F482689

General Info

Members Datasets Scaffolds Average Seq Length
831 312 831 183

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10000535|Ga0157369_1000053524
Length 177
Sequence MTSTFVVHVENKPGVLNRVASLFRRRAFNIESLTVGHTDKPGISRMTIVVEANLYKLVNVLRVDNITNQSSVFRDLAIIKVATTPESRAEIMQLAHVFRARVVDVTGESMVLETTGAEDKIDGLVEVLRPYGILEMARTGRVAMTRGASKQSDIQLDRRPVASATDPLDDEPVSYSV

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
224 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
297 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 4.21
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10028134 3300005290 Bacteria 1800
2 Ga0065712_10088104 3300005290 Bacteria 2538
3 Ga0065715_10123025 3300005293 Bacteria 2189
4 Ga0065715_10222596 3300005293 Bacteria 1266
5 Ga0065715_10263739 3300005293 Unclassified 1130
6 Ga0065715_10359783 3300005293 Bacteria 937
7 Ga0065715_10523175 3300005293 Unclassified 692
8 Ga0065707_10495927 3300005295 Unclassified 761
9 Ga0070676_10016794 3300005328 Bacteria 4046
10 Ga0070683_101095220 3300005329 Bacteria 765
11 Ga0070683_101228410 3300005329 Unclassified 720
12 Ga0070690_100049633 3300005330 Bacteria 2676
13 Ga0070690_100400749 3300005330 Bacteria 1008
14 Ga0070670_100082999 3300005331 Bacteria 2754
15 Ga0070670_100265915 3300005331 Bacteria 1496
16 Ga0070670_100287138 3300005331 Bacteria 1437
17 Ga0070670_100287351 3300005331 Bacteria 1436
18 Ga0070670_100440446 3300005331 Bacteria 1154
19 Ga0070677_10138642 3300005333 Bacteria 1119
20 Ga0070677_10177799 3300005333 Unclassified 1011
21 Ga0068869_100297242 3300005334 Bacteria 1303
22 Ga0068869_100554170 3300005334 Bacteria 966
23 Ga0070666_10152319 3300005335 Bacteria 1613
24 Ga0070666_10358225 3300005335 Bacteria 1045
25 Ga0070680_100470311 3300005336 Bacteria 1074
26 Ga0068868_100093500 3300005338 Bacteria 2424
27 Ga0068868_100102243 3300005338 Bacteria 2320
28 Ga0070660_100040847 3300005339 Bacteria 3533
29 Ga0070660_101156038 3300005339 Unclassified 656
30 Ga0070689_100209031 3300005340 Bacteria 1596
31 Ga0070689_100325822 3300005340 Bacteria 1284
32 Ga0070691_10077586 3300005341 Bacteria 1621
33 Ga0070687_100075395 3300005343 Bacteria 1824
34 Ga0070661_100154456 3300005344 Bacteria 1736
35 Ga0070661_100295756 3300005344 Bacteria 1259
36 Ga0070692_10523771 3300005345 Bacteria 772
37 Ga0070668_100168944 3300005347 Bacteria 1779
38 Ga0070668_100226196 3300005347 Bacteria 1545
39 Ga0070668_100403117 3300005347 Bacteria 1168
40 Ga0070669_100027284 3300005353 Bacteria 4110
41 Ga0070669_100030171 3300005353 Bacteria 3911
42 Ga0070669_100081178 3300005353 Bacteria 2415
43 Ga0070675_100000055 3300005354 Bacteria 68147
44 Ga0070675_100031874 3300005354 Bacteria 4263
45 Ga0070675_100060766 3300005354 Bacteria 3119
46 Ga0070675_100240442 3300005354 Bacteria 1582
47 Ga0070675_100322365 3300005354 Bacteria 1365
48 Ga0070675_100349560 3300005354 Bacteria 1311
49 Ga0070675_100390799 3300005354 Bacteria 1239
50 Ga0070675_101132164 3300005354 Bacteria 720
51 Ga0070671_100058300 3300005355 Bacteria 3214
52 Ga0070671_100403894 3300005355 Bacteria 1169
53 Ga0070671_100708167 3300005355 Bacteria 874
54 Ga0070674_100002222 3300005356 Bacteria 10676
55 Ga0070674_100092876 3300005356 Bacteria 2182
56 Ga0070673_100007433 3300005364 Bacteria 7224
57 Ga0070673_100199091 3300005364 Bacteria 1724
58 Ga0070673_100317694 3300005364 Bacteria 1375
59 Ga0070673_100657483 3300005364 Bacteria 960
60 Ga0070688_100017585 3300005365 Bacteria 4106
61 Ga0070688_100027256 3300005365 Bacteria 3402
62 Ga0070667_100796677 3300005367 Bacteria 877
63 Ga0070703_10155481 3300005406 Bacteria 863
64 Ga0070709_10443042 3300005434 Unclassified 977
65 Ga0070713_100222638 3300005436 Bacteria 1712
66 Ga0070710_10673034 3300005437 Bacteria 728
67 Ga0070701_10079196 3300005438 Bacteria 1775
68 Ga0070701_10728502 3300005438 Bacteria 670
69 Ga0070711_100704796 3300005439 Bacteria 850
70 Ga0070705_100950133 3300005440 Bacteria 694
71 Ga0070700_100002552 3300005441 Bacteria 9292
72 Ga0070694_100008007 3300005444 Bacteria 6458
73 Ga0070694_100167594 3300005444 Bacteria 1616
74 Ga0070694_100417898 3300005444 Bacteria 1053
75 Ga0070708_100185259 3300005445 Bacteria 1947
76 Ga0070708_100505708 3300005445 Bacteria 1140
77 Ga0070708_100821152 3300005445 Bacteria 874
78 Ga0070678_100006004 3300005456 Bacteria 7079
79 Ga0070678_100355349 3300005456 Bacteria 1261
80 Ga0070678_100571548 3300005456 Bacteria 1006
81 Ga0070678_100794180 3300005456 Bacteria 859
82 Ga0070678_101106805 3300005456 Bacteria 732
83 Ga0070662_100254206 3300005457 Bacteria 1414
84 Ga0070662_100949411 3300005457 Unclassified 735
85 Ga0070681_10139148 3300005458 Bacteria 2357
86 Ga0070681_10142616 3300005458 Bacteria 2325
87 Ga0070681_10145441 3300005458 Bacteria 2300
88 Ga0070681_10236447 3300005458 Bacteria 1741
89 Ga0070681_10574785 3300005458 Bacteria 1041
90 Ga0070681_10592507 3300005458 Bacteria 1023
91 Ga0070681_10885115 3300005458 Bacteria 811
92 Ga0068867_100013308 3300005459 Bacteria 5828
93 Ga0068867_100050115 3300005459 Bacteria 3076
94 Ga0068867_100348555 3300005459 Bacteria 1235
95 Ga0068867_100426367 3300005459 Bacteria 1125
96 Ga0068867_100703347 3300005459 Bacteria 892
97 Ga0068867_100858810 3300005459 Bacteria 814
98 Ga0070685_10009755 3300005466 Bacteria 4976
99 Ga0070706_100008764 3300005467 Bacteria 9424
100 Ga0070706_100266451 3300005467 Bacteria 1599
101 Ga0070706_100366713 3300005467 Bacteria 1342
102 Ga0070706_101096955 3300005467 Bacteria 733
103 Ga0070707_100155102 3300005468 Bacteria 2231
104 Ga0070707_100968494 3300005468 Bacteria 816
105 Ga0070707_101418963 3300005468 Unclassified 661
106 Ga0070698_100068978 3300005471 Bacteria 3552
107 Ga0070698_100258498 3300005471 Bacteria 1674
108 Ga0070698_100377123 3300005471 Bacteria 1351
109 Ga0070698_100494236 3300005471 Bacteria 1161
110 Ga0070698_100554566 3300005471 Bacteria 1089
111 Ga0070698_100649775 3300005471 Bacteria 996
112 Ga0070699_100029670 3300005518 Bacteria 4716
113 Ga0070699_100149832 3300005518 Bacteria 2063
114 Ga0070699_100181668 3300005518 Bacteria 1867
115 Ga0070699_100498816 3300005518 Bacteria 1106
116 Ga0070699_100530642 3300005518 Bacteria 1070
117 Ga0070699_100761591 3300005518 Bacteria 886
118 Ga0070679_100031445 3300005530 Bacteria 5243
119 Ga0070679_100109149 3300005530 Bacteria 2753
120 Ga0070679_100395577 3300005530 Bacteria 1328
121 Ga0070684_100276843 3300005535 Bacteria 1537
122 Ga0070684_100321305 3300005535 Bacteria 1422
123 Ga0070684_101149231 3300005535 Bacteria 730
124 Ga0070697_100000183 3300005536 Bacteria 51905
125 Ga0070697_100008131 3300005536 Bacteria 8185
126 Ga0070697_100217771 3300005536 Bacteria 1627
127 Ga0070697_100289369 3300005536 Bacteria 1407
128 Ga0070697_100366502 3300005536 Bacteria 1246
129 Ga0070697_101187959 3300005536 Unclassified 680
130 Ga0068853_100520292 3300005539 Bacteria 1125
131 Ga0070672_100007912 3300005543 Bacteria 7259
132 Ga0070672_100091827 3300005543 Bacteria 2450
133 Ga0070672_100269793 3300005543 Bacteria 1436
134 Ga0070672_100554949 3300005543 Bacteria 998
135 Ga0070672_100561505 3300005543 Bacteria 992
136 Ga0070672_101350045 3300005543 Bacteria 637
137 Ga0070686_100019068 3300005544 Bacteria 4036
138 Ga0070686_100032957 3300005544 Bacteria 3180
139 Ga0070686_100199450 3300005544 Bacteria 1433
140 Ga0070686_100403686 3300005544 Bacteria 1040
141 Ga0070695_100009349 3300005545 Bacteria 5831
142 Ga0070695_100060928 3300005545 Bacteria 2446
143 Ga0070695_100197478 3300005545 Bacteria 1435
144 Ga0070695_100353988 3300005545 Bacteria 1101
145 Ga0070696_100058403 3300005546 Bacteria 2694
146 Ga0070696_100137584 3300005546 Bacteria 1782
147 Ga0070696_100911756 3300005546 Bacteria 730
148 Ga0070696_101022863 3300005546 Unclassified 691
149 Ga0070693_100804050 3300005547 Bacteria 697
150 Ga0070665_100039958 3300005548 Bacteria 4717
151 Ga0070665_100043475 3300005548 Bacteria 4515
152 Ga0070665_100147040 3300005548 Bacteria 2359
153 Ga0070665_100774343 3300005548 Bacteria 972
154 Ga0070665_101175684 3300005548 Bacteria 778
155 Ga0070704_100003291 3300005549 Bacteria 9237
156 Ga0070704_100134913 3300005549 Bacteria 1919
157 Ga0070704_100747192 3300005549 Bacteria 871
158 Ga0070704_100900635 3300005549 Bacteria 796
159 Ga0068855_100065284 3300005563 Bacteria 4243
160 Ga0070664_100524930 3300005564 Bacteria 1093
161 Ga0070664_100586764 3300005564 Bacteria 1033
162 Ga0070664_100708397 3300005564 Bacteria 938
163 Ga0070664_101042540 3300005564 Bacteria 769
164 Ga0068857_100200162 3300005577 Bacteria 1821
165 Ga0068857_100210369 3300005577 Bacteria 1775
166 Ga0068857_100462823 3300005577 Bacteria 1187
167 Ga0068854_100711666 3300005578 Bacteria 868
168 Ga0068856_100039480 3300005614 Bacteria 4635
169 Ga0070702_100179897 3300005615 Bacteria 1383
170 Ga0070702_100650997 3300005615 Bacteria 797
171 Ga0068852_100403215 3300005616 Bacteria 1345
172 Ga0068852_100941417 3300005616 Unclassified 882
173 Ga0068859_100002955 3300005617 Bacteria 17241
174 Ga0068859_100157307 3300005617 Bacteria 2350
175 Ga0068859_100354151 3300005617 Bacteria 1563
176 Ga0068859_100822033 3300005617 Unclassified 1016
177 Ga0068859_100868094 3300005617 Bacteria 988
178 Ga0068864_100010173 3300005618 Bacteria 7766
179 Ga0068864_100412681 3300005618 Bacteria 1285
180 Ga0068864_100492805 3300005618 Bacteria 1178
181 Ga0068864_101097997 3300005618 Bacteria 792
182 Ga0068866_10079689 3300005718 Bacteria 1755
183 Ga0068866_10382751 3300005718 Bacteria 903
184 Ga0068866_10620423 3300005718 Unclassified 732
185 Ga0068861_101334175 3300005719 Bacteria 699
186 Ga0068851_10118415 3300005834 Bacteria 1421
187 Ga0068870_10493834 3300005840 Bacteria 815
188 Ga0068863_100170185 3300005841 Bacteria 2089
189 Ga0068863_100186126 3300005841 Bacteria 1995
190 Ga0068863_100352264 3300005841 Bacteria 1434
191 Ga0068863_100900118 3300005841 Bacteria 885
192 Ga0068858_100096867 3300005842 Bacteria 2750
193 Ga0068858_100182805 3300005842 Bacteria 1980
194 Ga0068858_100183774 3300005842 Bacteria 1974
195 Ga0068858_100295136 3300005842 Bacteria 1546
196 Ga0068858_100307671 3300005842 Bacteria 1513
197 Ga0068858_100423180 3300005842 Bacteria 1281
198 Ga0068858_100559380 3300005842 Bacteria 1107
199 Ga0068858_101226003 3300005842 Bacteria 738
200 Ga0068858_101691431 3300005842 Bacteria 625
201 Ga0068860_100228036 3300005843 Bacteria 1810
202 Ga0068860_100339990 3300005843 Bacteria 1476
203 Ga0068860_100419758 3300005843 Bacteria 1326
204 Ga0068860_100631847 3300005843 Bacteria 1078
205 Ga0068860_100831201 3300005843 Unclassified 938
206 Ga0068862_100016873 3300005844 Bacteria 6076
207 Ga0068862_100083941 3300005844 Bacteria 2767
208 Ga0068862_100203507 3300005844 Bacteria 1786
209 Ga0081455_10052704 3300005937 Bacteria 3481
210 Ga0081455_10067100 3300005937 Bacteria 2991
211 Ga0081455_10435669 3300005937 Bacteria 900
212 Ga0081539_10010495 3300005985 Bacteria 7512
213 Ga0081539_10200232 3300005985 Bacteria 923
214 Ga0070717_10326941 3300006028 Bacteria 1367
215 Ga0075432_10065960 3300006058 Bacteria 1295
216 Ga0070716_100142150 3300006173 Bacteria 1532
217 Ga0070716_100627900 3300006173 Bacteria 812
218 Ga0097621_100003570 3300006237 Bacteria 10750
219 Ga0097621_100006929 3300006237 Bacteria 8068
220 Ga0097621_100031556 3300006237 Bacteria 4205
221 Ga0097621_100073190 3300006237 Bacteria 2836
222 Ga0097621_100437125 3300006237 Bacteria 1177
223 Ga0097621_100484859 3300006237 Bacteria 1118
224 Ga0075370_10519002 3300006353 Bacteria 720
225 Ga0068871_100030849 3300006358 Bacteria 4225
226 Ga0068871_100041326 3300006358 Bacteria 3697
227 Ga0068871_100054112 3300006358 Bacteria 3255
228 Ga0068871_100120424 3300006358 Bacteria 2216
229 Ga0068871_100159232 3300006358 Bacteria 1930
230 Ga0068871_100267807 3300006358 Bacteria 1492
231 Ga0068871_100719785 3300006358 Bacteria 915
232 Ga0068871_100919632 3300006358 Bacteria 811
233 Ga0075428_100558654 3300006844 Bacteria 1223
234 Ga0075428_100711794 3300006844 Bacteria 1069
235 Ga0075431_100043842 3300006847 Bacteria 4613
236 Ga0075433_10107599 3300006852 Bacteria 2472
237 Ga0075433_10154090 3300006852 Bacteria 2044
238 Ga0075433_10206021 3300006852 Bacteria 1748
239 Ga0075433_10363199 3300006852 Bacteria 1279
240 Ga0075434_100091700 3300006871 Bacteria 3040
241 Ga0075434_100189701 3300006871 Bacteria 2076
242 Ga0075434_100400293 3300006871 Bacteria 1394
243 Ga0075434_100466636 3300006871 Bacteria 1284
244 Ga0075434_100624961 3300006871 Bacteria 1096
245 Ga0075434_100863765 3300006871 Bacteria 920
246 Ga0068865_100113304 3300006881 Bacteria 2004
247 Ga0068865_100558884 3300006881 Unclassified 962
248 Ga0075436_100022674 3300006914 Bacteria 4314
249 Ga0075436_100022932 3300006914 Bacteria 4288
250 Ga0075436_100026842 3300006914 Bacteria 3965
251 Ga0075436_100066077 3300006914 Bacteria 2499
252 Ga0097620_100002955 3300006931 Bacteria 17241
253 Ga0097620_100157303 3300006931 Bacteria 2350
254 Ga0097620_100354142 3300006931 Bacteria 1563
255 Ga0097620_100822048 3300006931 Unclassified 1016
256 Ga0097620_100868119 3300006931 Bacteria 988
257 Ga0075435_100000982 3300007076 Bacteria 18062
258 Ga0075435_100004535 3300007076 Bacteria 9549
259 Ga0075435_100008984 3300007076 Bacteria 7207
260 Ga0075435_100012947 3300007076 Bacteria 6187
261 Ga0075435_100064630 3300007076 Bacteria 2973
262 Ga0075435_100099384 3300007076 Bacteria 2409
263 Ga0075435_100118023 3300007076 Bacteria 2212
264 Ga0075435_100165371 3300007076 Bacteria 1865
265 Ga0075435_100744299 3300007076 Bacteria 853
266 Ga0075435_100814850 3300007076 Bacteria 813
267 Ga0105240_10178768 3300009093 Bacteria 2506
268 Ga0105240_11185799 3300009093 Bacteria 809
269 Ga0105240_11964780 3300009093 Bacteria 608
270 Ga0111539_10028824 3300009094 Bacteria 6770
271 Ga0111539_10088494 3300009094 Bacteria 3638
272 Ga0111539_10153878 3300009094 Bacteria 2691
273 Ga0111539_10403179 3300009094 Bacteria 1593
274 Ga0111539_10736539 3300009094 Bacteria 1147
275 Ga0111539_10867767 3300009094 Bacteria 1050
276 Ga0111539_11159044 3300009094 Bacteria 898
277 Ga0105245_10035083 3300009098 Bacteria 4451
278 Ga0105245_10041645 3300009098 Bacteria 4094
279 Ga0105245_10324400 3300009098 Bacteria 1518
280 Ga0105245_10619704 3300009098 Bacteria 1110
281 Ga0105245_10795086 3300009098 Bacteria 984
282 Ga0105247_10008843 3300009101 Bacteria 6139
283 Ga0105247_10123436 3300009101 Bacteria 1680
284 Ga0105247_10568984 3300009101 Bacteria 836
285 Ga0105247_11304512 3300009101 Bacteria 583
286 Ga0114129_10010381 3300009147 Bacteria 13281
287 Ga0114129_10011848 3300009147 Bacteria 12402
288 Ga0114129_10028993 3300009147 Bacteria 7840
289 Ga0114129_10029006 3300009147 Bacteria 7838
290 Ga0114129_10079890 3300009147 Bacteria 4547
291 Ga0114129_10106535 3300009147 Bacteria 3872
292 Ga0114129_10165420 3300009147 Bacteria 3019
293 Ga0114129_10324109 3300009147 Bacteria 2047
294 Ga0114129_10396837 3300009147 Bacteria 1819
295 Ga0114129_10399358 3300009147 Bacteria 1812
296 Ga0114129_11152612 3300009147 Bacteria 968
297 Ga0114129_11566788 3300009147 Unclassified 808
298 Ga0105243_10161109 3300009148 Bacteria 1934
299 Ga0105243_10201697 3300009148 Bacteria 1745
300 Ga0105243_10602166 3300009148 Bacteria 1058
301 Ga0105243_11198788 3300009148 Bacteria 772
302 Ga0105241_10305154 3300009174 Bacteria 1367
303 Ga0105241_10537928 3300009174 Bacteria 1047
304 Ga0105242_10021080 3300009176 Bacteria 5114
305 Ga0105242_10203318 3300009176 Bacteria 1760
306 Ga0105242_10206044 3300009176 Bacteria 1749
307 Ga0105242_10424778 3300009176 Bacteria 1246
308 Ga0105242_10640460 3300009176 Bacteria 1032
309 Ga0105242_10715420 3300009176 Bacteria 981
310 Ga0105242_10807308 3300009176 Bacteria 929
311 Ga0105248_10005653 3300009177 Bacteria 13734
312 Ga0105248_10007812 3300009177 Bacteria 11743
313 Ga0105248_10011297 3300009177 Bacteria 9846
314 Ga0105248_10027045 3300009177 Bacteria 6382
315 Ga0105248_10121507 3300009177 Bacteria 2946
316 Ga0105248_10359038 3300009177 Bacteria 1640
317 Ga0105248_10442687 3300009177 Bacteria 1464
318 Ga0105248_10482458 3300009177 Bacteria 1397
319 Ga0105248_10848019 3300009177 Bacteria 1031
320 Ga0105248_11079895 3300009177 Bacteria 907
321 Ga0105248_11231595 3300009177 Bacteria 846
322 Ga0105237_10648600 3300009545 Bacteria 1062
323 Ga0105238_10569141 3300009551 Bacteria 1138
324 Ga0105238_11691954 3300009551 Unclassified 664
325 Ga0105249_10044597 3300009553 Bacteria 4031
326 Ga0105249_10187100 3300009553 Bacteria 2018
327 Ga0105249_10607899 3300009553 Bacteria 1148
328 Ga0105249_11303145 3300009553 Bacteria 798
329 Ga0105239_11509220 3300010375 Bacteria 777
330 Ga0105246_10131282 3300011119 Bacteria 1871
331 Ga0157369_10000535 3300013105 Bacteria 50270
332 Ga0157374_10021328 3300013296 Bacteria 5763
333 Ga0157374_10254783 3300013296 Bacteria 1728
334 Ga0157374_10886338 3300013296 Bacteria 910
335 Ga0157378_10004694 3300013297 Bacteria 11989
336 Ga0157378_10438723 3300013297 Bacteria 1294
337 Ga0157378_11549450 3300013297 Bacteria 708
338 Ga0163162_10017908 3300013306 Bacteria 6931
339 Ga0163162_10378521 3300013306 Bacteria 1549
340 Ga0163162_11306328 3300013306 Bacteria 824
341 Ga0163162_11631134 3300013306 Bacteria 736
342 Ga0157375_10110326 3300013308 Bacteria 2848
343 Ga0157375_10188271 3300013308 Bacteria 2218
344 Ga0157375_10491558 3300013308 Bacteria 1392
345 Ga0157375_10494202 3300013308 Bacteria 1388
346 Ga0157375_11214937 3300013308 Unclassified 884
347 Ga0157375_11287010 3300013308 Bacteria 859
348 Ga0157375_11490877 3300013308 Unclassified 798
349 Ga0163163_10004562 3300014325 Bacteria 11825
350 Ga0163163_10053731 3300014325 Bacteria 3977
351 Ga0163163_10177578 3300014325 Bacteria 2176
352 Ga0163163_10970033 3300014325 Bacteria 913
353 Ga0163163_11025509 3300014325 Bacteria 888
354 Ga0157380_10031422 3300014326 Bacteria 4076
355 Ga0157380_10114323 3300014326 Bacteria 2274
356 Ga0157380_10126530 3300014326 Bacteria 2172
357 Ga0157380_10249218 3300014326 Bacteria 1606
358 Ga0157380_10419568 3300014326 Bacteria 1276
359 Ga0157380_11489736 3300014326 Bacteria 729
360 Ga0157377_10018695 3300014745 Bacteria 3606
361 Ga0157379_10019746 3300014968 Bacteria 5955
362 Ga0157379_10056109 3300014968 Bacteria 3520
363 Ga0157379_10217435 3300014968 Bacteria 1731
364 Ga0157379_10660466 3300014968 Unclassified 979
365 Ga0157379_11246994 3300014968 Bacteria 716
366 Ga0157376_10017840 3300014969 Bacteria 5425
367 Ga0157376_10173723 3300014969 Bacteria 1964
368 Ga0157376_10256817 3300014969 Bacteria 1635
369 Ga0157376_10513640 3300014969 Bacteria 1180
370 Ga0157376_10606233 3300014969 Bacteria 1090
371 Ga0157376_10708893 3300014969 Bacteria 1012
372 Ga0157376_11188491 3300014969 Bacteria 790
373 Ga0163161_10105378 3300017792 Bacteria 2103
374 Ga0213876_10071763 3300021384 Bacteria 1828
375 Ga0207697_10106579 3300025315 Bacteria 1198
376 Ga0207653_10049650 3300025885 Bacteria 1393
377 Ga0207682_10053288 3300025893 Bacteria 1678
378 Ga0207692_10562501 3300025898 Bacteria 730
379 Ga0207642_10081113 3300025899 Bacteria 1575
380 Ga0207710_10005396 3300025900 Bacteria 5512
381 Ga0207710_10048765 3300025900 Bacteria 1896
382 Ga0207680_10093938 3300025903 Bacteria 1914
383 Ga0207680_10116783 3300025903 Bacteria 1739
384 Ga0207647_10350199 3300025904 Bacteria 836
385 Ga0207699_10007807 3300025906 Bacteria 5243
386 Ga0207645_10005828 3300025907 Bacteria 8881
387 Ga0207645_10500498 3300025907 Bacteria 823
388 Ga0207643_10138433 3300025908 Bacteria 1453
389 Ga0207643_10316694 3300025908 Bacteria 973
390 Ga0207705_10777142 3300025909 Unclassified 744
391 Ga0207684_10035016 3300025910 Bacteria 4264
392 Ga0207684_10499743 3300025910 Bacteria 1042
393 Ga0207707_10095448 3300025912 Bacteria 2599
394 Ga0207707_10280198 3300025912 Bacteria 1444
395 Ga0207707_10356677 3300025912 Bacteria 1259
396 Ga0207707_10795300 3300025912 Bacteria 788
397 Ga0207695_10191244 3300025913 Bacteria 1964
398 Ga0207693_10270581 3300025915 Unclassified 1331
399 Ga0207662_10690516 3300025918 Unclassified 715
400 Ga0207657_10052141 3300025919 Bacteria 3552
401 Ga0207649_10069334 3300025920 Bacteria 2245
402 Ga0207649_10212637 3300025920 Bacteria 1373
403 Ga0207649_10630931 3300025920 Bacteria 826
404 Ga0207649_10692320 3300025920 Unclassified 790
405 Ga0207652_10089413 3300025921 Bacteria 2704
406 Ga0207652_10482256 3300025921 Bacteria 1117
407 Ga0207646_10075158 3300025922 Bacteria 3019
408 Ga0207646_10225443 3300025922 Bacteria 1693
409 Ga0207646_10232494 3300025922 Bacteria 1666
410 Ga0207646_10455607 3300025922 Bacteria 1154
411 Ga0207646_11123642 3300025922 Unclassified 691
412 Ga0207681_10039330 3300025923 Bacteria 3139
413 Ga0207681_10118780 3300025923 Bacteria 1936
414 Ga0207681_10156649 3300025923 Bacteria 1712
415 Ga0207681_10227138 3300025923 Bacteria 1447
416 Ga0207650_10146594 3300025925 Bacteria 1860
417 Ga0207650_10147551 3300025925 Bacteria 1854
418 Ga0207650_10232978 3300025925 Bacteria 1486
419 Ga0207650_10280784 3300025925 Bacteria 1356
420 Ga0207650_10287158 3300025925 Bacteria 1341
421 Ga0207650_10300057 3300025925 Bacteria 1312
422 Ga0207650_10375507 3300025925 Bacteria 1173
423 Ga0207659_10001583 3300025926 Bacteria 13492
424 Ga0207659_10009341 3300025926 Bacteria 6123
425 Ga0207659_10280573 3300025926 Bacteria 1362
426 Ga0207659_10418444 3300025926 Bacteria 1123
427 Ga0207659_10681566 3300025926 Bacteria 880
428 Ga0207659_11144104 3300025926 Bacteria 669
429 Ga0207687_10031081 3300025927 Bacteria 3607
430 Ga0207687_10260912 3300025927 Bacteria 1381
431 Ga0207687_10334828 3300025927 Bacteria 1229
432 Ga0207700_10023717 3300025928 Bacteria 4237
433 Ga0207644_10009889 3300025931 Bacteria 6275
434 Ga0207644_10511048 3300025931 Bacteria 992
435 Ga0207690_10248881 3300025932 Bacteria 1372
436 Ga0207690_11040034 3300025932 Bacteria 682
437 Ga0207690_11222926 3300025932 Bacteria 627
438 Ga0207706_10088113 3300025933 Bacteria 2729
439 Ga0207706_10282016 3300025933 Bacteria 1449
440 Ga0207686_10015837 3300025934 Bacteria 4224
441 Ga0207686_10042044 3300025934 Bacteria 2791
442 Ga0207686_10079551 3300025934 Bacteria 2135
443 Ga0207686_10888266 3300025934 Bacteria 718
444 Ga0207686_11200363 3300025934 Unclassified 621
445 Ga0207709_10254819 3300025935 Bacteria 1284
446 Ga0207670_10188595 3300025936 Bacteria 1559
447 Ga0207670_10259611 3300025936 Bacteria 1346
448 Ga0207669_10163677 3300025937 Bacteria 1575
449 Ga0207704_10004287 3300025938 Bacteria 6517
450 Ga0207704_10484842 3300025938 Unclassified 993
451 Ga0207665_10536443 3300025939 Bacteria 908
452 Ga0207691_10051210 3300025940 Bacteria 3776
453 Ga0207691_10183103 3300025940 Bacteria 1830
454 Ga0207691_10205776 3300025940 Bacteria 1711
455 Ga0207691_10269977 3300025940 Bacteria 1465
456 Ga0207691_10616099 3300025940 Bacteria 918
457 Ga0207711_10008211 3300025941 Bacteria 8738
458 Ga0207711_10012271 3300025941 Bacteria 7124
459 Ga0207711_10160489 3300025941 Bacteria 2034
460 Ga0207711_10351520 3300025941 Bacteria 1365
461 Ga0207711_10419410 3300025941 Bacteria 1245
462 Ga0207711_10472957 3300025941 Bacteria 1167
463 Ga0207711_10948906 3300025941 Bacteria 799
464 Ga0207689_10542798 3300025942 Unclassified 976
465 Ga0207689_10678505 3300025942 Bacteria 868
466 Ga0207661_11116385 3300025944 Unclassified 726
467 Ga0207661_11121162 3300025944 Bacteria 724
468 Ga0207679_10493835 3300025945 Bacteria 1091
469 Ga0207679_10577089 3300025945 Bacteria 1011
470 Ga0207679_10838057 3300025945 Bacteria 839
471 Ga0207667_11283812 3300025949 Unclassified 709
472 Ga0207651_10015397 3300025960 Bacteria 4443
473 Ga0207651_10056524 3300025960 Bacteria 2701
474 Ga0207651_10076797 3300025960 Bacteria 2389
475 Ga0207651_10111454 3300025960 Bacteria 2055
476 Ga0207651_10409635 3300025960 Bacteria 1155
477 Ga0207651_10447422 3300025960 Bacteria 1108
478 Ga0207651_10642570 3300025960 Unclassified 931
479 Ga0207651_10833295 3300025960 Unclassified 819
480 Ga0207651_11380495 3300025960 Bacteria 634
481 Ga0207712_10070741 3300025961 Bacteria 2507
482 Ga0207712_10450251 3300025961 Bacteria 1092
483 Ga0207668_10110058 3300025972 Bacteria 2065
484 Ga0207668_10200435 3300025972 Bacteria 1589
485 Ga0207668_10321112 3300025972 Bacteria 1285
486 Ga0207668_10871922 3300025972 Bacteria 800
487 Ga0207640_10042422 3300025981 Bacteria 2900
488 Ga0207640_10127195 3300025981 Bacteria 1836
489 Ga0207640_10338163 3300025981 Bacteria 1205
490 Ga0207658_10011360 3300025986 Bacteria 6060
491 Ga0207658_10419894 3300025986 Bacteria 1179
492 Ga0207677_10141763 3300026023 Bacteria 1841
493 Ga0207703_10066805 3300026035 Bacteria 2959
494 Ga0207703_10089972 3300026035 Bacteria 2578
495 Ga0207703_10115837 3300026035 Bacteria 2293
496 Ga0207703_10128427 3300026035 Bacteria 2186
497 Ga0207703_10158107 3300026035 Bacteria 1983
498 Ga0207703_10358993 3300026035 Bacteria 1343
499 Ga0207703_11366459 3300026035 Bacteria 681
500 Ga0207708_10014324 3300026075 Bacteria 5933
501 Ga0207708_10115747 3300026075 Bacteria 2085
502 Ga0207708_10159967 3300026075 Bacteria 1778
503 Ga0207708_10637460 3300026075 Bacteria 906
504 Ga0207708_10698468 3300026075 Bacteria 867
505 Ga0207708_10861093 3300026075 Bacteria 783
506 Ga0207702_10025917 3300026078 Bacteria 4868
507 Ga0207641_10007357 3300026088 Bacteria 9166
508 Ga0207648_10045119 3300026089 Bacteria 3867
509 Ga0207648_10080951 3300026089 Bacteria 2833
510 Ga0207648_10167183 3300026089 Bacteria 1944
511 Ga0207648_10189219 3300026089 Bacteria 1823
512 Ga0207648_10209830 3300026089 Bacteria 1728
513 Ga0207648_10381295 3300026089 Bacteria 1275
514 Ga0207648_10404642 3300026089 Bacteria 1237
515 Ga0207648_10455909 3300026089 Bacteria 1165
516 Ga0207648_10477631 3300026089 Bacteria 1138
517 Ga0207676_10749814 3300026095 Bacteria 949
518 Ga0207676_11028952 3300026095 Bacteria 812
519 Ga0207674_10107111 3300026116 Bacteria 2772
520 Ga0207674_10213752 3300026116 Bacteria 1877
521 Ga0207674_10939923 3300026116 Bacteria 833
522 Ga0207675_100043855 3300026118 Bacteria 4178
523 Ga0207675_101080479 3300026118 Unclassified 822
524 Ga0207675_101230191 3300026118 Bacteria 769
525 Ga0207683_10006801 3300026121 Bacteria 9793
526 Ga0207683_10179174 3300026121 Bacteria 1921
527 Ga0207683_10521715 3300026121 Bacteria 1098
528 Ga0207683_10692321 3300026121 Bacteria 945
529 Ga0207698_10725525 3300026142 Bacteria 991
530 Ga0207428_10033901 3300027907 Bacteria 4188
531 Ga0268266_10121845 3300028379 Bacteria 2321
532 Ga0268265_10017900 3300028380 Bacteria 4900
533 Ga0268265_10159475 3300028380 Bacteria 1914
534 Ga0268265_10294476 3300028380 Bacteria 1458
535 Ga0268265_10361190 3300028380 Bacteria 1329
536 Ga0268265_10514531 3300028380 Bacteria 1130
537 Ga0268265_10656582 3300028380 Bacteria 1009
538 Ga0268265_11038552 3300028380 Bacteria 811
539 Ga0268265_11412587 3300028380 Unclassified 698
540 Ga0268264_10159730 3300028381 Bacteria 2029
541 Ga0268264_10343825 3300028381 Bacteria 1418
542 Ga0268264_10345126 3300028381 Bacteria 1415
543 Ga0268264_10478855 3300028381 Bacteria 1210
544 Ga0268264_10649787 3300028381 Bacteria 1044
545 Ga0268264_10743494 3300028381 Unclassified 977
546 Ga0307511_10106184 3300030521 Bacteria 1814
547 Ga0265760_10012055 3300031090 Bacteria 2471
548 Ga0265331_10086526 3300031250 Bacteria 1452
549 Ga0307408_100197579 3300031548 Bacteria 1625
550 Ga0307408_100679469 3300031548 Bacteria 923
551 Ga0265314_10038673 3300031711 Bacteria 3444
552 Ga0265314_10148437 3300031711 Bacteria 1441
553 Ga0307413_10383379 3300031824 Unclassified 1096
554 Ga0307409_100176555 3300031995 Bacteria 1886
555 Ga0307416_100175300 3300032002 Bacteria 2002
556 Ga0307416_100759321 3300032002 Bacteria 1063
557 Ga0307411_10411742 3300032005 Bacteria 1120
558 Ga0307415_101282646 3300032126 Unclassified 693
559 Ga0316593_10159833 3300032168 Bacteria 822
560 Ga0373930_0001039 3300034816 Bacteria 3995
561 Ga0373948_0003611 3300034817 Bacteria 2391
562 Ga0373950_0007534 3300034818 Bacteria 1692
563 Ga0373958_0059178 3300034819 Bacteria 826
564 Ga0373958_0099560 3300034819 Bacteria 680
565 Ga0373959_0002937 3300034820 Bacteria 2705
566 Ga0373940_0001597 3300035088 Bacteria 4162
567 Ga0373949_0002049 3300035090 Bacteria 5334
568 Ga0373949_0130997 3300035090 Bacteria 712
569 Ga0373951_0010193 3300035091 Bacteria 2109
570 Ga0373952_0004034 3300035092 Bacteria 2652
571 Ga0373952_0156845 3300035092 Bacteria 642
572 Ga0373932_0011931 3300035112 Bacteria 2132
573 Ga0373941_0008907 3300035115 Bacteria 2513
574 Ga0373941_0014275 3300035115 Bacteria 2117
575 Ga0373956_0363148 3300035119 Bacteria 690
576 Ga0373960_0000007 3300035121 Bacteria 26901
577 Ga0373943_0065497 3300035170 Bacteria 1827
578 Ga0373943_0244533 3300035170 Bacteria 1006
579 Ga0373955_0026296 3300035172 Bacteria 2997
580 Ga0373955_0160464 3300035172 Unclassified 1327
581 Ga0373955_0584454 3300035172 Bacteria 684
582 Ga0373942_0000144 3300035207 Bacteria 16957
583 Ga0373961_0001062 3300035241 Bacteria 8844
584 Ga0373961_0199554 3300035241 Bacteria 705
585 Ga0373962_0009438 3300035242 Bacteria 2418
586 Ga0373931_0009351 3300035691 Bacteria 4683
587 Ga0373931_0340294 3300035691 Unclassified 937
588 Ga0373935_0129470 3300035692 Bacteria 1695
589 Ga0373927_0728767 3300035695 Bacteria 655
590 Ga0373933_0373417 3300035724 Bacteria 928
591 Ga0373937_0065621 3300036401 Bacteria 3342
592 Ga0373937_0120683 3300036401 Bacteria 2443
593 Ga0373937_0286481 3300036401 Bacteria 1556
594 Ga0373937_0387378 3300036401 Bacteria 1326
595 Ga0373937_0397056 3300036401 Bacteria 1308
596 Ga0373937_0451230 3300036401 Bacteria 1221
597 Ga0373937_0923021 3300036401 Bacteria 822
598 Ga0373937_1544026 3300036401 Bacteria 611
599 Ga0316584_0023699 3300036712 Bacteria 4486
600 Ga0373925_0096732 3300037068 Bacteria 2264
601 Ga0373925_0536071 3300037068 Bacteria 962
602 Ga0395905_0395185 3300037471 Bacteria 1277
603 Ga0395905_0607884 3300037471 Unclassified 995
604 Ga0436365_1014920 3300039437 Bacteria 1061
605 Ga0436360_0946107 3300039438 Unclassified 856
606 Ga0436363_1364936 3300039450 Unclassified 677
607 Ga0439436_0027191 3300041404 Bacteria 1675
608 Ga0439453_0052883 3300041408 Bacteria 825
609 Ga0439462_0004597 3300042015 Bacteria 3378
610 Ga0439446_0037817 3300042156 Bacteria 1414
611 Ga0439434_0210453 3300042435 Bacteria 658
612 Ga0439435_0008363 3300042436 Bacteria 2398
613 Ga0439435_0034788 3300042436 Bacteria 1386
614 Ga0439460_0114596 3300042461 Bacteria 877
615 Ga0450916_025143 3300042530 Bacteria 840
616 Ga0451577_0126528 3300042876 Bacteria 2290
617 Ga0453683_0337052 3300044673 Bacteria 968
618 Ga0453684_0012417 3300044712 Bacteria 14049
619 Ga0453684_0240918 3300044712 Bacteria 2082
620 Ga0453684_0351786 3300044712 Bacteria 1661
621 Ga0453684_0704764 3300044712 Bacteria 1097
622 Ga0453684_0847613 3300044712 Bacteria 982
623 Ga0453684_1082138 3300044712 Bacteria 848
624 Ga0453684_1270950 3300044712 Unclassified 769
625 Ga0453684_1289510 3300044712 Bacteria 762
626 Ga0466957_0309256 3300044842 Bacteria 1064
627 Ga0466959_0753365 3300045049 Bacteria 652
628 Ga0451576_0060074 3300045051 Bacteria 3966
629 Ga0451576_0311039 3300045051 Bacteria 1648
630 Ga0495629_0687620 3300046459 Bacteria 680
631 Ga0495580_0593989 3300046472 Unclassified 732
632 Ga0495608_0032472 3300046511 Bacteria 3528
633 Ga0495628_0200898 3300046516 Bacteria 1502
634 Ga0495628_0744515 3300046516 Bacteria 689
635 Ga0495630_0001261 3300046517 Bacteria 17462
636 Ga0495642_0229553 3300046528 Bacteria 811
637 Ga0495640_0058597 3300046533 Bacteria 2626
638 Ga0495640_0265528 3300046533 Bacteria 1071
639 Ga0495640_0320742 3300046533 Bacteria 960
640 Ga0495586_0430889 3300046535 Unclassified 760
641 Ga0495587_0103928 3300046536 Bacteria 1635
642 Ga0495587_0326267 3300046536 Bacteria 857
643 Ga0495621_0049700 3300046539 Bacteria 1497
644 Ga0495645_0001445 3300046543 Bacteria 16045
645 Ga0495645_0003703 3300046543 Bacteria 10388
646 Ga0495645_0399841 3300046543 Bacteria 876
647 Ga0495667_0131666 3300046559 Bacteria 1613
648 Ga0495667_0655823 3300046559 Unclassified 652
649 Ga0495634_0296754 3300046642 Bacteria 978
650 Ga0495634_0601735 3300046642 Bacteria 638
651 Ga0495635_0045658 3300046663 Bacteria 3023
652 Ga0495659_0384898 3300046664 Unclassified 604
653 Ga0495599_0493938 3300046678 Bacteria 721
654 Ga0495647_0051787 3300046681 Bacteria 1597
655 Ga0495658_0041589 3300046683 Bacteria 2561
656 Ga0495658_0184788 3300046683 Bacteria 1294
657 Ga0495669_0063262 3300046684 Bacteria 1678
658 Ga0495669_0218129 3300046684 Bacteria 914
659 Ga0495613_0002821 3300046689 Bacteria 13042
660 Ga0495600_0326728 3300046809 Bacteria 964
661 Ga0495581_0235484 3300047315 Bacteria 1071
662 Ga0495604_0026092 3300047317 Bacteria 4652
663 Ga0495674_0053305 3300047319 Bacteria 3556
664 Ga0495684_0000682 3300047471 Bacteria 27327
665 Ga0495602_0068417 3300048088 Bacteria 3049
666 Ga0495614_0366864 3300048089 Archaea 673
667 Ga0496100_0001533 3300048903 Bacteria 11332
668 Ga0496101_0006897 3300048904 Bacteria 7332
669 Ga0496103_0526264 3300048906 Bacteria 756
670 Ga0496104_0017217 3300048907 Bacteria 6576
671 Ga0496104_0033960 3300048907 Bacteria 4755
672 Ga0496104_0132020 3300048907 Bacteria 2399
673 Ga0496105_0072751 3300048908 Bacteria 2841
674 Ga0496105_0212906 3300048908 Bacteria 1574
675 Ga0496105_0632752 3300048908 Bacteria 827
676 Ga0496105_0662297 3300048908 Bacteria 805
677 Ga0496105_0762376 3300048908 Bacteria 738
678 Ga0496106_0036620 3300048909 Bacteria 3670
679 Ga0496106_0067690 3300048909 Bacteria 2723
680 Ga0496106_0075618 3300048909 Bacteria 2580
681 Ga0496106_0616180 3300048909 Bacteria 869
682 Ga0496106_0621194 3300048909 Bacteria 865
683 Ga0496107_0928689 3300048910 Unclassified 633
684 Ga0496108_0008779 3300048911 Bacteria 8194
685 Ga0496108_0192001 3300048911 Bacteria 1770
686 Ga0496109_0490426 3300048912 Bacteria 1160
687 Ga0496110_0806984 3300048913 Bacteria 843
688 Ga0496111_0420167 3300048914 Bacteria 988
689 Ga0496112_0006594 3300048915 Bacteria 10214
690 Ga0496112_0017015 3300048915 Bacteria 6825
691 Ga0496112_0135408 3300048915 Bacteria 2434
692 Ga0496112_0812191 3300048915 Bacteria 860
693 Ga0496112_1124251 3300048915 Bacteria 703
694 Ga0496113_0083404 3300048916 Bacteria 2452
695 Ga0496113_0352338 3300048916 Bacteria 1181
696 Ga0496114_0069418 3300048917 Bacteria 2959
697 Ga0496114_0156997 3300048917 Bacteria 1976
698 Ga0496114_0179591 3300048917 Bacteria 1848
699 Ga0496114_0259810 3300048917 Bacteria 1529
700 Ga0496115_0112495 3300048918 Bacteria 2237
701 Ga0496115_0157689 3300048918 Bacteria 1875
702 Ga0501033_0012882 3300049570 Bacteria 6379
703 Ga0501034_0040753 3300049571 Bacteria 4699
704 Ga0501034_0099532 3300049571 Bacteria 2902
705 Ga0501036_0046736 3300049572 Bacteria 3665
706 Ga0501036_0097367 3300049572 Bacteria 2487
707 Ga0501036_0529829 3300049572 Bacteria 979
708 Ga0501038_0128728 3300049574 Bacteria 2081
709 Ga0501038_0451611 3300049574 Bacteria 988
710 Ga0501039_0044997 3300049575 Bacteria 3409
711 Ga0501039_0062686 3300049575 Bacteria 2881
712 Ga0501039_0186959 3300049575 Bacteria 1629
713 Ga0501040_0001751 3300049576 Bacteria 13950
714 Ga0501041_0075541 3300049577 Bacteria 2072
715 Ga0501041_0084346 3300049577 Bacteria 1958
716 Ga0501042_0005260 3300049578 Bacteria 8316
717 Ga0501042_0015393 3300049578 Bacteria 5237
718 Ga0501042_0087723 3300049578 Bacteria 2232
719 Ga0501043_0171388 3300049579 Bacteria 1693
720 Ga0501046_0008978 3300049580 Bacteria 8680
721 Ga0501048_0096860 3300049582 Bacteria 2081
722 Ga0501048_0418578 3300049582 Bacteria 958
723 Ga0501048_0474770 3300049582 Unclassified 896
724 Ga0501067_0192240 3300049583 Bacteria 1137
725 Ga0501068_0425683 3300049584 Unclassified 857
726 Ga0501068_0594089 3300049584 Bacteria 721
727 Ga0501071_0040725 3300049587 Bacteria 3325
728 Ga0501071_0330638 3300049587 Bacteria 1158
729 Ga0501071_0835522 3300049587 Bacteria 710
730 Ga0501072_0010677 3300049588 Bacteria 6993
731 Ga0501072_0038436 3300049588 Bacteria 3756
732 Ga0501072_0064467 3300049588 Bacteria 2889
733 Ga0501072_0609308 3300049588 Bacteria 861
734 Ga0501073_0035438 3300049589 Bacteria 3548
735 Ga0501073_0067833 3300049589 Bacteria 2487
736 Ga0501073_0262281 3300049589 Bacteria 1192
737 Ga0501074_0021554 3300049590 Bacteria 4679
738 Ga0501074_0211742 3300049590 Bacteria 1381
739 Ga0501075_0004548 3300049591 Bacteria 9401
740 Ga0501075_0050742 3300049591 Bacteria 3119
741 Ga0501075_0292262 3300049591 Bacteria 1241
742 Ga0501076_0012693 3300049592 Bacteria 6307
743 Ga0501076_0177813 3300049592 Bacteria 1734
744 Ga0501076_0281600 3300049592 Bacteria 1362
745 Ga0501077_0005464 3300049593 Bacteria 7737
746 Ga0501077_0259619 3300049593 Bacteria 1105
747 Ga0501225_0034063 3300049705 Bacteria 1402
748 Ga0501079_0094378 3300049741 Bacteria 2318
749 Ga0501080_0011276 3300049742 Bacteria 8182
750 Ga0501080_0053548 3300049742 Bacteria 3757
751 Ga0501080_0191547 3300049742 Bacteria 1879
752 Ga0501080_0524951 3300049742 Bacteria 1056
753 Ga0501080_1087256 3300049742 Bacteria 691
754 Ga0501081_0000624 3300049743 Bacteria 20161
755 Ga0501081_0417550 3300049743 Bacteria 994
756 Ga0501083_0216227 3300049744 Bacteria 1249
757 Ga0501035_0118995 3300049822 Bacteria 2310
758 Ga0501044_0025835 3300049823 Bacteria 6225
759 Ga0501045_0014008 3300049824 Bacteria 5676
760 Ga0501045_0051903 3300049824 Bacteria 2993
761 Ga0501045_0120737 3300049824 Bacteria 1946
762 Ga0501045_0938853 3300049824 Bacteria 635
763 nmdc:mga05p37_1031475_c1 3300050507 Bacteria 870
764 nmdc:mga05p37_1090426_c1 3300050507 Bacteria 837
765 nmdc:mga05p37_15317_c1 3300050507 Bacteria 9211
766 nmdc:mga05p37_16647_c1 3300050507 Bacteria 8857
767 nmdc:mga05p37_38590_c1 3300050507 Bacteria 5859
768 nmdc:mga05p37_729641_c1 3300050507 Bacteria 1096
769 nmdc:mga05p37_7530_c1 3300050507 Bacteria 12835
770 nmdc:mga05p37_97789_c1 3300050507 Bacteria 3616
771 nmdc:mga08y16_16490_c2 3300050511 Bacteria 6371
772 nmdc:mga08y16_182547_c1 3300050511 Bacteria 2178
773 nmdc:mga08y16_21673_c1 3300050511 Bacteria 6783
774 nmdc:mga08y16_261089_c1 3300050511 Bacteria 1789
775 nmdc:mga08y16_5107_c1 3300050511 Bacteria 13711
776 nmdc:mga08y16_661762_c1 3300050511 Bacteria 1047
777 nmdc:mga08y16_899649_c1 3300050511 Bacteria 871
778 nmdc:mga0n895_103239_c1 3300050512 Bacteria 2862
779 nmdc:mga0n895_1537346_c1 3300050512 Bacteria 631
780 nmdc:mga0n895_257182_c1 3300050512 Bacteria 1772
781 nmdc:mga0n895_280586_c1 3300050512 Bacteria 1689
782 nmdc:mga0n895_310555_c1 3300050512 Bacteria 1598
783 nmdc:mga0n895_390941_c1 3300050512 Bacteria 1407
784 nmdc:mga0n895_428690_c1 3300050512 Bacteria 1336
785 nmdc:mga0n895_616694_c1 3300050512 Bacteria 1086
786 nmdc:mga0n895_676153_c1 3300050512 Bacteria 1030
787 nmdc:mga0n895_67_c1 3300050512 Bacteria 61603
788 nmdc:mga0n895_957354_c1 3300050512 Bacteria 839
789 nmdc:mga0rr50_106311_c1 3300050513 Bacteria 2214
790 nmdc:mga0rr50_114_c1 3300050513 Bacteria 44678
791 nmdc:mga0rr50_117144_c1 3300050513 Bacteria 2115
792 nmdc:mga0rr50_295238_c1 3300050513 Bacteria 1355
793 nmdc:mga0rr50_3192_c1 3300050513 Bacteria 9370
794 nmdc:mga0rr50_619962_c1 3300050513 Bacteria 923
795 nmdc:mga0rr50_697828_c1 3300050513 Bacteria 866
796 nmdc:mga0rr50_8855_c1 3300050513 Bacteria 6285
797 nmdc:mga08x19_103783_c1 3300050514 Bacteria 1889
798 nmdc:mga08x19_129116_c1 3300050514 Bacteria 1699
799 nmdc:mga08x19_138697_c1 3300050514 Bacteria 1641
800 nmdc:mga08x19_175118_c1 3300050514 Bacteria 1463
801 nmdc:mga08x19_2465_c1 3300050514 Bacteria 11258
802 nmdc:mga0a205_27073_c1 3300050515 Bacteria 5473
803 nmdc:mga0a205_36758_c1 3300050515 Bacteria 4707
804 nmdc:mga0a205_440193_c1 3300050515 Bacteria 1164
805 nmdc:mga0a205_575132_c1 3300050515 Bacteria 981
806 nmdc:mga0a205_575787_c1 3300050515 Bacteria 980
807 nmdc:mga0a205_76377_c1 3300050515 Bacteria 3237
808 nmdc:mga0a205_9408_c1 3300050515 Bacteria 8932
809 nmdc:mga0a205_95048_c1 3300050515 Bacteria 2879
810 Ga0495601_0020931 3300053077 Bacteria 3999
811 Ga0495601_0154615 3300053077 Bacteria 1498
812 Ga0495601_0244394 3300053077 Bacteria 1172
813 Ga0495601_0428872 3300053077 Bacteria 856
814 Ga0495595_0391000 3300053084 Bacteria 704
815 Ga0495595_0520115 3300053084 Bacteria 607
816 Ga0495619_0024195 3300053085 Bacteria 3895
817 Ga0495619_0030540 3300053085 Bacteria 3488
818 Ga0495619_0093133 3300053085 Bacteria 2042
819 Ga0495619_0351401 3300053085 Bacteria 1020
820 Ga0501084_0018300 3300054114 Bacteria 5834
821 Ga0501084_0029871 3300054114 Bacteria 4559
822 Ga0501084_0112407 3300054114 Bacteria 2289
823 Ga0501084_0348518 3300054114 Bacteria 1251
824 Ga0501082_0025547 3300060353 Bacteria 5089
825 Ga0501082_0281256 3300060353 Bacteria 1448
826 Ga0501082_0408722 3300060353 Bacteria 1185
827 Ga0501082_0828576 3300060353 Bacteria 809
828 Ga0501082_0877351 3300060353 Bacteria 785
829 Ga0530510_0029745 3300061734 Bacteria 3921
830 Ga0530510_0032762 3300061734 Bacteria 3740
831 Ga0530510_0143239 3300061734 Bacteria 1762

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_1270950 Ga0453684_1270950_36_554 157
2 3300036712 Ga0316584_0023699 Ga0316584_0023699_558_1073 159
3 3300005459 Ga0068867_100348555 Ga0068867_1003485552 162
4 3300049824 Ga0501045_0938853 Ga0501045_0938853_13_564 162
5 3300050512 nmdc:mga0n895_957354_c1 nmdc:mga0n895_957354_c1_27_542 162
6 3300005354 Ga0070675_100031874 Ga0070675_1000318743 163
7 3300005456 Ga0070678_101106805 Ga0070678_1011068051 163
8 3300009094 Ga0111539_11159044 Ga0111539_111590442 163
9 3300025926 Ga0207659_10009341 Ga0207659_100093412 163
10 3300025937 Ga0207669_10163677 Ga0207669_101636772 163
11 3300025940 Ga0207691_10205776 Ga0207691_102057762 163
12 3300025960 Ga0207651_10447422 Ga0207651_104474222 163
13 3300050511 nmdc:mga08y16_899649_c1 nmdc:mga08y16_899649_c1_90_650 163
14 3300005345 Ga0070692_10523771 Ga0070692_105237711 165
15 3300013105 Ga0157369_10000535 Ga0157369_1000053524 165
16 3300050515 nmdc:mga0a205_575132_c1 nmdc:mga0a205_575132_c1_240_791 165
17 3300005293 Ga0065715_10523175 Ga0065715_105231751 166
18 3300005456 Ga0070678_100355349 Ga0070678_1003553491 166
19 3300009098 Ga0105245_10324400 Ga0105245_103244002 166
20 3300009176 Ga0105242_10206044 Ga0105242_102060441 166
21 3300009177 Ga0105248_10007812 Ga0105248_100078127 166
22 3300013308 Ga0157375_10188271 Ga0157375_101882713 166
23 3300014969 Ga0157376_10173723 Ga0157376_101737232 166
24 3300025927 Ga0207687_10334828 Ga0207687_103348282 166
25 3300005546 Ga0070696_101022863 Ga0070696_1010228631 167
26 3300032168 Ga0316593_10159833 Ga0316593_101598331 167
27 3300049590 Ga0501074_0211742 Ga0501074_0211742_74_616 167
28 3300049743 Ga0501081_0417550 Ga0501081_0417550_128_670 167
29 3300005293 Ga0065715_10359783 Ga0065715_103597831 168
30 3300005295 Ga0065707_10495927 Ga0065707_104959271 168
31 3300005330 Ga0070690_100049633 Ga0070690_1000496332 168
32 3300005331 Ga0070670_100440446 Ga0070670_1004404462 168
33 3300005336 Ga0070680_100470311 Ga0070680_1004703111 168
34 3300005339 Ga0070660_100040847 Ga0070660_1000408472 168
35 3300005444 Ga0070694_100417898 Ga0070694_1004178982 168
36 3300005458 Ga0070681_10236447 Ga0070681_102364472 168
37 3300005530 Ga0070679_100395577 Ga0070679_1003955772 168
38 3300005539 Ga0068853_100520292 Ga0068853_1005202922 168
39 3300005577 Ga0068857_100210369 Ga0068857_1002103692 168
40 3300005617 Ga0068859_100868094 Ga0068859_1008680941 168
41 3300006847 Ga0075431_100043842 Ga0075431_1000438422 168
42 3300006931 Ga0097620_100868119 Ga0097620_1008681192 168
43 3300009177 Ga0105248_10482458 Ga0105248_104824581 168
44 3300009553 Ga0105249_10187100 Ga0105249_101871002 168
45 3300013308 Ga0157375_11214937 Ga0157375_112149372 168
46 3300025909 Ga0207705_10777142 Ga0207705_107771421 168
47 3300025912 Ga0207707_10095448 Ga0207707_100954482 168
48 3300025919 Ga0207657_10052141 Ga0207657_100521412 168
49 3300025925 Ga0207650_10146594 Ga0207650_101465942 168
50 3300025945 Ga0207679_10493835 Ga0207679_104938352 168
51 3300025972 Ga0207668_10871922 Ga0207668_108719222 168
52 3300026035 Ga0207703_10358993 Ga0207703_103589932 168
53 3300026075 Ga0207708_10861093 Ga0207708_108610932 168
54 3300026116 Ga0207674_10213752 Ga0207674_102137522 168
55 3300031824 Ga0307413_10383379 Ga0307413_103833792 168
56 3300035170 Ga0373943_0065497 Ga0373943_0065497_43_594 168
57 3300035172 Ga0373955_0160464 Ga0373955_0160464_420_971 168
58 3300035692 Ga0373935_0129470 Ga0373935_0129470_966_1517 168
59 3300035695 Ga0373927_0728767 Ga0373927_0728767_53_604 168
60 3300036401 Ga0373937_0286481 Ga0373937_0286481_919_1470 168
61 3300042436 Ga0439435_0034788 Ga0439435_0034788_832_1368 168
62 3300046516 Ga0495628_0200898 Ga0495628_0200898_457_1008 168
63 3300046536 Ga0495587_0326267 Ga0495587_0326267_45_596 168
64 3300048907 Ga0496104_0017217 Ga0496104_0017217_5246_5794 168
65 3300048908 Ga0496105_0662297 Ga0496105_0662297_238_786 168
66 3300048915 Ga0496112_0017015 Ga0496112_0017015_89_637 168
67 3300048916 Ga0496113_0352338 Ga0496113_0352338_109_657 168
68 3300049572 Ga0501036_0046736 Ga0501036_0046736_2026_2544 168
69 3300049574 Ga0501038_0451611 Ga0501038_0451611_230_748 168
70 3300049575 Ga0501039_0062686 Ga0501039_0062686_1209_1727 168
71 3300049578 Ga0501042_0087723 Ga0501042_0087723_666_1184 168
72 3300049582 Ga0501048_0096860 Ga0501048_0096860_752_1270 168
73 3300049587 Ga0501071_0040725 Ga0501071_0040725_2265_2783 168
74 3300049588 Ga0501072_0064467 Ga0501072_0064467_165_683 168
75 3300049592 Ga0501076_0012693 Ga0501076_0012693_1226_1744 168
76 3300049741 Ga0501079_0094378 Ga0501079_0094378_411_929 168
77 3300049742 Ga0501080_0011276 Ga0501080_0011276_4992_5510 168
78 3300049744 Ga0501083_0216227 Ga0501083_0216227_505_1023 168
79 3300049824 Ga0501045_0051903 Ga0501045_0051903_2030_2548 168
80 3300050512 nmdc:mga0n895_280586_c1 nmdc:mga0n895_280586_c1_1083_1631 168
81 3300053077 Ga0495601_0244394 Ga0495601_0244394_95_646 168
82 3300053077 Ga0495601_0428872 Ga0495601_0428872_240_791 168
83 3300053084 Ga0495595_0520115 Ga0495595_0520115_65_592 168
84 3300053085 Ga0495619_0093133 Ga0495619_0093133_1314_1865 168
85 3300060353 Ga0501082_0828576 Ga0501082_0828576_168_719 168
86 3300061734 Ga0530510_0143239 Ga0530510_0143239_43_561 168
87 3300005457 Ga0070662_100949411 Ga0070662_1009494111 169
88 3300005536 Ga0070697_100366502 Ga0070697_1003665021 169
89 3300005841 Ga0068863_100900118 Ga0068863_1009001182 169
90 3300031090 Ga0265760_10012055 Ga0265760_100120553 169
91 3300031548 Ga0307408_100679469 Ga0307408_1006794692 169
92 3300042015 Ga0439462_0004597 Ga0439462_0004597_2379_2927 169
93 3300042156 Ga0439446_0037817 Ga0439446_0037817_370_918 169
94 3300048089 Ga0495614_0366864 Ga0495614_0366864_96_626 169
95 3300005364 Ga0070673_100199091 Ga0070673_1001990911 170
96 3300005563 Ga0068855_100065284 Ga0068855_1000652846 170
97 3300009094 Ga0111539_10403179 Ga0111539_104031792 170
98 3300009177 Ga0105248_10005653 Ga0105248_1000565310 170
99 3300013306 Ga0163162_11306328 Ga0163162_113063281 170
100 3300013308 Ga0157375_11490877 Ga0157375_114908771 170
101 3300014969 Ga0157376_11188491 Ga0157376_111884911 170
102 3300025949 Ga0207667_11283812 Ga0207667_112838121 170
103 3300025960 Ga0207651_10833295 Ga0207651_108332952 170
104 3300027907 Ga0207428_10033901 Ga0207428_100339013 170
105 3300031250 Ga0265331_10086526 Ga0265331_100865262 170
106 3300039438 Ga0436360_0946107 Ga0436360_0946107_53_625 170
107 3300041404 Ga0439436_0027191 Ga0439436_0027191_344_895 170
108 3300042876 Ga0451577_0126528 Ga0451577_0126528_1687_2214 170
109 3300044712 Ga0453684_0012417 Ga0453684_0012417_11678_12208 170
110 3300044712 Ga0453684_0240918 Ga0453684_0240918_1007_1534 170
111 3300044712 Ga0453684_0847613 Ga0453684_0847613_284_811 170
112 3300044712 Ga0453684_1082138 Ga0453684_1082138_173_703 170
113 3300044712 Ga0453684_1289510 Ga0453684_1289510_176_706 170
114 3300048909 Ga0496106_0075618 Ga0496106_0075618_1872_2417 170
115 3300049577 Ga0501041_0084346 Ga0501041_0084346_149_700 170
116 3300049588 Ga0501072_0038436 Ga0501072_0038436_1070_1621 170
117 3300049589 Ga0501073_0067833 Ga0501073_0067833_145_678 170
118 3300049591 Ga0501075_0292262 Ga0501075_0292262_107_658 170
119 3300049592 Ga0501076_0281600 Ga0501076_0281600_99_650 170
120 3300049705 Ga0501225_0034063 Ga0501225_0034063_20_568 170
121 3300050511 nmdc:mga08y16_21673_c1 nmdc:mga08y16_21673_c1_370_930 170
122 3300050513 nmdc:mga0rr50_106311_c1 nmdc:mga0rr50_106311_c1_1549_2082 170
123 3300054114 Ga0501084_0348518 Ga0501084_0348518_170_721 170
124 3300060353 Ga0501082_0408722 Ga0501082_0408722_10_561 170
125 3300005467 Ga0070706_100008764 Ga0070706_1000087641 171
126 3300005518 Ga0070699_100761591 Ga0070699_1007615911 171
127 3300005546 Ga0070696_100058403 Ga0070696_1000584032 171
128 3300005547 Ga0070693_100804050 Ga0070693_1008040501 171
129 3300005844 Ga0068862_100203507 Ga0068862_1002035072 171
130 3300006852 Ga0075433_10154090 Ga0075433_101540903 171
131 3300009094 Ga0111539_10028824 Ga0111539_100288242 171
132 3300009147 Ga0114129_10106535 Ga0114129_101065351 171
133 3300009147 Ga0114129_10165420 Ga0114129_101654202 171
134 3300009177 Ga0105248_10359038 Ga0105248_103590381 171
135 3300025910 Ga0207684_10035016 Ga0207684_100350163 171
136 3300025922 Ga0207646_10232494 Ga0207646_102324942 171
137 3300025941 Ga0207711_10351520 Ga0207711_103515202 171
138 3300026075 Ga0207708_10698468 Ga0207708_106984682 171
139 3300031711 Ga0265314_10148437 Ga0265314_101484372 171
140 3300044712 Ga0453684_0704764 Ga0453684_0704764_182_754 171
141 3300050507 nmdc:mga05p37_1031475_c1 nmdc:mga05p37_1031475_c1_306_842 171
142 3300050511 nmdc:mga08y16_16490_c2 nmdc:mga08y16_16490_c2_5106_5657 171
143 3300050514 nmdc:mga08x19_138697_c1 nmdc:mga08x19_138697_c1_777_1313 171
144 3300050515 nmdc:mga0a205_9408_c1 nmdc:mga0a205_9408_c1_1384_1920 171
145 3300005329 Ga0070683_101228410 Ga0070683_1012284101 172
146 3300005344 Ga0070661_100154456 Ga0070661_1001544562 172
147 3300005535 Ga0070684_100276843 Ga0070684_1002768432 172
148 3300005564 Ga0070664_100708397 Ga0070664_1007083972 172
149 3300005614 Ga0068856_100039480 Ga0068856_1000394802 172
150 3300009093 Ga0105240_10178768 Ga0105240_101787682 172
151 3300025913 Ga0207695_10191244 Ga0207695_101912441 172
152 3300025920 Ga0207649_10069334 Ga0207649_100693341 172
153 3300025944 Ga0207661_11116385 Ga0207661_111163851 172
154 3300025945 Ga0207679_10838057 Ga0207679_108380571 172
155 3300026078 Ga0207702_10025917 Ga0207702_100259176 172
156 3300026142 Ga0207698_10725525 Ga0207698_107255252 172
157 3300028380 Ga0268265_11038552 Ga0268265_110385521 172
158 3300031995 Ga0307409_100176555 Ga0307409_1001765552 172
159 3300032005 Ga0307411_10411742 Ga0307411_104117421 172
160 3300036401 Ga0373937_0120683 Ga0373937_0120683_1510_2067 172
161 3300044712 Ga0453684_0351786 Ga0453684_0351786_254_793 172
162 3300049572 Ga0501036_0097367 Ga0501036_0097367_1056_1613 172
163 3300049574 Ga0501038_0128728 Ga0501038_0128728_32_589 172
164 3300049575 Ga0501039_0186959 Ga0501039_0186959_994_1551 172
165 3300049578 Ga0501042_0005260 Ga0501042_0005260_406_963 172
166 3300049582 Ga0501048_0418578 Ga0501048_0418578_187_744 172
167 3300049584 Ga0501068_0594089 Ga0501068_0594089_49_606 172
168 3300049587 Ga0501071_0330638 Ga0501071_0330638_326_883 172
169 3300049591 Ga0501075_0050742 Ga0501075_0050742_1349_1906 172
170 3300049592 Ga0501076_0177813 Ga0501076_0177813_1130_1687 172
171 3300049593 Ga0501077_0259619 Ga0501077_0259619_198_755 172
172 3300049742 Ga0501080_0191547 Ga0501080_0191547_1233_1790 172
173 3300054114 Ga0501084_0018300 Ga0501084_0018300_1271_1828 172
174 3300005445 Ga0070708_100821152 Ga0070708_1008211521 173
175 3300006237 Ga0097621_100006929 Ga0097621_1000069293 173
176 3300006358 Ga0068871_100719785 Ga0068871_1007197852 173
177 3300007076 Ga0075435_100814850 Ga0075435_1008148501 173
178 3300045049 Ga0466959_0753365 Ga0466959_0753365_30_581 173
179 3300048913 Ga0496110_0806984 Ga0496110_0806984_147_695 173
180 3300050513 nmdc:mga0rr50_697828_c1 nmdc:mga0rr50_697828_c1_205_756 173
181 3300005293 Ga0065715_10222596 Ga0065715_102225961 174
182 3300005331 Ga0070670_100082999 Ga0070670_1000829993 174
183 3300005331 Ga0070670_100265915 Ga0070670_1002659152 174
184 3300005331 Ga0070670_100287138 Ga0070670_1002871382 174
185 3300005335 Ga0070666_10152319 Ga0070666_101523192 174
186 3300005344 Ga0070661_100295756 Ga0070661_1002957561 174
187 3300005347 Ga0070668_100168944 Ga0070668_1001689442 174
188 3300005347 Ga0070668_100403117 Ga0070668_1004031171 174
189 3300005353 Ga0070669_100081178 Ga0070669_1000811782 174
190 3300005354 Ga0070675_100000055 Ga0070675_10000005510 174
191 3300005354 Ga0070675_100060766 Ga0070675_1000607662 174
192 3300005354 Ga0070675_100322365 Ga0070675_1003223651 174
193 3300005356 Ga0070674_100092876 Ga0070674_1000928762 174
194 3300005364 Ga0070673_100317694 Ga0070673_1003176942 174
195 3300005367 Ga0070667_100796677 Ga0070667_1007966771 174
196 3300005439 Ga0070711_100704796 Ga0070711_1007047961 174
197 3300005456 Ga0070678_100006004 Ga0070678_1000060045 174
198 3300005456 Ga0070678_100794180 Ga0070678_1007941801 174
199 3300005458 Ga0070681_10592507 Ga0070681_105925071 174
200 3300005459 Ga0068867_100703347 Ga0068867_1007033471 174
201 3300005459 Ga0068867_100858810 Ga0068867_1008588101 174
202 3300005471 Ga0070698_100068978 Ga0070698_1000689783 174
203 3300005471 Ga0070698_100554566 Ga0070698_1005545662 174
204 3300005518 Ga0070699_100029670 Ga0070699_1000296703 174
205 3300005518 Ga0070699_100530642 Ga0070699_1005306421 174
206 3300005543 Ga0070672_100554949 Ga0070672_1005549491 174
207 3300005543 Ga0070672_101350045 Ga0070672_1013500451 174
208 3300005564 Ga0070664_100524930 Ga0070664_1005249302 174
209 3300005564 Ga0070664_100586764 Ga0070664_1005867641 174
210 3300005616 Ga0068852_100403215 Ga0068852_1004032151 174
211 3300005616 Ga0068852_100941417 Ga0068852_1009414172 174
212 3300005718 Ga0068866_10620423 Ga0068866_106204231 174
213 3300005985 Ga0081539_10010495 Ga0081539_100104951 174
214 3300005985 Ga0081539_10200232 Ga0081539_102002322 174
215 3300006237 Ga0097621_100031556 Ga0097621_1000315562 174
216 3300006358 Ga0068871_100041326 Ga0068871_1000413264 174
217 3300006358 Ga0068871_100267807 Ga0068871_1002678072 174
218 3300006844 Ga0075428_100711794 Ga0075428_1007117942 174
219 3300006852 Ga0075433_10107599 Ga0075433_101075992 174
220 3300006852 Ga0075433_10363199 Ga0075433_103631992 174
221 3300006871 Ga0075434_100624961 Ga0075434_1006249612 174
222 3300006881 Ga0068865_100558884 Ga0068865_1005588842 174
223 3300006914 Ga0075436_100026842 Ga0075436_1000268422 174
224 3300007076 Ga0075435_100064630 Ga0075435_1000646303 174
225 3300009094 Ga0111539_10736539 Ga0111539_107365392 174
226 3300009094 Ga0111539_10867767 Ga0111539_108677671 174
227 3300009101 Ga0105247_10568984 Ga0105247_105689841 174
228 3300009147 Ga0114129_10324109 Ga0114129_103241092 174
229 3300009147 Ga0114129_10396837 Ga0114129_103968372 174
230 3300009147 Ga0114129_11566788 Ga0114129_115667881 174
231 3300009148 Ga0105243_10602166 Ga0105243_106021662 174
232 3300009176 Ga0105242_10203318 Ga0105242_102033182 174
233 3300009176 Ga0105242_10424778 Ga0105242_104247782 174
234 3300009553 Ga0105249_11303145 Ga0105249_113031452 174
235 3300013297 Ga0157378_11549450 Ga0157378_115494501 174
236 3300013308 Ga0157375_11287010 Ga0157375_112870101 174
237 3300014326 Ga0157380_10249218 Ga0157380_102492182 174
238 3300014326 Ga0157380_10419568 Ga0157380_104195682 174
239 3300014326 Ga0157380_11489736 Ga0157380_114897361 174
240 3300014745 Ga0157377_10018695 Ga0157377_100186952 174
241 3300014968 Ga0157379_10660466 Ga0157379_106604662 174
242 3300014968 Ga0157379_11246994 Ga0157379_112469941 174
243 3300014969 Ga0157376_10513640 Ga0157376_105136403 174
244 3300025315 Ga0207697_10106579 Ga0207697_101065792 174
245 3300025903 Ga0207680_10116783 Ga0207680_101167832 174
246 3300025904 Ga0207647_10350199 Ga0207647_103501991 174
247 3300025908 Ga0207643_10138433 Ga0207643_101384332 174
248 3300025920 Ga0207649_10630931 Ga0207649_106309311 174
249 3300025922 Ga0207646_10225443 Ga0207646_102254431 174
250 3300025923 Ga0207681_10227138 Ga0207681_102271382 174
251 3300025925 Ga0207650_10147551 Ga0207650_101475512 174
252 3300025925 Ga0207650_10232978 Ga0207650_102329782 174
253 3300025925 Ga0207650_10300057 Ga0207650_103000572 174
254 3300025925 Ga0207650_10375507 Ga0207650_103755071 174
255 3300025926 Ga0207659_10001583 Ga0207659_100015832 174
256 3300025926 Ga0207659_10681566 Ga0207659_106815662 174
257 3300025938 Ga0207704_10484842 Ga0207704_104848422 174
258 3300025940 Ga0207691_10183103 Ga0207691_101831032 174
259 3300025940 Ga0207691_10616099 Ga0207691_106160992 174
260 3300025945 Ga0207679_10577089 Ga0207679_105770892 174
261 3300025960 Ga0207651_10076797 Ga0207651_100767972 174
262 3300025960 Ga0207651_11380495 Ga0207651_113804951 174
263 3300025972 Ga0207668_10200435 Ga0207668_102004352 174
264 3300025972 Ga0207668_10321112 Ga0207668_103211122 174
265 3300025986 Ga0207658_10419894 Ga0207658_104198941 174
266 3300026035 Ga0207703_11366459 Ga0207703_113664591 174
267 3300026075 Ga0207708_10637460 Ga0207708_106374601 174
268 3300026089 Ga0207648_10080951 Ga0207648_100809511 174
269 3300026089 Ga0207648_10404642 Ga0207648_104046422 174
270 3300026089 Ga0207648_10455909 Ga0207648_104559092 174
271 3300026118 Ga0207675_101080479 Ga0207675_1010804792 174
272 3300026121 Ga0207683_10006801 Ga0207683_1000680110 174
273 3300026121 Ga0207683_10692321 Ga0207683_106923211 174
274 3300028380 Ga0268265_10656582 Ga0268265_106565821 174
275 3300028380 Ga0268265_11412587 Ga0268265_114125871 174
276 3300031548 Ga0307408_100197579 Ga0307408_1001975791 174
277 3300035090 Ga0373949_0130997 Ga0373949_0130997_106_660 174
278 3300035115 Ga0373941_0008907 Ga0373941_0008907_1450_2001 174
279 3300035119 Ga0373956_0363148 Ga0373956_0363148_41_586 174
280 3300035724 Ga0373933_0373417 Ga0373933_0373417_73_618 174
281 3300036401 Ga0373937_0065621 Ga0373937_0065621_1937_2482 174
282 3300036401 Ga0373937_0451230 Ga0373937_0451230_49_594 174
283 3300036401 Ga0373937_0923021 Ga0373937_0923021_118_669 174
284 3300036401 Ga0373937_1544026 Ga0373937_1544026_41_586 174
285 3300037068 Ga0373925_0536071 Ga0373925_0536071_63_608 174
286 3300039450 Ga0436363_1364936 Ga0436363_1364936_90_650 174
287 3300046533 Ga0495640_0058597 Ga0495640_0058597_839_1390 174
288 3300046533 Ga0495640_0320742 Ga0495640_0320742_395_940 174
289 3300046539 Ga0495621_0049700 Ga0495621_0049700_910_1458 174
290 3300046543 Ga0495645_0399841 Ga0495645_0399841_280_831 174
291 3300046642 Ga0495634_0601735 Ga0495634_0601735_20_571 174
292 3300046681 Ga0495647_0051787 Ga0495647_0051787_428_973 174
293 3300048903 Ga0496100_0001533 Ga0496100_0001533_10329_10874 174
294 3300048904 Ga0496101_0006897 Ga0496101_0006897_4329_4874 174
295 3300048906 Ga0496103_0526264 Ga0496103_0526264_103_654 174
296 3300048907 Ga0496104_0033960 Ga0496104_0033960_1215_1760 174
297 3300048908 Ga0496105_0072751 Ga0496105_0072751_1209_1754 174
298 3300048909 Ga0496106_0036620 Ga0496106_0036620_2687_3232 174
299 3300048909 Ga0496106_0067690 Ga0496106_0067690_1483_2034 174
300 3300048910 Ga0496107_0928689 Ga0496107_0928689_19_564 174
301 3300048911 Ga0496108_0192001 Ga0496108_0192001_877_1428 174
302 3300048918 Ga0496115_0157689 Ga0496115_0157689_262_807 174
303 3300050511 nmdc:mga08y16_661762_c1 nmdc:mga08y16_661762_c1_464_1009 174
304 3300050515 nmdc:mga0a205_27073_c1 nmdc:mga0a205_27073_c1_1163_1714 174
305 3300053085 Ga0495619_0351401 Ga0495619_0351401_342_893 174
306 3300005293 Ga0065715_10123025 Ga0065715_101230252 175
307 3300005355 Ga0070671_100708167 Ga0070671_1007081671 175
308 3300005364 Ga0070673_100007433 Ga0070673_1000074333 175
309 3300005437 Ga0070710_10673034 Ga0070710_106730341 175
310 3300005445 Ga0070708_100185259 Ga0070708_1001852592 175
311 3300005445 Ga0070708_100505708 Ga0070708_1005057082 175
312 3300005467 Ga0070706_100366713 Ga0070706_1003667132 175
313 3300005471 Ga0070698_100258498 Ga0070698_1002584981 175
314 3300005471 Ga0070698_100649775 Ga0070698_1006497752 175
315 3300005548 Ga0070665_100774343 Ga0070665_1007743432 175
316 3300005548 Ga0070665_101175684 Ga0070665_1011756842 175
317 3300005615 Ga0070702_100650997 Ga0070702_1006509971 175
318 3300005617 Ga0068859_100354151 Ga0068859_1003541512 175
319 3300005842 Ga0068858_100182805 Ga0068858_1001828052 175
320 3300005842 Ga0068858_100183774 Ga0068858_1001837742 175
321 3300005842 Ga0068858_100423180 Ga0068858_1004231802 175
322 3300005843 Ga0068860_100631847 Ga0068860_1006318471 175
323 3300005843 Ga0068860_100831201 Ga0068860_1008312012 175
324 3300006173 Ga0070716_100627900 Ga0070716_1006279001 175
325 3300006358 Ga0068871_100919632 Ga0068871_1009196321 175
326 3300006914 Ga0075436_100022932 Ga0075436_1000229322 175
327 3300006931 Ga0097620_100354142 Ga0097620_1003541422 175
328 3300007076 Ga0075435_100012947 Ga0075435_1000129477 175
329 3300009098 Ga0105245_10619704 Ga0105245_106197042 175
330 3300009101 Ga0105247_10123436 Ga0105247_101234362 175
331 3300009101 Ga0105247_11304512 Ga0105247_113045121 175
332 3300009147 Ga0114129_10011848 Ga0114129_100118486 175
333 3300009147 Ga0114129_10399358 Ga0114129_103993582 175
334 3300009147 Ga0114129_11152612 Ga0114129_111526121 175
335 3300009177 Ga0105248_10121507 Ga0105248_101215072 175
336 3300009177 Ga0105248_10848019 Ga0105248_108480191 175
337 3300009177 Ga0105248_11079895 Ga0105248_110798952 175
338 3300013297 Ga0157378_10438723 Ga0157378_104387232 175
339 3300014325 Ga0163163_10053731 Ga0163163_100537313 175
340 3300014968 Ga0157379_10056109 Ga0157379_100561094 175
341 3300014968 Ga0157379_10217435 Ga0157379_102174352 175
342 3300025900 Ga0207710_10048765 Ga0207710_100487652 175
343 3300025918 Ga0207662_10690516 Ga0207662_106905161 175
344 3300025927 Ga0207687_10260912 Ga0207687_102609122 175
345 3300025939 Ga0207665_10536443 Ga0207665_105364432 175
346 3300025941 Ga0207711_10008211 Ga0207711_100082114 175
347 3300025942 Ga0207689_10542798 Ga0207689_105427981 175
348 3300025960 Ga0207651_10015397 Ga0207651_100153974 175
349 3300026035 Ga0207703_10089972 Ga0207703_100899722 175
350 3300026035 Ga0207703_10128427 Ga0207703_101284272 175
351 3300026035 Ga0207703_10158107 Ga0207703_101581072 175
352 3300028381 Ga0268264_10159730 Ga0268264_101597301 175
353 3300028381 Ga0268264_10345126 Ga0268264_103451261 175
354 3300028381 Ga0268264_10743494 Ga0268264_107434941 175
355 3300036401 Ga0373937_0387378 Ga0373937_0387378_552_1100 175
356 3300042530 Ga0450916_025143 Ga0450916_025143_184_741 175
357 3300045051 Ga0451576_0311039 Ga0451576_0311039_737_1300 175
358 3300046459 Ga0495629_0687620 Ga0495629_0687620_58_606 175
359 3300046535 Ga0495586_0430889 Ga0495586_0430889_175_723 175
360 3300048915 Ga0496112_0812191 Ga0496112_0812191_198_752 175
361 3300048917 Ga0496114_0259810 Ga0496114_0259810_119_667 175
362 3300049571 Ga0501034_0040753 Ga0501034_0040753_1652_2212 175
363 3300049571 Ga0501034_0099532 Ga0501034_0099532_1992_2552 175
364 3300049587 Ga0501071_0835522 Ga0501071_0835522_18_563 175
365 3300049588 Ga0501072_0609308 Ga0501072_0609308_10_573 175
366 3300049742 Ga0501080_0524951 Ga0501080_0524951_59_604 175
367 3300049742 Ga0501080_1087256 Ga0501080_1087256_77_637 175
368 3300049823 Ga0501044_0025835 Ga0501044_0025835_2432_2992 175
369 3300049824 Ga0501045_0120737 Ga0501045_0120737_1378_1923 175
370 3300050507 nmdc:mga05p37_1090426_c1 nmdc:mga05p37_1090426_c1_267_824 175
371 3300050507 nmdc:mga05p37_7530_c1 nmdc:mga05p37_7530_c1_5543_6097 175
372 3300050512 nmdc:mga0n895_1537346_c1 nmdc:mga0n895_1537346_c1_90_617 175
373 3300050512 nmdc:mga0n895_676153_c1 nmdc:mga0n895_676153_c1_350_904 175
374 3300050513 nmdc:mga0rr50_8855_c1 nmdc:mga0rr50_8855_c1_2985_3539 175
375 3300050514 nmdc:mga08x19_129116_c1 nmdc:mga08x19_129116_c1_511_1068 175
376 3300060353 Ga0501082_0877351 Ga0501082_0877351_80_640 175
377 3300061734 Ga0530510_0032762 Ga0530510_0032762_1805_2350 175
378 3300005290 Ga0065712_10088104 Ga0065712_100881042 176
379 3300005293 Ga0065715_10263739 Ga0065715_102637391 176
380 3300005328 Ga0070676_10016794 Ga0070676_100167944 176
381 3300005330 Ga0070690_100400749 Ga0070690_1004007492 176
382 3300005331 Ga0070670_100287351 Ga0070670_1002873512 176
383 3300005333 Ga0070677_10177799 Ga0070677_101777991 176
384 3300005334 Ga0068869_100297242 Ga0068869_1002972422 176
385 3300005335 Ga0070666_10358225 Ga0070666_103582252 176
386 3300005338 Ga0068868_100093500 Ga0068868_1000935002 176
387 3300005338 Ga0068868_100102243 Ga0068868_1001022432 176
388 3300005339 Ga0070660_101156038 Ga0070660_1011560381 176
389 3300005340 Ga0070689_100209031 Ga0070689_1002090312 176
390 3300005341 Ga0070691_10077586 Ga0070691_100775862 176
391 3300005343 Ga0070687_100075395 Ga0070687_1000753952 176
392 3300005353 Ga0070669_100027284 Ga0070669_1000272843 176
393 3300005353 Ga0070669_100030171 Ga0070669_1000301713 176
394 3300005354 Ga0070675_100390799 Ga0070675_1003907991 176
395 3300005355 Ga0070671_100058300 Ga0070671_1000583002 176
396 3300005355 Ga0070671_100403894 Ga0070671_1004038942 176
397 3300005356 Ga0070674_100002222 Ga0070674_1000022224 176
398 3300005364 Ga0070673_100657483 Ga0070673_1006574831 176
399 3300005365 Ga0070688_100017585 Ga0070688_1000175854 176
400 3300005365 Ga0070688_100027256 Ga0070688_1000272562 176
401 3300005406 Ga0070703_10155481 Ga0070703_101554811 176
402 3300005438 Ga0070701_10079196 Ga0070701_100791961 176
403 3300005440 Ga0070705_100950133 Ga0070705_1009501331 176
404 3300005441 Ga0070700_100002552 Ga0070700_1000025525 176
405 3300005444 Ga0070694_100008007 Ga0070694_1000080077 176
406 3300005457 Ga0070662_100254206 Ga0070662_1002542062 176
407 3300005458 Ga0070681_10145441 Ga0070681_101454412 176
408 3300005459 Ga0068867_100013308 Ga0068867_1000133082 176
409 3300005459 Ga0068867_100050115 Ga0068867_1000501152 176
410 3300005459 Ga0068867_100426367 Ga0068867_1004263672 176
411 3300005467 Ga0070706_100266451 Ga0070706_1002664512 176
412 3300005467 Ga0070706_101096955 Ga0070706_1010969551 176
413 3300005468 Ga0070707_101418963 Ga0070707_1014189631 176
414 3300005471 Ga0070698_100377123 Ga0070698_1003771232 176
415 3300005518 Ga0070699_100149832 Ga0070699_1001498322 176
416 3300005518 Ga0070699_100498816 Ga0070699_1004988161 176
417 3300005535 Ga0070684_100321305 Ga0070684_1003213051 176
418 3300005536 Ga0070697_100008131 Ga0070697_1000081315 176
419 3300005536 Ga0070697_100217771 Ga0070697_1002177711 176
420 3300005536 Ga0070697_101187959 Ga0070697_1011879591 176
421 3300005543 Ga0070672_100007912 Ga0070672_1000079122 176
422 3300005543 Ga0070672_100269793 Ga0070672_1002697932 176
423 3300005543 Ga0070672_100561505 Ga0070672_1005615051 176
424 3300005544 Ga0070686_100019068 Ga0070686_1000190684 176
425 3300005544 Ga0070686_100032957 Ga0070686_1000329572 176
426 3300005544 Ga0070686_100199450 Ga0070686_1001994501 176
427 3300005545 Ga0070695_100009349 Ga0070695_1000093492 176
428 3300005545 Ga0070695_100197478 Ga0070695_1001974781 176
429 3300005545 Ga0070695_100353988 Ga0070695_1003539881 176
430 3300005546 Ga0070696_100137584 Ga0070696_1001375842 176
431 3300005546 Ga0070696_100911756 Ga0070696_1009117561 176
432 3300005548 Ga0070665_100039958 Ga0070665_1000399582 176
433 3300005548 Ga0070665_100043475 Ga0070665_1000434752 176
434 3300005548 Ga0070665_100147040 Ga0070665_1001470402 176
435 3300005549 Ga0070704_100003291 Ga0070704_1000032917 176
436 3300005549 Ga0070704_100134913 Ga0070704_1001349132 176
437 3300005549 Ga0070704_100900635 Ga0070704_1009006351 176
438 3300005564 Ga0070664_101042540 Ga0070664_1010425402 176
439 3300005578 Ga0068854_100711666 Ga0068854_1007116662 176
440 3300005617 Ga0068859_100157307 Ga0068859_1001573072 176
441 3300005617 Ga0068859_100822033 Ga0068859_1008220331 176
442 3300005618 Ga0068864_100010173 Ga0068864_10001017310 176
443 3300005618 Ga0068864_100412681 Ga0068864_1004126812 176
444 3300005618 Ga0068864_100492805 Ga0068864_1004928052 176
445 3300005618 Ga0068864_101097997 Ga0068864_1010979971 176
446 3300005718 Ga0068866_10079689 Ga0068866_100796892 176
447 3300005718 Ga0068866_10382751 Ga0068866_103827512 176
448 3300005719 Ga0068861_101334175 Ga0068861_1013341752 176
449 3300005834 Ga0068851_10118415 Ga0068851_101184152 176
450 3300005840 Ga0068870_10493834 Ga0068870_104938342 176
451 3300005841 Ga0068863_100170185 Ga0068863_1001701852 176
452 3300005841 Ga0068863_100186126 Ga0068863_1001861262 176
453 3300005841 Ga0068863_100352264 Ga0068863_1003522642 176
454 3300005842 Ga0068858_100096867 Ga0068858_1000968673 176
455 3300005842 Ga0068858_100307671 Ga0068858_1003076712 176
456 3300005842 Ga0068858_100559380 Ga0068858_1005593801 176
457 3300005842 Ga0068858_101226003 Ga0068858_1012260031 176
458 3300005842 Ga0068858_101691431 Ga0068858_1016914311 176
459 3300005843 Ga0068860_100228036 Ga0068860_1002280362 176
460 3300005843 Ga0068860_100339990 Ga0068860_1003399902 176
461 3300005844 Ga0068862_100016873 Ga0068862_1000168732 176
462 3300005937 Ga0081455_10052704 Ga0081455_100527041 176
463 3300005937 Ga0081455_10435669 Ga0081455_104356692 176
464 3300006058 Ga0075432_10065960 Ga0075432_100659602 176
465 3300006237 Ga0097621_100003570 Ga0097621_1000035707 176
466 3300006237 Ga0097621_100073190 Ga0097621_1000731902 176
467 3300006237 Ga0097621_100437125 Ga0097621_1004371252 176
468 3300006358 Ga0068871_100030849 Ga0068871_1000308493 176
469 3300006358 Ga0068871_100120424 Ga0068871_1001204242 176
470 3300006358 Ga0068871_100159232 Ga0068871_1001592322 176
471 3300006844 Ga0075428_100558654 Ga0075428_1005586542 176
472 3300006852 Ga0075433_10206021 Ga0075433_102060212 176
473 3300006871 Ga0075434_100091700 Ga0075434_1000917002 176
474 3300006871 Ga0075434_100189701 Ga0075434_1001897012 176
475 3300006871 Ga0075434_100400293 Ga0075434_1004002931 176
476 3300006871 Ga0075434_100466636 Ga0075434_1004666362 176
477 3300006871 Ga0075434_100863765 Ga0075434_1008637651 176
478 3300006881 Ga0068865_100113304 Ga0068865_1001133042 176
479 3300006914 Ga0075436_100022674 Ga0075436_1000226743 176
480 3300006914 Ga0075436_100066077 Ga0075436_1000660772 176
481 3300006931 Ga0097620_100157303 Ga0097620_1001573033 176
482 3300006931 Ga0097620_100822048 Ga0097620_1008220481 176
483 3300007076 Ga0075435_100000982 Ga0075435_10000098215 176
484 3300007076 Ga0075435_100004535 Ga0075435_1000045355 176
485 3300007076 Ga0075435_100008984 Ga0075435_1000089845 176
486 3300007076 Ga0075435_100099384 Ga0075435_1000993842 176
487 3300007076 Ga0075435_100118023 Ga0075435_1001180232 176
488 3300007076 Ga0075435_100165371 Ga0075435_1001653712 176
489 3300007076 Ga0075435_100744299 Ga0075435_1007442992 176
490 3300009093 Ga0105240_11185799 Ga0105240_111857991 176
491 3300009093 Ga0105240_11964780 Ga0105240_119647801 176
492 3300009094 Ga0111539_10088494 Ga0111539_100884944 176
493 3300009094 Ga0111539_10153878 Ga0111539_101538782 176
494 3300009098 Ga0105245_10035083 Ga0105245_100350833 176
495 3300009098 Ga0105245_10041645 Ga0105245_100416454 176
496 3300009098 Ga0105245_10795086 Ga0105245_107950862 176
497 3300009101 Ga0105247_10008843 Ga0105247_100088432 176
498 3300009147 Ga0114129_10010381 Ga0114129_100103816 176
499 3300009147 Ga0114129_10028993 Ga0114129_100289936 176
500 3300009147 Ga0114129_10029006 Ga0114129_100290062 176
501 3300009147 Ga0114129_10079890 Ga0114129_100798902 176
502 3300009148 Ga0105243_10161109 Ga0105243_101611092 176
503 3300009148 Ga0105243_10201697 Ga0105243_102016972 176
504 3300009174 Ga0105241_10305154 Ga0105241_103051542 176
505 3300009176 Ga0105242_10021080 Ga0105242_100210803 176
506 3300009176 Ga0105242_10715420 Ga0105242_107154202 176
507 3300009176 Ga0105242_10807308 Ga0105242_108073082 176
508 3300009177 Ga0105248_10011297 Ga0105248_1001129710 176
509 3300009177 Ga0105248_10027045 Ga0105248_100270457 176
510 3300009177 Ga0105248_10442687 Ga0105248_104426872 176
511 3300009177 Ga0105248_11231595 Ga0105248_112315951 176
512 3300009545 Ga0105237_10648600 Ga0105237_106486001 176
513 3300009551 Ga0105238_10569141 Ga0105238_105691412 176
514 3300009553 Ga0105249_10607899 Ga0105249_106078992 176
515 3300010375 Ga0105239_11509220 Ga0105239_115092201 176
516 3300011119 Ga0105246_10131282 Ga0105246_101312822 176
517 3300013296 Ga0157374_10021328 Ga0157374_100213282 176
518 3300013296 Ga0157374_10254783 Ga0157374_102547832 176
519 3300013296 Ga0157374_10886338 Ga0157374_108863382 176
520 3300013306 Ga0163162_10017908 Ga0163162_100179086 176
521 3300013306 Ga0163162_10378521 Ga0163162_103785212 176
522 3300013308 Ga0157375_10110326 Ga0157375_101103262 176
523 3300013308 Ga0157375_10491558 Ga0157375_104915582 176
524 3300013308 Ga0157375_10494202 Ga0157375_104942022 176
525 3300014325 Ga0163163_10004562 Ga0163163_100045628 176
526 3300014325 Ga0163163_10177578 Ga0163163_101775782 176
527 3300014325 Ga0163163_10970033 Ga0163163_109700332 176
528 3300014325 Ga0163163_11025509 Ga0163163_110255091 176
529 3300014326 Ga0157380_10114323 Ga0157380_101143232 176
530 3300014326 Ga0157380_10126530 Ga0157380_101265302 176
531 3300014968 Ga0157379_10019746 Ga0157379_100197464 176
532 3300014969 Ga0157376_10017840 Ga0157376_100178402 176
533 3300014969 Ga0157376_10256817 Ga0157376_102568172 176
534 3300014969 Ga0157376_10708893 Ga0157376_107088931 176
535 3300017792 Ga0163161_10105378 Ga0163161_101053782 176
536 3300025885 Ga0207653_10049650 Ga0207653_100496502 176
537 3300025893 Ga0207682_10053288 Ga0207682_100532882 176
538 3300025899 Ga0207642_10081113 Ga0207642_100811132 176
539 3300025900 Ga0207710_10005396 Ga0207710_100053963 176
540 3300025903 Ga0207680_10093938 Ga0207680_100939382 176
541 3300025907 Ga0207645_10005828 Ga0207645_100058285 176
542 3300025908 Ga0207643_10316694 Ga0207643_103166942 176
543 3300025910 Ga0207684_10499743 Ga0207684_104997431 176
544 3300025920 Ga0207649_10212637 Ga0207649_102126371 176
545 3300025920 Ga0207649_10692320 Ga0207649_106923201 176
546 3300025922 Ga0207646_11123642 Ga0207646_111236421 176
547 3300025923 Ga0207681_10039330 Ga0207681_100393302 176
548 3300025923 Ga0207681_10156649 Ga0207681_101566492 176
549 3300025925 Ga0207650_10280784 Ga0207650_102807842 176
550 3300025925 Ga0207650_10287158 Ga0207650_102871582 176
551 3300025926 Ga0207659_10280573 Ga0207659_102805732 176
552 3300025926 Ga0207659_10418444 Ga0207659_104184442 176
553 3300025926 Ga0207659_11144104 Ga0207659_111441042 176
554 3300025927 Ga0207687_10031081 Ga0207687_100310813 176
555 3300025931 Ga0207644_10009889 Ga0207644_100098892 176
556 3300025932 Ga0207690_10248881 Ga0207690_102488812 176
557 3300025932 Ga0207690_11040034 Ga0207690_110400341 176
558 3300025933 Ga0207706_10088113 Ga0207706_100881132 176
559 3300025933 Ga0207706_10282016 Ga0207706_102820162 176
560 3300025934 Ga0207686_10015837 Ga0207686_100158372 176
561 3300025934 Ga0207686_10042044 Ga0207686_100420442 176
562 3300025934 Ga0207686_10079551 Ga0207686_100795513 176
563 3300025934 Ga0207686_10888266 Ga0207686_108882661 176
564 3300025934 Ga0207686_11200363 Ga0207686_112003631 176
565 3300025935 Ga0207709_10254819 Ga0207709_102548192 176
566 3300025936 Ga0207670_10259611 Ga0207670_102596111 176
567 3300025938 Ga0207704_10004287 Ga0207704_100042877 176
568 3300025940 Ga0207691_10269977 Ga0207691_102699772 176
569 3300025941 Ga0207711_10012271 Ga0207711_100122717 176
570 3300025941 Ga0207711_10160489 Ga0207711_101604891 176
571 3300025941 Ga0207711_10419410 Ga0207711_104194101 176
572 3300025941 Ga0207711_10472957 Ga0207711_104729572 176
573 3300025941 Ga0207711_10948906 Ga0207711_109489062 176
574 3300025942 Ga0207689_10678505 Ga0207689_106785052 176
575 3300025960 Ga0207651_10056524 Ga0207651_100565243 176
576 3300025960 Ga0207651_10111454 Ga0207651_101114541 176
577 3300025960 Ga0207651_10409635 Ga0207651_104096351 176
578 3300025960 Ga0207651_10642570 Ga0207651_106425702 176
579 3300025961 Ga0207712_10450251 Ga0207712_104502512 176
580 3300025972 Ga0207668_10110058 Ga0207668_101100582 176
581 3300025981 Ga0207640_10042422 Ga0207640_100424222 176
582 3300025981 Ga0207640_10127195 Ga0207640_101271952 176
583 3300025986 Ga0207658_10011360 Ga0207658_100113604 176
584 3300026023 Ga0207677_10141763 Ga0207677_101417632 176
585 3300026035 Ga0207703_10115837 Ga0207703_101158372 176
586 3300026075 Ga0207708_10014324 Ga0207708_100143242 176
587 3300026075 Ga0207708_10115747 Ga0207708_101157472 176
588 3300026088 Ga0207641_10007357 Ga0207641_100073575 176
589 3300026089 Ga0207648_10045119 Ga0207648_100451192 176
590 3300026089 Ga0207648_10167183 Ga0207648_101671832 176
591 3300026089 Ga0207648_10189219 Ga0207648_101892192 176
592 3300026089 Ga0207648_10209830 Ga0207648_102098302 176
593 3300026095 Ga0207676_10749814 Ga0207676_107498141 176
594 3300026095 Ga0207676_11028952 Ga0207676_110289521 176
595 3300026118 Ga0207675_100043855 Ga0207675_1000438552 176
596 3300026118 Ga0207675_101230191 Ga0207675_1012301912 176
597 3300026121 Ga0207683_10179174 Ga0207683_101791742 176
598 3300028379 Ga0268266_10121845 Ga0268266_101218453 176
599 3300028380 Ga0268265_10017900 Ga0268265_100179006 176
600 3300028380 Ga0268265_10159475 Ga0268265_101594752 176
601 3300028380 Ga0268265_10361190 Ga0268265_103611902 176
602 3300028381 Ga0268264_10478855 Ga0268264_104788552 176
603 3300028381 Ga0268264_10649787 Ga0268264_106497871 176
604 3300030521 Ga0307511_10106184 Ga0307511_101061841 176
605 3300031711 Ga0265314_10038673 Ga0265314_100386734 176
606 3300032002 Ga0307416_100759321 Ga0307416_1007593212 176
607 3300034816 Ga0373930_0001039 Ga0373930_0001039_3115_3672 176
608 3300034817 Ga0373948_0003611 Ga0373948_0003611_20_577 176
609 3300034818 Ga0373950_0007534 Ga0373950_0007534_937_1494 176
610 3300034819 Ga0373958_0059178 Ga0373958_0059178_253_810 176
611 3300034819 Ga0373958_0099560 Ga0373958_0099560_76_633 176
612 3300034820 Ga0373959_0002937 Ga0373959_0002937_2031_2588 176
613 3300035088 Ga0373940_0001597 Ga0373940_0001597_79_636 176
614 3300035090 Ga0373949_0002049 Ga0373949_0002049_771_1328 176
615 3300035091 Ga0373951_0010193 Ga0373951_0010193_1518_2075 176
616 3300035092 Ga0373952_0004034 Ga0373952_0004034_1987_2544 176
617 3300035092 Ga0373952_0156845 Ga0373952_0156845_36_593 176
618 3300035112 Ga0373932_0011931 Ga0373932_0011931_1487_2044 176
619 3300035115 Ga0373941_0014275 Ga0373941_0014275_870_1427 176
620 3300035121 Ga0373960_0000007 Ga0373960_0000007_17063_17620 176
621 3300035172 Ga0373955_0584454 Ga0373955_0584454_12_569 176
622 3300035207 Ga0373942_0000144 Ga0373942_0000144_8015_8572 176
623 3300035241 Ga0373961_0001062 Ga0373961_0001062_5747_6304 176
624 3300035242 Ga0373962_0009438 Ga0373962_0009438_37_594 176
625 3300035691 Ga0373931_0009351 Ga0373931_0009351_228_785 176
626 3300035691 Ga0373931_0340294 Ga0373931_0340294_38_595 176
627 3300037068 Ga0373925_0096732 Ga0373925_0096732_74_631 176
628 3300037471 Ga0395905_0395185 Ga0395905_0395185_329_877 176
629 3300044673 Ga0453683_0337052 Ga0453683_0337052_18_602 176
630 3300044842 Ga0466957_0309256 Ga0466957_0309256_82_639 176
631 3300045051 Ga0451576_0060074 Ga0451576_0060074_2319_2876 176
632 3300046528 Ga0495642_0229553 Ga0495642_0229553_29_586 176
633 3300046543 Ga0495645_0001445 Ga0495645_0001445_9151_9708 176
634 3300046559 Ga0495667_0655823 Ga0495667_0655823_79_636 176
635 3300046663 Ga0495635_0045658 Ga0495635_0045658_603_1160 176
636 3300046664 Ga0495659_0384898 Ga0495659_0384898_32_589 176
637 3300046678 Ga0495599_0493938 Ga0495599_0493938_95_652 176
638 3300046683 Ga0495658_0041589 Ga0495658_0041589_1605_2162 176
639 3300046683 Ga0495658_0184788 Ga0495658_0184788_120_677 176
640 3300046684 Ga0495669_0218129 Ga0495669_0218129_102_659 176
641 3300048907 Ga0496104_0132020 Ga0496104_0132020_1652_2209 176
642 3300048908 Ga0496105_0212906 Ga0496105_0212906_95_646 176
643 3300048908 Ga0496105_0632752 Ga0496105_0632752_43_600 176
644 3300048909 Ga0496106_0616180 Ga0496106_0616180_104_661 176
645 3300048909 Ga0496106_0621194 Ga0496106_0621194_235_792 176
646 3300048911 Ga0496108_0008779 Ga0496108_0008779_5231_5788 176
647 3300048914 Ga0496111_0420167 Ga0496111_0420167_301_858 176
648 3300048915 Ga0496112_0006594 Ga0496112_0006594_958_1515 176
649 3300048916 Ga0496113_0083404 Ga0496113_0083404_27_584 176
650 3300048917 Ga0496114_0069418 Ga0496114_0069418_933_1490 176
651 3300048917 Ga0496114_0156997 Ga0496114_0156997_479_1036 176
652 3300048917 Ga0496114_0179591 Ga0496114_0179591_1130_1687 176
653 3300048918 Ga0496115_0112495 Ga0496115_0112495_1599_2156 176
654 3300050507 nmdc:mga05p37_15317_c1 nmdc:mga05p37_15317_c1_8149_8706 176
655 3300050507 nmdc:mga05p37_16647_c1 nmdc:mga05p37_16647_c1_486_1043 176
656 3300050507 nmdc:mga05p37_38590_c1 nmdc:mga05p37_38590_c1_5274_5831 176
657 3300050507 nmdc:mga05p37_729641_c1 nmdc:mga05p37_729641_c1_56_613 176
658 3300050507 nmdc:mga05p37_97789_c1 nmdc:mga05p37_97789_c1_2559_3134 176
659 3300050511 nmdc:mga08y16_182547_c1 nmdc:mga08y16_182547_c1_1397_1957 176
660 3300050511 nmdc:mga08y16_261089_c1 nmdc:mga08y16_261089_c1_551_1108 176
661 3300050511 nmdc:mga08y16_5107_c1 nmdc:mga08y16_5107_c1_12778_13338 176
662 3300050512 nmdc:mga0n895_103239_c1 nmdc:mga0n895_103239_c1_527_1084 176
663 3300050512 nmdc:mga0n895_257182_c1 nmdc:mga0n895_257182_c1_369_926 176
664 3300050512 nmdc:mga0n895_310555_c1 nmdc:mga0n895_310555_c1_68_625 176
665 3300050512 nmdc:mga0n895_390941_c1 nmdc:mga0n895_390941_c1_765_1322 176
666 3300050512 nmdc:mga0n895_428690_c1 nmdc:mga0n895_428690_c1_202_759 176
667 3300050512 nmdc:mga0n895_616694_c1 nmdc:mga0n895_616694_c1_183_737 176
668 3300050512 nmdc:mga0n895_67_c1 nmdc:mga0n895_67_c1_59683_60240 176
669 3300050513 nmdc:mga0rr50_114_c1 nmdc:mga0rr50_114_c1_2354_2911 176
670 3300050513 nmdc:mga0rr50_117144_c1 nmdc:mga0rr50_117144_c1_827_1384 176
671 3300050513 nmdc:mga0rr50_295238_c1 nmdc:mga0rr50_295238_c1_353_910 176
672 3300050513 nmdc:mga0rr50_3192_c1 nmdc:mga0rr50_3192_c1_6446_7003 176
673 3300050513 nmdc:mga0rr50_619962_c1 nmdc:mga0rr50_619962_c1_191_748 176
674 3300050514 nmdc:mga08x19_103783_c1 nmdc:mga08x19_103783_c1_320_877 176
675 3300050514 nmdc:mga08x19_175118_c1 nmdc:mga08x19_175118_c1_762_1319 176
676 3300050514 nmdc:mga08x19_2465_c1 nmdc:mga08x19_2465_c1_6966_7523 176
677 3300050515 nmdc:mga0a205_36758_c1 nmdc:mga0a205_36758_c1_2657_3214 176
678 3300050515 nmdc:mga0a205_440193_c1 nmdc:mga0a205_440193_c1_284_841 176
679 3300050515 nmdc:mga0a205_575787_c1 nmdc:mga0a205_575787_c1_139_696 176
680 3300050515 nmdc:mga0a205_76377_c1 nmdc:mga0a205_76377_c1_1073_1630 176
681 3300050515 nmdc:mga0a205_95048_c1 nmdc:mga0a205_95048_c1_1166_1723 176
682 3300053077 Ga0495601_0154615 Ga0495601_0154615_76_633 176
683 3300053085 Ga0495619_0024195 Ga0495619_0024195_2850_3407 176
684 3300005434 Ga0070709_10443042 Ga0070709_104430421 177
685 3300005436 Ga0070713_100222638 Ga0070713_1002226382 177
686 3300005458 Ga0070681_10142616 Ga0070681_101426162 177
687 3300005458 Ga0070681_10574785 Ga0070681_105747852 177
688 3300005471 Ga0070698_100494236 Ga0070698_1004942361 177
689 3300005535 Ga0070684_101149231 Ga0070684_1011492311 177
690 3300005615 Ga0070702_100179897 Ga0070702_1001798972 177
691 3300005843 Ga0068860_100419758 Ga0068860_1004197582 177
692 3300005937 Ga0081455_10067100 Ga0081455_100671003 177
693 3300006028 Ga0070717_10326941 Ga0070717_103269412 177
694 3300006173 Ga0070716_100142150 Ga0070716_1001421502 177
695 3300006358 Ga0068871_100054112 Ga0068871_1000541123 177
696 3300009148 Ga0105243_11198788 Ga0105243_111987882 177
697 3300009174 Ga0105241_10537928 Ga0105241_105379281 177
698 3300013297 Ga0157378_10004694 Ga0157378_100046943 177
699 3300014969 Ga0157376_10606233 Ga0157376_106062332 177
700 3300021384 Ga0213876_10071763 Ga0213876_100717632 177
701 3300025898 Ga0207692_10562501 Ga0207692_105625011 177
702 3300025906 Ga0207699_10007807 Ga0207699_100078072 177
703 3300025912 Ga0207707_10280198 Ga0207707_102801982 177
704 3300025912 Ga0207707_10356677 Ga0207707_103566772 177
705 3300025915 Ga0207693_10270581 Ga0207693_102705812 177
706 3300025928 Ga0207700_10023717 Ga0207700_100237173 177
707 3300026089 Ga0207648_10381295 Ga0207648_103812951 177
708 3300028381 Ga0268264_10343825 Ga0268264_103438252 177
709 3300035170 Ga0373943_0244533 Ga0373943_0244533_102_656 177
710 3300035172 Ga0373955_0026296 Ga0373955_0026296_764_1318 177
711 3300035241 Ga0373961_0199554 Ga0373961_0199554_93_650 177
712 3300036401 Ga0373937_0397056 Ga0373937_0397056_632_1186 177
713 3300039437 Ga0436365_1014920 Ga0436365_1014920_377_931 177
714 3300046472 Ga0495580_0593989 Ga0495580_0593989_89_643 177
715 3300046511 Ga0495608_0032472 Ga0495608_0032472_1122_1676 177
716 3300046516 Ga0495628_0744515 Ga0495628_0744515_50_607 177
717 3300046517 Ga0495630_0001261 Ga0495630_0001261_14680_15234 177
718 3300046533 Ga0495640_0265528 Ga0495640_0265528_64_618 177
719 3300046536 Ga0495587_0103928 Ga0495587_0103928_736_1290 177
720 3300046543 Ga0495645_0003703 Ga0495645_0003703_368_922 177
721 3300046559 Ga0495667_0131666 Ga0495667_0131666_786_1340 177
722 3300046642 Ga0495634_0296754 Ga0495634_0296754_208_762 177
723 3300046684 Ga0495669_0063262 Ga0495669_0063262_146_700 177
724 3300046689 Ga0495613_0002821 Ga0495613_0002821_7809_8363 177
725 3300046809 Ga0495600_0326728 Ga0495600_0326728_140_694 177
726 3300047315 Ga0495581_0235484 Ga0495581_0235484_15_569 177
727 3300047317 Ga0495604_0026092 Ga0495604_0026092_1930_2484 177
728 3300047319 Ga0495674_0053305 Ga0495674_0053305_2526_3080 177
729 3300047471 Ga0495684_0000682 Ga0495684_0000682_22411_22965 177
730 3300048088 Ga0495602_0068417 Ga0495602_0068417_1678_2232 177
731 3300053077 Ga0495601_0020931 Ga0495601_0020931_3151_3705 177
732 3300053084 Ga0495595_0391000 Ga0495595_0391000_96_650 177
733 3300053085 Ga0495619_0030540 Ga0495619_0030540_412_966 177
734 3300005334 Ga0068869_100554170 Ga0068869_1005541702 178
735 3300005530 Ga0070679_100031445 Ga0070679_1000314452 178
736 3300005536 Ga0070697_100289369 Ga0070697_1002893692 178
737 3300005842 Ga0068858_100295136 Ga0068858_1002951362 178
738 3300009176 Ga0105242_10640460 Ga0105242_106404601 178
739 3300025921 Ga0207652_10482256 Ga0207652_104822562 178
740 3300026035 Ga0207703_10066805 Ga0207703_100668052 178
741 3300032002 Ga0307416_100175300 Ga0307416_1001753002 178
742 3300032126 Ga0307415_101282646 Ga0307415_1012826461 178
743 3300049583 Ga0501067_0192240 Ga0501067_0192240_64_615 178
744 3300049589 Ga0501073_0262281 Ga0501073_0262281_65_616 178
745 3300054114 Ga0501084_0112407 Ga0501084_0112407_653_1204 178
746 3300060353 Ga0501082_0281256 Ga0501082_0281256_160_711 178
747 3300005468 Ga0070707_100968494 Ga0070707_1009684942 179
748 3300005518 Ga0070699_100181668 Ga0070699_1001816681 179
749 3300025922 Ga0207646_10455607 Ga0207646_104556072 179
750 3300005333 Ga0070677_10138642 Ga0070677_101386422 180
751 3300005347 Ga0070668_100226196 Ga0070668_1002261961 180
752 3300005354 Ga0070675_100240442 Ga0070675_1002404421 180
753 3300005354 Ga0070675_100349560 Ga0070675_1003495601 180
754 3300005354 Ga0070675_101132164 Ga0070675_1011321641 180
755 3300005438 Ga0070701_10728502 Ga0070701_107285021 180
756 3300005456 Ga0070678_100571548 Ga0070678_1005715482 180
757 3300005466 Ga0070685_10009755 Ga0070685_100097553 180
758 3300005543 Ga0070672_100091827 Ga0070672_1000918272 180
759 3300005844 Ga0068862_100083941 Ga0068862_1000839412 180
760 3300006353 Ga0075370_10519002 Ga0075370_105190021 180
761 3300009553 Ga0105249_10044597 Ga0105249_100445972 180
762 3300013306 Ga0163162_11631134 Ga0163162_116311341 180
763 3300025923 Ga0207681_10118780 Ga0207681_101187802 180
764 3300025931 Ga0207644_10511048 Ga0207644_105110481 180
765 3300025940 Ga0207691_10051210 Ga0207691_100512103 180
766 3300025961 Ga0207712_10070741 Ga0207712_100707411 180
767 3300025981 Ga0207640_10338163 Ga0207640_103381632 180
768 3300026075 Ga0207708_10159967 Ga0207708_101599672 180
769 3300026121 Ga0207683_10521715 Ga0207683_105217152 180
770 3300028380 Ga0268265_10294476 Ga0268265_102944762 180
771 3300041408 Ga0439453_0052883 Ga0439453_0052883_213_761 180
772 3300042435 Ga0439434_0210453 Ga0439434_0210453_62_610 180
773 3300042436 Ga0439435_0008363 Ga0439435_0008363_86_628 180
774 3300042461 Ga0439460_0114596 Ga0439460_0114596_10_558 180
775 3300049570 Ga0501033_0012882 Ga0501033_0012882_2483_3025 180
776 3300049572 Ga0501036_0529829 Ga0501036_0529829_203_745 180
777 3300049575 Ga0501039_0044997 Ga0501039_0044997_110_652 180
778 3300049576 Ga0501040_0001751 Ga0501040_0001751_12433_12975 180
779 3300049577 Ga0501041_0075541 Ga0501041_0075541_1075_1617 180
780 3300049578 Ga0501042_0015393 Ga0501042_0015393_452_994 180
781 3300049579 Ga0501043_0171388 Ga0501043_0171388_553_1095 180
782 3300049580 Ga0501046_0008978 Ga0501046_0008978_2421_2963 180
783 3300049582 Ga0501048_0474770 Ga0501048_0474770_256_798 180
784 3300049584 Ga0501068_0425683 Ga0501068_0425683_214_756 180
785 3300049588 Ga0501072_0010677 Ga0501072_0010677_975_1517 180
786 3300049589 Ga0501073_0035438 Ga0501073_0035438_1110_1652 180
787 3300049590 Ga0501074_0021554 Ga0501074_0021554_2054_2596 180
788 3300049591 Ga0501075_0004548 Ga0501075_0004548_2411_2953 180
789 3300049593 Ga0501077_0005464 Ga0501077_0005464_3370_3912 180
790 3300049742 Ga0501080_0053548 Ga0501080_0053548_839_1381 180
791 3300049743 Ga0501081_0000624 Ga0501081_0000624_14628_15170 180
792 3300049822 Ga0501035_0118995 Ga0501035_0118995_107_649 180
793 3300049824 Ga0501045_0014008 Ga0501045_0014008_1362_1904 180
794 3300054114 Ga0501084_0029871 Ga0501084_0029871_3815_4357 180
795 3300060353 Ga0501082_0025547 Ga0501082_0025547_3514_4056 180
796 3300061734 Ga0530510_0029745 Ga0530510_0029745_3322_3864 180
797 3300005290 Ga0065712_10028134 Ga0065712_100281342 181
798 3300005329 Ga0070683_101095220 Ga0070683_1010952201 181
799 3300005340 Ga0070689_100325822 Ga0070689_1003258221 181
800 3300005444 Ga0070694_100167594 Ga0070694_1001675941 181
801 3300005458 Ga0070681_10139148 Ga0070681_101391482 181
802 3300005458 Ga0070681_10885115 Ga0070681_108851151 181
803 3300005468 Ga0070707_100155102 Ga0070707_1001551022 181
804 3300005530 Ga0070679_100109149 Ga0070679_1001091492 181
805 3300005536 Ga0070697_100000183 Ga0070697_10000018357 181
806 3300005544 Ga0070686_100403686 Ga0070686_1004036861 181
807 3300005545 Ga0070695_100060928 Ga0070695_1000609283 181
808 3300005549 Ga0070704_100747192 Ga0070704_1007471921 181
809 3300005577 Ga0068857_100200162 Ga0068857_1002001622 181
810 3300005577 Ga0068857_100462823 Ga0068857_1004628231 181
811 3300005617 Ga0068859_100002955 Ga0068859_10000295518 181
812 3300006237 Ga0097621_100484859 Ga0097621_1004848592 181
813 3300006931 Ga0097620_100002955 Ga0097620_10000295518 181
814 3300009551 Ga0105238_11691954 Ga0105238_116919541 181
815 3300014326 Ga0157380_10031422 Ga0157380_100314223 181
816 3300025907 Ga0207645_10500498 Ga0207645_105004981 181
817 3300025912 Ga0207707_10795300 Ga0207707_107953001 181
818 3300025921 Ga0207652_10089413 Ga0207652_100894131 181
819 3300025922 Ga0207646_10075158 Ga0207646_100751582 181
820 3300025932 Ga0207690_11222926 Ga0207690_112229261 181
821 3300025936 Ga0207670_10188595 Ga0207670_101885952 181
822 3300025944 Ga0207661_11121162 Ga0207661_111211622 181
823 3300026089 Ga0207648_10477631 Ga0207648_104776312 181
824 3300026116 Ga0207674_10107111 Ga0207674_101071112 181
825 3300026116 Ga0207674_10939923 Ga0207674_109399231 181
826 3300028380 Ga0268265_10514531 Ga0268265_105145312 181
827 3300037471 Ga0395905_0607884 Ga0395905_0607884_380_946 181
828 3300048908 Ga0496105_0762376 Ga0496105_0762376_19_582 181
829 3300048912 Ga0496109_0490426 Ga0496109_0490426_26_592 181
830 3300048915 Ga0496112_0135408 Ga0496112_0135408_1155_1721 181
831 3300048915 Ga0496112_1124251 Ga0496112_1124251_30_593 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10369

ALS_ss_C

Small subunit of acetolactate synthase

74

147

0.99

PF13710

ACT_5

ACT domain

11

63

0.92

PF22629

AHAS-like_ACT

AHAS-like ACT domain

5

63

0.89

PF01842

ACT

ACT domain

3

59

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ko1-assembly1.cif.gz_B solution nmr structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a 0.8467 1 74
6lpi-assembly1.cif.gz_E crystal structure of ahas holo-enzyme 0.8411 1 74
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.8405 2 157
7bfg-assembly1.cif.gz_I circular permutant of ribosomal protein s6, p54-55 truncated, v37a mutant. 0.8197 3 74
2fgc-assembly1.cif.gz_A-2 crystal structure of acetolactate synthase- small subunit from thermotoga maritima 0.819 1 157
ID Description Score Start End Superfamily
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9742 83 155 3.30.70.1150
af_Q57625_89_166_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9447 83 156 3.30.70.1150
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9326 83 158 3.30.70.1150
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9016 83 155 3.30.70.1150
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.8875 83 158 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A388P049-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9749 82 150 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A7K4NBU8-F1-model_v4 deleted 0.9319 80 153
AF-A0A537SWU0-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.923 85 156 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A2H0M709-F1-model_v4 Acetolactate synthase small subunit C-terminal domain-containing protein 0.9229 81 155 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A8A5Z5S2-F1-model_v4 deleted 0.9199 80 156

Feature Viewer

pLDDT pTM Quality
85.65 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map