935002 | 176 |
| 387 | 3300005338 | Ga0068868_100102243 | Ga0068868_1001022432 | 176 |
| 388 | 3300005339 | Ga0070660_101156038 | Ga0070660_1011560381 | 176 |
| 389 | 3300005340 | Ga0070689_100209031 | Ga0070689_1002090312 | 176 |
| 390 | 3300005341 | Ga0070691_10077586 | Ga0070691_100775862 | 176 |
| 391 | 3300005343 | Ga0070687_100075395 | Ga0070687_1000753952 | 176 |
| 392 | 3300005353 | Ga0070669_100027284 | Ga0070669_1000272843 | 176 |
| 393 | 3300005353 | Ga0070669_100030171 | Ga0070669_1000301713 | 176 |
| 394 | 3300005354 | Ga0070675_100390799 | Ga0070675_1003907991 | 176 |
| 395 | 3300005355 | Ga0070671_100058300 | Ga0070671_1000583002 | 176 |
| 396 | 3300005355 | Ga0070671_100403894 | Ga0070671_1004038942 | 176 |
| 397 | 3300005356 | Ga0070674_100002222 | Ga0070674_1000022224 | 176 |
| 398 | 3300005364 | Ga0070673_100657483 | Ga0070673_1006574831 | 176 |
| 399 | 3300005365 | Ga0070688_100017585 | Ga0070688_1000175854 | 176 |
| 400 | 3300005365 | Ga0070688_100027256 | Ga0070688_1000272562 | 176 |
| 401 | 3300005406 | Ga0070703_10155481 | Ga0070703_101554811 | 176 |
| 402 | 3300005438 | Ga0070701_10079196 | Ga0070701_100791961 | 176 |
| 403 | 3300005440 | Ga0070705_100950133 | Ga0070705_1009501331 | 176 |
| 404 | 3300005441 | Ga0070700_100002552 | Ga0070700_1000025525 | 176 |
| 405 | 3300005444 | Ga0070694_100008007 | Ga0070694_1000080077 | 176 |
| 406 | 3300005457 | Ga0070662_100254206 | Ga0070662_1002542062 | 176 |
| 407 | 3300005458 | Ga0070681_10145441 | Ga0070681_101454412 | 176 |
| 408 | 3300005459 | Ga0068867_100013308 | Ga0068867_1000133082 | 176 |
| 409 | 3300005459 | Ga0068867_100050115 | Ga0068867_1000501152 | 176 |
| 410 | 3300005459 | Ga0068867_100426367 | Ga0068867_1004263672 | 176 |
| 411 | 3300005467 | Ga0070706_100266451 | Ga0070706_1002664512 | 176 |
| 412 | 3300005467 | Ga0070706_101096955 | Ga0070706_1010969551 | 176 |
| 413 | 3300005468 | Ga0070707_101418963 | Ga0070707_1014189631 | 176 |
| 414 | 3300005471 | Ga0070698_100377123 | Ga0070698_1003771232 | 176 |
| 415 | 3300005518 | Ga0070699_100149832 | Ga0070699_1001498322 | 176 |
| 416 | 3300005518 | Ga0070699_100498816 | Ga0070699_1004988161 | 176 |
| 417 | 3300005535 | Ga0070684_100321305 | Ga0070684_1003213051 | 176 |
| 418 | 3300005536 | Ga0070697_100008131 | Ga0070697_1000081315 | 176 |
| 419 | 3300005536 | Ga0070697_100217771 | Ga0070697_1002177711 | 176 |
| 420 | 3300005536 | Ga0070697_101187959 | Ga0070697_1011879591 | 176 |
| 421 | 3300005543 | Ga0070672_100007912 | Ga0070672_1000079122 | 176 |
| 422 | 3300005543 | Ga0070672_100269793 | Ga0070672_1002697932 | 176 |
| 423 | 3300005543 | Ga0070672_100561505 | Ga0070672_1005615051 | 176 |
| 424 | 3300005544 | Ga0070686_100019068 | Ga0070686_1000190684 | 176 |
| 425 | 3300005544 | Ga0070686_100032957 | Ga0070686_1000329572 | 176 |
| 426 | 3300005544 | Ga0070686_100199450 | Ga0070686_1001994501 | 176 |
| 427 | 3300005545 | Ga0070695_100009349 | Ga0070695_1000093492 | 176 |
| 428 | 3300005545 | Ga0070695_100197478 | Ga0070695_1001974781 | 176 |
| 429 | 3300005545 | Ga0070695_100353988 | Ga0070695_1003539881 | 176 |
| 430 | 3300005546 | Ga0070696_100137584 | Ga0070696_1001375842 | 176 |
| 431 | 3300005546 | Ga0070696_100911756 | Ga0070696_1009117561 | 176 |
| 432 | 3300005548 | Ga0070665_100039958 | Ga0070665_1000399582 | 176 |
| 433 | 3300005548 | Ga0070665_100043475 | Ga0070665_1000434752 | 176 |
| 434 | 3300005548 | Ga0070665_100147040 | Ga0070665_1001470402 | 176 |
| 435 | 3300005549 | Ga0070704_100003291 | Ga0070704_1000032917 | 176 |
| 436 | 3300005549 | Ga0070704_100134913 | Ga0070704_1001349132 | 176 |
| 437 | 3300005549 | Ga0070704_100900635 | Ga0070704_1009006351 | 176 |
| 438 | 3300005564 | Ga0070664_101042540 | Ga0070664_1010425402 | 176 |
| 439 | 3300005578 | Ga0068854_100711666 | Ga0068854_1007116662 | 176 |
| 440 | 3300005617 | Ga0068859_100157307 | Ga0068859_1001573072 | 176 |
| 441 | 3300005617 | Ga0068859_100822033 | Ga0068859_1008220331 | 176 |
| 442 | 3300005618 | Ga0068864_100010173 | Ga0068864_10001017310 | 176 |
| 443 | 3300005618 | Ga0068864_100412681 | Ga0068864_1004126812 | 176 |
| 444 | 3300005618 | Ga0068864_100492805 | Ga0068864_1004928052 | 176 |
| 445 | 3300005618 | Ga0068864_101097997 | Ga0068864_1010979971 | 176 |
| 446 | 3300005718 | Ga0068866_10079689 | Ga0068866_100796892 | 176 |
| 447 | 3300005718 | Ga0068866_10382751 | Ga0068866_103827512 | 176 |
| 448 | 3300005719 | Ga0068861_101334175 | Ga0068861_1013341752 | 176 |
| 449 | 3300005834 | Ga0068851_10118415 | Ga0068851_101184152 | 176 |
| 450 | 3300005840 | Ga0068870_10493834 | Ga0068870_104938342 | 176 |
| 451 | 3300005841 | Ga0068863_100170185 | Ga0068863_1001701852 | 176 |
| 452 | 3300005841 | Ga0068863_100186126 | Ga0068863_1001861262 | 176 |
| 453 | 3300005841 | Ga0068863_100352264 | Ga0068863_1003522642 | 176 |
| 454 | 3300005842 | Ga0068858_100096867 | Ga0068858_1000968673 | 176 |
| 455 | 3300005842 | Ga0068858_100307671 | Ga0068858_1003076712 | 176 |
| 456 | 3300005842 | Ga0068858_100559380 | Ga0068858_1005593801 | 176 |
| 457 | 3300005842 | Ga0068858_101226003 | Ga0068858_1012260031 | 176 |
| 458 | 3300005842 | Ga0068858_101691431 | Ga0068858_1016914311 | 176 |
| 459 | 3300005843 | Ga0068860_100228036 | Ga0068860_1002280362 | 176 |
| 460 | 3300005843 | Ga0068860_100339990 | Ga0068860_1003399902 | 176 |
| 461 | 3300005844 | Ga0068862_100016873 | Ga0068862_1000168732 | 176 |
| 462 | 3300005937 | Ga0081455_10052704 | Ga0081455_100527041 | 176 |
| 463 | 3300005937 | Ga0081455_10435669 | Ga0081455_104356692 | 176 |
| 464 | 3300006058 | Ga0075432_10065960 | Ga0075432_100659602 | 176 |
| 465 | 3300006237 | Ga0097621_100003570 | Ga0097621_1000035707 | 176 |
| 466 | 3300006237 | Ga0097621_100073190 | Ga0097621_1000731902 | 176 |
| 467 | 3300006237 | Ga0097621_100437125 | Ga0097621_1004371252 | 176 |
| 468 | 3300006358 | Ga0068871_100030849 | Ga0068871_1000308493 | 176 |
| 469 | 3300006358 | Ga0068871_100120424 | Ga0068871_1001204242 | 176 |
| 470 | 3300006358 | Ga0068871_100159232 | Ga0068871_1001592322 | 176 |
| 471 | 3300006844 | Ga0075428_100558654 | Ga0075428_1005586542 | 176 |
| 472 | 3300006852 | Ga0075433_10206021 | Ga0075433_102060212 | 176 |
| 473 | 3300006871 | Ga0075434_100091700 | Ga0075434_1000917002 | 176 |
| 474 | 3300006871 | Ga0075434_100189701 | Ga0075434_1001897012 | 176 |
| 475 | 3300006871 | Ga0075434_100400293 | Ga0075434_1004002931 | 176 |
| 476 | 3300006871 | Ga0075434_100466636 | Ga0075434_1004666362 | 176 |
| 477 | 3300006871 | Ga0075434_100863765 | Ga0075434_1008637651 | 176 |
| 478 | 3300006881 | Ga0068865_100113304 | Ga0068865_1001133042 | 176 |
| 479 | 3300006914 | Ga0075436_100022674 | Ga0075436_1000226743 | 176 |
| 480 | 3300006914 | Ga0075436_100066077 | Ga0075436_1000660772 | 176 |
| 481 | 3300006931 | Ga0097620_100157303 | Ga0097620_1001573033 | 176 |
| 482 | 3300006931 | Ga0097620_100822048 | Ga0097620_1008220481 | 176 |
| 483 | 3300007076 | Ga0075435_100000982 | Ga0075435_10000098215 | 176 |
| 484 | 3300007076 | Ga0075435_100004535 | Ga0075435_1000045355 | 176 |
| 485 | 3300007076 | Ga0075435_100008984 | Ga0075435_1000089845 | 176 |
| 486 | 3300007076 | Ga0075435_100099384 | Ga0075435_1000993842 | 176 |
| 487 | 3300007076 | Ga0075435_100118023 | Ga0075435_1001180232 | 176 |
| 488 | 3300007076 | Ga0075435_100165371 | Ga0075435_1001653712 | 176 |
| 489 | 3300007076 | Ga0075435_100744299 | Ga0075435_1007442992 | 176 |
| 490 | 3300009093 | Ga0105240_11185799 | Ga0105240_111857991 | 176 |
| 491 | 3300009093 | Ga0105240_11964780 | Ga0105240_119647801 | 176 |
| 492 | 3300009094 | Ga0111539_10088494 | Ga0111539_100884944 | 176 |
| 493 | 3300009094 | Ga0111539_10153878 | Ga0111539_101538782 | 176 |
| 494 | 3300009098 | Ga0105245_10035083 | Ga0105245_100350833 | 176 |
| 495 | 3300009098 | Ga0105245_10041645 | Ga0105245_100416454 | 176 |
| 496 | 3300009098 | Ga0105245_10795086 | Ga0105245_107950862 | 176 |
| 497 | 3300009101 | Ga0105247_10008843 | Ga0105247_100088432 | 176 |
| 498 | 3300009147 | Ga0114129_10010381 | Ga0114129_100103816 | 176 |
| 499 | 3300009147 | Ga0114129_10028993 | Ga0114129_100289936 | 176 |
| 500 | 3300009147 | Ga0114129_10029006 | Ga0114129_100290062 | 176 |
| 501 | 3300009147 | Ga0114129_10079890 | Ga0114129_100798902 | 176 |
| 502 | 3300009148 | Ga0105243_10161109 | Ga0105243_101611092 | 176 |
| 503 | 3300009148 | Ga0105243_10201697 | Ga0105243_102016972 | 176 |
| 504 | 3300009174 | Ga0105241_10305154 | Ga0105241_103051542 | 176 |
| 505 | 3300009176 | Ga0105242_10021080 | Ga0105242_100210803 | 176 |
| 506 | 3300009176 | Ga0105242_10715420 | Ga0105242_107154202 | 176 |
| 507 | 3300009176 | Ga0105242_10807308 | Ga0105242_108073082 | 176 |
| 508 | 3300009177 | Ga0105248_10011297 | Ga0105248_1001129710 | 176 |
| 509 | 3300009177 | Ga0105248_10027045 | Ga0105248_100270457 | 176 |
| 510 | 3300009177 | Ga0105248_10442687 | Ga0105248_104426872 | 176 |
| 511 | 3300009177 | Ga0105248_11231595 | Ga0105248_112315951 | 176 |
| 512 | 3300009545 | Ga0105237_10648600 | Ga0105237_106486001 | 176 |
| 513 | 3300009551 | Ga0105238_10569141 | Ga0105238_105691412 | 176 |
| 514 | 3300009553 | Ga0105249_10607899 | Ga0105249_106078992 | 176 |
| 515 | 3300010375 | Ga0105239_11509220 | Ga0105239_115092201 | 176 |
| 516 | 3300011119 | Ga0105246_10131282 | Ga0105246_101312822 | 176 |
| 517 | 3300013296 | Ga0157374_10021328 | Ga0157374_100213282 | 176 |
| 518 | 3300013296 | Ga0157374_10254783 | Ga0157374_102547832 | 176 |
| 519 | 3300013296 | Ga0157374_10886338 | Ga0157374_108863382 | 176 |
| 520 | 3300013306 | Ga0163162_10017908 | Ga0163162_100179086 | 176 |
| 521 | 3300013306 | Ga0163162_10378521 | Ga0163162_103785212 | 176 |
| 522 | 3300013308 | Ga0157375_10110326 | Ga0157375_101103262 | 176 |
| 523 | 3300013308 | Ga0157375_10491558 | Ga0157375_104915582 | 176 |
| 524 | 3300013308 | Ga0157375_10494202 | Ga0157375_104942022 | 176 |
| 525 | 3300014325 | Ga0163163_10004562 | Ga0163163_100045628 | 176 |
| 526 | 3300014325 | Ga0163163_10177578 | Ga0163163_101775782 | 176 |
| 527 | 3300014325 | Ga0163163_10970033 | Ga0163163_109700332 | 176 |
| 528 | 3300014325 | Ga0163163_11025509 | Ga0163163_110255091 | 176 |
| 529 | 3300014326 | Ga0157380_10114323 | Ga0157380_101143232 | 176 |
| 530 | 3300014326 | Ga0157380_10126530 | Ga0157380_101265302 | 176 |
| 531 | 3300014968 | Ga0157379_10019746 | Ga0157379_100197464 | 176 |
| 532 | 3300014969 | Ga0157376_10017840 | Ga0157376_100178402 | 176 |
| 533 | 3300014969 | Ga0157376_10256817 | Ga0157376_102568172 | 176 |
| 534 | 3300014969 | Ga0157376_10708893 | Ga0157376_107088931 | 176 |
| 535 | 3300017792 | Ga0163161_10105378 | Ga0163161_101053782 | 176 |
| 536 | 3300025885 | Ga0207653_10049650 | Ga0207653_100496502 | 176 |
| 537 | 3300025893 | Ga0207682_10053288 | Ga0207682_100532882 | 176 |
| 538 | 3300025899 | Ga0207642_10081113 | Ga0207642_100811132 | 176 |
| 539 | 3300025900 | Ga0207710_10005396 | Ga0207710_100053963 | 176 |
| 540 | 3300025903 | Ga0207680_10093938 | Ga0207680_100939382 | 176 |
| 541 | 3300025907 | Ga0207645_10005828 | Ga0207645_100058285 | 176 |
| 542 | 3300025908 | Ga0207643_10316694 | Ga0207643_103166942 | 176 |
| 543 | 3300025910 | Ga0207684_10499743 | Ga0207684_104997431 | 176 |
| 544 | 3300025920 | Ga0207649_10212637 | Ga0207649_102126371 | 176 |
| 545 | 3300025920 | Ga0207649_10692320 | Ga0207649_106923201 | 176 |
| 546 | 3300025922 | Ga0207646_11123642 | Ga0207646_111236421 | 176 |
| 547 | 3300025923 | Ga0207681_10039330 | Ga0207681_100393302 | 176 |
| 548 | 3300025923 | Ga0207681_10156649 | Ga0207681_101566492 | 176 |
| 549 | 3300025925 | Ga0207650_10280784 | Ga0207650_102807842 | 176 |
| 550 | 3300025925 | Ga0207650_10287158 | Ga0207650_102871582 | 176 |
| 551 | 3300025926 | Ga0207659_10280573 | Ga0207659_102805732 | 176 |
| 552 | 3300025926 | Ga0207659_10418444 | Ga0207659_104184442 | 176 |
| 553 | 3300025926 | Ga0207659_11144104 | Ga0207659_111441042 | 176 |
| 554 | 3300025927 | Ga0207687_10031081 | Ga0207687_100310813 | 176 |
| 555 | 3300025931 | Ga0207644_10009889 | Ga0207644_100098892 | 176 |
| 556 | 3300025932 | Ga0207690_10248881 | Ga0207690_102488812 | 176 |
| 557 | 3300025932 | Ga0207690_11040034 | Ga0207690_110400341 | 176 |
| 558 | 3300025933 | Ga0207706_10088113 | Ga0207706_100881132 | 176 |
| 559 | 3300025933 | Ga0207706_10282016 | Ga0207706_102820162 | 176 |
| 560 | 3300025934 | Ga0207686_10015837 | Ga0207686_100158372 | 176 |
| 561 | 3300025934 | Ga0207686_10042044 | Ga0207686_100420442 | 176 |
| 562 | 3300025934 | Ga0207686_10079551 | Ga0207686_100795513 | 176 |
| 563 | 3300025934 | Ga0207686_10888266 | Ga0207686_108882661 | 176 |
| 564 | 3300025934 | Ga0207686_11200363 | Ga0207686_112003631 | 176 |
| 565 | 3300025935 | Ga0207709_10254819 | Ga0207709_102548192 | 176 |
| 566 | 3300025936 | Ga0207670_10259611 | Ga0207670_102596111 | 176 |
| 567 | 3300025938 | Ga0207704_10004287 | Ga0207704_100042877 | 176 |
| 568 | 3300025940 | Ga0207691_10269977 | Ga0207691_102699772 | 176 |
| 569 | 3300025941 | Ga0207711_10012271 | Ga0207711_100122717 | 176 |
| 570 | 3300025941 | Ga0207711_10160489 | Ga0207711_101604891 | 176 |
| 571 | 3300025941 | Ga0207711_10419410 | Ga0207711_104194101 | 176 |
| 572 | 3300025941 | Ga0207711_10472957 | Ga0207711_104729572 | 176 |
| 573 | 3300025941 | Ga0207711_10948906 | Ga0207711_109489062 | 176 |
| 574 | 3300025942 | Ga0207689_10678505 | Ga0207689_106785052 | 176 |
| 575 | 3300025960 | Ga0207651_10056524 | Ga0207651_100565243 | 176 |
| 576 | 3300025960 | Ga0207651_10111454 | Ga0207651_101114541 | 176 |
| 577 | 3300025960 | Ga0207651_10409635 | Ga0207651_104096351 | 176 |
| 578 | 3300025960 | Ga0207651_10642570 | Ga0207651_106425702 | 176 |
| 579 | 3300025961 | Ga0207712_10450251 | Ga0207712_104502512 | 176 |
| 580 | 3300025972 | Ga0207668_10110058 | Ga0207668_101100582 | 176 |
| 581 | 3300025981 | Ga0207640_10042422 | Ga0207640_100424222 | 176 |
| 582 | 3300025981 | Ga0207640_10127195 | Ga0207640_101271952 | 176 |
| 583 | 3300025986 | Ga0207658_10011360 | Ga0207658_100113604 | 176 |
| 584 | 3300026023 | Ga0207677_10141763 | Ga0207677_101417632 | 176 |
| 585 | 3300026035 | Ga0207703_10115837 | Ga0207703_101158372 | 176 |
| 586 | 3300026075 | Ga0207708_10014324 | Ga0207708_100143242 | 176 |
| 587 | 3300026075 | Ga0207708_10115747 | Ga0207708_101157472 | 176 |
| 588 | 3300026088 | Ga0207641_10007357 | Ga0207641_100073575 | 176 |
| 589 | 3300026089 | Ga0207648_10045119 | Ga0207648_100451192 | 176 |
| 590 | 3300026089 | Ga0207648_10167183 | Ga0207648_101671832 | 176 |
| 591 | 3300026089 | Ga0207648_10189219 | Ga0207648_101892192 | 176 |
| 592 | 3300026089 | Ga0207648_10209830 | Ga0207648_102098302 | 176 |
| 593 | 3300026095 | Ga0207676_10749814 | Ga0207676_107498141 | 176 |
| 594 | 3300026095 | Ga0207676_11028952 | Ga0207676_110289521 | 176 |
| 595 | 3300026118 | Ga0207675_100043855 | Ga0207675_1000438552 | 176 |
| 596 | 3300026118 | Ga0207675_101230191 | Ga0207675_1012301912 | 176 |
| 597 | 3300026121 | Ga0207683_10179174 | Ga0207683_101791742 | 176 |
| 598 | 3300028379 | Ga0268266_10121845 | Ga0268266_101218453 | 176 |
| 599 | 3300028380 | Ga0268265_10017900 | Ga0268265_100179006 | 176 |
| 600 | 3300028380 | Ga0268265_10159475 | Ga0268265_101594752 | 176 |
| 601 | 3300028380 | Ga0268265_10361190 | Ga0268265_103611902 | 176 |
| 602 | 3300028381 | Ga0268264_10478855 | Ga0268264_104788552 | 176 |
| 603 | 3300028381 | Ga0268264_10649787 | Ga0268264_106497871 | 176 |
| 604 | 3300030521 | Ga0307511_10106184 | Ga0307511_101061841 | 176 |
| 605 | 3300031711 | Ga0265314_10038673 | Ga0265314_100386734 | 176 |
| 606 | 3300032002 | Ga0307416_100759321 | Ga0307416_1007593212 | 176 |
| 607 | 3300034816 | Ga0373930_0001039 | Ga0373930_0001039_3115_3672 | 176 |
| 608 | 3300034817 | Ga0373948_0003611 | Ga0373948_0003611_20_577 | 176 |
| 609 | 3300034818 | Ga0373950_0007534 | Ga0373950_0007534_937_1494 | 176 |
| 610 | 3300034819 | Ga0373958_0059178 | Ga0373958_0059178_253_810 | 176 |
| 611 | 3300034819 | Ga0373958_0099560 | Ga0373958_0099560_76_633 | 176 |
| 612 | 3300034820 | Ga0373959_0002937 | Ga0373959_0002937_2031_2588 | 176 |
| 613 | 3300035088 | Ga0373940_0001597 | Ga0373940_0001597_79_636 | 176 |
| 614 | 3300035090 | Ga0373949_0002049 | Ga0373949_0002049_771_1328 | 176 |
| 615 | 3300035091 | Ga0373951_0010193 | Ga0373951_0010193_1518_2075 | 176 |
| 616 | 3300035092 | Ga0373952_0004034 | Ga0373952_0004034_1987_2544 | 176 |
| 617 | 3300035092 | Ga0373952_0156845 | Ga0373952_0156845_36_593 | 176 |
| 618 | 3300035112 | Ga0373932_0011931 | Ga0373932_0011931_1487_2044 | 176 |
| 619 | 3300035115 | Ga0373941_0014275 | Ga0373941_0014275_870_1427 | 176 |
| 620 | 3300035121 | Ga0373960_0000007 | Ga0373960_0000007_17063_17620 | 176 |
| 621 | 3300035172 | Ga0373955_0584454 | Ga0373955_0584454_12_569 | 176 |
| 622 | 3300035207 | Ga0373942_0000144 | Ga0373942_0000144_8015_8572 | 176 |
| 623 | 3300035241 | Ga0373961_0001062 | Ga0373961_0001062_5747_6304 | 176 |
| 624 | 3300035242 | Ga0373962_0009438 | Ga0373962_0009438_37_594 | 176 |
| 625 | 3300035691 | Ga0373931_0009351 | Ga0373931_0009351_228_785 | 176 |
| 626 | 3300035691 | Ga0373931_0340294 | Ga0373931_0340294_38_595 | 176 |
| 627 | 3300037068 | Ga0373925_0096732 | Ga0373925_0096732_74_631 | 176 |
| 628 | 3300037471 | Ga0395905_0395185 | Ga0395905_0395185_329_877 | 176 |
| 629 | 3300044673 | Ga0453683_0337052 | Ga0453683_0337052_18_602 | 176 |
| 630 | 3300044842 | Ga0466957_0309256 | Ga0466957_0309256_82_639 | 176 |
| 631 | 3300045051 | Ga0451576_0060074 | Ga0451576_0060074_2319_2876 | 176 |
| 632 | 3300046528 | Ga0495642_0229553 | Ga0495642_0229553_29_586 | 176 |
| 633 | 3300046543 | Ga0495645_0001445 | Ga0495645_0001445_9151_9708 | 176 |
| 634 | 3300046559 | Ga0495667_0655823 | Ga0495667_0655823_79_636 | 176 |
| 635 | 3300046663 | Ga0495635_0045658 | Ga0495635_0045658_603_1160 | 176 |
| 636 | 3300046664 | Ga0495659_0384898 | Ga0495659_0384898_32_589 | 176 |
| 637 | 3300046678 | Ga0495599_0493938 | Ga0495599_0493938_95_652 | 176 |
| 638 | 3300046683 | Ga0495658_0041589 | Ga0495658_0041589_1605_2162 | 176 |
| 639 | 3300046683 | Ga0495658_0184788 | Ga0495658_0184788_120_677 | 176 |
| 640 | 3300046684 | Ga0495669_0218129 | Ga0495669_0218129_102_659 | 176 |
| 641 | 3300048907 | Ga0496104_0132020 | Ga0496104_0132020_1652_2209 | 176 |
| 642 | 3300048908 | Ga0496105_0212906 | Ga0496105_0212906_95_646 | 176 |
| 643 | 3300048908 | Ga0496105_0632752 | Ga0496105_0632752_43_600 | 176 |
| 644 | 3300048909 | Ga0496106_0616180 | Ga0496106_0616180_104_661 | 176 |
| 645 | 3300048909 | Ga0496106_0621194 | Ga0496106_0621194_235_792 | 176 |
| 646 | 3300048911 | Ga0496108_0008779 | Ga0496108_0008779_5231_5788 | 176 |
| 647 | 3300048914 | Ga0496111_0420167 | Ga0496111_0420167_301_858 | 176 |
| 648 | 3300048915 | Ga0496112_0006594 | Ga0496112_0006594_958_1515 | 176 |
| 649 | 3300048916 | Ga0496113_0083404 | Ga0496113_0083404_27_584 | 176 |
| 650 | 3300048917 | Ga0496114_0069418 | Ga0496114_0069418_933_1490 | 176 |
| 651 | 3300048917 | Ga0496114_0156997 | Ga0496114_0156997_479_1036 | 176 |
| 652 | 3300048917 | Ga0496114_0179591 | Ga0496114_0179591_1130_1687 | 176 |
| 653 | 3300048918 | Ga0496115_0112495 | Ga0496115_0112495_1599_2156 | 176 |
| 654 | 3300050507 | nmdc:mga05p37_15317_c1 | nmdc:mga05p37_15317_c1_8149_8706 | 176 |
| 655 | 3300050507 | nmdc:mga05p37_16647_c1 | nmdc:mga05p37_16647_c1_486_1043 | 176 |
| 656 | 3300050507 | nmdc:mga05p37_38590_c1 | nmdc:mga05p37_38590_c1_5274_5831 | 176 |
| 657 | 3300050507 | nmdc:mga05p37_729641_c1 | nmdc:mga05p37_729641_c1_56_613 | 176 |
| 658 | 3300050507 | nmdc:mga05p37_97789_c1 | nmdc:mga05p37_97789_c1_2559_3134 | 176 |
| 659 | 3300050511 | nmdc:mga08y16_182547_c1 | nmdc:mga08y16_182547_c1_1397_1957 | 176 |
| 660 | 3300050511 | nmdc:mga08y16_261089_c1 | nmdc:mga08y16_261089_c1_551_1108 | 176 |
| 661 | 3300050511 | nmdc:mga08y16_5107_c1 | nmdc:mga08y16_5107_c1_12778_13338 | 176 |
| 662 | 3300050512 | nmdc:mga0n895_103239_c1 | nmdc:mga0n895_103239_c1_527_1084 | 176 |
| 663 | 3300050512 | nmdc:mga0n895_257182_c1 | nmdc:mga0n895_257182_c1_369_926 | 176 |
| 664 | 3300050512 | nmdc:mga0n895_310555_c1 | nmdc:mga0n895_310555_c1_68_625 | 176 |
| 665 | 3300050512 | nmdc:mga0n895_390941_c1 | nmdc:mga0n895_390941_c1_765_1322 | 176 |
| 666 | 3300050512 | nmdc:mga0n895_428690_c1 | nmdc:mga0n895_428690_c1_202_759 | 176 |
| 667 | 3300050512 | nmdc:mga0n895_616694_c1 | nmdc:mga0n895_616694_c1_183_737 | 176 |
| 668 | 3300050512 | nmdc:mga0n895_67_c1 | nmdc:mga0n895_67_c1_59683_60240 | 176 |
| 669 | 3300050513 | nmdc:mga0rr50_114_c1 | nmdc:mga0rr50_114_c1_2354_2911 | 176 |
| 670 | 3300050513 | nmdc:mga0rr50_117144_c1 | nmdc:mga0rr50_117144_c1_827_1384 | 176 |
| 671 | 3300050513 | nmdc:mga0rr50_295238_c1 | nmdc:mga0rr50_295238_c1_353_910 | 176 |
| 672 | 3300050513 | nmdc:mga0rr50_3192_c1 | nmdc:mga0rr50_3192_c1_6446_7003 | 176 |
| 673 | 3300050513 | nmdc:mga0rr50_619962_c1 | nmdc:mga0rr50_619962_c1_191_748 | 176 |
| 674 | 3300050514 | nmdc:mga08x19_103783_c1 | nmdc:mga08x19_103783_c1_320_877 | 176 |
| 675 | 3300050514 | nmdc:mga08x19_175118_c1 | nmdc:mga08x19_175118_c1_762_1319 | 176 |
| 676 | 3300050514 | nmdc:mga08x19_2465_c1 | nmdc:mga08x19_2465_c1_6966_7523 | 176 |
| 677 | 3300050515 | nmdc:mga0a205_36758_c1 | nmdc:mga0a205_36758_c1_2657_3214 | 176 |
| 678 | 3300050515 | nmdc:mga0a205_440193_c1 | nmdc:mga0a205_440193_c1_284_841 | 176 |
| 679 | 3300050515 | nmdc:mga0a205_575787_c1 | nmdc:mga0a205_575787_c1_139_696 | 176 |
| 680 | 3300050515 | nmdc:mga0a205_76377_c1 | nmdc:mga0a205_76377_c1_1073_1630 | 176 |
| 681 | 3300050515 | nmdc:mga0a205_95048_c1 | nmdc:mga0a205_95048_c1_1166_1723 | 176 |
| 682 | 3300053077 | Ga0495601_0154615 | Ga0495601_0154615_76_633 | 176 |
| 683 | 3300053085 | Ga0495619_0024195 | Ga0495619_0024195_2850_3407 | 176 |
| 684 | 3300005434 | Ga0070709_10443042 | Ga0070709_104430421 | 177 |
| 685 | 3300005436 | Ga0070713_100222638 | Ga0070713_1002226382 | 177 |
| 686 | 3300005458 | Ga0070681_10142616 | Ga0070681_101426162 | 177 |
| 687 | 3300005458 | Ga0070681_10574785 | Ga0070681_105747852 | 177 |
| 688 | 3300005471 | Ga0070698_100494236 | Ga0070698_1004942361 | 177 |
| 689 | 3300005535 | Ga0070684_101149231 | Ga0070684_1011492311 | 177 |
| 690 | 3300005615 | Ga0070702_100179897 | Ga0070702_1001798972 | 177 |
| 691 | 3300005843 | Ga0068860_100419758 | Ga0068860_1004197582 | 177 |
| 692 | 3300005937 | Ga0081455_10067100 | Ga0081455_100671003 | 177 |
| 693 | 3300006028 | Ga0070717_10326941 | Ga0070717_103269412 | 177 |
| 694 | 3300006173 | Ga0070716_100142150 | Ga0070716_1001421502 | 177 |
| 695 | 3300006358 | Ga0068871_100054112 | Ga0068871_1000541123 | 177 |
| 696 | 3300009148 | Ga0105243_11198788 | Ga0105243_111987882 | 177 |
| 697 | 3300009174 | Ga0105241_10537928 | Ga0105241_105379281 | 177 |
| 698 | 3300013297 | Ga0157378_10004694 | Ga0157378_100046943 | 177 |
| 699 | 3300014969 | Ga0157376_10606233 | Ga0157376_106062332 | 177 |
| 700 | 3300021384 | Ga0213876_10071763 | Ga0213876_100717632 | 177 |
| 701 | 3300025898 | Ga0207692_10562501 | Ga0207692_105625011 | 177 |
| 702 | 3300025906 | Ga0207699_10007807 | Ga0207699_100078072 | 177 |
| 703 | 3300025912 | Ga0207707_10280198 | Ga0207707_102801982 | 177 |
| 704 | 3300025912 | Ga0207707_10356677 | Ga0207707_103566772 | 177 |
| 705 | 3300025915 | Ga0207693_10270581 | Ga0207693_102705812 | 177 |
| 706 | 3300025928 | Ga0207700_10023717 | Ga0207700_100237173 | 177 |
| 707 | 3300026089 | Ga0207648_10381295 | Ga0207648_103812951 | 177 |
| 708 | 3300028381 | Ga0268264_10343825 | Ga0268264_103438252 | 177 |
| 709 | 3300035170 | Ga0373943_0244533 | Ga0373943_0244533_102_656 | 177 |
| 710 | 3300035172 | Ga0373955_0026296 | Ga0373955_0026296_764_1318 | 177 |
| 711 | 3300035241 | Ga0373961_0199554 | Ga0373961_0199554_93_650 | 177 |
| 712 | 3300036401 | Ga0373937_0397056 | Ga0373937_0397056_632_1186 | 177 |
| 713 | 3300039437 | Ga0436365_1014920 | Ga0436365_1014920_377_931 | 177 |
| 714 | 3300046472 | Ga0495580_0593989 | Ga0495580_0593989_89_643 | 177 |
| 715 | 3300046511 | Ga0495608_0032472 | Ga0495608_0032472_1122_1676 | 177 |
| 716 | 3300046516 | Ga0495628_0744515 | Ga0495628_0744515_50_607 | 177 |
| 717 | 3300046517 | Ga0495630_0001261 | Ga0495630_0001261_14680_15234 | 177 |
| 718 | 3300046533 | Ga0495640_0265528 | Ga0495640_0265528_64_618 | 177 |
| 719 | 3300046536 | Ga0495587_0103928 | Ga0495587_0103928_736_1290 | 177 |
| 720 | 3300046543 | Ga0495645_0003703 | Ga0495645_0003703_368_922 | 177 |
| 721 | 3300046559 | Ga0495667_0131666 | Ga0495667_0131666_786_1340 | 177 |
| 722 | 3300046642 | Ga0495634_0296754 | Ga0495634_0296754_208_762 | 177 |
| 723 | 3300046684 | Ga0495669_0063262 | Ga0495669_0063262_146_700 | 177 |
| 724 | 3300046689 | Ga0495613_0002821 | Ga0495613_0002821_7809_8363 | 177 |
| 725 | 3300046809 | Ga0495600_0326728 | Ga0495600_0326728_140_694 | 177 |
| 726 | 3300047315 | Ga0495581_0235484 | Ga0495581_0235484_15_569 | 177 |
| 727 | 3300047317 | Ga0495604_0026092 | Ga0495604_0026092_1930_2484 | 177 |
| 728 | 3300047319 | Ga0495674_0053305 | Ga0495674_0053305_2526_3080 | 177 |
| 729 | 3300047471 | Ga0495684_0000682 | Ga0495684_0000682_22411_22965 | 177 |
| 730 | 3300048088 | Ga0495602_0068417 | Ga0495602_0068417_1678_2232 | 177 |
| 731 | 3300053077 | Ga0495601_0020931 | Ga0495601_0020931_3151_3705 | 177 |
| 732 | 3300053084 | Ga0495595_0391000 | Ga0495595_0391000_96_650 | 177 |
| 733 | 3300053085 | Ga0495619_0030540 | Ga0495619_0030540_412_966 | 177 |
| 734 | 3300005334 | Ga0068869_100554170 | Ga0068869_1005541702 | 178 |
| 735 | 3300005530 | Ga0070679_100031445 | Ga0070679_1000314452 | 178 |
| 736 | 3300005536 | Ga0070697_100289369 | Ga0070697_1002893692 | 178 |
| 737 | 3300005842 | Ga0068858_100295136 | Ga0068858_1002951362 | 178 |
| 738 | 3300009176 | Ga0105242_10640460 | Ga0105242_106404601 | 178 |
| 739 | 3300025921 | Ga0207652_10482256 | Ga0207652_104822562 | 178 |
| 740 | 3300026035 | Ga0207703_10066805 | Ga0207703_100668052 | 178 |
| 741 | 3300032002 | Ga0307416_100175300 | Ga0307416_1001753002 | 178 |
| 742 | 3300032126 | Ga0307415_101282646 | Ga0307415_1012826461 | 178 |
| 743 | 3300049583 | Ga0501067_0192240 | Ga0501067_0192240_64_615 | 178 |
| 744 | 3300049589 | Ga0501073_0262281 | Ga0501073_0262281_65_616 | 178 |
| 745 | 3300054114 | Ga0501084_0112407 | Ga0501084_0112407_653_1204 | 178 |
| 746 | 3300060353 | Ga0501082_0281256 | Ga0501082_0281256_160_711 | 178 |
| 747 | 3300005468 | Ga0070707_100968494 | Ga0070707_1009684942 | 179 |
| 748 | 3300005518 | Ga0070699_100181668 | Ga0070699_1001816681 | 179 |
| 749 | 3300025922 | Ga0207646_10455607 | Ga0207646_104556072 | 179 |
| 750 | 3300005333 | Ga0070677_10138642 | Ga0070677_101386422 | 180 |
| 751 | 3300005347 | Ga0070668_100226196 | Ga0070668_1002261961 | 180 |
| 752 | 3300005354 | Ga0070675_100240442 | Ga0070675_1002404421 | 180 |
| 753 | 3300005354 | Ga0070675_100349560 | Ga0070675_1003495601 | 180 |
| 754 | 3300005354 | Ga0070675_101132164 | Ga0070675_1011321641 | 180 |
| 755 | 3300005438 | Ga0070701_10728502 | Ga0070701_107285021 | 180 |
| 756 | 3300005456 | Ga0070678_100571548 | Ga0070678_1005715482 | 180 |
| 757 | 3300005466 | Ga0070685_10009755 | Ga0070685_100097553 | 180 |
| 758 | 3300005543 | Ga0070672_100091827 | Ga0070672_1000918272 | 180 |
| 759 | 3300005844 | Ga0068862_100083941 | Ga0068862_1000839412 | 180 |
| 760 | 3300006353 | Ga0075370_10519002 | Ga0075370_105190021 | 180 |
| 761 | 3300009553 | Ga0105249_10044597 | Ga0105249_100445972 | 180 |
| 762 | 3300013306 | Ga0163162_11631134 | Ga0163162_116311341 | 180 |
| 763 | 3300025923 | Ga0207681_10118780 | Ga0207681_101187802 | 180 |
| 764 | 3300025931 | Ga0207644_10511048 | Ga0207644_105110481 | 180 |
| 765 | 3300025940 | Ga0207691_10051210 | Ga0207691_100512103 | 180 |
| 766 | 3300025961 | Ga0207712_10070741 | Ga0207712_100707411 | 180 |
| 767 | 3300025981 | Ga0207640_10338163 | Ga0207640_103381632 | 180 |
| 768 | 3300026075 | Ga0207708_10159967 | Ga0207708_101599672 | 180 |
| 769 | 3300026121 | Ga0207683_10521715 | Ga0207683_105217152 | 180 |
| 770 | 3300028380 | Ga0268265_10294476 | Ga0268265_102944762 | 180 |
| 771 | 3300041408 | Ga0439453_0052883 | Ga0439453_0052883_213_761 | 180 |
| 772 | 3300042435 | Ga0439434_0210453 | Ga0439434_0210453_62_610 | 180 |
| 773 | 3300042436 | Ga0439435_0008363 | Ga0439435_0008363_86_628 | 180 |
| 774 | 3300042461 | Ga0439460_0114596 | Ga0439460_0114596_10_558 | 180 |
| 775 | 3300049570 | Ga0501033_0012882 | Ga0501033_0012882_2483_3025 | 180 |
| 776 | 3300049572 | Ga0501036_0529829 | Ga0501036_0529829_203_745 | 180 |
| 777 | 3300049575 | Ga0501039_0044997 | Ga0501039_0044997_110_652 | 180 |
| 778 | 3300049576 | Ga0501040_0001751 | Ga0501040_0001751_12433_12975 | 180 |
| 779 | 3300049577 | Ga0501041_0075541 | Ga0501041_0075541_1075_1617 | 180 |
| 780 | 3300049578 | Ga0501042_0015393 | Ga0501042_0015393_452_994 | 180 |
| 781 | 3300049579 | Ga0501043_0171388 | Ga0501043_0171388_553_1095 | 180 |
| 782 | 3300049580 | Ga0501046_0008978 | Ga0501046_0008978_2421_2963 | 180 |
| 783 | 3300049582 | Ga0501048_0474770 | Ga0501048_0474770_256_798 | 180 |
| 784 | 3300049584 | Ga0501068_0425683 | Ga0501068_0425683_214_756 | 180 |
| 785 | 3300049588 | Ga0501072_0010677 | Ga0501072_0010677_975_1517 | 180 |
| 786 | 3300049589 | Ga0501073_0035438 | Ga0501073_0035438_1110_1652 | 180 |
| 787 | 3300049590 | Ga0501074_0021554 | Ga0501074_0021554_2054_2596 | 180 |
| 788 | 3300049591 | Ga0501075_0004548 | Ga0501075_0004548_2411_2953 | 180 |
| 789 | 3300049593 | Ga0501077_0005464 | Ga0501077_0005464_3370_3912 | 180 |
| 790 | 3300049742 | Ga0501080_0053548 | Ga0501080_0053548_839_1381 | 180 |
| 791 | 3300049743 | Ga0501081_0000624 | Ga0501081_0000624_14628_15170 | 180 |
| 792 | 3300049822 | Ga0501035_0118995 | Ga0501035_0118995_107_649 | 180 |
| 793 | 3300049824 | Ga0501045_0014008 | Ga0501045_0014008_1362_1904 | 180 |
| 794 | 3300054114 | Ga0501084_0029871 | Ga0501084_0029871_3815_4357 | 180 |
| 795 | 3300060353 | Ga0501082_0025547 | Ga0501082_0025547_3514_4056 | 180 |
| 796 | 3300061734 | Ga0530510_0029745 | Ga0530510_0029745_3322_3864 | 180 |
| 797 | 3300005290 | Ga0065712_10028134 | Ga0065712_100281342 | 181 |
| 798 | 3300005329 | Ga0070683_101095220 | Ga0070683_1010952201 | 181 |
| 799 | 3300005340 | Ga0070689_100325822 | Ga0070689_1003258221 | 181 |
| 800 | 3300005444 | Ga0070694_100167594 | Ga0070694_1001675941 | 181 |
| 801 | 3300005458 | Ga0070681_10139148 | Ga0070681_101391482 | 181 |
| 802 | 3300005458 | Ga0070681_10885115 | Ga0070681_108851151 | 181 |
| 803 | 3300005468 | Ga0070707_100155102 | Ga0070707_1001551022 | 181 |
| 804 | 3300005530 | Ga0070679_100109149 | Ga0070679_1001091492 | 181 |
| 805 | 3300005536 | Ga0070697_100000183 | Ga0070697_10000018357 | 181 |
| 806 | 3300005544 | Ga0070686_100403686 | Ga0070686_1004036861 | 181 |
| 807 | 3300005545 | Ga0070695_100060928 | Ga0070695_1000609283 | 181 |
| 808 | 3300005549 | Ga0070704_100747192 | Ga0070704_1007471921 | 181 |
| 809 | 3300005577 | Ga0068857_100200162 | Ga0068857_1002001622 | 181 |
| 810 | 3300005577 | Ga0068857_100462823 | Ga0068857_1004628231 | 181 |
| 811 | 3300005617 | Ga0068859_100002955 | Ga0068859_10000295518 | 181 |
| 812 | 3300006237 | Ga0097621_100484859 | Ga0097621_1004848592 | 181 |
| 813 | 3300006931 | Ga0097620_100002955 | Ga0097620_10000295518 | 181 |
| 814 | 3300009551 | Ga0105238_11691954 | Ga0105238_116919541 | 181 |
| 815 | 3300014326 | Ga0157380_10031422 | Ga0157380_100314223 | 181 |
| 816 | 3300025907 | Ga0207645_10500498 | Ga0207645_105004981 | 181 |
| 817 | 3300025912 | Ga0207707_10795300 | Ga0207707_107953001 | 181 |
| 818 | 3300025921 | Ga0207652_10089413 | Ga0207652_100894131 | 181 |
| 819 | 3300025922 | Ga0207646_10075158 | Ga0207646_100751582 | 181 |
| 820 | 3300025932 | Ga0207690_11222926 | Ga0207690_112229261 | 181 |
| 821 | 3300025936 | Ga0207670_10188595 | Ga0207670_101885952 | 181 |
| 822 | 3300025944 | Ga0207661_11121162 | Ga0207661_111211622 | 181 |
| 823 | 3300026089 | Ga0207648_10477631 | Ga0207648_104776312 | 181 |
| 824 | 3300026116 | Ga0207674_10107111 | Ga0207674_101071112 | 181 |
| 825 | 3300026116 | Ga0207674_10939923 | Ga0207674_109399231 | 181 |
| 826 | 3300028380 | Ga0268265_10514531 | Ga0268265_105145312 | 181 |
| 827 | 3300037471 | Ga0395905_0607884 | Ga0395905_0607884_380_946 | 181 |
| 828 | 3300048908 | Ga0496105_0762376 | Ga0496105_0762376_19_582 | 181 |
| 829 | 3300048912 | Ga0496109_0490426 | Ga0496109_0490426_26_592 | 181 |
| 830 | 3300048915 | Ga0496112_0135408 | Ga0496112_0135408_1155_1721 | 181 |
| 831 | 3300048915 | Ga0496112_1124251 | Ga0496112_1124251_30_593 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ko1-assembly1.cif.gz_B | solution nmr structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a | 0.8467 | 1 | 74 |
| 6lpi-assembly1.cif.gz_E | crystal structure of ahas holo-enzyme | 0.8411 | 1 | 74 |
| 6u9h-assembly1.cif.gz_G | arabidopsis thaliana acetohydroxyacid synthase complex | 0.8405 | 2 | 157 |
| 7bfg-assembly1.cif.gz_I | circular permutant of ribosomal protein s6, p54-55 truncated, v37a mutant. | 0.8197 | 3 | 74 |
| 2fgc-assembly1.cif.gz_A-2 | crystal structure of acetolactate synthase- small subunit from thermotoga maritima | 0.819 | 1 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q93YZ7_400_477_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9742 | 83 | 155 | 3.30.70.1150 |
| af_Q57625_89_166_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9447 | 83 | 156 | 3.30.70.1150 |
| af_P9WKJ3_86_164_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9326 | 83 | 158 | 3.30.70.1150 |
| af_Q93YZ7_400_477_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9016 | 83 | 155 | 3.30.70.1150 |
| af_P9WKJ3_86_164_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.8875 | 83 | 158 | 3.30.70.1150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A388P049-F1-model_v4 | Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) | 0.9749 | 82 | 150 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
| AF-A0A7K4NBU8-F1-model_v4 | deleted | 0.9319 | 80 | 153 |
|
| AF-A0A537SWU0-F1-model_v4 | Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) | 0.923 | 85 | 156 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
| AF-A0A2H0M709-F1-model_v4 | Acetolactate synthase small subunit C-terminal domain-containing protein | 0.9229 | 81 | 155 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
| AF-A0A8A5Z5S2-F1-model_v4 | deleted | 0.9199 | 80 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar