F482804

General Info

Members Datasets Scaffolds Average Seq Length
834 366 1668 311

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0246669|Ga0453684_0246669_192_1154
Length 320
Sequence MGSWIARIRASIVAGVVVGCAGLHAPLVLAEKFDYQLAPLKVADDTWVLIGKTEDFTRANGGNIVNTAFVVTEDGVVVIDSGPSRRYAEQMRAAIAKITAKPVVRVFNTHHHPDHFLGNQVFARVPTAALAVTIAGQKQEGVAFTDNVYRLSGDWILGTEPVAASESVAPGVYNIGGHAFELIALAGHTQGDLVILDRSTGVIFTGDLVFHNRAPTTPHASIAQWLAALDGLDAIRYQLMVPGHGNPVPDGRAVDQTRRYLRWLEATLRQAAEHGDEMNEVLALPLPAEFGSIPLMRVEFARSVAHLYRRYEAGTLAHSR

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
78 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
79 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
82 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
83 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
84 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
85 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
86 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
87 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
88 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
89 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
90 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
91 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
92 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
93 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
94 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
95 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
96 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
97 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
102 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
212 2511231004 Pseudomonas sp. GM102 Isolate Nodule
213 2511231007 Pseudomonas sp. GM18 Isolate Nodule
214 2511231012 Pseudomonas sp. GM33 Isolate Nodule
215 2511231015 Pseudomonas sp. GM49 Isolate Nodule
216 2511231016 Pseudomonas sp. GM50 Isolate Nodule
217 2511231017 Pseudomonas sp. GM55 Isolate Nodule
218 2511231018 Pseudomonas sp. GM60 Isolate Nodule
219 2511231019 Pseudomonas sp. GM67 Isolate Nodule
220 2511231021 Pseudomonas sp. GM78 Isolate Nodule
221 2511231022 Pseudomonas sp. GM79 Isolate Nodule
222 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
223 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
224 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
225 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
226 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
227 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
228 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
229 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
230 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
231 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
232 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
233 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
234 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
235 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
236 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
237 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
238 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
239 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
240 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
241 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
242 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
243 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
244 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
245 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
246 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
247 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
248 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
249 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
250 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
251 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
252 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
253 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
254 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
255 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
256 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
257 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
258 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
259 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
260 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
261 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
262 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
263 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
264 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
265 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
266 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
267 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
268 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
269 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
270 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
271 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
272 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
273 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
274 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
275 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
276 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
277 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
278 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
279 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
280 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
281 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
282 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
283 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
284 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
285 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
286 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
287 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
288 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
289 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
290 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
291 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
292 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
293 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
294 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
295 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
296 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
297 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
298 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
299 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
300 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
301 2773857670 Pseudomonas sp. 478 Isolate Unclassified
302 2784132072 Pseudomonas sp. 460 Isolate Unclassified
303 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
304 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
305 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
306 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
307 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
308 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
309 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
310 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
311 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
312 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
313 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
314 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
315 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
316 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
317 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
318 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
319 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
320 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
321 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
322 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
323 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
324 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
325 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
326 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
327 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
328 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
329 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
330 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
331 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
332 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
333 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
334 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
335 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
336 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
337 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
338 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
339 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
340 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
341 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
342 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
343 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
344 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
345 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
346 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
347 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
348 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
349 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
350 639633007 Azoarcus olearius BH72 Isolate Unclassified
351 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
352 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
353 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
354 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
355 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
356 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
357 8052494512 Pseudomonas putida LD6 Isolate Unclassified
358 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
359 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
360 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
361 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
362 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
363 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
364 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
365 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
366 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.41
Metatranscriptomes 0
Isolates 18.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 1.92
Rhizoplane 8.15
Rhizosphere 73.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0246669 3300044712 Bacteria 2053
2 MRS2a_Contig_5158 2124908027 Bacteria 19190
3 SwRhRL2b_contig_1319436 2162886007 Bacteria 1940
4 JGI25162J39368_1000050 3300002737 Bacteria 157157
5 JGI25163J39215_1000351 3300002771 Bacteria 15275
6 JGI25164J39214_1000025 3300002772 Bacteria 157157
7 JGI25165J46597_1000114 3300003214 Bacteria 144350
8 JGI25165J46597_1000176 3300003214 Bacteria 99160
9 Ga0055530_10000075 3300003791 Bacteria 84932
10 Ga0055530_10032368 3300003791 Bacteria 1360
11 Ga0055540_1000115 3300003792 Bacteria 84932
12 Ga0065714_10000744 3300005288 Bacteria 2932
13 Ga0065714_10002340 3300005288 Bacteria 25797
14 Ga0065714_10006336 3300005288 Bacteria 5927
15 Ga0065714_10029782 3300005288 Bacteria 1496
16 Ga0065714_10074007 3300005288 Bacteria 3096
17 Ga0065714_10083749 3300005288 Bacteria 2232
18 Ga0065714_10092038 3300005288 Bacteria 1885
19 Ga0065714_10092661 3300005288 Bacteria 1870
20 Ga0065704_10000778 3300005289 Bacteria 18558
21 Ga0065704_10009688 3300005289 Bacteria 3447
22 Ga0065704_10072252 3300005289 Bacteria 8859
23 Ga0065712_10008598 3300005290 Bacteria 6003
24 Ga0065715_10281495 3300005293 Bacteria 1074
25 Ga0070670_100000303 3300005331 Bacteria 42489
26 Ga0070661_100002107 3300005344 Bacteria 13699
27 Ga0070669_100030218 3300005353 Bacteria 3908
28 Ga0070662_100001726 3300005457 Bacteria 13449
29 Ga0070664_100002981 3300005564 Bacteria 13699
30 Ga0068854_100204646 3300005578 Bacteria 1554
31 Ga0068851_10000132 3300005834 Bacteria 40261
32 Ga0075432_10001039 3300006058 Bacteria 8837
33 Ga0075432_10008235 3300006058 Bacteria 3554
34 Ga0075432_10016885 3300006058 Bacteria 2491
35 Ga0075362_10012119 3300006177 Bacteria 3416
36 Ga0099823_1000001 3300006944 Bacteria 216833
37 Ga0079104_1000303 3300006946 Bacteria 62394
38 Ga0079104_1000554 3300006946 Bacteria 38699
39 Ga0105251_10000038 3300009011 Bacteria 116060
40 Ga0105251_10002494 3300009011 Bacteria 14402
41 Ga0105251_10010425 3300009011 Bacteria 5393
42 Ga0105251_10012550 3300009011 Bacteria 4789
43 Ga0105244_10000016 3300009036 Bacteria 255363
44 Ga0105244_10001524 3300009036 Bacteria 18507
45 Ga0105244_10004851 3300009036 Bacteria 9120
46 Ga0105244_10008586 3300009036 Bacteria 6370
47 Ga0105244_10014628 3300009036 Bacteria 4533
48 Ga0105244_10016545 3300009036 Bacteria 4199
49 Ga0105244_10084222 3300009036 Bacteria 1571
50 Ga0105244_10111564 3300009036 Bacteria 1330
51 Ga0105250_10000353 3300009092 Bacteria 35144
52 Ga0105250_10027363 3300009092 Bacteria 2298
53 Ga0105243_10014929 3300009148 Bacteria 5879
54 Ga0105243_10039721 3300009148 Bacteria 3670
55 Ga0105243_10054921 3300009148 Bacteria 3164
56 Ga0105242_10022928 3300009176 Bacteria 4917
57 Ga0105248_10712762 3300009177 Bacteria 1132
58 Ga0105237_10006234 3300009545 Bacteria 13284
59 Ga0105246_10047293 3300011119 Bacteria 2937
60 Ga0157373_10001148 3300013100 Bacteria 20279
61 Ga0157373_10006474 3300013100 Bacteria 8739
62 Ga0157373_10008114 3300013100 Bacteria 7806
63 Ga0157373_10086368 3300013100 Bacteria 2211
64 Ga0157371_10001502 3300013102 Bacteria 24121
65 Ga0157371_10001866 3300013102 Bacteria 21095
66 Ga0157371_10054590 3300013102 Bacteria 2837
67 Ga0157370_10001953 3300013104 Bacteria 25403
68 Ga0157370_10134614 3300013104 Bacteria 2304
69 Ga0157370_10135693 3300013104 Bacteria 2293
70 Ga0157369_10009531 3300013105 Bacteria 11103
71 Ga0157369_10011089 3300013105 Bacteria 10254
72 Ga0157369_10012461 3300013105 Bacteria 9646
73 Ga0163162_10421486 3300013306 Bacteria 1467
74 Ga0157372_10001218 3300013307 Bacteria 27843
75 Ga0157375_10188795 3300013308 Bacteria 2215
76 Ga0182008_10000604 3300014497 Bacteria 26387
77 Ga0182008_10007960 3300014497 Bacteria 5813
78 Ga0182008_10009829 3300014497 Bacteria 5143
79 Ga0182008_10040881 3300014497 Bacteria 2314
80 Ga0182006_1001202 3300015261 Bacteria 16166
81 Ga0182006_1003368 3300015261 Bacteria 8214
82 Ga0182006_1007155 3300015261 Bacteria 5130
83 Ga0182006_1061485 3300015261 Bacteria 1416
84 Ga0182007_10000071 3300015262 Bacteria 81966
85 Ga0182007_10001255 3300015262 Bacteria 13789
86 Ga0182007_10013309 3300015262 Bacteria 3141
87 Ga0182005_1000524 3300015265 Bacteria 19519
88 Ga0182005_1002580 3300015265 Bacteria 6418
89 Ga0182005_1017753 3300015265 Bacteria 1969
90 Ga0163161_10004705 3300017792 Bacteria 9493
91 Ga0163161_10006045 3300017792 Bacteria 8391
92 Ga0163161_10013164 3300017792 Bacteria 5751
93 Ga0163161_10040096 3300017792 Bacteria 3363
94 Ga0163161_10044526 3300017792 Bacteria 3197
95 Ga0163161_10075880 3300017792 Bacteria 2467
96 Ga0163161_10119533 3300017792 Bacteria 1979
97 Ga0209760_100033 3300025207 Bacteria 136583
98 Ga0207427_100003 3300025231 Bacteria 1035004
99 Ga0209437_100002 3300025233 Bacteria 1574801
100 Ga0209233_1000004 3300025261 Bacteria 1574798
101 Ga0209676_1000617 3300025292 Bacteria 51959
102 Ga0209676_1004064 3300025292 Bacteria 8411
103 Ga0209676_1008768 3300025292 Bacteria 4456
104 Ga0209050_1000013 3300025298 Bacteria 811408
105 Ga0209050_1000914 3300025298 Bacteria 38994
106 Ga0209051_1000007 3300025303 Bacteria 811408
107 Ga0209257_1011899 3300025304 Bacteria 4108
108 Ga0207656_10000287 3300025321 Bacteria 17443
109 Ga0207696_1000016 3300025711 Bacteria 502467
110 Ga0207696_1000108 3300025711 Bacteria 157445
111 Ga0207696_1024126 3300025711 Bacteria 1910
112 Ga0207655_1000027 3300025728 Bacteria 444552
113 Ga0207655_1000114 3300025728 Bacteria 164098
114 Ga0207655_1000384 3300025728 Bacteria 61818
115 Ga0207655_1002020 3300025728 Bacteria 17156
116 Ga0207655_1003059 3300025728 Bacteria 12750
117 Ga0207655_1022254 3300025728 Bacteria 3186
118 Ga0207713_1000185 3300025735 Bacteria 88697
119 Ga0207713_1001969 3300025735 Bacteria 15463
120 Ga0207713_1002029 3300025735 Bacteria 15167
121 Ga0207713_1006075 3300025735 Bacteria 7441
122 Ga0207713_1015292 3300025735 Bacteria 3946
123 Ga0207713_1032451 3300025735 Bacteria 2293
124 Ga0207671_10001354 3300025914 Bacteria 28611
125 Ga0207649_10000577 3300025920 Bacteria 25047
126 Ga0207681_10006717 3300025923 Bacteria 7059
127 Ga0207650_10000068 3300025925 Bacteria 139947
128 Ga0207706_10004228 3300025933 Bacteria 13524
129 Ga0207686_10046243 3300025934 Bacteria 2683
130 Ga0207709_10003872 3300025935 Bacteria 8757
131 Ga0207709_10013552 3300025935 Bacteria 4497
132 Ga0207709_10430934 3300025935 Bacteria 1015
133 Ga0207679_10001702 3300025945 Bacteria 13713
134 Ga0207640_10133741 3300025981 Bacteria 1797
135 Ga0209281_1000009 3300027111 Bacteria 771717
136 Ga0209281_1000063 3300027111 Bacteria 288465
137 Ga0209389_1000007 3300027296 Bacteria 227459
138 Ga0207428_10009356 3300027907 Bacteria 8791
139 Ga0207428_10052476 3300027907 Bacteria 3256
140 Ga0207428_10064906 3300027907 Bacteria 2882
141 Ga0207428_10142031 3300027907 Bacteria 1832
142 Ga0207428_10155921 3300027907 Bacteria 1737
143 Ga0207428_10256962 3300027907 Bacteria 1302
144 Ga0307408_100000018 3300031548 Bacteria 346872
145 Ga0307408_100014570 3300031548 Bacteria 5224
146 Ga0307408_100094845 3300031548 Bacteria 2260
147 Ga0307405_10000137 3300031731 Bacteria 28468
148 Ga0307405_10005300 3300031731 Bacteria 6201
149 Ga0307405_10074088 3300031731 Bacteria 2200
150 Ga0307405_10392857 3300031731 Bacteria 1083
151 Ga0307406_10183447 3300031901 Bacteria 1525
152 Ga0307406_10324395 3300031901 Bacteria 1192
153 Ga0307407_10208722 3300031903 Bacteria 1313
154 Ga0307412_10029725 3300031911 Bacteria 3431
155 Ga0307412_10115139 3300031911 Bacteria 1926
156 Ga0307416_100234527 3300032002 Bacteria 1772
157 Ga0307414_10052408 3300032004 Bacteria 2839
158 Ga0307414_10088530 3300032004 Bacteria 2291
159 Ga0307414_10193598 3300032004 Bacteria 1647
160 Ga0307411_10020277 3300032005 Bacteria 3862
161 Ga0307411_10075767 3300032005 Bacteria 2297
162 Ga0439438_003908 3300041405 Bacteria 5866
163 Ga0439438_004339 3300041405 Bacteria 5469
164 Ga0439438_005962 3300041405 Bacteria 4397
165 Ga0439438_013043 3300041405 Bacteria 2521
166 Ga0439438_017339 3300041405 Bacteria 2075
167 Ga0439447_003607 3300041407 Bacteria 5480
168 Ga0439447_004429 3300041407 Bacteria 4831
169 Ga0439447_009200 3300041407 Bacteria 3010
170 Ga0439447_015362 3300041407 Bacteria 2125
171 Ga0439466_0002538 3300041411 Bacteria 7147
172 Ga0439466_0004357 3300041411 Bacteria 5457
173 Ga0439466_0006691 3300041411 Bacteria 4373
174 Ga0439466_0009076 3300041411 Bacteria 3731
175 Ga0439466_0015463 3300041411 Bacteria 2771
176 Ga0439466_0030632 3300041411 Bacteria 1843
177 Ga0439465_0008365 3300041413 Bacteria 3266
178 Ga0439431_0002411 3300041997 Bacteria 4138
179 Ga0439432_000171 3300042006 Bacteria 22714
180 Ga0439432_007279 3300042006 Bacteria 3928
181 Ga0439432_010393 3300042006 Bacteria 3224
182 Ga0439432_013015 3300042006 Bacteria 2833
183 Ga0439451_010572 3300042009 Bacteria 1860
184 Ga0439451_016675 3300042009 Bacteria 1478
185 Ga0439451_036055 3300042009 Bacteria 994
186 Ga0439452_000677 3300042010 Bacteria 16790
187 Ga0439452_003056 3300042010 Bacteria 5950
188 Ga0439452_004545 3300042010 Bacteria 4632
189 Ga0439452_004693 3300042010 Bacteria 4528
190 Ga0439452_007797 3300042010 Bacteria 3251
191 Ga0439452_009314 3300042010 Bacteria 2898
192 Ga0439452_010565 3300042010 Bacteria 2679
193 Ga0439452_018732 3300042010 Bacteria 1840
194 Ga0439456_004218 3300042013 Bacteria 2913
195 Ga0439463_002247 3300042016 Bacteria 4955
196 Ga0439463_004592 3300042016 Bacteria 3458
197 Ga0450911_002259 3300042115 Bacteria 3866
198 Ga0450911_002820 3300042115 Bacteria 3269
199 Ga0450911_003118 3300042115 Bacteria 3013
200 Ga0450911_010864 3300042115 Bacteria 1252
201 Ga0450920_000960 3300042122 Bacteria 4700
202 Ga0450922_000360 3300042124 Bacteria 4853
203 Ga0450890_000606 3300042127 Bacteria 5233
204 Ga0450894_002753 3300042131 Bacteria 2331
205 Ga0450898_000712 3300042134 Bacteria 4031
206 Ga0450899_001487 3300042135 Bacteria 2619
207 Ga0450902_001289 3300042137 Bacteria 3386
208 Ga0450902_003671 3300042137 Bacteria 2254
209 Ga0450902_006821 3300042137 Bacteria 1755
210 Ga0450903_001686 3300042138 Bacteria 4084
211 Ga0450903_001697 3300042138 Bacteria 4061
212 Ga0450905_001436 3300042142 Bacteria 3043
213 Ga0450906_003228 3300042145 Bacteria 3519
214 Ga0450907_000140 3300042146 Bacteria 27596
215 Ga0450907_025237 3300042146 Bacteria 1005
216 Ga0450910_002522 3300042147 Bacteria 2405
217 Ga0450910_009742 3300042147 Bacteria 1361
218 Ga0439446_0028856 3300042156 Bacteria 1599
219 Ga0450908_001543 3300042184 Bacteria 4470
220 Ga0450908_005901 3300042184 Bacteria 2339
221 Ga0450909_002131 3300042185 Bacteria 2793
222 Ga0439434_0002427 3300042435 Bacteria 5421
223 Ga0439434_0004141 3300042435 Bacteria 4233
224 Ga0439464_0000443 3300042439 Bacteria 8221
225 Ga0439464_0016060 3300042439 Bacteria 2023
226 Ga0439460_0002498 3300042461 Bacteria 4439
227 Ga0439460_0005265 3300042461 Bacteria 3169
228 Ga0450901_002227 3300042533 Bacteria 2127
229 Ga0439440_0001299 3300042993 Bacteria 4530
230 Ga0439440_0012945 3300042993 Bacteria 1781
231 Ga0439440_0040919 3300042993 Bacteria 1129
232 Ga0451576_0000591 3300045051 Bacteria 76735
233 Ga0495617_000826 3300046452 Bacteria 14740
234 Ga0495617_005450 3300046452 Bacteria 4507
235 Ga0495617_007936 3300046452 Bacteria 3671
236 Ga0495617_008755 3300046452 Bacteria 3484
237 Ga0495617_009711 3300046452 Bacteria 3301
238 Ga0495617_065742 3300046452 Bacteria 1195
239 Ga0495627_005583 3300046453 Bacteria 5036
240 Ga0495603_0004426 3300046455 Bacteria 8375
241 Ga0495603_0036666 3300046455 Bacteria 2943
242 Ga0495590_0002605 3300046457 Bacteria 7455
243 Ga0495590_0006559 3300046457 Bacteria 4539
244 Ga0495590_0025540 3300046457 Bacteria 2077
245 Ga0495590_0070917 3300046457 Bacteria 1222
246 Ga0495591_000174 3300046458 Bacteria 66422
247 Ga0495591_000697 3300046458 Bacteria 24507
248 Ga0495591_000809 3300046458 Bacteria 22141
249 Ga0495591_001735 3300046458 Bacteria 12988
250 Ga0495591_008718 3300046458 Bacteria 4121
251 Ga0495591_015979 3300046458 Bacteria 2631
252 Ga0495591_031472 3300046458 Bacteria 1591
253 Ga0495629_0093107 3300046459 Bacteria 2103
254 Ga0495638_0003448 3300046460 Bacteria 12455
255 Ga0495638_0011837 3300046460 Bacteria 6001
256 Ga0495638_0021838 3300046460 Bacteria 4207
257 Ga0495638_0036107 3300046460 Bacteria 3149
258 Ga0495638_0058887 3300046460 Bacteria 2379
259 Ga0495638_0123132 3300046460 Bacteria 1530
260 Ga0495638_0223700 3300046460 Bacteria 1050
261 Ga0495653_0049230 3300046463 Bacteria 3247
262 Ga0495653_0288031 3300046463 Bacteria 1075
263 Ga0495650_0001051 3300046471 Bacteria 30683
264 Ga0495650_0002388 3300046471 Bacteria 15361
265 Ga0495650_0006072 3300046471 Bacteria 7624
266 Ga0495650_0008122 3300046471 Bacteria 6177
267 Ga0495650_0011840 3300046471 Bacteria 4735
268 Ga0495650_0031224 3300046471 Bacteria 2400
269 Ga0495580_0326583 3300046472 Bacteria 1042
270 Ga0495582_0015874 3300046473 Bacteria 4129
271 Ga0495605_0000076 3300046474 Bacteria 128699
272 Ga0495605_0001638 3300046474 Bacteria 14431
273 Ga0495605_0002121 3300046474 Bacteria 12413
274 Ga0495605_0002432 3300046474 Bacteria 11513
275 Ga0495605_0011566 3300046474 Bacteria 4915
276 Ga0495605_0017220 3300046474 Bacteria 3894
277 Ga0495605_0023402 3300046474 Bacteria 3249
278 Ga0495605_0036829 3300046474 Bacteria 2464
279 Ga0495639_0000563 3300046475 Bacteria 17303
280 Ga0495639_0007071 3300046475 Bacteria 4820
281 Ga0495639_0041389 3300046475 Bacteria 2075
282 Ga0495584_0001241 3300046491 Bacteria 15569
283 Ga0495584_0001301 3300046491 Bacteria 15186
284 Ga0495584_0002919 3300046491 Bacteria 9540
285 Ga0495584_0003118 3300046491 Bacteria 9206
286 Ga0495584_0004135 3300046491 Bacteria 7832
287 Ga0495584_0004362 3300046491 Bacteria 7619
288 Ga0495584_0007572 3300046491 Bacteria 5660
289 Ga0495584_0014709 3300046491 Bacteria 3987
290 Ga0495584_0151165 3300046491 Bacteria 1179
291 Ga0495585_0000545 3300046492 Bacteria 35585
292 Ga0495585_0024521 3300046492 Bacteria 3458
293 Ga0495585_0029212 3300046492 Bacteria 3139
294 Ga0495585_0042777 3300046492 Bacteria 2535
295 Ga0495585_0153079 3300046492 Bacteria 1201
296 Ga0495594_0089341 3300046499 Bacteria 1725
297 Ga0495607_0000799 3300046501 Bacteria 29847
298 Ga0495607_0002369 3300046501 Bacteria 15384
299 Ga0495607_0011916 3300046501 Bacteria 5760
300 Ga0495607_0021849 3300046501 Bacteria 4023
301 Ga0495607_0034393 3300046501 Bacteria 3074
302 Ga0495607_0039962 3300046501 Bacteria 2796
303 Ga0495607_0043919 3300046501 Bacteria 2639
304 Ga0495607_0063519 3300046501 Bacteria 2088
305 Ga0495607_0148839 3300046501 Bacteria 1200
306 Ga0495607_0176741 3300046501 Bacteria 1073
307 Ga0495583_0000172 3300046506 Bacteria 109791
308 Ga0495583_0000813 3300046506 Bacteria 38429
309 Ga0495583_0005099 3300046506 Bacteria 9057
310 Ga0495583_0008503 3300046506 Bacteria 6263
311 Ga0495583_0014007 3300046506 Bacteria 4442
312 Ga0495583_0044567 3300046506 Bacteria 2056
313 Ga0495606_0000028 3300046507 Bacteria 251032
314 Ga0495606_0000684 3300046507 Bacteria 52863
315 Ga0495606_0002075 3300046507 Bacteria 24486
316 Ga0495606_0003306 3300046507 Bacteria 17217
317 Ga0495606_0012296 3300046507 Bacteria 6884
318 Ga0495606_0065931 3300046507 Bacteria 2298
319 Ga0495610_0001089 3300046512 Bacteria 24852
320 Ga0495610_0004091 3300046512 Bacteria 10927
321 Ga0495610_0012001 3300046512 Bacteria 5249
322 Ga0495610_0012622 3300046512 Bacteria 5071
323 Ga0495610_0017558 3300046512 Bacteria 4076
324 Ga0495610_0020005 3300046512 Bacteria 3729
325 Ga0495610_0020231 3300046512 Bacteria 3700
326 Ga0495610_0054924 3300046512 Bacteria 1922
327 Ga0495610_0056084 3300046512 Bacteria 1896
328 Ga0495616_0017235 3300046513 Bacteria 3984
329 Ga0495616_0021128 3300046513 Bacteria 3529
330 Ga0495616_0025932 3300046513 Bacteria 3125
331 Ga0495616_0052285 3300046513 Bacteria 2034
332 Ga0495620_0000011 3300046515 Bacteria 170987
333 Ga0495620_0000314 3300046515 Bacteria 34524
334 Ga0495620_0004729 3300046515 Bacteria 7653
335 Ga0495620_0006281 3300046515 Bacteria 6539
336 Ga0495620_0015603 3300046515 Bacteria 3831
337 Ga0495620_0015924 3300046515 Bacteria 3785
338 Ga0495630_0026502 3300046517 Bacteria 4292
339 Ga0495630_0050454 3300046517 Bacteria 3114
340 Ga0495631_0000275 3300046518 Bacteria 35971
341 Ga0495631_0008361 3300046518 Bacteria 5215
342 Ga0495631_0015699 3300046518 Bacteria 3622
343 Ga0495631_0031460 3300046518 Bacteria 2400
344 Ga0495631_0072768 3300046518 Bacteria 1484
345 Ga0495632_0001446 3300046519 Bacteria 19737
346 Ga0495632_0001462 3300046519 Bacteria 19633
347 Ga0495632_0002289 3300046519 Bacteria 14750
348 Ga0495632_0017216 3300046519 Bacteria 3996
349 Ga0495632_0030936 3300046519 Bacteria 2773
350 Ga0495632_0031263 3300046519 Bacteria 2754
351 Ga0495632_0034581 3300046519 Bacteria 2585
352 Ga0495632_0159273 3300046519 Bacteria 1040
353 Ga0495637_0000027 3300046520 Bacteria 146241
354 Ga0495637_0001476 3300046520 Bacteria 13811
355 Ga0495637_0009577 3300046520 Bacteria 4722
356 Ga0495637_0014696 3300046520 Bacteria 3688
357 Ga0495637_0021018 3300046520 Bacteria 2994
358 Ga0495637_0046539 3300046520 Bacteria 1834
359 Ga0495637_0047143 3300046520 Bacteria 1820
360 Ga0495637_0058025 3300046520 Bacteria 1596
361 Ga0495643_0005300 3300046522 Bacteria 8753
362 Ga0495643_0005423 3300046522 Bacteria 8632
363 Ga0495643_0009526 3300046522 Bacteria 6032
364 Ga0495643_0011839 3300046522 Bacteria 5289
365 Ga0495643_0013261 3300046522 Bacteria 4939
366 Ga0495643_0051388 3300046522 Bacteria 2216
367 Ga0495643_0073857 3300046522 Bacteria 1786
368 Ga0495644_0007674 3300046523 Bacteria 4160
369 Ga0495644_0007800 3300046523 Bacteria 4125
370 Ga0495644_0008624 3300046523 Bacteria 3925
371 Ga0495644_0026710 3300046523 Bacteria 2189
372 Ga0495644_0061101 3300046523 Bacteria 1416
373 Ga0495648_0008539 3300046524 Bacteria 8045
374 Ga0495648_0012258 3300046524 Bacteria 6405
375 Ga0495648_0012950 3300046524 Bacteria 6194
376 Ga0495648_0014240 3300046524 Bacteria 5833
377 Ga0495648_0017267 3300046524 Bacteria 5167
378 Ga0495648_0026536 3300046524 Bacteria 3896
379 Ga0495648_0027428 3300046524 Bacteria 3812
380 Ga0495648_0027839 3300046524 Bacteria 3776
381 Ga0495648_0053570 3300046524 Bacteria 2443
382 Ga0495648_0062290 3300046524 Bacteria 2209
383 Ga0495648_0066672 3300046524 Bacteria 2109
384 Ga0495648_0089331 3300046524 Bacteria 1729
385 Ga0495648_0116059 3300046524 Bacteria 1447
386 Ga0495648_0134845 3300046524 Bacteria 1307
387 Ga0495666_0001581 3300046526 Bacteria 11205
388 Ga0495666_0013234 3300046526 Bacteria 4114
389 Ga0495666_0027206 3300046526 Bacteria 2816
390 Ga0495666_0040580 3300046526 Bacteria 2256
391 Ga0495666_0097428 3300046526 Bacteria 1386
392 Ga0495642_0000067 3300046528 Bacteria 61823
393 Ga0495642_0000334 3300046528 Bacteria 25618
394 Ga0495642_0017588 3300046528 Bacteria 2794
395 Ga0495654_0000658 3300046530 Bacteria 27234
396 Ga0495654_0001188 3300046530 Bacteria 18540
397 Ga0495654_0005001 3300046530 Bacteria 7787
398 Ga0495654_0015040 3300046530 Bacteria 4111
399 Ga0495654_0023658 3300046530 Bacteria 3180
400 Ga0495654_0029233 3300046530 Bacteria 2811
401 Ga0495654_0030989 3300046530 Bacteria 2716
402 Ga0495654_0032361 3300046530 Bacteria 2651
403 Ga0495654_0034513 3300046530 Bacteria 2551
404 Ga0495654_0046604 3300046530 Bacteria 2134
405 Ga0495654_0055750 3300046530 Bacteria 1912
406 Ga0495654_0074947 3300046530 Bacteria 1597
407 Ga0495586_0014791 3300046535 Bacteria 4148
408 Ga0495587_0030587 3300046536 Bacteria 3264
409 Ga0495609_0000206 3300046538 Bacteria 58720
410 Ga0495609_0006540 3300046538 Bacteria 5937
411 Ga0495609_0034354 3300046538 Bacteria 2299
412 Ga0495597_0007463 3300046542 Bacteria 5549
413 Ga0495597_0011774 3300046542 Bacteria 4236
414 Ga0495597_0055416 3300046542 Bacteria 1738
415 Ga0495597_0080126 3300046542 Bacteria 1397
416 Ga0495597_0090277 3300046542 Bacteria 1301
417 Ga0495645_0033668 3300046543 Bacteria 3738
418 Ga0495622_0000638 3300046557 Bacteria 20320
419 Ga0495622_0004006 3300046557 Bacteria 6876
420 Ga0495622_0005661 3300046557 Bacteria 5793
421 Ga0495622_0008757 3300046557 Bacteria 4688
422 Ga0495622_0015265 3300046557 Bacteria 3570
423 Ga0495622_0033067 3300046557 Bacteria 2414
424 Ga0495633_0023203 3300046558 Bacteria 3074
425 Ga0495633_0036921 3300046558 Bacteria 2339
426 Ga0495633_0038234 3300046558 Bacteria 2293
427 Ga0495656_0015464 3300046615 Bacteria 2880
428 Ga0495668_0003932 3300046616 Bacteria 10849
429 Ga0495668_0020336 3300046616 Bacteria 3819
430 Ga0495634_0004634 3300046642 Bacteria 10725
431 Ga0495634_0089760 3300046642 Bacteria 1997
432 Ga0495611_0004712 3300046648 Bacteria 5858
433 Ga0495611_0039564 3300046648 Bacteria 2099
434 Ga0495611_0201529 3300046648 Bacteria 928
435 Ga0495625_0000296 3300046660 Bacteria 77050
436 Ga0495625_0003091 3300046660 Bacteria 17000
437 Ga0495625_0020945 3300046660 Bacteria 5041
438 Ga0495625_0030847 3300046660 Bacteria 3994
439 Ga0495625_0036429 3300046660 Bacteria 3616
440 Ga0495625_0224082 3300046660 Bacteria 1230
441 Ga0495635_0001148 3300046663 Bacteria 17665
442 Ga0495659_0000598 3300046664 Bacteria 13341
443 Ga0495659_0004432 3300046664 Bacteria 4422
444 Ga0495659_0014043 3300046664 Bacteria 2615
445 Ga0495661_0000119 3300046665 Bacteria 94133
446 Ga0495661_0014902 3300046665 Bacteria 5198
447 Ga0495661_0016659 3300046665 Bacteria 4865
448 Ga0495661_0020600 3300046665 Bacteria 4303
449 Ga0495661_0039361 3300046665 Bacteria 2938
450 Ga0495661_0040715 3300046665 Bacteria 2879
451 Ga0495661_0064652 3300046665 Bacteria 2157
452 Ga0495588_0007905 3300046674 Bacteria 4859
453 Ga0495588_0104023 3300046674 Bacteria 1493
454 Ga0495657_0253755 3300046675 Bacteria 1058
455 Ga0495623_0004954 3300046679 Bacteria 8735
456 Ga0495623_0096825 3300046679 Bacteria 1802
457 Ga0495646_0018087 3300046680 Bacteria 4463
458 Ga0495669_0063712 3300046684 Bacteria 1672
459 Ga0495670_0004075 3300046691 Bacteria 7167
460 Ga0495670_0012001 3300046691 Bacteria 4264
461 Ga0495670_0024729 3300046691 Bacteria 2969
462 Ga0495670_0031010 3300046691 Bacteria 2655
463 Ga0495670_0032593 3300046691 Bacteria 2591
464 Ga0495670_0043503 3300046691 Bacteria 2241
465 Ga0495670_0063342 3300046691 Bacteria 1861
466 Ga0495670_0082414 3300046691 Bacteria 1640
467 Ga0495670_0162304 3300046691 Bacteria 1174
468 Ga0495671_0001916 3300046692 Bacteria 13352
469 Ga0495671_0002561 3300046692 Bacteria 11431
470 Ga0495671_0004284 3300046692 Bacteria 8574
471 Ga0495671_0009697 3300046692 Bacteria 5370
472 Ga0495671_0010657 3300046692 Bacteria 5085
473 Ga0495671_0018723 3300046692 Bacteria 3670
474 Ga0495671_0031902 3300046692 Bacteria 2691
475 Ga0495671_0033160 3300046692 Bacteria 2632
476 Ga0495671_0039221 3300046692 Bacteria 2392
477 Ga0495671_0090269 3300046692 Bacteria 1499
478 Ga0495671_0118828 3300046692 Bacteria 1290
479 Ga0495649_0002307 3300046694 Bacteria 13546
480 Ga0495649_0010671 3300046694 Bacteria 5409
481 Ga0495649_0015118 3300046694 Bacteria 4399
482 Ga0495649_0019652 3300046694 Bacteria 3794
483 Ga0495649_0022717 3300046694 Bacteria 3509
484 Ga0495649_0029786 3300046694 Bacteria 3016
485 Ga0495649_0033607 3300046694 Bacteria 2822
486 Ga0495649_0037245 3300046694 Bacteria 2670
487 Ga0495589_0000220 3300046794 Bacteria 48490
488 Ga0495589_0000931 3300046794 Bacteria 17965
489 Ga0495589_0003983 3300046794 Bacteria 7927
490 Ga0495589_0056847 3300046794 Bacteria 1925
491 Ga0495660_0002659 3300046810 Bacteria 11320
492 Ga0495660_0007182 3300046810 Bacteria 6561
493 Ga0495660_0012139 3300046810 Bacteria 4998
494 Ga0495660_0017838 3300046810 Bacteria 4083
495 Ga0495660_0018431 3300046810 Bacteria 4013
496 Ga0495660_0021115 3300046810 Bacteria 3731
497 Ga0495660_0043482 3300046810 Bacteria 2477
498 Ga0495660_0051552 3300046810 Bacteria 2238
499 Ga0495660_0127604 3300046810 Bacteria 1279
500 Ga0495660_0167537 3300046810 Bacteria 1072
501 Ga0495581_0003194 3300047315 Bacteria 9378
502 Ga0495581_0025995 3300047315 Bacteria 3395
503 Ga0495604_0010786 3300047317 Bacteria 7256
504 Ga0495636_0051151 3300047318 Bacteria 1731
505 Ga0495674_0028321 3300047319 Bacteria 5110
506 Ga0495672_0000553 3300047320 Bacteria 42512
507 Ga0495672_0008074 3300047320 Bacteria 7819
508 Ga0495672_0010919 3300047320 Bacteria 6441
509 Ga0495672_0012559 3300047320 Bacteria 5905
510 Ga0495672_0014257 3300047320 Bacteria 5451
511 Ga0495672_0017997 3300047320 Bacteria 4705
512 Ga0495672_0025140 3300047320 Bacteria 3819
513 Ga0495672_0029851 3300047320 Bacteria 3427
514 Ga0495672_0030038 3300047320 Bacteria 3414
515 Ga0495672_0036031 3300047320 Bacteria 3041
516 Ga0495672_0050232 3300047320 Bacteria 2463
517 Ga0495672_0058772 3300047320 Bacteria 2227
518 Ga0495672_0106168 3300047320 Bacteria 1514
519 Ga0495676_0000003 3300047321 Bacteria 318463
520 Ga0495680_0009996 3300047322 Bacteria 8491
521 Ga0495680_0026818 3300047322 Bacteria 4744
522 Ga0495680_0050829 3300047322 Bacteria 3239
523 Ga0495680_0054160 3300047322 Bacteria 3116
524 Ga0495683_0000382 3300047323 Bacteria 36179
525 Ga0495683_0000852 3300047323 Bacteria 21615
526 Ga0495683_0009550 3300047323 Bacteria 5167
527 Ga0495683_0011676 3300047323 Bacteria 4621
528 Ga0495683_0013000 3300047323 Bacteria 4360
529 Ga0495683_0016722 3300047323 Bacteria 3807
530 Ga0495683_0057577 3300047323 Bacteria 1931
531 Ga0495683_0106566 3300047323 Bacteria 1342
532 Ga0495687_004098 3300047443 Bacteria 10082
533 Ga0495687_004969 3300047443 Bacteria 8694
534 Ga0495687_007403 3300047443 Bacteria 6468
535 Ga0495687_053972 3300047443 Bacteria 1689
536 Ga0495675_0020419 3300047444 Bacteria 4212
537 Ga0495677_0000621 3300047445 Bacteria 14403
538 Ga0495679_001158 3300047446 Bacteria 15748
539 Ga0495679_003272 3300047446 Bacteria 7848
540 Ga0495679_009848 3300047446 Bacteria 3792
541 Ga0495685_012289 3300047447 Bacteria 2899
542 Ga0495673_0000602 3300047469 Bacteria 35831
543 Ga0495673_0000782 3300047469 Bacteria 30047
544 Ga0495673_0002393 3300047469 Bacteria 13258
545 Ga0495673_0003440 3300047469 Bacteria 10422
546 Ga0495673_0010563 3300047469 Bacteria 5011
547 Ga0495673_0016804 3300047469 Bacteria 3730
548 Ga0495673_0029565 3300047469 Bacteria 2584
549 Ga0495673_0035647 3300047469 Bacteria 2289
550 Ga0495673_0038941 3300047469 Bacteria 2159
551 Ga0495673_0052623 3300047469 Bacteria 1778
552 Ga0495681_0005092 3300047470 Bacteria 8861
553 Ga0495681_0007269 3300047470 Bacteria 7114
554 Ga0495681_0009412 3300047470 Bacteria 6022
555 Ga0495681_0010033 3300047470 Bacteria 5766
556 Ga0495681_0011556 3300047470 Bacteria 5249
557 Ga0495681_0012260 3300047470 Bacteria 5049
558 Ga0495681_0014950 3300047470 Bacteria 4421
559 Ga0495681_0017403 3300047470 Bacteria 3990
560 Ga0495681_0023982 3300047470 Bacteria 3225
561 Ga0495681_0027234 3300047470 Bacteria 2960
562 Ga0495681_0033300 3300047470 Bacteria 2583
563 Ga0495684_0035996 3300047471 Bacteria 3796
564 Ga0495686_0010813 3300047472 Bacteria 6469
565 Ga0495686_0047400 3300047472 Bacteria 2713
566 Ga0495593_0008220 3300047673 Bacteria 6070
567 Ga0495593_0023197 3300047673 Bacteria 3451
568 Ga0495614_0036271 3300048089 Bacteria 2117
569 Ga0495626_0000086 3300048091 Bacteria 123059
570 Ga0495626_0001191 3300048091 Bacteria 21581
571 Ga0495626_0001541 3300048091 Bacteria 18097
572 Ga0495626_0002350 3300048091 Bacteria 13316
573 Ga0495626_0005638 3300048091 Bacteria 7252
574 Ga0495626_0005927 3300048091 Bacteria 7037
575 Ga0495626_0099461 3300048091 Bacteria 1269
576 Ga0496102_0000073 3300048905 Bacteria 149887
577 Ga0496102_0055901 3300048905 Bacteria 3599
578 Ga0496103_0051494 3300048906 Bacteria 2549
579 Ga0496104_0409534 3300048907 Bacteria 1268
580 Ga0496110_0150873 3300048913 Bacteria 2105
581 Ga0496110_0215226 3300048913 Bacteria 1747
582 Ga0496111_0159412 3300048914 Bacteria 1675
583 Ga0496111_0334201 3300048914 Bacteria 1122
584 Ga0496114_0102327 3300048917 Bacteria 2447
585 Ga0496115_0021197 3300048918 Bacteria 5018
586 Ga0496116_0000995 3300048919 Bacteria 34718
587 Ga0496116_0015721 3300048919 Bacteria 5965
588 Ga0496117_0013130 3300048920 Bacteria 7250
589 Ga0496117_0014592 3300048920 Bacteria 6759
590 Ga0496117_0022977 3300048920 Bacteria 4987
591 Ga0496117_0024212 3300048920 Bacteria 4809
592 Ga0496117_0024679 3300048920 Bacteria 4745
593 Ga0496117_0025585 3300048920 Bacteria 4637
594 Ga0496117_0044827 3300048920 Bacteria 3200
595 Ga0496117_0103369 3300048920 Bacteria 1795
596 Ga0496117_0200285 3300048920 Bacteria 1129
597 Ga0496118_0020357 3300048921 Bacteria 5884
598 Ga0496118_0022302 3300048921 Bacteria 5542
599 Ga0496118_0023787 3300048921 Bacteria 5308
600 Ga0496118_0025532 3300048921 Bacteria 5061
601 Ga0496118_0031708 3300048921 Bacteria 4374
602 Ga0496118_0044031 3300048921 Bacteria 3499
603 Ga0496118_0052541 3300048921 Bacteria 3106
604 Ga0496118_0054404 3300048921 Bacteria 3032
605 Ga0496118_0083386 3300048921 Bacteria 2235
606 Ga0496118_0112752 3300048921 Bacteria 1799
607 Ga0496118_0117878 3300048921 Bacteria 1740
608 Ga0496119_0002172 3300048922 Bacteria 22016
609 Ga0496119_0007243 3300048922 Bacteria 10040
610 Ga0496120_0002014 3300048923 Bacteria 22111
611 Ga0496120_0005044 3300048923 Bacteria 10703
612 Ga0496120_0146785 3300048923 Bacteria 1190
613 Ga0496121_0001663 3300048924 Bacteria 36677
614 Ga0496121_0005421 3300048924 Bacteria 16376
615 Ga0496121_0026738 3300048924 Bacteria 5422
616 Ga0496121_0028037 3300048924 Bacteria 5252
617 Ga0496121_0030367 3300048924 Bacteria 4964
618 Ga0496121_0094563 3300048924 Bacteria 2324
619 Ga0496121_0175145 3300048924 Bacteria 1554
620 Ga0496121_0191632 3300048924 Bacteria 1465
621 Ga0496121_0358548 3300048924 Bacteria 969
622 Ga0496122_0000244 3300048925 Bacteria 122107
623 Ga0496122_0005970 3300048925 Bacteria 14253
624 Ga0496122_0019091 3300048925 Bacteria 6285
625 Ga0496122_0028352 3300048925 Bacteria 4754
626 Ga0496122_0032031 3300048925 Bacteria 4357
627 Ga0496122_0040945 3300048925 Bacteria 3672
628 Ga0496122_0045809 3300048925 Bacteria 3394
629 Ga0496122_0135941 3300048925 Bacteria 1549
630 Ga0496123_0000201 3300048926 Bacteria 121915
631 Ga0496123_0011426 3300048926 Bacteria 7696
632 Ga0496123_0013135 3300048926 Bacteria 6983
633 Ga0496123_0024807 3300048926 Bacteria 4542
634 Ga0496123_0039495 3300048926 Bacteria 3300
635 Ga0496123_0050969 3300048926 Bacteria 2761
636 Ga0496123_0152347 3300048926 Bacteria 1245
637 Ga0496124_0003104 3300048927 Bacteria 20627
638 Ga0496124_0018543 3300048927 Bacteria 6514
639 Ga0496124_0019143 3300048927 Bacteria 6387
640 Ga0496124_0029065 3300048927 Bacteria 4932
641 Ga0496124_0029690 3300048927 Bacteria 4864
642 Ga0496124_0038621 3300048927 Bacteria 4144
643 Ga0496124_0051265 3300048927 Bacteria 3512
644 Ga0496124_0087049 3300048927 Bacteria 2555
645 Ga0496124_0094458 3300048927 Bacteria 2432
646 Ga0496124_0114604 3300048927 Bacteria 2164
647 Ga0496125_0000862 3300048928 Bacteria 48602
648 Ga0496125_0024867 3300048928 Bacteria 5496
649 Ga0496125_0024937 3300048928 Bacteria 5488
650 Ga0496125_0024954 3300048928 Bacteria 5485
651 Ga0496125_0039292 3300048928 Bacteria 4077
652 Ga0496125_0042139 3300048928 Bacteria 3893
653 Ga0496125_0065178 3300048928 Bacteria 2888
654 Ga0496125_0101603 3300048928 Bacteria 2115
655 Ga0496126_0004738 3300048929 Bacteria 16040
656 Ga0496126_0033523 3300048929 Bacteria 4830
657 Ga0496126_0145215 3300048929 Bacteria 2038
658 Ga0495678_008440 3300049459 Bacteria 5195
659 Ga0495678_008505 3300049459 Bacteria 5169
660 Ga0495678_009902 3300049459 Bacteria 4672
661 Ga0495678_013485 3300049459 Bacteria 3837
662 Ga0495678_021785 3300049459 Bacteria 2815
663 Ga0495678_046866 3300049459 Bacteria 1696
664 Ga0495678_061761 3300049459 Bacteria 1404
665 Ga0495678_064843 3300049459 Bacteria 1358
666 Ga0495682_0000138 3300049460 Bacteria 63246
667 Ga0495682_0004702 3300049460 Bacteria 5780
668 Ga0495682_0018407 3300049460 Bacteria 2630
669 Ga0495682_0023955 3300049460 Bacteria 2278
670 Ga0495682_0035889 3300049460 Bacteria 1825
671 Ga0501032_0010934 3300049569 Bacteria 6526
672 Ga0501034_0000003 3300049571 Bacteria 471748
673 Ga0501034_0235891 3300049571 Bacteria 1777
674 Ga0501034_0428665 3300049571 Bacteria 1243
675 Ga0501037_0234027 3300049573 Bacteria 1289
676 Ga0501226_000017 3300049853 Bacteria 150879
677 nmdc:mga00v17_69450_c1 3300050491 Bacteria 2180
678 nmdc:mga00v17_78588_c1 3300050491 Bacteria 2056
679 Ga0500659_0063600 3300053135 Bacteria 1966
680 2511258060 2511231004 Bacteria 6669789
681 2511271543 2511231007 Bacteria 6306603
682 2511302942 2511231012 Bacteria 6738011
683 2511322862 2511231015 Bacteria 6598026
684 2511329322 2511231016 Bacteria 6704427
685 2511331381 2511231017 Bacteria 6503007
686 2511336178 2511231018 Bacteria 6436256
687 2511342237 2511231019 Bacteria 6520662
688 2511354953 2511231021 Bacteria 7302637
689 2511362726 2511231022 Bacteria 6719296
690 2511824964 2511231156 Bacteria 6845832
691 2555669224 2554235341 Bacteria 6867980
692 2599357878 2599185160 Bacteria 6844013
693 2599361631 2599185161 Bacteria 6960462
694 2599367953 2599185162 Bacteria 6957254
695 2599374742 2599185163 Bacteria 6995158
696 2599383043 2599185164 Bacteria 6841688
697 2599389574 2599185165 Bacteria 6843250
698 2599393600 2599185166 Bacteria 6959206
699 2599397862 2599185167 Bacteria 6353609
700 2599405367 2599185168 Bacteria 6997636
701 2599452309 2599185179 Bacteria 6611171
702 2599464694 2599185181 Bacteria 6844519
703 2599468244 2599185182 Bacteria 6883168
704 2599493717 2599185186 Bacteria 6831633
705 2599502315 2599185188 Bacteria 6164180
706 2599513312 2599185190 Bacteria 6285678
707 2599518188 2599185191 Bacteria 6297582
708 2599612842 2599185212 Bacteria 6765997
709 2599769044 2599185248 Bacteria 6696816
710 2599877985 2599185288 Bacteria 6666191
711 2599884843 2599185289 Bacteria 6778765
712 2599891988 2599185290 Bacteria 6289611
713 2599895979 2599185291 Bacteria 6775623
714 2599932623 2599185300 Bacteria 6062622
715 2599943375 2599185302 Bacteria 5954930
716 2599952207 2599185303 Bacteria 6512725
717 2599954486 2599185304 Bacteria 5951361
718 2599957864 2599185305 Bacteria 6748700
719 2599966787 2599185306 Bacteria 6637356
720 2599970390 2599185307 Bacteria 6194719
721 2599978066 2599185308 Bacteria 6621546
722 2599983799 2599185309 Bacteria 5969593
723 2599988695 2599185310 Bacteria 6014457
724 2599993354 2599185311 Bacteria 6354990
725 2600001401 2599185312 Bacteria 5912071
726 2600004039 2599185313 Bacteria 6658188
727 2600012207 2599185314 Bacteria 6621749
728 2600015587 2599185315 Bacteria 6771107
729 2600021941 2599185316 Bacteria 6320029
730 2600028546 2599185317 Bacteria 6435722
731 2600037538 2599185318 Bacteria 6961590
732 2600042867 2599185319 Bacteria 6637840
733 2600048604 2599185320 Bacteria 5963263
734 2600050795 2599185321 Bacteria 6764560
735 2600060077 2599185322 Bacteria 6763055
736 2600063298 2599185323 Bacteria 6688755
737 2600072673 2599185324 Bacteria 6590677
738 2600075215 2599185325 Bacteria 6324919
739 2600217416 2599185356 Bacteria 6843884
740 2600357713 2600254930 Bacteria 6431253
741 2600365632 2600254931 Bacteria 6734225
742 2600446630 2600254954 Bacteria 5100516
743 2601777586 2600255313 Bacteria 6842543
744 2602010829 2600255389 Bacteria 5275336
745 2621298795 2619619299 Bacteria 6649820
746 2624492660 2623620446 Bacteria 6500345
747 2643841653 2643221565 Bacteria 6216018
748 2643956968 2643221589 Bacteria 6250934
749 2644024891 2643221602 Bacteria 6249926
750 2644186760 2643221633 Bacteria 6733554
751 2644283938 2643221650 Bacteria 7029547
752 2652544946 2651869719 Bacteria 6047974
753 2671088671 2667528170 Bacteria 6786960
754 2671098273 2667528171 Bacteria 6900659
755 2671126289 2667528176 Bacteria 6724917
756 2677900729 2675903420 Bacteria 6247433
757 2678263601 2675903515 Bacteria 6580491
758 2729145489 2728369097 Bacteria 4333476
759 2738672044 2738541265 Bacteria 6594665
760 2738750437 2738541282 Bacteria 6593925
761 2738810032 2738541294 Bacteria 6925949
762 2738859478 2738541303 Bacteria 6591772
763 2738897392 2738541309 Bacteria 6926455
764 2739197683 2738543004 Bacteria 6381073
765 2739258597 2738543015 Bacteria 6750701
766 2739286375 2738543020 Bacteria 5718238
767 2739291688 2738543021 Bacteria 5718241
768 2745009932 2744054620 Bacteria 6551379
769 2774123241 2773857670 Bacteria 6407454
770 2784315765 2784132072 Bacteria 6596533
771 2794594850 2791355520 Bacteria 5948615
772 2808856270 2808606361 Bacteria 6136259
773 2808924710 2808606376 Bacteria 6248667
774 2808932978 2808606377 Bacteria 6646337
775 2808938991 2808606378 Bacteria 6177535
776 2808943241 2808606379 Bacteria 5022697
777 2808946708 2808606380 Bacteria 6248705
778 2808955123 2808606381 Bacteria 6646461
779 2808958309 2808606382 Bacteria 6841132
780 2808964762 2808606383 Bacteria 6138645
781 2808977000 2808606385 Bacteria 6711065
782 2808992155 2808606388 Bacteria 6706662
783 2809002100 2808606389 Bacteria 6138126
784 2812368046 2811994881 Bacteria 6298475
785 2817492044 2816332298 Bacteria 6852809
786 2819703344 2818991464 Bacteria 6907494
787 2823423410 2823421272 Bacteria 5372474
788 2825651975 2825651385 Bacteria 6715909
789 2834032858 2834028612 Bacteria 6354979
790 2842858150 2842854478 Bacteria 6143501
791 2844669659 2844665904 Bacteria 6817974
792 2852613666 2852612431 Bacteria 6885235
793 2852668598 2852667396 Bacteria 6885555
794 2860342340 2860339153 Bacteria 6846989
795 2904550568 2904550169 Bacteria 6221258
796 2913039677 2913036834 Bacteria 6704877
797 2917073027 2917070673 Bacteria 6868303
798 2919156765 2919155634 Bacteria 4860545
799 2919459020 2919456309 Bacteria 6586567
800 2919484767 2919481497 Bacteria 6907839
801 2919505220 2919501602 Bacteria 5286340
802 2919702646 2919697872 Bacteria 6553725
803 2923522098 2923519811 Bacteria 6298479
804 2923588446 2923586266 Bacteria 6565975
805 2926066897 2926063275 Bacteria 5285848
806 2929147582 2929144301 Bacteria 6622272
807 2931375147 2931369376 Bacteria 6847892
808 2931394537 2931390751 Bacteria 6273349
809 2931402423 2931396565 Bacteria 7251677
810 2935359443 2935353572 Unclassified 6955622
811 2939638499 2939636861 Bacteria 6297853
812 2945934226 2945928738 Bacteria 6053221
813 2988728860 2988728565 Bacteria 6124362
814 3007514619 3007511990 Bacteria 6481491
815 3007808261 3007803356 Bacteria 5931491
816 3007869135 3007866637 Bacteria 5899198
817 637319559 637000220 Bacteria 7074893
818 639788133 639633007 Bacteria 4376040
819 640488211 640427133 Bacteria 4567418
820 651176165 651053060 Bacteria 4689946
821 8011354595 8011350971 Bacteria 6158957
822 8019775663 8019769354 Bacteria 6924660
823 8019781052 8019775933 Bacteria 6858656
824 8034963697 8034962539 Bacteria 4884839
825 8052497779 8052494512 Bacteria 5765634
826 8054507050 8054503363 Bacteria 6101651
827 8055820115 8055817908 Bacteria 6609162
828 8055883312 8055878733 Bacteria 5907058
829 8056129298 8056125926 Bacteria 6228218
830 8056135481 8056131705 Bacteria 6107031
831 8056146203 8056143049 Bacteria 6307666
832 8056157623 8056155041 Bacteria 6486948
833 8056165253 8056161164 Bacteria 6106669
834 8057799663 8057798959 Bacteria 6713499
835 Ga0453684_0246669
836 MRS2a_Contig_5158
837 SwRhRL2b_contig_1319436
838 JGI25162J39368_1000050
839 JGI25163J39215_1000351
840 JGI25164J39214_1000025
841 JGI25165J46597_1000114
842 JGI25165J46597_1000176
843 Ga0055530_10000075
844 Ga0055530_10032368
845 Ga0055540_1000115
846 Ga0065714_10000744
847 Ga0065714_10002340
848 Ga0065714_10006336
849 Ga0065714_10029782
850 Ga0065714_10074007
851 Ga0065714_10083749
852 Ga0065714_10092038
853 Ga0065714_10092661
854 Ga0065704_10000778
855 Ga0065704_10009688
856 Ga0065704_10072252
857 Ga0065712_10008598
858 Ga0065715_10281495
859 Ga0070670_100000303
860 Ga0070661_100002107
861 Ga0070669_100030218
862 Ga0070662_100001726
863 Ga0070664_100002981
864 Ga0068854_100204646
865 Ga0068851_10000132
866 Ga0075432_10001039
867 Ga0075432_10008235
868 Ga0075432_10016885
869 Ga0075362_10012119
870 Ga0099823_1000001
871 Ga0079104_1000303
872 Ga0079104_1000554
873 Ga0105251_10000038
874 Ga0105251_10002494
875 Ga0105251_10010425
876 Ga0105251_10012550
877 Ga0105244_10000016
878 Ga0105244_10001524
879 Ga0105244_10004851
880 Ga0105244_10008586
881 Ga0105244_10014628
882 Ga0105244_10016545
883 Ga0105244_10084222
884 Ga0105244_10111564
885 Ga0105250_10000353
886 Ga0105250_10027363
887 Ga0105243_10014929
888 Ga0105243_10039721
889 Ga0105243_10054921
890 Ga0105242_10022928
891 Ga0105248_10712762
892 Ga0105237_10006234
893 Ga0105246_10047293
894 Ga0157373_10001148
895 Ga0157373_10006474
896 Ga0157373_10008114
897 Ga0157373_10086368
898 Ga0157371_10001502
899 Ga0157371_10001866
900 Ga0157371_10054590
901 Ga0157370_10001953
902 Ga0157370_10134614
903 Ga0157370_10135693
904 Ga0157369_10009531
905 Ga0157369_10011089
906 Ga0157369_10012461
907 Ga0163162_10421486
908 Ga0157372_10001218
909 Ga0157375_10188795
910 Ga0182008_10000604
911 Ga0182008_10007960
912 Ga0182008_10009829
913 Ga0182008_10040881
914 Ga0182006_1001202
915 Ga0182006_1003368
916 Ga0182006_1007155
917 Ga0182006_1061485
918 Ga0182007_10000071
919 Ga0182007_10001255
920 Ga0182007_10013309
921 Ga0182005_1000524
922 Ga0182005_1002580
923 Ga0182005_1017753
924 Ga0163161_10004705
925 Ga0163161_10006045
926 Ga0163161_10013164
927 Ga0163161_10040096
928 Ga0163161_10044526
929 Ga0163161_10075880
930 Ga0163161_10119533
931 Ga0209760_100033
932 Ga0207427_100003
933 Ga0209437_100002
934 Ga0209233_1000004
935 Ga0209676_1000617
936 Ga0209676_1004064
937 Ga0209676_1008768
938 Ga0209050_1000013
939 Ga0209050_1000914
940 Ga0209051_1000007
941 Ga0209257_1011899
942 Ga0207656_10000287
943 Ga0207696_1000016
944 Ga0207696_1000108
945 Ga0207696_1024126
946 Ga0207655_1000027
947 Ga0207655_1000114
948 Ga0207655_1000384
949 Ga0207655_1002020
950 Ga0207655_1003059
951 Ga0207655_1022254
952 Ga0207713_1000185
953 Ga0207713_1001969
954 Ga0207713_1002029
955 Ga0207713_1006075
956 Ga0207713_1015292
957 Ga0207713_1032451
958 Ga0207671_10001354
959 Ga0207649_10000577
960 Ga0207681_10006717
961 Ga0207650_10000068
962 Ga0207706_10004228
963 Ga0207686_10046243
964 Ga0207709_10003872
965 Ga0207709_10013552
966 Ga0207709_10430934
967 Ga0207679_10001702
968 Ga0207640_10133741
969 Ga0209281_1000009
970 Ga0209281_1000063
971 Ga0209389_1000007
972 Ga0207428_10009356
973 Ga0207428_10052476
974 Ga0207428_10064906
975 Ga0207428_10142031
976 Ga0207428_10155921
977 Ga0207428_10256962
978 Ga0307408_100000018
979 Ga0307408_100014570
980 Ga0307408_100094845
981 Ga0307405_10000137
982 Ga0307405_10005300
983 Ga0307405_10074088
984 Ga0307405_10392857
985 Ga0307406_10183447
986 Ga0307406_10324395
987 Ga0307407_10208722
988 Ga0307412_10029725
989 Ga0307412_10115139
990 Ga0307416_100234527
991 Ga0307414_10052408
992 Ga0307414_10088530
993 Ga0307414_10193598
994 Ga0307411_10020277
995 Ga0307411_10075767
996 Ga0439438_003908
997 Ga0439438_004339
998 Ga0439438_005962
999 Ga0439438_013043
1000 Ga0439438_017339
1001 Ga0439447_003607
1002 Ga0439447_004429
1003 Ga0439447_009200
1004 Ga0439447_015362
1005 Ga0439466_0002538
1006 Ga0439466_0004357
1007 Ga0439466_0006691
1008 Ga0439466_0009076
1009 Ga0439466_0015463
1010 Ga0439466_0030632
1011 Ga0439465_0008365
1012 Ga0439431_0002411
1013 Ga0439432_000171
1014 Ga0439432_007279
1015 Ga0439432_010393
1016 Ga0439432_013015
1017 Ga0439451_010572
1018 Ga0439451_016675
1019 Ga0439451_036055
1020 Ga0439452_000677
1021 Ga0439452_003056
1022 Ga0439452_004545
1023 Ga0439452_004693
1024 Ga0439452_007797
1025 Ga0439452_009314
1026 Ga0439452_010565
1027 Ga0439452_018732
1028 Ga0439456_004218
1029 Ga0439463_002247
1030 Ga0439463_004592
1031 Ga0450911_002259
1032 Ga0450911_002820
1033 Ga0450911_003118
1034 Ga0450911_010864
1035 Ga0450920_000960
1036 Ga0450922_000360
1037 Ga0450890_000606
1038 Ga0450894_002753
1039 Ga0450898_000712
1040 Ga0450899_001487
1041 Ga0450902_001289
1042 Ga0450902_003671
1043 Ga0450902_006821
1044 Ga0450903_001686
1045 Ga0450903_001697
1046 Ga0450905_001436
1047 Ga0450906_003228
1048 Ga0450907_000140
1049 Ga0450907_025237
1050 Ga0450910_002522
1051 Ga0450910_009742
1052 Ga0439446_0028856
1053 Ga0450908_001543
1054 Ga0450908_005901
1055 Ga0450909_002131
1056 Ga0439434_0002427
1057 Ga0439434_0004141
1058 Ga0439464_0000443
1059 Ga0439464_0016060
1060 Ga0439460_0002498
1061 Ga0439460_0005265
1062 Ga0450901_002227
1063 Ga0439440_0001299
1064 Ga0439440_0012945
1065 Ga0439440_0040919
1066 Ga0451576_0000591
1067 Ga0495617_000826
1068 Ga0495617_005450
1069 Ga0495617_007936
1070 Ga0495617_008755
1071 Ga0495617_009711
1072 Ga0495617_065742
1073 Ga0495627_005583
1074 Ga0495603_0004426
1075 Ga0495603_0036666
1076 Ga0495590_0002605
1077 Ga0495590_0006559
1078 Ga0495590_0025540
1079 Ga0495590_0070917
1080 Ga0495591_000174
1081 Ga0495591_000697
1082 Ga0495591_000809
1083 Ga0495591_001735
1084 Ga0495591_008718
1085 Ga0495591_015979
1086 Ga0495591_031472
1087 Ga0495629_0093107
1088 Ga0495638_0003448
1089 Ga0495638_0011837
1090 Ga0495638_0021838
1091 Ga0495638_0036107
1092 Ga0495638_0058887
1093 Ga0495638_0123132
1094 Ga0495638_0223700
1095 Ga0495653_0049230
1096 Ga0495653_0288031
1097 Ga0495650_0001051
1098 Ga0495650_0002388
1099 Ga0495650_0006072
1100 Ga0495650_0008122
1101 Ga0495650_0011840
1102 Ga0495650_0031224
1103 Ga0495580_0326583
1104 Ga0495582_0015874
1105 Ga0495605_0000076
1106 Ga0495605_0001638
1107 Ga0495605_0002121
1108 Ga0495605_0002432
1109 Ga0495605_0011566
1110 Ga0495605_0017220
1111 Ga0495605_0023402
1112 Ga0495605_0036829
1113 Ga0495639_0000563
1114 Ga0495639_0007071
1115 Ga0495639_0041389
1116 Ga0495584_0001241
1117 Ga0495584_0001301
1118 Ga0495584_0002919
1119 Ga0495584_0003118
1120 Ga0495584_0004135
1121 Ga0495584_0004362
1122 Ga0495584_0007572
1123 Ga0495584_0014709
1124 Ga0495584_0151165
1125 Ga0495585_0000545
1126 Ga0495585_0024521
1127 Ga0495585_0029212
1128 Ga0495585_0042777
1129 Ga0495585_0153079
1130 Ga0495594_0089341
1131 Ga0495607_0000799
1132 Ga0495607_0002369
1133 Ga0495607_0011916
1134 Ga0495607_0021849
1135 Ga0495607_0034393
1136 Ga0495607_0039962
1137 Ga0495607_0043919
1138 Ga0495607_0063519
1139 Ga0495607_0148839
1140 Ga0495607_0176741
1141 Ga0495583_0000172
1142 Ga0495583_0000813
1143 Ga0495583_0005099
1144 Ga0495583_0008503
1145 Ga0495583_0014007
1146 Ga0495583_0044567
1147 Ga0495606_0000028
1148 Ga0495606_0000684
1149 Ga0495606_0002075
1150 Ga0495606_0003306
1151 Ga0495606_0012296
1152 Ga0495606_0065931
1153 Ga0495610_0001089
1154 Ga0495610_0004091
1155 Ga0495610_0012001
1156 Ga0495610_0012622
1157 Ga0495610_0017558
1158 Ga0495610_0020005
1159 Ga0495610_0020231
1160 Ga0495610_0054924
1161 Ga0495610_0056084
1162 Ga0495616_0017235
1163 Ga0495616_0021128
1164 Ga0495616_0025932
1165 Ga0495616_0052285
1166 Ga0495620_0000011
1167 Ga0495620_0000314
1168 Ga0495620_0004729
1169 Ga0495620_0006281
1170 Ga0495620_0015603
1171 Ga0495620_0015924
1172 Ga0495630_0026502
1173 Ga0495630_0050454
1174 Ga0495631_0000275
1175 Ga0495631_0008361
1176 Ga0495631_0015699
1177 Ga0495631_0031460
1178 Ga0495631_0072768
1179 Ga0495632_0001446
1180 Ga0495632_0001462
1181 Ga0495632_0002289
1182 Ga0495632_0017216
1183 Ga0495632_0030936
1184 Ga0495632_0031263
1185 Ga0495632_0034581
1186 Ga0495632_0159273
1187 Ga0495637_0000027
1188 Ga0495637_0001476
1189 Ga0495637_0009577
1190 Ga0495637_0014696
1191 Ga0495637_0021018
1192 Ga0495637_0046539
1193 Ga0495637_0047143
1194 Ga0495637_0058025
1195 Ga0495643_0005300
1196 Ga0495643_0005423
1197 Ga0495643_0009526
1198 Ga0495643_0011839
1199 Ga0495643_0013261
1200 Ga0495643_0051388
1201 Ga0495643_0073857
1202 Ga0495644_0007674
1203 Ga0495644_0007800
1204 Ga0495644_0008624
1205 Ga0495644_0026710
1206 Ga0495644_0061101
1207 Ga0495648_0008539
1208 Ga0495648_0012258
1209 Ga0495648_0012950
1210 Ga0495648_0014240
1211 Ga0495648_0017267
1212 Ga0495648_0026536
1213 Ga0495648_0027428
1214 Ga0495648_0027839
1215 Ga0495648_0053570
1216 Ga0495648_0062290
1217 Ga0495648_0066672
1218 Ga0495648_0089331
1219 Ga0495648_0116059
1220 Ga0495648_0134845
1221 Ga0495666_0001581
1222 Ga0495666_0013234
1223 Ga0495666_0027206
1224 Ga0495666_0040580
1225 Ga0495666_0097428
1226 Ga0495642_0000067
1227 Ga0495642_0000334
1228 Ga0495642_0017588
1229 Ga0495654_0000658
1230 Ga0495654_0001188
1231 Ga0495654_0005001
1232 Ga0495654_0015040
1233 Ga0495654_0023658
1234 Ga0495654_0029233
1235 Ga0495654_0030989
1236 Ga0495654_0032361
1237 Ga0495654_0034513
1238 Ga0495654_0046604
1239 Ga0495654_0055750
1240 Ga0495654_0074947
1241 Ga0495586_0014791
1242 Ga0495587_0030587
1243 Ga0495609_0000206
1244 Ga0495609_0006540
1245 Ga0495609_0034354
1246 Ga0495597_0007463
1247 Ga0495597_0011774
1248 Ga0495597_0055416
1249 Ga0495597_0080126
1250 Ga0495597_0090277
1251 Ga0495645_0033668
1252 Ga0495622_0000638
1253 Ga0495622_0004006
1254 Ga0495622_0005661
1255 Ga0495622_0008757
1256 Ga0495622_0015265
1257 Ga0495622_0033067
1258 Ga0495633_0023203
1259 Ga0495633_0036921
1260 Ga0495633_0038234
1261 Ga0495656_0015464
1262 Ga0495668_0003932
1263 Ga0495668_0020336
1264 Ga0495634_0004634
1265 Ga0495634_0089760
1266 Ga0495611_0004712
1267 Ga0495611_0039564
1268 Ga0495611_0201529
1269 Ga0495625_0000296
1270 Ga0495625_0003091
1271 Ga0495625_0020945
1272 Ga0495625_0030847
1273 Ga0495625_0036429
1274 Ga0495625_0224082
1275 Ga0495635_0001148
1276 Ga0495659_0000598
1277 Ga0495659_0004432
1278 Ga0495659_0014043
1279 Ga0495661_0000119
1280 Ga0495661_0014902
1281 Ga0495661_0016659
1282 Ga0495661_0020600
1283 Ga0495661_0039361
1284 Ga0495661_0040715
1285 Ga0495661_0064652
1286 Ga0495588_0007905
1287 Ga0495588_0104023
1288 Ga0495657_0253755
1289 Ga0495623_0004954
1290 Ga0495623_0096825
1291 Ga0495646_0018087
1292 Ga0495669_0063712
1293 Ga0495670_0004075
1294 Ga0495670_0012001
1295 Ga0495670_0024729
1296 Ga0495670_0031010
1297 Ga0495670_0032593
1298 Ga0495670_0043503
1299 Ga0495670_0063342
1300 Ga0495670_0082414
1301 Ga0495670_0162304
1302 Ga0495671_0001916
1303 Ga0495671_0002561
1304 Ga0495671_0004284
1305 Ga0495671_0009697
1306 Ga0495671_0010657
1307 Ga0495671_0018723
1308 Ga0495671_0031902
1309 Ga0495671_0033160
1310 Ga0495671_0039221
1311 Ga0495671_0090269
1312 Ga0495671_0118828
1313 Ga0495649_0002307
1314 Ga0495649_0010671
1315 Ga0495649_0015118
1316 Ga0495649_0019652
1317 Ga0495649_0022717
1318 Ga0495649_0029786
1319 Ga0495649_0033607
1320 Ga0495649_0037245
1321 Ga0495589_0000220
1322 Ga0495589_0000931
1323 Ga0495589_0003983
1324 Ga0495589_0056847
1325 Ga0495660_0002659
1326 Ga0495660_0007182
1327 Ga0495660_0012139
1328 Ga0495660_0017838
1329 Ga0495660_0018431
1330 Ga0495660_0021115
1331 Ga0495660_0043482
1332 Ga0495660_0051552
1333 Ga0495660_0127604
1334 Ga0495660_0167537
1335 Ga0495581_0003194
1336 Ga0495581_0025995
1337 Ga0495604_0010786
1338 Ga0495636_0051151
1339 Ga0495674_0028321
1340 Ga0495672_0000553
1341 Ga0495672_0008074
1342 Ga0495672_0010919
1343 Ga0495672_0012559
1344 Ga0495672_0014257
1345 Ga0495672_0017997
1346 Ga0495672_0025140
1347 Ga0495672_0029851
1348 Ga0495672_0030038
1349 Ga0495672_0036031
1350 Ga0495672_0050232
1351 Ga0495672_0058772
1352 Ga0495672_0106168
1353 Ga0495676_0000003
1354 Ga0495680_0009996
1355 Ga0495680_0026818
1356 Ga0495680_0050829
1357 Ga0495680_0054160
1358 Ga0495683_0000382
1359 Ga0495683_0000852
1360 Ga0495683_0009550
1361 Ga0495683_0011676
1362 Ga0495683_0013000
1363 Ga0495683_0016722
1364 Ga0495683_0057577
1365 Ga0495683_0106566
1366 Ga0495687_004098
1367 Ga0495687_004969
1368 Ga0495687_007403
1369 Ga0495687_053972
1370 Ga0495675_0020419
1371 Ga0495677_0000621
1372 Ga0495679_001158
1373 Ga0495679_003272
1374 Ga0495679_009848
1375 Ga0495685_012289
1376 Ga0495673_0000602
1377 Ga0495673_0000782
1378 Ga0495673_0002393
1379 Ga0495673_0003440
1380 Ga0495673_0010563
1381 Ga0495673_0016804
1382 Ga0495673_0029565
1383 Ga0495673_0035647
1384 Ga0495673_0038941
1385 Ga0495673_0052623
1386 Ga0495681_0005092
1387 Ga0495681_0007269
1388 Ga0495681_0009412
1389 Ga0495681_0010033
1390 Ga0495681_0011556
1391 Ga0495681_0012260
1392 Ga0495681_0014950
1393 Ga0495681_0017403
1394 Ga0495681_0023982
1395 Ga0495681_0027234
1396 Ga0495681_0033300
1397 Ga0495684_0035996
1398 Ga0495686_0010813
1399 Ga0495686_0047400
1400 Ga0495593_0008220
1401 Ga0495593_0023197
1402 Ga0495614_0036271
1403 Ga0495626_0000086
1404 Ga0495626_0001191
1405 Ga0495626_0001541
1406 Ga0495626_0002350
1407 Ga0495626_0005638
1408 Ga0495626_0005927
1409 Ga0495626_0099461
1410 Ga0496102_0000073
1411 Ga0496102_0055901
1412 Ga0496103_0051494
1413 Ga0496104_0409534
1414 Ga0496110_0150873
1415 Ga0496110_0215226
1416 Ga0496111_0159412
1417 Ga0496111_0334201
1418 Ga0496114_0102327
1419 Ga0496115_0021197
1420 Ga0496116_0000995
1421 Ga0496116_0015721
1422 Ga0496117_0013130
1423 Ga0496117_0014592
1424 Ga0496117_0022977
1425 Ga0496117_0024212
1426 Ga0496117_0024679
1427 Ga0496117_0025585
1428 Ga0496117_0044827
1429 Ga0496117_0103369
1430 Ga0496117_0200285
1431 Ga0496118_0020357
1432 Ga0496118_0022302
1433 Ga0496118_0023787
1434 Ga0496118_0025532
1435 Ga0496118_0031708
1436 Ga0496118_0044031
1437 Ga0496118_0052541
1438 Ga0496118_0054404
1439 Ga0496118_0083386
1440 Ga0496118_0112752
1441 Ga0496118_0117878
1442 Ga0496119_0002172
1443 Ga0496119_0007243
1444 Ga0496120_0002014
1445 Ga0496120_0005044
1446 Ga0496120_0146785
1447 Ga0496121_0001663
1448 Ga0496121_0005421
1449 Ga0496121_0026738
1450 Ga0496121_0028037
1451 Ga0496121_0030367
1452 Ga0496121_0094563
1453 Ga0496121_0175145
1454 Ga0496121_0191632
1455 Ga0496121_0358548
1456 Ga0496122_0000244
1457 Ga0496122_0005970
1458 Ga0496122_0019091
1459 Ga0496122_0028352
1460 Ga0496122_0032031
1461 Ga0496122_0040945
1462 Ga0496122_0045809
1463 Ga0496122_0135941
1464 Ga0496123_0000201
1465 Ga0496123_0011426
1466 Ga0496123_0013135
1467 Ga0496123_0024807
1468 Ga0496123_0039495
1469 Ga0496123_0050969
1470 Ga0496123_0152347
1471 Ga0496124_0003104
1472 Ga0496124_0018543
1473 Ga0496124_0019143
1474 Ga0496124_0029065
1475 Ga0496124_0029690
1476 Ga0496124_0038621
1477 Ga0496124_0051265
1478 Ga0496124_0087049
1479 Ga0496124_0094458
1480 Ga0496124_0114604
1481 Ga0496125_0000862
1482 Ga0496125_0024867
1483 Ga0496125_0024937
1484 Ga0496125_0024954
1485 Ga0496125_0039292
1486 Ga0496125_0042139
1487 Ga0496125_0065178
1488 Ga0496125_0101603
1489 Ga0496126_0004738
1490 Ga0496126_0033523
1491 Ga0496126_0145215
1492 Ga0495678_008440
1493 Ga0495678_008505
1494 Ga0495678_009902
1495 Ga0495678_013485
1496 Ga0495678_021785
1497 Ga0495678_046866
1498 Ga0495678_061761
1499 Ga0495678_064843
1500 Ga0495682_0000138
1501 Ga0495682_0004702
1502 Ga0495682_0018407
1503 Ga0495682_0023955
1504 Ga0495682_0035889
1505 Ga0501032_0010934
1506 Ga0501034_0000003
1507 Ga0501034_0235891
1508 Ga0501034_0428665
1509 Ga0501037_0234027
1510 Ga0501226_000017
1511 nmdc:mga00v17_69450_c1
1512 nmdc:mga00v17_78588_c1
1513 Ga0500659_0063600
1514 2511258060
1515 2511271543
1516 2511302942
1517 2511322862
1518 2511329322
1519 2511331381
1520 2511336178
1521 2511342237
1522 2511354953
1523 2511362726
1524 2511824964
1525 2555669224
1526 2599357878
1527 2599361631
1528 2599367953
1529 2599374742
1530 2599383043
1531 2599389574
1532 2599393600
1533 2599397862
1534 2599405367
1535 2599452309
1536 2599464694
1537 2599468244
1538 2599493717
1539 2599502315
1540 2599513312
1541 2599518188
1542 2599612842
1543 2599769044
1544 2599877985
1545 2599884843
1546 2599891988
1547 2599895979
1548 2599932623
1549 2599943375
1550 2599952207
1551 2599954486
1552 2599957864
1553 2599966787
1554 2599970390
1555 2599978066
1556 2599983799
1557 2599988695
1558 2599993354
1559 2600001401
1560 2600004039
1561 2600012207
1562 2600015587
1563 2600021941
1564 2600028546
1565 2600037538
1566 2600042867
1567 2600048604
1568 2600050795
1569 2600060077
1570 2600063298
1571 2600072673
1572 2600075215
1573 2600217416
1574 2600357713
1575 2600365632
1576 2600446630
1577 2601777586
1578 2602010829
1579 2621298795
1580 2624492660
1581 2643841653
1582 2643956968
1583 2644024891
1584 2644186760
1585 2644283938
1586 2652544946
1587 2671088671
1588 2671098273
1589 2671126289
1590 2677900729
1591 2678263601
1592 2729145489
1593 2738672044
1594 2738750437
1595 2738810032
1596 2738859478
1597 2738897392
1598 2739197683
1599 2739258597
1600 2739286375
1601 2739291688
1602 2745009932
1603 2774123241
1604 2784315765
1605 2794594850
1606 2808856270
1607 2808924710
1608 2808932978
1609 2808938991
1610 2808943241
1611 2808946708
1612 2808955123
1613 2808958309
1614 2808964762
1615 2808977000
1616 2808992155
1617 2809002100
1618 2812368046
1619 2817492044
1620 2819703344
1621 2823423410
1622 2825651975
1623 2834032858
1624 2842858150
1625 2844669659
1626 2852613666
1627 2852668598
1628 2860342340
1629 2904550568
1630 2913039677
1631 2917073027
1632 2919156765
1633 2919459020
1634 2919484767
1635 2919505220
1636 2919702646
1637 2923522098
1638 2923588446
1639 2926066897
1640 2929147582
1641 2931375147
1642 2931394537
1643 2931402423
1644 2935359443
1645 2939638499
1646 2945934226
1647 2988728860
1648 3007514619
1649 3007808261
1650 3007869135
1651 637319559
1652 639788133
1653 640488211
1654 651176165
1655 8011354595
1656 8019775663
1657 8019781052
1658 8034963697
1659 8052497779
1660 8054507050
1661 8055820115
1662 8055883312
1663 8056129298
1664 8056135481
1665 8056146203
1666 8056157623
1667 8056165253
1668 8057799663

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

60

244

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xfr-assembly1.cif.gz_A metallo-beta-lactamase from pontibacter korlensis 0.8631 22 246
4nq5-assembly1.cif.gz_A bacillus cereus zn-dependent metallo-beta-lactamase at ph 7 complexed with compound cs319 0.8568 26 245
1bmc-assembly1.cif.gz_A structure of a zinc metallo-beta-lactamase from bacillus cereus 0.8555 26 245
3kns-assembly4.cif.gz_D bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) 0.8543 22 245
3fai-assembly1.cif.gz_A the di zinc carbapenemase cpha n220g mutant 0.8528 21 245
ID Description Score Start End Superfamily
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8574 152 234 3.60.15.10
1x8gA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8535 21 245 3.60.15.10
1x8gA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8359 21 245 3.60.15.10
3l6nA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8253 19 245 3.60.15.10
4nq7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8241 26 245 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A3D0K7C7-F1-model_v4 deleted 0.9808 11 152
AF-A0A431KTK1-F1-model_v4 Quinoprotein relay system zinc metallohydrolase 1 0.9789 12 268 GO:0016787
AF-A0A1X1QQ21-F1-model_v4 MBL fold metallo-hydrolase 0.9755 18 298 GO:0016787
AF-A0A661F283-F1-model_v4 MBL fold metallo-hydrolase 0.973 12 191 GO:0016787
AF-A0A2P8EN68-F1-model_v4 Quinoprotein relay system zinc metallohydrolase 1 0.9726 12 297 GO:0016787

Map