F482804
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 834 | 366 | 1668 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0246669|Ga0453684_0246669_192_1154 |
| Length | 320 |
| Sequence | MGSWIARIRASIVAGVVVGCAGLHAPLVLAEKFDYQLAPLKVADDTWVLIGKTEDFTRANGGNIVNTAFVVTEDGVVVIDSGPSRRYAEQMRAAIAKITAKPVVRVFNTHHHPDHFLGNQVFARVPTAALAVTIAGQKQEGVAFTDNVYRLSGDWILGTEPVAASESVAPGVYNIGGHAFELIALAGHTQGDLVILDRSTGVIFTGDLVFHNRAPTTPHASIAQWLAALDGLDAIRYQLMVPGHGNPVPDGRAVDQTRRYLRWLEATLRQAAEHGDEMNEVLALPLPAEFGSIPLMRVEFARSVAHLYRRYEAGTLAHSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 20 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 21 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 22 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 23 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 24 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 25 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 41 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 67 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 68 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 70 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 71 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 72 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 73 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 74 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 75 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 76 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 77 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 78 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 79 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 80 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 81 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 82 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 83 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 84 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 85 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 86 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 87 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 88 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 89 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 90 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 91 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 92 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 93 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 94 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 95 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 96 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 97 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 98 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 99 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 100 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 101 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 102 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 103 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 104 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 105 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 106 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 107 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 108 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 109 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 194 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 195 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 196 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 197 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 200 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 212 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 213 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 214 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 215 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 216 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 217 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 218 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 219 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 220 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 221 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 222 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 223 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 224 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 225 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 226 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 227 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 228 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 229 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 230 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 231 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 232 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 233 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 234 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 235 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 236 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 237 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 238 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 239 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 240 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 241 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 242 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 243 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 244 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 245 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 246 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 247 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 248 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 249 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 250 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 251 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 252 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 253 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 254 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 255 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 256 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 257 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 258 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 259 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 260 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 261 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 262 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 263 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 264 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 265 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 266 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 267 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 268 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 269 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 270 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 271 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 272 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 273 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 274 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 275 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 276 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 277 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 278 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 279 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 280 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 281 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 282 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 283 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 284 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 285 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 286 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 287 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 288 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 289 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 290 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 291 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 292 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 293 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 294 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 295 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 296 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 297 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 298 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 299 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 300 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 301 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 302 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 303 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 304 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 305 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 306 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 307 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 308 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 309 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 310 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 311 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 312 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 313 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 314 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 315 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 316 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 317 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 318 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 319 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 320 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 321 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 322 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 323 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 324 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 325 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 326 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 327 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 328 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 329 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 330 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 331 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 332 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 333 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 334 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 335 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 336 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 337 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 338 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 339 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 340 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 341 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 342 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 343 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 344 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 345 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 346 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 347 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 348 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 349 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 350 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 351 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 352 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 353 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 354 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 355 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 356 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 357 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 358 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 359 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 360 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 361 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 362 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 363 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 364 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 365 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 366 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.41 |
| Metatranscriptomes | 0 |
| Isolates | 18.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.76 |
| Nodule | 1.92 |
| Rhizoplane | 8.15 |
| Rhizosphere | 73.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0246669 | 3300044712 | Bacteria | 2053 |
| 2 | MRS2a_Contig_5158 | 2124908027 | Bacteria | 19190 |
| 3 | SwRhRL2b_contig_1319436 | 2162886007 | Bacteria | 1940 |
| 4 | JGI25162J39368_1000050 | 3300002737 | Bacteria | 157157 |
| 5 | JGI25163J39215_1000351 | 3300002771 | Bacteria | 15275 |
| 6 | JGI25164J39214_1000025 | 3300002772 | Bacteria | 157157 |
| 7 | JGI25165J46597_1000114 | 3300003214 | Bacteria | 144350 |
| 8 | JGI25165J46597_1000176 | 3300003214 | Bacteria | 99160 |
| 9 | Ga0055530_10000075 | 3300003791 | Bacteria | 84932 |
| 10 | Ga0055530_10032368 | 3300003791 | Bacteria | 1360 |
| 11 | Ga0055540_1000115 | 3300003792 | Bacteria | 84932 |
| 12 | Ga0065714_10000744 | 3300005288 | Bacteria | 2932 |
| 13 | Ga0065714_10002340 | 3300005288 | Bacteria | 25797 |
| 14 | Ga0065714_10006336 | 3300005288 | Bacteria | 5927 |
| 15 | Ga0065714_10029782 | 3300005288 | Bacteria | 1496 |
| 16 | Ga0065714_10074007 | 3300005288 | Bacteria | 3096 |
| 17 | Ga0065714_10083749 | 3300005288 | Bacteria | 2232 |
| 18 | Ga0065714_10092038 | 3300005288 | Bacteria | 1885 |
| 19 | Ga0065714_10092661 | 3300005288 | Bacteria | 1870 |
| 20 | Ga0065704_10000778 | 3300005289 | Bacteria | 18558 |
| 21 | Ga0065704_10009688 | 3300005289 | Bacteria | 3447 |
| 22 | Ga0065704_10072252 | 3300005289 | Bacteria | 8859 |
| 23 | Ga0065712_10008598 | 3300005290 | Bacteria | 6003 |
| 24 | Ga0065715_10281495 | 3300005293 | Bacteria | 1074 |
| 25 | Ga0070670_100000303 | 3300005331 | Bacteria | 42489 |
| 26 | Ga0070661_100002107 | 3300005344 | Bacteria | 13699 |
| 27 | Ga0070669_100030218 | 3300005353 | Bacteria | 3908 |
| 28 | Ga0070662_100001726 | 3300005457 | Bacteria | 13449 |
| 29 | Ga0070664_100002981 | 3300005564 | Bacteria | 13699 |
| 30 | Ga0068854_100204646 | 3300005578 | Bacteria | 1554 |
| 31 | Ga0068851_10000132 | 3300005834 | Bacteria | 40261 |
| 32 | Ga0075432_10001039 | 3300006058 | Bacteria | 8837 |
| 33 | Ga0075432_10008235 | 3300006058 | Bacteria | 3554 |
| 34 | Ga0075432_10016885 | 3300006058 | Bacteria | 2491 |
| 35 | Ga0075362_10012119 | 3300006177 | Bacteria | 3416 |
| 36 | Ga0099823_1000001 | 3300006944 | Bacteria | 216833 |
| 37 | Ga0079104_1000303 | 3300006946 | Bacteria | 62394 |
| 38 | Ga0079104_1000554 | 3300006946 | Bacteria | 38699 |
| 39 | Ga0105251_10000038 | 3300009011 | Bacteria | 116060 |
| 40 | Ga0105251_10002494 | 3300009011 | Bacteria | 14402 |
| 41 | Ga0105251_10010425 | 3300009011 | Bacteria | 5393 |
| 42 | Ga0105251_10012550 | 3300009011 | Bacteria | 4789 |
| 43 | Ga0105244_10000016 | 3300009036 | Bacteria | 255363 |
| 44 | Ga0105244_10001524 | 3300009036 | Bacteria | 18507 |
| 45 | Ga0105244_10004851 | 3300009036 | Bacteria | 9120 |
| 46 | Ga0105244_10008586 | 3300009036 | Bacteria | 6370 |
| 47 | Ga0105244_10014628 | 3300009036 | Bacteria | 4533 |
| 48 | Ga0105244_10016545 | 3300009036 | Bacteria | 4199 |
| 49 | Ga0105244_10084222 | 3300009036 | Bacteria | 1571 |
| 50 | Ga0105244_10111564 | 3300009036 | Bacteria | 1330 |
| 51 | Ga0105250_10000353 | 3300009092 | Bacteria | 35144 |
| 52 | Ga0105250_10027363 | 3300009092 | Bacteria | 2298 |
| 53 | Ga0105243_10014929 | 3300009148 | Bacteria | 5879 |
| 54 | Ga0105243_10039721 | 3300009148 | Bacteria | 3670 |
| 55 | Ga0105243_10054921 | 3300009148 | Bacteria | 3164 |
| 56 | Ga0105242_10022928 | 3300009176 | Bacteria | 4917 |
| 57 | Ga0105248_10712762 | 3300009177 | Bacteria | 1132 |
| 58 | Ga0105237_10006234 | 3300009545 | Bacteria | 13284 |
| 59 | Ga0105246_10047293 | 3300011119 | Bacteria | 2937 |
| 60 | Ga0157373_10001148 | 3300013100 | Bacteria | 20279 |
| 61 | Ga0157373_10006474 | 3300013100 | Bacteria | 8739 |
| 62 | Ga0157373_10008114 | 3300013100 | Bacteria | 7806 |
| 63 | Ga0157373_10086368 | 3300013100 | Bacteria | 2211 |
| 64 | Ga0157371_10001502 | 3300013102 | Bacteria | 24121 |
| 65 | Ga0157371_10001866 | 3300013102 | Bacteria | 21095 |
| 66 | Ga0157371_10054590 | 3300013102 | Bacteria | 2837 |
| 67 | Ga0157370_10001953 | 3300013104 | Bacteria | 25403 |
| 68 | Ga0157370_10134614 | 3300013104 | Bacteria | 2304 |
| 69 | Ga0157370_10135693 | 3300013104 | Bacteria | 2293 |
| 70 | Ga0157369_10009531 | 3300013105 | Bacteria | 11103 |
| 71 | Ga0157369_10011089 | 3300013105 | Bacteria | 10254 |
| 72 | Ga0157369_10012461 | 3300013105 | Bacteria | 9646 |
| 73 | Ga0163162_10421486 | 3300013306 | Bacteria | 1467 |
| 74 | Ga0157372_10001218 | 3300013307 | Bacteria | 27843 |
| 75 | Ga0157375_10188795 | 3300013308 | Bacteria | 2215 |
| 76 | Ga0182008_10000604 | 3300014497 | Bacteria | 26387 |
| 77 | Ga0182008_10007960 | 3300014497 | Bacteria | 5813 |
| 78 | Ga0182008_10009829 | 3300014497 | Bacteria | 5143 |
| 79 | Ga0182008_10040881 | 3300014497 | Bacteria | 2314 |
| 80 | Ga0182006_1001202 | 3300015261 | Bacteria | 16166 |
| 81 | Ga0182006_1003368 | 3300015261 | Bacteria | 8214 |
| 82 | Ga0182006_1007155 | 3300015261 | Bacteria | 5130 |
| 83 | Ga0182006_1061485 | 3300015261 | Bacteria | 1416 |
| 84 | Ga0182007_10000071 | 3300015262 | Bacteria | 81966 |
| 85 | Ga0182007_10001255 | 3300015262 | Bacteria | 13789 |
| 86 | Ga0182007_10013309 | 3300015262 | Bacteria | 3141 |
| 87 | Ga0182005_1000524 | 3300015265 | Bacteria | 19519 |
| 88 | Ga0182005_1002580 | 3300015265 | Bacteria | 6418 |
| 89 | Ga0182005_1017753 | 3300015265 | Bacteria | 1969 |
| 90 | Ga0163161_10004705 | 3300017792 | Bacteria | 9493 |
| 91 | Ga0163161_10006045 | 3300017792 | Bacteria | 8391 |
| 92 | Ga0163161_10013164 | 3300017792 | Bacteria | 5751 |
| 93 | Ga0163161_10040096 | 3300017792 | Bacteria | 3363 |
| 94 | Ga0163161_10044526 | 3300017792 | Bacteria | 3197 |
| 95 | Ga0163161_10075880 | 3300017792 | Bacteria | 2467 |
| 96 | Ga0163161_10119533 | 3300017792 | Bacteria | 1979 |
| 97 | Ga0209760_100033 | 3300025207 | Bacteria | 136583 |
| 98 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 99 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 100 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 101 | Ga0209676_1000617 | 3300025292 | Bacteria | 51959 |
| 102 | Ga0209676_1004064 | 3300025292 | Bacteria | 8411 |
| 103 | Ga0209676_1008768 | 3300025292 | Bacteria | 4456 |
| 104 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 105 | Ga0209050_1000914 | 3300025298 | Bacteria | 38994 |
| 106 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 107 | Ga0209257_1011899 | 3300025304 | Bacteria | 4108 |
| 108 | Ga0207656_10000287 | 3300025321 | Bacteria | 17443 |
| 109 | Ga0207696_1000016 | 3300025711 | Bacteria | 502467 |
| 110 | Ga0207696_1000108 | 3300025711 | Bacteria | 157445 |
| 111 | Ga0207696_1024126 | 3300025711 | Bacteria | 1910 |
| 112 | Ga0207655_1000027 | 3300025728 | Bacteria | 444552 |
| 113 | Ga0207655_1000114 | 3300025728 | Bacteria | 164098 |
| 114 | Ga0207655_1000384 | 3300025728 | Bacteria | 61818 |
| 115 | Ga0207655_1002020 | 3300025728 | Bacteria | 17156 |
| 116 | Ga0207655_1003059 | 3300025728 | Bacteria | 12750 |
| 117 | Ga0207655_1022254 | 3300025728 | Bacteria | 3186 |
| 118 | Ga0207713_1000185 | 3300025735 | Bacteria | 88697 |
| 119 | Ga0207713_1001969 | 3300025735 | Bacteria | 15463 |
| 120 | Ga0207713_1002029 | 3300025735 | Bacteria | 15167 |
| 121 | Ga0207713_1006075 | 3300025735 | Bacteria | 7441 |
| 122 | Ga0207713_1015292 | 3300025735 | Bacteria | 3946 |
| 123 | Ga0207713_1032451 | 3300025735 | Bacteria | 2293 |
| 124 | Ga0207671_10001354 | 3300025914 | Bacteria | 28611 |
| 125 | Ga0207649_10000577 | 3300025920 | Bacteria | 25047 |
| 126 | Ga0207681_10006717 | 3300025923 | Bacteria | 7059 |
| 127 | Ga0207650_10000068 | 3300025925 | Bacteria | 139947 |
| 128 | Ga0207706_10004228 | 3300025933 | Bacteria | 13524 |
| 129 | Ga0207686_10046243 | 3300025934 | Bacteria | 2683 |
| 130 | Ga0207709_10003872 | 3300025935 | Bacteria | 8757 |
| 131 | Ga0207709_10013552 | 3300025935 | Bacteria | 4497 |
| 132 | Ga0207709_10430934 | 3300025935 | Bacteria | 1015 |
| 133 | Ga0207679_10001702 | 3300025945 | Bacteria | 13713 |
| 134 | Ga0207640_10133741 | 3300025981 | Bacteria | 1797 |
| 135 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 136 | Ga0209281_1000063 | 3300027111 | Bacteria | 288465 |
| 137 | Ga0209389_1000007 | 3300027296 | Bacteria | 227459 |
| 138 | Ga0207428_10009356 | 3300027907 | Bacteria | 8791 |
| 139 | Ga0207428_10052476 | 3300027907 | Bacteria | 3256 |
| 140 | Ga0207428_10064906 | 3300027907 | Bacteria | 2882 |
| 141 | Ga0207428_10142031 | 3300027907 | Bacteria | 1832 |
| 142 | Ga0207428_10155921 | 3300027907 | Bacteria | 1737 |
| 143 | Ga0207428_10256962 | 3300027907 | Bacteria | 1302 |
| 144 | Ga0307408_100000018 | 3300031548 | Bacteria | 346872 |
| 145 | Ga0307408_100014570 | 3300031548 | Bacteria | 5224 |
| 146 | Ga0307408_100094845 | 3300031548 | Bacteria | 2260 |
| 147 | Ga0307405_10000137 | 3300031731 | Bacteria | 28468 |
| 148 | Ga0307405_10005300 | 3300031731 | Bacteria | 6201 |
| 149 | Ga0307405_10074088 | 3300031731 | Bacteria | 2200 |
| 150 | Ga0307405_10392857 | 3300031731 | Bacteria | 1083 |
| 151 | Ga0307406_10183447 | 3300031901 | Bacteria | 1525 |
| 152 | Ga0307406_10324395 | 3300031901 | Bacteria | 1192 |
| 153 | Ga0307407_10208722 | 3300031903 | Bacteria | 1313 |
| 154 | Ga0307412_10029725 | 3300031911 | Bacteria | 3431 |
| 155 | Ga0307412_10115139 | 3300031911 | Bacteria | 1926 |
| 156 | Ga0307416_100234527 | 3300032002 | Bacteria | 1772 |
| 157 | Ga0307414_10052408 | 3300032004 | Bacteria | 2839 |
| 158 | Ga0307414_10088530 | 3300032004 | Bacteria | 2291 |
| 159 | Ga0307414_10193598 | 3300032004 | Bacteria | 1647 |
| 160 | Ga0307411_10020277 | 3300032005 | Bacteria | 3862 |
| 161 | Ga0307411_10075767 | 3300032005 | Bacteria | 2297 |
| 162 | Ga0439438_003908 | 3300041405 | Bacteria | 5866 |
| 163 | Ga0439438_004339 | 3300041405 | Bacteria | 5469 |
| 164 | Ga0439438_005962 | 3300041405 | Bacteria | 4397 |
| 165 | Ga0439438_013043 | 3300041405 | Bacteria | 2521 |
| 166 | Ga0439438_017339 | 3300041405 | Bacteria | 2075 |
| 167 | Ga0439447_003607 | 3300041407 | Bacteria | 5480 |
| 168 | Ga0439447_004429 | 3300041407 | Bacteria | 4831 |
| 169 | Ga0439447_009200 | 3300041407 | Bacteria | 3010 |
| 170 | Ga0439447_015362 | 3300041407 | Bacteria | 2125 |
| 171 | Ga0439466_0002538 | 3300041411 | Bacteria | 7147 |
| 172 | Ga0439466_0004357 | 3300041411 | Bacteria | 5457 |
| 173 | Ga0439466_0006691 | 3300041411 | Bacteria | 4373 |
| 174 | Ga0439466_0009076 | 3300041411 | Bacteria | 3731 |
| 175 | Ga0439466_0015463 | 3300041411 | Bacteria | 2771 |
| 176 | Ga0439466_0030632 | 3300041411 | Bacteria | 1843 |
| 177 | Ga0439465_0008365 | 3300041413 | Bacteria | 3266 |
| 178 | Ga0439431_0002411 | 3300041997 | Bacteria | 4138 |
| 179 | Ga0439432_000171 | 3300042006 | Bacteria | 22714 |
| 180 | Ga0439432_007279 | 3300042006 | Bacteria | 3928 |
| 181 | Ga0439432_010393 | 3300042006 | Bacteria | 3224 |
| 182 | Ga0439432_013015 | 3300042006 | Bacteria | 2833 |
| 183 | Ga0439451_010572 | 3300042009 | Bacteria | 1860 |
| 184 | Ga0439451_016675 | 3300042009 | Bacteria | 1478 |
| 185 | Ga0439451_036055 | 3300042009 | Bacteria | 994 |
| 186 | Ga0439452_000677 | 3300042010 | Bacteria | 16790 |
| 187 | Ga0439452_003056 | 3300042010 | Bacteria | 5950 |
| 188 | Ga0439452_004545 | 3300042010 | Bacteria | 4632 |
| 189 | Ga0439452_004693 | 3300042010 | Bacteria | 4528 |
| 190 | Ga0439452_007797 | 3300042010 | Bacteria | 3251 |
| 191 | Ga0439452_009314 | 3300042010 | Bacteria | 2898 |
| 192 | Ga0439452_010565 | 3300042010 | Bacteria | 2679 |
| 193 | Ga0439452_018732 | 3300042010 | Bacteria | 1840 |
| 194 | Ga0439456_004218 | 3300042013 | Bacteria | 2913 |
| 195 | Ga0439463_002247 | 3300042016 | Bacteria | 4955 |
| 196 | Ga0439463_004592 | 3300042016 | Bacteria | 3458 |
| 197 | Ga0450911_002259 | 3300042115 | Bacteria | 3866 |
| 198 | Ga0450911_002820 | 3300042115 | Bacteria | 3269 |
| 199 | Ga0450911_003118 | 3300042115 | Bacteria | 3013 |
| 200 | Ga0450911_010864 | 3300042115 | Bacteria | 1252 |
| 201 | Ga0450920_000960 | 3300042122 | Bacteria | 4700 |
| 202 | Ga0450922_000360 | 3300042124 | Bacteria | 4853 |
| 203 | Ga0450890_000606 | 3300042127 | Bacteria | 5233 |
| 204 | Ga0450894_002753 | 3300042131 | Bacteria | 2331 |
| 205 | Ga0450898_000712 | 3300042134 | Bacteria | 4031 |
| 206 | Ga0450899_001487 | 3300042135 | Bacteria | 2619 |
| 207 | Ga0450902_001289 | 3300042137 | Bacteria | 3386 |
| 208 | Ga0450902_003671 | 3300042137 | Bacteria | 2254 |
| 209 | Ga0450902_006821 | 3300042137 | Bacteria | 1755 |
| 210 | Ga0450903_001686 | 3300042138 | Bacteria | 4084 |
| 211 | Ga0450903_001697 | 3300042138 | Bacteria | 4061 |
| 212 | Ga0450905_001436 | 3300042142 | Bacteria | 3043 |
| 213 | Ga0450906_003228 | 3300042145 | Bacteria | 3519 |
| 214 | Ga0450907_000140 | 3300042146 | Bacteria | 27596 |
| 215 | Ga0450907_025237 | 3300042146 | Bacteria | 1005 |
| 216 | Ga0450910_002522 | 3300042147 | Bacteria | 2405 |
| 217 | Ga0450910_009742 | 3300042147 | Bacteria | 1361 |
| 218 | Ga0439446_0028856 | 3300042156 | Bacteria | 1599 |
| 219 | Ga0450908_001543 | 3300042184 | Bacteria | 4470 |
| 220 | Ga0450908_005901 | 3300042184 | Bacteria | 2339 |
| 221 | Ga0450909_002131 | 3300042185 | Bacteria | 2793 |
| 222 | Ga0439434_0002427 | 3300042435 | Bacteria | 5421 |
| 223 | Ga0439434_0004141 | 3300042435 | Bacteria | 4233 |
| 224 | Ga0439464_0000443 | 3300042439 | Bacteria | 8221 |
| 225 | Ga0439464_0016060 | 3300042439 | Bacteria | 2023 |
| 226 | Ga0439460_0002498 | 3300042461 | Bacteria | 4439 |
| 227 | Ga0439460_0005265 | 3300042461 | Bacteria | 3169 |
| 228 | Ga0450901_002227 | 3300042533 | Bacteria | 2127 |
| 229 | Ga0439440_0001299 | 3300042993 | Bacteria | 4530 |
| 230 | Ga0439440_0012945 | 3300042993 | Bacteria | 1781 |
| 231 | Ga0439440_0040919 | 3300042993 | Bacteria | 1129 |
| 232 | Ga0451576_0000591 | 3300045051 | Bacteria | 76735 |
| 233 | Ga0495617_000826 | 3300046452 | Bacteria | 14740 |
| 234 | Ga0495617_005450 | 3300046452 | Bacteria | 4507 |
| 235 | Ga0495617_007936 | 3300046452 | Bacteria | 3671 |
| 236 | Ga0495617_008755 | 3300046452 | Bacteria | 3484 |
| 237 | Ga0495617_009711 | 3300046452 | Bacteria | 3301 |
| 238 | Ga0495617_065742 | 3300046452 | Bacteria | 1195 |
| 239 | Ga0495627_005583 | 3300046453 | Bacteria | 5036 |
| 240 | Ga0495603_0004426 | 3300046455 | Bacteria | 8375 |
| 241 | Ga0495603_0036666 | 3300046455 | Bacteria | 2943 |
| 242 | Ga0495590_0002605 | 3300046457 | Bacteria | 7455 |
| 243 | Ga0495590_0006559 | 3300046457 | Bacteria | 4539 |
| 244 | Ga0495590_0025540 | 3300046457 | Bacteria | 2077 |
| 245 | Ga0495590_0070917 | 3300046457 | Bacteria | 1222 |
| 246 | Ga0495591_000174 | 3300046458 | Bacteria | 66422 |
| 247 | Ga0495591_000697 | 3300046458 | Bacteria | 24507 |
| 248 | Ga0495591_000809 | 3300046458 | Bacteria | 22141 |
| 249 | Ga0495591_001735 | 3300046458 | Bacteria | 12988 |
| 250 | Ga0495591_008718 | 3300046458 | Bacteria | 4121 |
| 251 | Ga0495591_015979 | 3300046458 | Bacteria | 2631 |
| 252 | Ga0495591_031472 | 3300046458 | Bacteria | 1591 |
| 253 | Ga0495629_0093107 | 3300046459 | Bacteria | 2103 |
| 254 | Ga0495638_0003448 | 3300046460 | Bacteria | 12455 |
| 255 | Ga0495638_0011837 | 3300046460 | Bacteria | 6001 |
| 256 | Ga0495638_0021838 | 3300046460 | Bacteria | 4207 |
| 257 | Ga0495638_0036107 | 3300046460 | Bacteria | 3149 |
| 258 | Ga0495638_0058887 | 3300046460 | Bacteria | 2379 |
| 259 | Ga0495638_0123132 | 3300046460 | Bacteria | 1530 |
| 260 | Ga0495638_0223700 | 3300046460 | Bacteria | 1050 |
| 261 | Ga0495653_0049230 | 3300046463 | Bacteria | 3247 |
| 262 | Ga0495653_0288031 | 3300046463 | Bacteria | 1075 |
| 263 | Ga0495650_0001051 | 3300046471 | Bacteria | 30683 |
| 264 | Ga0495650_0002388 | 3300046471 | Bacteria | 15361 |
| 265 | Ga0495650_0006072 | 3300046471 | Bacteria | 7624 |
| 266 | Ga0495650_0008122 | 3300046471 | Bacteria | 6177 |
| 267 | Ga0495650_0011840 | 3300046471 | Bacteria | 4735 |
| 268 | Ga0495650_0031224 | 3300046471 | Bacteria | 2400 |
| 269 | Ga0495580_0326583 | 3300046472 | Bacteria | 1042 |
| 270 | Ga0495582_0015874 | 3300046473 | Bacteria | 4129 |
| 271 | Ga0495605_0000076 | 3300046474 | Bacteria | 128699 |
| 272 | Ga0495605_0001638 | 3300046474 | Bacteria | 14431 |
| 273 | Ga0495605_0002121 | 3300046474 | Bacteria | 12413 |
| 274 | Ga0495605_0002432 | 3300046474 | Bacteria | 11513 |
| 275 | Ga0495605_0011566 | 3300046474 | Bacteria | 4915 |
| 276 | Ga0495605_0017220 | 3300046474 | Bacteria | 3894 |
| 277 | Ga0495605_0023402 | 3300046474 | Bacteria | 3249 |
| 278 | Ga0495605_0036829 | 3300046474 | Bacteria | 2464 |
| 279 | Ga0495639_0000563 | 3300046475 | Bacteria | 17303 |
| 280 | Ga0495639_0007071 | 3300046475 | Bacteria | 4820 |
| 281 | Ga0495639_0041389 | 3300046475 | Bacteria | 2075 |
| 282 | Ga0495584_0001241 | 3300046491 | Bacteria | 15569 |
| 283 | Ga0495584_0001301 | 3300046491 | Bacteria | 15186 |
| 284 | Ga0495584_0002919 | 3300046491 | Bacteria | 9540 |
| 285 | Ga0495584_0003118 | 3300046491 | Bacteria | 9206 |
| 286 | Ga0495584_0004135 | 3300046491 | Bacteria | 7832 |
| 287 | Ga0495584_0004362 | 3300046491 | Bacteria | 7619 |
| 288 | Ga0495584_0007572 | 3300046491 | Bacteria | 5660 |
| 289 | Ga0495584_0014709 | 3300046491 | Bacteria | 3987 |
| 290 | Ga0495584_0151165 | 3300046491 | Bacteria | 1179 |
| 291 | Ga0495585_0000545 | 3300046492 | Bacteria | 35585 |
| 292 | Ga0495585_0024521 | 3300046492 | Bacteria | 3458 |
| 293 | Ga0495585_0029212 | 3300046492 | Bacteria | 3139 |
| 294 | Ga0495585_0042777 | 3300046492 | Bacteria | 2535 |
| 295 | Ga0495585_0153079 | 3300046492 | Bacteria | 1201 |
| 296 | Ga0495594_0089341 | 3300046499 | Bacteria | 1725 |
| 297 | Ga0495607_0000799 | 3300046501 | Bacteria | 29847 |
| 298 | Ga0495607_0002369 | 3300046501 | Bacteria | 15384 |
| 299 | Ga0495607_0011916 | 3300046501 | Bacteria | 5760 |
| 300 | Ga0495607_0021849 | 3300046501 | Bacteria | 4023 |
| 301 | Ga0495607_0034393 | 3300046501 | Bacteria | 3074 |
| 302 | Ga0495607_0039962 | 3300046501 | Bacteria | 2796 |
| 303 | Ga0495607_0043919 | 3300046501 | Bacteria | 2639 |
| 304 | Ga0495607_0063519 | 3300046501 | Bacteria | 2088 |
| 305 | Ga0495607_0148839 | 3300046501 | Bacteria | 1200 |
| 306 | Ga0495607_0176741 | 3300046501 | Bacteria | 1073 |
| 307 | Ga0495583_0000172 | 3300046506 | Bacteria | 109791 |
| 308 | Ga0495583_0000813 | 3300046506 | Bacteria | 38429 |
| 309 | Ga0495583_0005099 | 3300046506 | Bacteria | 9057 |
| 310 | Ga0495583_0008503 | 3300046506 | Bacteria | 6263 |
| 311 | Ga0495583_0014007 | 3300046506 | Bacteria | 4442 |
| 312 | Ga0495583_0044567 | 3300046506 | Bacteria | 2056 |
| 313 | Ga0495606_0000028 | 3300046507 | Bacteria | 251032 |
| 314 | Ga0495606_0000684 | 3300046507 | Bacteria | 52863 |
| 315 | Ga0495606_0002075 | 3300046507 | Bacteria | 24486 |
| 316 | Ga0495606_0003306 | 3300046507 | Bacteria | 17217 |
| 317 | Ga0495606_0012296 | 3300046507 | Bacteria | 6884 |
| 318 | Ga0495606_0065931 | 3300046507 | Bacteria | 2298 |
| 319 | Ga0495610_0001089 | 3300046512 | Bacteria | 24852 |
| 320 | Ga0495610_0004091 | 3300046512 | Bacteria | 10927 |
| 321 | Ga0495610_0012001 | 3300046512 | Bacteria | 5249 |
| 322 | Ga0495610_0012622 | 3300046512 | Bacteria | 5071 |
| 323 | Ga0495610_0017558 | 3300046512 | Bacteria | 4076 |
| 324 | Ga0495610_0020005 | 3300046512 | Bacteria | 3729 |
| 325 | Ga0495610_0020231 | 3300046512 | Bacteria | 3700 |
| 326 | Ga0495610_0054924 | 3300046512 | Bacteria | 1922 |
| 327 | Ga0495610_0056084 | 3300046512 | Bacteria | 1896 |
| 328 | Ga0495616_0017235 | 3300046513 | Bacteria | 3984 |
| 329 | Ga0495616_0021128 | 3300046513 | Bacteria | 3529 |
| 330 | Ga0495616_0025932 | 3300046513 | Bacteria | 3125 |
| 331 | Ga0495616_0052285 | 3300046513 | Bacteria | 2034 |
| 332 | Ga0495620_0000011 | 3300046515 | Bacteria | 170987 |
| 333 | Ga0495620_0000314 | 3300046515 | Bacteria | 34524 |
| 334 | Ga0495620_0004729 | 3300046515 | Bacteria | 7653 |
| 335 | Ga0495620_0006281 | 3300046515 | Bacteria | 6539 |
| 336 | Ga0495620_0015603 | 3300046515 | Bacteria | 3831 |
| 337 | Ga0495620_0015924 | 3300046515 | Bacteria | 3785 |
| 338 | Ga0495630_0026502 | 3300046517 | Bacteria | 4292 |
| 339 | Ga0495630_0050454 | 3300046517 | Bacteria | 3114 |
| 340 | Ga0495631_0000275 | 3300046518 | Bacteria | 35971 |
| 341 | Ga0495631_0008361 | 3300046518 | Bacteria | 5215 |
| 342 | Ga0495631_0015699 | 3300046518 | Bacteria | 3622 |
| 343 | Ga0495631_0031460 | 3300046518 | Bacteria | 2400 |
| 344 | Ga0495631_0072768 | 3300046518 | Bacteria | 1484 |
| 345 | Ga0495632_0001446 | 3300046519 | Bacteria | 19737 |
| 346 | Ga0495632_0001462 | 3300046519 | Bacteria | 19633 |
| 347 | Ga0495632_0002289 | 3300046519 | Bacteria | 14750 |
| 348 | Ga0495632_0017216 | 3300046519 | Bacteria | 3996 |
| 349 | Ga0495632_0030936 | 3300046519 | Bacteria | 2773 |
| 350 | Ga0495632_0031263 | 3300046519 | Bacteria | 2754 |
| 351 | Ga0495632_0034581 | 3300046519 | Bacteria | 2585 |
| 352 | Ga0495632_0159273 | 3300046519 | Bacteria | 1040 |
| 353 | Ga0495637_0000027 | 3300046520 | Bacteria | 146241 |
| 354 | Ga0495637_0001476 | 3300046520 | Bacteria | 13811 |
| 355 | Ga0495637_0009577 | 3300046520 | Bacteria | 4722 |
| 356 | Ga0495637_0014696 | 3300046520 | Bacteria | 3688 |
| 357 | Ga0495637_0021018 | 3300046520 | Bacteria | 2994 |
| 358 | Ga0495637_0046539 | 3300046520 | Bacteria | 1834 |
| 359 | Ga0495637_0047143 | 3300046520 | Bacteria | 1820 |
| 360 | Ga0495637_0058025 | 3300046520 | Bacteria | 1596 |
| 361 | Ga0495643_0005300 | 3300046522 | Bacteria | 8753 |
| 362 | Ga0495643_0005423 | 3300046522 | Bacteria | 8632 |
| 363 | Ga0495643_0009526 | 3300046522 | Bacteria | 6032 |
| 364 | Ga0495643_0011839 | 3300046522 | Bacteria | 5289 |
| 365 | Ga0495643_0013261 | 3300046522 | Bacteria | 4939 |
| 366 | Ga0495643_0051388 | 3300046522 | Bacteria | 2216 |
| 367 | Ga0495643_0073857 | 3300046522 | Bacteria | 1786 |
| 368 | Ga0495644_0007674 | 3300046523 | Bacteria | 4160 |
| 369 | Ga0495644_0007800 | 3300046523 | Bacteria | 4125 |
| 370 | Ga0495644_0008624 | 3300046523 | Bacteria | 3925 |
| 371 | Ga0495644_0026710 | 3300046523 | Bacteria | 2189 |
| 372 | Ga0495644_0061101 | 3300046523 | Bacteria | 1416 |
| 373 | Ga0495648_0008539 | 3300046524 | Bacteria | 8045 |
| 374 | Ga0495648_0012258 | 3300046524 | Bacteria | 6405 |
| 375 | Ga0495648_0012950 | 3300046524 | Bacteria | 6194 |
| 376 | Ga0495648_0014240 | 3300046524 | Bacteria | 5833 |
| 377 | Ga0495648_0017267 | 3300046524 | Bacteria | 5167 |
| 378 | Ga0495648_0026536 | 3300046524 | Bacteria | 3896 |
| 379 | Ga0495648_0027428 | 3300046524 | Bacteria | 3812 |
| 380 | Ga0495648_0027839 | 3300046524 | Bacteria | 3776 |
| 381 | Ga0495648_0053570 | 3300046524 | Bacteria | 2443 |
| 382 | Ga0495648_0062290 | 3300046524 | Bacteria | 2209 |
| 383 | Ga0495648_0066672 | 3300046524 | Bacteria | 2109 |
| 384 | Ga0495648_0089331 | 3300046524 | Bacteria | 1729 |
| 385 | Ga0495648_0116059 | 3300046524 | Bacteria | 1447 |
| 386 | Ga0495648_0134845 | 3300046524 | Bacteria | 1307 |
| 387 | Ga0495666_0001581 | 3300046526 | Bacteria | 11205 |
| 388 | Ga0495666_0013234 | 3300046526 | Bacteria | 4114 |
| 389 | Ga0495666_0027206 | 3300046526 | Bacteria | 2816 |
| 390 | Ga0495666_0040580 | 3300046526 | Bacteria | 2256 |
| 391 | Ga0495666_0097428 | 3300046526 | Bacteria | 1386 |
| 392 | Ga0495642_0000067 | 3300046528 | Bacteria | 61823 |
| 393 | Ga0495642_0000334 | 3300046528 | Bacteria | 25618 |
| 394 | Ga0495642_0017588 | 3300046528 | Bacteria | 2794 |
| 395 | Ga0495654_0000658 | 3300046530 | Bacteria | 27234 |
| 396 | Ga0495654_0001188 | 3300046530 | Bacteria | 18540 |
| 397 | Ga0495654_0005001 | 3300046530 | Bacteria | 7787 |
| 398 | Ga0495654_0015040 | 3300046530 | Bacteria | 4111 |
| 399 | Ga0495654_0023658 | 3300046530 | Bacteria | 3180 |
| 400 | Ga0495654_0029233 | 3300046530 | Bacteria | 2811 |
| 401 | Ga0495654_0030989 | 3300046530 | Bacteria | 2716 |
| 402 | Ga0495654_0032361 | 3300046530 | Bacteria | 2651 |
| 403 | Ga0495654_0034513 | 3300046530 | Bacteria | 2551 |
| 404 | Ga0495654_0046604 | 3300046530 | Bacteria | 2134 |
| 405 | Ga0495654_0055750 | 3300046530 | Bacteria | 1912 |
| 406 | Ga0495654_0074947 | 3300046530 | Bacteria | 1597 |
| 407 | Ga0495586_0014791 | 3300046535 | Bacteria | 4148 |
| 408 | Ga0495587_0030587 | 3300046536 | Bacteria | 3264 |
| 409 | Ga0495609_0000206 | 3300046538 | Bacteria | 58720 |
| 410 | Ga0495609_0006540 | 3300046538 | Bacteria | 5937 |
| 411 | Ga0495609_0034354 | 3300046538 | Bacteria | 2299 |
| 412 | Ga0495597_0007463 | 3300046542 | Bacteria | 5549 |
| 413 | Ga0495597_0011774 | 3300046542 | Bacteria | 4236 |
| 414 | Ga0495597_0055416 | 3300046542 | Bacteria | 1738 |
| 415 | Ga0495597_0080126 | 3300046542 | Bacteria | 1397 |
| 416 | Ga0495597_0090277 | 3300046542 | Bacteria | 1301 |
| 417 | Ga0495645_0033668 | 3300046543 | Bacteria | 3738 |
| 418 | Ga0495622_0000638 | 3300046557 | Bacteria | 20320 |
| 419 | Ga0495622_0004006 | 3300046557 | Bacteria | 6876 |
| 420 | Ga0495622_0005661 | 3300046557 | Bacteria | 5793 |
| 421 | Ga0495622_0008757 | 3300046557 | Bacteria | 4688 |
| 422 | Ga0495622_0015265 | 3300046557 | Bacteria | 3570 |
| 423 | Ga0495622_0033067 | 3300046557 | Bacteria | 2414 |
| 424 | Ga0495633_0023203 | 3300046558 | Bacteria | 3074 |
| 425 | Ga0495633_0036921 | 3300046558 | Bacteria | 2339 |
| 426 | Ga0495633_0038234 | 3300046558 | Bacteria | 2293 |
| 427 | Ga0495656_0015464 | 3300046615 | Bacteria | 2880 |
| 428 | Ga0495668_0003932 | 3300046616 | Bacteria | 10849 |
| 429 | Ga0495668_0020336 | 3300046616 | Bacteria | 3819 |
| 430 | Ga0495634_0004634 | 3300046642 | Bacteria | 10725 |
| 431 | Ga0495634_0089760 | 3300046642 | Bacteria | 1997 |
| 432 | Ga0495611_0004712 | 3300046648 | Bacteria | 5858 |
| 433 | Ga0495611_0039564 | 3300046648 | Bacteria | 2099 |
| 434 | Ga0495611_0201529 | 3300046648 | Bacteria | 928 |
| 435 | Ga0495625_0000296 | 3300046660 | Bacteria | 77050 |
| 436 | Ga0495625_0003091 | 3300046660 | Bacteria | 17000 |
| 437 | Ga0495625_0020945 | 3300046660 | Bacteria | 5041 |
| 438 | Ga0495625_0030847 | 3300046660 | Bacteria | 3994 |
| 439 | Ga0495625_0036429 | 3300046660 | Bacteria | 3616 |
| 440 | Ga0495625_0224082 | 3300046660 | Bacteria | 1230 |
| 441 | Ga0495635_0001148 | 3300046663 | Bacteria | 17665 |
| 442 | Ga0495659_0000598 | 3300046664 | Bacteria | 13341 |
| 443 | Ga0495659_0004432 | 3300046664 | Bacteria | 4422 |
| 444 | Ga0495659_0014043 | 3300046664 | Bacteria | 2615 |
| 445 | Ga0495661_0000119 | 3300046665 | Bacteria | 94133 |
| 446 | Ga0495661_0014902 | 3300046665 | Bacteria | 5198 |
| 447 | Ga0495661_0016659 | 3300046665 | Bacteria | 4865 |
| 448 | Ga0495661_0020600 | 3300046665 | Bacteria | 4303 |
| 449 | Ga0495661_0039361 | 3300046665 | Bacteria | 2938 |
| 450 | Ga0495661_0040715 | 3300046665 | Bacteria | 2879 |
| 451 | Ga0495661_0064652 | 3300046665 | Bacteria | 2157 |
| 452 | Ga0495588_0007905 | 3300046674 | Bacteria | 4859 |
| 453 | Ga0495588_0104023 | 3300046674 | Bacteria | 1493 |
| 454 | Ga0495657_0253755 | 3300046675 | Bacteria | 1058 |
| 455 | Ga0495623_0004954 | 3300046679 | Bacteria | 8735 |
| 456 | Ga0495623_0096825 | 3300046679 | Bacteria | 1802 |
| 457 | Ga0495646_0018087 | 3300046680 | Bacteria | 4463 |
| 458 | Ga0495669_0063712 | 3300046684 | Bacteria | 1672 |
| 459 | Ga0495670_0004075 | 3300046691 | Bacteria | 7167 |
| 460 | Ga0495670_0012001 | 3300046691 | Bacteria | 4264 |
| 461 | Ga0495670_0024729 | 3300046691 | Bacteria | 2969 |
| 462 | Ga0495670_0031010 | 3300046691 | Bacteria | 2655 |
| 463 | Ga0495670_0032593 | 3300046691 | Bacteria | 2591 |
| 464 | Ga0495670_0043503 | 3300046691 | Bacteria | 2241 |
| 465 | Ga0495670_0063342 | 3300046691 | Bacteria | 1861 |
| 466 | Ga0495670_0082414 | 3300046691 | Bacteria | 1640 |
| 467 | Ga0495670_0162304 | 3300046691 | Bacteria | 1174 |
| 468 | Ga0495671_0001916 | 3300046692 | Bacteria | 13352 |
| 469 | Ga0495671_0002561 | 3300046692 | Bacteria | 11431 |
| 470 | Ga0495671_0004284 | 3300046692 | Bacteria | 8574 |
| 471 | Ga0495671_0009697 | 3300046692 | Bacteria | 5370 |
| 472 | Ga0495671_0010657 | 3300046692 | Bacteria | 5085 |
| 473 | Ga0495671_0018723 | 3300046692 | Bacteria | 3670 |
| 474 | Ga0495671_0031902 | 3300046692 | Bacteria | 2691 |
| 475 | Ga0495671_0033160 | 3300046692 | Bacteria | 2632 |
| 476 | Ga0495671_0039221 | 3300046692 | Bacteria | 2392 |
| 477 | Ga0495671_0090269 | 3300046692 | Bacteria | 1499 |
| 478 | Ga0495671_0118828 | 3300046692 | Bacteria | 1290 |
| 479 | Ga0495649_0002307 | 3300046694 | Bacteria | 13546 |
| 480 | Ga0495649_0010671 | 3300046694 | Bacteria | 5409 |
| 481 | Ga0495649_0015118 | 3300046694 | Bacteria | 4399 |
| 482 | Ga0495649_0019652 | 3300046694 | Bacteria | 3794 |
| 483 | Ga0495649_0022717 | 3300046694 | Bacteria | 3509 |
| 484 | Ga0495649_0029786 | 3300046694 | Bacteria | 3016 |
| 485 | Ga0495649_0033607 | 3300046694 | Bacteria | 2822 |
| 486 | Ga0495649_0037245 | 3300046694 | Bacteria | 2670 |
| 487 | Ga0495589_0000220 | 3300046794 | Bacteria | 48490 |
| 488 | Ga0495589_0000931 | 3300046794 | Bacteria | 17965 |
| 489 | Ga0495589_0003983 | 3300046794 | Bacteria | 7927 |
| 490 | Ga0495589_0056847 | 3300046794 | Bacteria | 1925 |
| 491 | Ga0495660_0002659 | 3300046810 | Bacteria | 11320 |
| 492 | Ga0495660_0007182 | 3300046810 | Bacteria | 6561 |
| 493 | Ga0495660_0012139 | 3300046810 | Bacteria | 4998 |
| 494 | Ga0495660_0017838 | 3300046810 | Bacteria | 4083 |
| 495 | Ga0495660_0018431 | 3300046810 | Bacteria | 4013 |
| 496 | Ga0495660_0021115 | 3300046810 | Bacteria | 3731 |
| 497 | Ga0495660_0043482 | 3300046810 | Bacteria | 2477 |
| 498 | Ga0495660_0051552 | 3300046810 | Bacteria | 2238 |
| 499 | Ga0495660_0127604 | 3300046810 | Bacteria | 1279 |
| 500 | Ga0495660_0167537 | 3300046810 | Bacteria | 1072 |
| 501 | Ga0495581_0003194 | 3300047315 | Bacteria | 9378 |
| 502 | Ga0495581_0025995 | 3300047315 | Bacteria | 3395 |
| 503 | Ga0495604_0010786 | 3300047317 | Bacteria | 7256 |
| 504 | Ga0495636_0051151 | 3300047318 | Bacteria | 1731 |
| 505 | Ga0495674_0028321 | 3300047319 | Bacteria | 5110 |
| 506 | Ga0495672_0000553 | 3300047320 | Bacteria | 42512 |
| 507 | Ga0495672_0008074 | 3300047320 | Bacteria | 7819 |
| 508 | Ga0495672_0010919 | 3300047320 | Bacteria | 6441 |
| 509 | Ga0495672_0012559 | 3300047320 | Bacteria | 5905 |
| 510 | Ga0495672_0014257 | 3300047320 | Bacteria | 5451 |
| 511 | Ga0495672_0017997 | 3300047320 | Bacteria | 4705 |
| 512 | Ga0495672_0025140 | 3300047320 | Bacteria | 3819 |
| 513 | Ga0495672_0029851 | 3300047320 | Bacteria | 3427 |
| 514 | Ga0495672_0030038 | 3300047320 | Bacteria | 3414 |
| 515 | Ga0495672_0036031 | 3300047320 | Bacteria | 3041 |
| 516 | Ga0495672_0050232 | 3300047320 | Bacteria | 2463 |
| 517 | Ga0495672_0058772 | 3300047320 | Bacteria | 2227 |
| 518 | Ga0495672_0106168 | 3300047320 | Bacteria | 1514 |
| 519 | Ga0495676_0000003 | 3300047321 | Bacteria | 318463 |
| 520 | Ga0495680_0009996 | 3300047322 | Bacteria | 8491 |
| 521 | Ga0495680_0026818 | 3300047322 | Bacteria | 4744 |
| 522 | Ga0495680_0050829 | 3300047322 | Bacteria | 3239 |
| 523 | Ga0495680_0054160 | 3300047322 | Bacteria | 3116 |
| 524 | Ga0495683_0000382 | 3300047323 | Bacteria | 36179 |
| 525 | Ga0495683_0000852 | 3300047323 | Bacteria | 21615 |
| 526 | Ga0495683_0009550 | 3300047323 | Bacteria | 5167 |
| 527 | Ga0495683_0011676 | 3300047323 | Bacteria | 4621 |
| 528 | Ga0495683_0013000 | 3300047323 | Bacteria | 4360 |
| 529 | Ga0495683_0016722 | 3300047323 | Bacteria | 3807 |
| 530 | Ga0495683_0057577 | 3300047323 | Bacteria | 1931 |
| 531 | Ga0495683_0106566 | 3300047323 | Bacteria | 1342 |
| 532 | Ga0495687_004098 | 3300047443 | Bacteria | 10082 |
| 533 | Ga0495687_004969 | 3300047443 | Bacteria | 8694 |
| 534 | Ga0495687_007403 | 3300047443 | Bacteria | 6468 |
| 535 | Ga0495687_053972 | 3300047443 | Bacteria | 1689 |
| 536 | Ga0495675_0020419 | 3300047444 | Bacteria | 4212 |
| 537 | Ga0495677_0000621 | 3300047445 | Bacteria | 14403 |
| 538 | Ga0495679_001158 | 3300047446 | Bacteria | 15748 |
| 539 | Ga0495679_003272 | 3300047446 | Bacteria | 7848 |
| 540 | Ga0495679_009848 | 3300047446 | Bacteria | 3792 |
| 541 | Ga0495685_012289 | 3300047447 | Bacteria | 2899 |
| 542 | Ga0495673_0000602 | 3300047469 | Bacteria | 35831 |
| 543 | Ga0495673_0000782 | 3300047469 | Bacteria | 30047 |
| 544 | Ga0495673_0002393 | 3300047469 | Bacteria | 13258 |
| 545 | Ga0495673_0003440 | 3300047469 | Bacteria | 10422 |
| 546 | Ga0495673_0010563 | 3300047469 | Bacteria | 5011 |
| 547 | Ga0495673_0016804 | 3300047469 | Bacteria | 3730 |
| 548 | Ga0495673_0029565 | 3300047469 | Bacteria | 2584 |
| 549 | Ga0495673_0035647 | 3300047469 | Bacteria | 2289 |
| 550 | Ga0495673_0038941 | 3300047469 | Bacteria | 2159 |
| 551 | Ga0495673_0052623 | 3300047469 | Bacteria | 1778 |
| 552 | Ga0495681_0005092 | 3300047470 | Bacteria | 8861 |
| 553 | Ga0495681_0007269 | 3300047470 | Bacteria | 7114 |
| 554 | Ga0495681_0009412 | 3300047470 | Bacteria | 6022 |
| 555 | Ga0495681_0010033 | 3300047470 | Bacteria | 5766 |
| 556 | Ga0495681_0011556 | 3300047470 | Bacteria | 5249 |
| 557 | Ga0495681_0012260 | 3300047470 | Bacteria | 5049 |
| 558 | Ga0495681_0014950 | 3300047470 | Bacteria | 4421 |
| 559 | Ga0495681_0017403 | 3300047470 | Bacteria | 3990 |
| 560 | Ga0495681_0023982 | 3300047470 | Bacteria | 3225 |
| 561 | Ga0495681_0027234 | 3300047470 | Bacteria | 2960 |
| 562 | Ga0495681_0033300 | 3300047470 | Bacteria | 2583 |
| 563 | Ga0495684_0035996 | 3300047471 | Bacteria | 3796 |
| 564 | Ga0495686_0010813 | 3300047472 | Bacteria | 6469 |
| 565 | Ga0495686_0047400 | 3300047472 | Bacteria | 2713 |
| 566 | Ga0495593_0008220 | 3300047673 | Bacteria | 6070 |
| 567 | Ga0495593_0023197 | 3300047673 | Bacteria | 3451 |
| 568 | Ga0495614_0036271 | 3300048089 | Bacteria | 2117 |
| 569 | Ga0495626_0000086 | 3300048091 | Bacteria | 123059 |
| 570 | Ga0495626_0001191 | 3300048091 | Bacteria | 21581 |
| 571 | Ga0495626_0001541 | 3300048091 | Bacteria | 18097 |
| 572 | Ga0495626_0002350 | 3300048091 | Bacteria | 13316 |
| 573 | Ga0495626_0005638 | 3300048091 | Bacteria | 7252 |
| 574 | Ga0495626_0005927 | 3300048091 | Bacteria | 7037 |
| 575 | Ga0495626_0099461 | 3300048091 | Bacteria | 1269 |
| 576 | Ga0496102_0000073 | 3300048905 | Bacteria | 149887 |
| 577 | Ga0496102_0055901 | 3300048905 | Bacteria | 3599 |
| 578 | Ga0496103_0051494 | 3300048906 | Bacteria | 2549 |
| 579 | Ga0496104_0409534 | 3300048907 | Bacteria | 1268 |
| 580 | Ga0496110_0150873 | 3300048913 | Bacteria | 2105 |
| 581 | Ga0496110_0215226 | 3300048913 | Bacteria | 1747 |
| 582 | Ga0496111_0159412 | 3300048914 | Bacteria | 1675 |
| 583 | Ga0496111_0334201 | 3300048914 | Bacteria | 1122 |
| 584 | Ga0496114_0102327 | 3300048917 | Bacteria | 2447 |
| 585 | Ga0496115_0021197 | 3300048918 | Bacteria | 5018 |
| 586 | Ga0496116_0000995 | 3300048919 | Bacteria | 34718 |
| 587 | Ga0496116_0015721 | 3300048919 | Bacteria | 5965 |
| 588 | Ga0496117_0013130 | 3300048920 | Bacteria | 7250 |
| 589 | Ga0496117_0014592 | 3300048920 | Bacteria | 6759 |
| 590 | Ga0496117_0022977 | 3300048920 | Bacteria | 4987 |
| 591 | Ga0496117_0024212 | 3300048920 | Bacteria | 4809 |
| 592 | Ga0496117_0024679 | 3300048920 | Bacteria | 4745 |
| 593 | Ga0496117_0025585 | 3300048920 | Bacteria | 4637 |
| 594 | Ga0496117_0044827 | 3300048920 | Bacteria | 3200 |
| 595 | Ga0496117_0103369 | 3300048920 | Bacteria | 1795 |
| 596 | Ga0496117_0200285 | 3300048920 | Bacteria | 1129 |
| 597 | Ga0496118_0020357 | 3300048921 | Bacteria | 5884 |
| 598 | Ga0496118_0022302 | 3300048921 | Bacteria | 5542 |
| 599 | Ga0496118_0023787 | 3300048921 | Bacteria | 5308 |
| 600 | Ga0496118_0025532 | 3300048921 | Bacteria | 5061 |
| 601 | Ga0496118_0031708 | 3300048921 | Bacteria | 4374 |
| 602 | Ga0496118_0044031 | 3300048921 | Bacteria | 3499 |
| 603 | Ga0496118_0052541 | 3300048921 | Bacteria | 3106 |
| 604 | Ga0496118_0054404 | 3300048921 | Bacteria | 3032 |
| 605 | Ga0496118_0083386 | 3300048921 | Bacteria | 2235 |
| 606 | Ga0496118_0112752 | 3300048921 | Bacteria | 1799 |
| 607 | Ga0496118_0117878 | 3300048921 | Bacteria | 1740 |
| 608 | Ga0496119_0002172 | 3300048922 | Bacteria | 22016 |
| 609 | Ga0496119_0007243 | 3300048922 | Bacteria | 10040 |
| 610 | Ga0496120_0002014 | 3300048923 | Bacteria | 22111 |
| 611 | Ga0496120_0005044 | 3300048923 | Bacteria | 10703 |
| 612 | Ga0496120_0146785 | 3300048923 | Bacteria | 1190 |
| 613 | Ga0496121_0001663 | 3300048924 | Bacteria | 36677 |
| 614 | Ga0496121_0005421 | 3300048924 | Bacteria | 16376 |
| 615 | Ga0496121_0026738 | 3300048924 | Bacteria | 5422 |
| 616 | Ga0496121_0028037 | 3300048924 | Bacteria | 5252 |
| 617 | Ga0496121_0030367 | 3300048924 | Bacteria | 4964 |
| 618 | Ga0496121_0094563 | 3300048924 | Bacteria | 2324 |
| 619 | Ga0496121_0175145 | 3300048924 | Bacteria | 1554 |
| 620 | Ga0496121_0191632 | 3300048924 | Bacteria | 1465 |
| 621 | Ga0496121_0358548 | 3300048924 | Bacteria | 969 |
| 622 | Ga0496122_0000244 | 3300048925 | Bacteria | 122107 |
| 623 | Ga0496122_0005970 | 3300048925 | Bacteria | 14253 |
| 624 | Ga0496122_0019091 | 3300048925 | Bacteria | 6285 |
| 625 | Ga0496122_0028352 | 3300048925 | Bacteria | 4754 |
| 626 | Ga0496122_0032031 | 3300048925 | Bacteria | 4357 |
| 627 | Ga0496122_0040945 | 3300048925 | Bacteria | 3672 |
| 628 | Ga0496122_0045809 | 3300048925 | Bacteria | 3394 |
| 629 | Ga0496122_0135941 | 3300048925 | Bacteria | 1549 |
| 630 | Ga0496123_0000201 | 3300048926 | Bacteria | 121915 |
| 631 | Ga0496123_0011426 | 3300048926 | Bacteria | 7696 |
| 632 | Ga0496123_0013135 | 3300048926 | Bacteria | 6983 |
| 633 | Ga0496123_0024807 | 3300048926 | Bacteria | 4542 |
| 634 | Ga0496123_0039495 | 3300048926 | Bacteria | 3300 |
| 635 | Ga0496123_0050969 | 3300048926 | Bacteria | 2761 |
| 636 | Ga0496123_0152347 | 3300048926 | Bacteria | 1245 |
| 637 | Ga0496124_0003104 | 3300048927 | Bacteria | 20627 |
| 638 | Ga0496124_0018543 | 3300048927 | Bacteria | 6514 |
| 639 | Ga0496124_0019143 | 3300048927 | Bacteria | 6387 |
| 640 | Ga0496124_0029065 | 3300048927 | Bacteria | 4932 |
| 641 | Ga0496124_0029690 | 3300048927 | Bacteria | 4864 |
| 642 | Ga0496124_0038621 | 3300048927 | Bacteria | 4144 |
| 643 | Ga0496124_0051265 | 3300048927 | Bacteria | 3512 |
| 644 | Ga0496124_0087049 | 3300048927 | Bacteria | 2555 |
| 645 | Ga0496124_0094458 | 3300048927 | Bacteria | 2432 |
| 646 | Ga0496124_0114604 | 3300048927 | Bacteria | 2164 |
| 647 | Ga0496125_0000862 | 3300048928 | Bacteria | 48602 |
| 648 | Ga0496125_0024867 | 3300048928 | Bacteria | 5496 |
| 649 | Ga0496125_0024937 | 3300048928 | Bacteria | 5488 |
| 650 | Ga0496125_0024954 | 3300048928 | Bacteria | 5485 |
| 651 | Ga0496125_0039292 | 3300048928 | Bacteria | 4077 |
| 652 | Ga0496125_0042139 | 3300048928 | Bacteria | 3893 |
| 653 | Ga0496125_0065178 | 3300048928 | Bacteria | 2888 |
| 654 | Ga0496125_0101603 | 3300048928 | Bacteria | 2115 |
| 655 | Ga0496126_0004738 | 3300048929 | Bacteria | 16040 |
| 656 | Ga0496126_0033523 | 3300048929 | Bacteria | 4830 |
| 657 | Ga0496126_0145215 | 3300048929 | Bacteria | 2038 |
| 658 | Ga0495678_008440 | 3300049459 | Bacteria | 5195 |
| 659 | Ga0495678_008505 | 3300049459 | Bacteria | 5169 |
| 660 | Ga0495678_009902 | 3300049459 | Bacteria | 4672 |
| 661 | Ga0495678_013485 | 3300049459 | Bacteria | 3837 |
| 662 | Ga0495678_021785 | 3300049459 | Bacteria | 2815 |
| 663 | Ga0495678_046866 | 3300049459 | Bacteria | 1696 |
| 664 | Ga0495678_061761 | 3300049459 | Bacteria | 1404 |
| 665 | Ga0495678_064843 | 3300049459 | Bacteria | 1358 |
| 666 | Ga0495682_0000138 | 3300049460 | Bacteria | 63246 |
| 667 | Ga0495682_0004702 | 3300049460 | Bacteria | 5780 |
| 668 | Ga0495682_0018407 | 3300049460 | Bacteria | 2630 |
| 669 | Ga0495682_0023955 | 3300049460 | Bacteria | 2278 |
| 670 | Ga0495682_0035889 | 3300049460 | Bacteria | 1825 |
| 671 | Ga0501032_0010934 | 3300049569 | Bacteria | 6526 |
| 672 | Ga0501034_0000003 | 3300049571 | Bacteria | 471748 |
| 673 | Ga0501034_0235891 | 3300049571 | Bacteria | 1777 |
| 674 | Ga0501034_0428665 | 3300049571 | Bacteria | 1243 |
| 675 | Ga0501037_0234027 | 3300049573 | Bacteria | 1289 |
| 676 | Ga0501226_000017 | 3300049853 | Bacteria | 150879 |
| 677 | nmdc:mga00v17_69450_c1 | 3300050491 | Bacteria | 2180 |
| 678 | nmdc:mga00v17_78588_c1 | 3300050491 | Bacteria | 2056 |
| 679 | Ga0500659_0063600 | 3300053135 | Bacteria | 1966 |
| 680 | 2511258060 | 2511231004 | Bacteria | 6669789 |
| 681 | 2511271543 | 2511231007 | Bacteria | 6306603 |
| 682 | 2511302942 | 2511231012 | Bacteria | 6738011 |
| 683 | 2511322862 | 2511231015 | Bacteria | 6598026 |
| 684 | 2511329322 | 2511231016 | Bacteria | 6704427 |
| 685 | 2511331381 | 2511231017 | Bacteria | 6503007 |
| 686 | 2511336178 | 2511231018 | Bacteria | 6436256 |
| 687 | 2511342237 | 2511231019 | Bacteria | 6520662 |
| 688 | 2511354953 | 2511231021 | Bacteria | 7302637 |
| 689 | 2511362726 | 2511231022 | Bacteria | 6719296 |
| 690 | 2511824964 | 2511231156 | Bacteria | 6845832 |
| 691 | 2555669224 | 2554235341 | Bacteria | 6867980 |
| 692 | 2599357878 | 2599185160 | Bacteria | 6844013 |
| 693 | 2599361631 | 2599185161 | Bacteria | 6960462 |
| 694 | 2599367953 | 2599185162 | Bacteria | 6957254 |
| 695 | 2599374742 | 2599185163 | Bacteria | 6995158 |
| 696 | 2599383043 | 2599185164 | Bacteria | 6841688 |
| 697 | 2599389574 | 2599185165 | Bacteria | 6843250 |
| 698 | 2599393600 | 2599185166 | Bacteria | 6959206 |
| 699 | 2599397862 | 2599185167 | Bacteria | 6353609 |
| 700 | 2599405367 | 2599185168 | Bacteria | 6997636 |
| 701 | 2599452309 | 2599185179 | Bacteria | 6611171 |
| 702 | 2599464694 | 2599185181 | Bacteria | 6844519 |
| 703 | 2599468244 | 2599185182 | Bacteria | 6883168 |
| 704 | 2599493717 | 2599185186 | Bacteria | 6831633 |
| 705 | 2599502315 | 2599185188 | Bacteria | 6164180 |
| 706 | 2599513312 | 2599185190 | Bacteria | 6285678 |
| 707 | 2599518188 | 2599185191 | Bacteria | 6297582 |
| 708 | 2599612842 | 2599185212 | Bacteria | 6765997 |
| 709 | 2599769044 | 2599185248 | Bacteria | 6696816 |
| 710 | 2599877985 | 2599185288 | Bacteria | 6666191 |
| 711 | 2599884843 | 2599185289 | Bacteria | 6778765 |
| 712 | 2599891988 | 2599185290 | Bacteria | 6289611 |
| 713 | 2599895979 | 2599185291 | Bacteria | 6775623 |
| 714 | 2599932623 | 2599185300 | Bacteria | 6062622 |
| 715 | 2599943375 | 2599185302 | Bacteria | 5954930 |
| 716 | 2599952207 | 2599185303 | Bacteria | 6512725 |
| 717 | 2599954486 | 2599185304 | Bacteria | 5951361 |
| 718 | 2599957864 | 2599185305 | Bacteria | 6748700 |
| 719 | 2599966787 | 2599185306 | Bacteria | 6637356 |
| 720 | 2599970390 | 2599185307 | Bacteria | 6194719 |
| 721 | 2599978066 | 2599185308 | Bacteria | 6621546 |
| 722 | 2599983799 | 2599185309 | Bacteria | 5969593 |
| 723 | 2599988695 | 2599185310 | Bacteria | 6014457 |
| 724 | 2599993354 | 2599185311 | Bacteria | 6354990 |
| 725 | 2600001401 | 2599185312 | Bacteria | 5912071 |
| 726 | 2600004039 | 2599185313 | Bacteria | 6658188 |
| 727 | 2600012207 | 2599185314 | Bacteria | 6621749 |
| 728 | 2600015587 | 2599185315 | Bacteria | 6771107 |
| 729 | 2600021941 | 2599185316 | Bacteria | 6320029 |
| 730 | 2600028546 | 2599185317 | Bacteria | 6435722 |
| 731 | 2600037538 | 2599185318 | Bacteria | 6961590 |
| 732 | 2600042867 | 2599185319 | Bacteria | 6637840 |
| 733 | 2600048604 | 2599185320 | Bacteria | 5963263 |
| 734 | 2600050795 | 2599185321 | Bacteria | 6764560 |
| 735 | 2600060077 | 2599185322 | Bacteria | 6763055 |
| 736 | 2600063298 | 2599185323 | Bacteria | 6688755 |
| 737 | 2600072673 | 2599185324 | Bacteria | 6590677 |
| 738 | 2600075215 | 2599185325 | Bacteria | 6324919 |
| 739 | 2600217416 | 2599185356 | Bacteria | 6843884 |
| 740 | 2600357713 | 2600254930 | Bacteria | 6431253 |
| 741 | 2600365632 | 2600254931 | Bacteria | 6734225 |
| 742 | 2600446630 | 2600254954 | Bacteria | 5100516 |
| 743 | 2601777586 | 2600255313 | Bacteria | 6842543 |
| 744 | 2602010829 | 2600255389 | Bacteria | 5275336 |
| 745 | 2621298795 | 2619619299 | Bacteria | 6649820 |
| 746 | 2624492660 | 2623620446 | Bacteria | 6500345 |
| 747 | 2643841653 | 2643221565 | Bacteria | 6216018 |
| 748 | 2643956968 | 2643221589 | Bacteria | 6250934 |
| 749 | 2644024891 | 2643221602 | Bacteria | 6249926 |
| 750 | 2644186760 | 2643221633 | Bacteria | 6733554 |
| 751 | 2644283938 | 2643221650 | Bacteria | 7029547 |
| 752 | 2652544946 | 2651869719 | Bacteria | 6047974 |
| 753 | 2671088671 | 2667528170 | Bacteria | 6786960 |
| 754 | 2671098273 | 2667528171 | Bacteria | 6900659 |
| 755 | 2671126289 | 2667528176 | Bacteria | 6724917 |
| 756 | 2677900729 | 2675903420 | Bacteria | 6247433 |
| 757 | 2678263601 | 2675903515 | Bacteria | 6580491 |
| 758 | 2729145489 | 2728369097 | Bacteria | 4333476 |
| 759 | 2738672044 | 2738541265 | Bacteria | 6594665 |
| 760 | 2738750437 | 2738541282 | Bacteria | 6593925 |
| 761 | 2738810032 | 2738541294 | Bacteria | 6925949 |
| 762 | 2738859478 | 2738541303 | Bacteria | 6591772 |
| 763 | 2738897392 | 2738541309 | Bacteria | 6926455 |
| 764 | 2739197683 | 2738543004 | Bacteria | 6381073 |
| 765 | 2739258597 | 2738543015 | Bacteria | 6750701 |
| 766 | 2739286375 | 2738543020 | Bacteria | 5718238 |
| 767 | 2739291688 | 2738543021 | Bacteria | 5718241 |
| 768 | 2745009932 | 2744054620 | Bacteria | 6551379 |
| 769 | 2774123241 | 2773857670 | Bacteria | 6407454 |
| 770 | 2784315765 | 2784132072 | Bacteria | 6596533 |
| 771 | 2794594850 | 2791355520 | Bacteria | 5948615 |
| 772 | 2808856270 | 2808606361 | Bacteria | 6136259 |
| 773 | 2808924710 | 2808606376 | Bacteria | 6248667 |
| 774 | 2808932978 | 2808606377 | Bacteria | 6646337 |
| 775 | 2808938991 | 2808606378 | Bacteria | 6177535 |
| 776 | 2808943241 | 2808606379 | Bacteria | 5022697 |
| 777 | 2808946708 | 2808606380 | Bacteria | 6248705 |
| 778 | 2808955123 | 2808606381 | Bacteria | 6646461 |
| 779 | 2808958309 | 2808606382 | Bacteria | 6841132 |
| 780 | 2808964762 | 2808606383 | Bacteria | 6138645 |
| 781 | 2808977000 | 2808606385 | Bacteria | 6711065 |
| 782 | 2808992155 | 2808606388 | Bacteria | 6706662 |
| 783 | 2809002100 | 2808606389 | Bacteria | 6138126 |
| 784 | 2812368046 | 2811994881 | Bacteria | 6298475 |
| 785 | 2817492044 | 2816332298 | Bacteria | 6852809 |
| 786 | 2819703344 | 2818991464 | Bacteria | 6907494 |
| 787 | 2823423410 | 2823421272 | Bacteria | 5372474 |
| 788 | 2825651975 | 2825651385 | Bacteria | 6715909 |
| 789 | 2834032858 | 2834028612 | Bacteria | 6354979 |
| 790 | 2842858150 | 2842854478 | Bacteria | 6143501 |
| 791 | 2844669659 | 2844665904 | Bacteria | 6817974 |
| 792 | 2852613666 | 2852612431 | Bacteria | 6885235 |
| 793 | 2852668598 | 2852667396 | Bacteria | 6885555 |
| 794 | 2860342340 | 2860339153 | Bacteria | 6846989 |
| 795 | 2904550568 | 2904550169 | Bacteria | 6221258 |
| 796 | 2913039677 | 2913036834 | Bacteria | 6704877 |
| 797 | 2917073027 | 2917070673 | Bacteria | 6868303 |
| 798 | 2919156765 | 2919155634 | Bacteria | 4860545 |
| 799 | 2919459020 | 2919456309 | Bacteria | 6586567 |
| 800 | 2919484767 | 2919481497 | Bacteria | 6907839 |
| 801 | 2919505220 | 2919501602 | Bacteria | 5286340 |
| 802 | 2919702646 | 2919697872 | Bacteria | 6553725 |
| 803 | 2923522098 | 2923519811 | Bacteria | 6298479 |
| 804 | 2923588446 | 2923586266 | Bacteria | 6565975 |
| 805 | 2926066897 | 2926063275 | Bacteria | 5285848 |
| 806 | 2929147582 | 2929144301 | Bacteria | 6622272 |
| 807 | 2931375147 | 2931369376 | Bacteria | 6847892 |
| 808 | 2931394537 | 2931390751 | Bacteria | 6273349 |
| 809 | 2931402423 | 2931396565 | Bacteria | 7251677 |
| 810 | 2935359443 | 2935353572 | Unclassified | 6955622 |
| 811 | 2939638499 | 2939636861 | Bacteria | 6297853 |
| 812 | 2945934226 | 2945928738 | Bacteria | 6053221 |
| 813 | 2988728860 | 2988728565 | Bacteria | 6124362 |
| 814 | 3007514619 | 3007511990 | Bacteria | 6481491 |
| 815 | 3007808261 | 3007803356 | Bacteria | 5931491 |
| 816 | 3007869135 | 3007866637 | Bacteria | 5899198 |
| 817 | 637319559 | 637000220 | Bacteria | 7074893 |
| 818 | 639788133 | 639633007 | Bacteria | 4376040 |
| 819 | 640488211 | 640427133 | Bacteria | 4567418 |
| 820 | 651176165 | 651053060 | Bacteria | 4689946 |
| 821 | 8011354595 | 8011350971 | Bacteria | 6158957 |
| 822 | 8019775663 | 8019769354 | Bacteria | 6924660 |
| 823 | 8019781052 | 8019775933 | Bacteria | 6858656 |
| 824 | 8034963697 | 8034962539 | Bacteria | 4884839 |
| 825 | 8052497779 | 8052494512 | Bacteria | 5765634 |
| 826 | 8054507050 | 8054503363 | Bacteria | 6101651 |
| 827 | 8055820115 | 8055817908 | Bacteria | 6609162 |
| 828 | 8055883312 | 8055878733 | Bacteria | 5907058 |
| 829 | 8056129298 | 8056125926 | Bacteria | 6228218 |
| 830 | 8056135481 | 8056131705 | Bacteria | 6107031 |
| 831 | 8056146203 | 8056143049 | Bacteria | 6307666 |
| 832 | 8056157623 | 8056155041 | Bacteria | 6486948 |
| 833 | 8056165253 | 8056161164 | Bacteria | 6106669 |
| 834 | 8057799663 | 8057798959 | Bacteria | 6713499 |
| 835 | Ga0453684_0246669 | |||
| 836 | MRS2a_Contig_5158 | |||
| 837 | SwRhRL2b_contig_1319436 | |||
| 838 | JGI25162J39368_1000050 | |||
| 839 | JGI25163J39215_1000351 | |||
| 840 | JGI25164J39214_1000025 | |||
| 841 | JGI25165J46597_1000114 | |||
| 842 | JGI25165J46597_1000176 | |||
| 843 | Ga0055530_10000075 | |||
| 844 | Ga0055530_10032368 | |||
| 845 | Ga0055540_1000115 | |||
| 846 | Ga0065714_10000744 | |||
| 847 | Ga0065714_10002340 | |||
| 848 | Ga0065714_10006336 | |||
| 849 | Ga0065714_10029782 | |||
| 850 | Ga0065714_10074007 | |||
| 851 | Ga0065714_10083749 | |||
| 852 | Ga0065714_10092038 | |||
| 853 | Ga0065714_10092661 | |||
| 854 | Ga0065704_10000778 | |||
| 855 | Ga0065704_10009688 | |||
| 856 | Ga0065704_10072252 | |||
| 857 | Ga0065712_10008598 | |||
| 858 | Ga0065715_10281495 | |||
| 859 | Ga0070670_100000303 | |||
| 860 | Ga0070661_100002107 | |||
| 861 | Ga0070669_100030218 | |||
| 862 | Ga0070662_100001726 | |||
| 863 | Ga0070664_100002981 | |||
| 864 | Ga0068854_100204646 | |||
| 865 | Ga0068851_10000132 | |||
| 866 | Ga0075432_10001039 | |||
| 867 | Ga0075432_10008235 | |||
| 868 | Ga0075432_10016885 | |||
| 869 | Ga0075362_10012119 | |||
| 870 | Ga0099823_1000001 | |||
| 871 | Ga0079104_1000303 | |||
| 872 | Ga0079104_1000554 | |||
| 873 | Ga0105251_10000038 | |||
| 874 | Ga0105251_10002494 | |||
| 875 | Ga0105251_10010425 | |||
| 876 | Ga0105251_10012550 | |||
| 877 | Ga0105244_10000016 | |||
| 878 | Ga0105244_10001524 | |||
| 879 | Ga0105244_10004851 | |||
| 880 | Ga0105244_10008586 | |||
| 881 | Ga0105244_10014628 | |||
| 882 | Ga0105244_10016545 | |||
| 883 | Ga0105244_10084222 | |||
| 884 | Ga0105244_10111564 | |||
| 885 | Ga0105250_10000353 | |||
| 886 | Ga0105250_10027363 | |||
| 887 | Ga0105243_10014929 | |||
| 888 | Ga0105243_10039721 | |||
| 889 | Ga0105243_10054921 | |||
| 890 | Ga0105242_10022928 | |||
| 891 | Ga0105248_10712762 | |||
| 892 | Ga0105237_10006234 | |||
| 893 | Ga0105246_10047293 | |||
| 894 | Ga0157373_10001148 | |||
| 895 | Ga0157373_10006474 | |||
| 896 | Ga0157373_10008114 | |||
| 897 | Ga0157373_10086368 | |||
| 898 | Ga0157371_10001502 | |||
| 899 | Ga0157371_10001866 | |||
| 900 | Ga0157371_10054590 | |||
| 901 | Ga0157370_10001953 | |||
| 902 | Ga0157370_10134614 | |||
| 903 | Ga0157370_10135693 | |||
| 904 | Ga0157369_10009531 | |||
| 905 | Ga0157369_10011089 | |||
| 906 | Ga0157369_10012461 | |||
| 907 | Ga0163162_10421486 | |||
| 908 | Ga0157372_10001218 | |||
| 909 | Ga0157375_10188795 | |||
| 910 | Ga0182008_10000604 | |||
| 911 | Ga0182008_10007960 | |||
| 912 | Ga0182008_10009829 | |||
| 913 | Ga0182008_10040881 | |||
| 914 | Ga0182006_1001202 | |||
| 915 | Ga0182006_1003368 | |||
| 916 | Ga0182006_1007155 | |||
| 917 | Ga0182006_1061485 | |||
| 918 | Ga0182007_10000071 | |||
| 919 | Ga0182007_10001255 | |||
| 920 | Ga0182007_10013309 | |||
| 921 | Ga0182005_1000524 | |||
| 922 | Ga0182005_1002580 | |||
| 923 | Ga0182005_1017753 | |||
| 924 | Ga0163161_10004705 | |||
| 925 | Ga0163161_10006045 | |||
| 926 | Ga0163161_10013164 | |||
| 927 | Ga0163161_10040096 | |||
| 928 | Ga0163161_10044526 | |||
| 929 | Ga0163161_10075880 | |||
| 930 | Ga0163161_10119533 | |||
| 931 | Ga0209760_100033 | |||
| 932 | Ga0207427_100003 | |||
| 933 | Ga0209437_100002 | |||
| 934 | Ga0209233_1000004 | |||
| 935 | Ga0209676_1000617 | |||
| 936 | Ga0209676_1004064 | |||
| 937 | Ga0209676_1008768 | |||
| 938 | Ga0209050_1000013 | |||
| 939 | Ga0209050_1000914 | |||
| 940 | Ga0209051_1000007 | |||
| 941 | Ga0209257_1011899 | |||
| 942 | Ga0207656_10000287 | |||
| 943 | Ga0207696_1000016 | |||
| 944 | Ga0207696_1000108 | |||
| 945 | Ga0207696_1024126 | |||
| 946 | Ga0207655_1000027 | |||
| 947 | Ga0207655_1000114 | |||
| 948 | Ga0207655_1000384 | |||
| 949 | Ga0207655_1002020 | |||
| 950 | Ga0207655_1003059 | |||
| 951 | Ga0207655_1022254 | |||
| 952 | Ga0207713_1000185 | |||
| 953 | Ga0207713_1001969 | |||
| 954 | Ga0207713_1002029 | |||
| 955 | Ga0207713_1006075 | |||
| 956 | Ga0207713_1015292 | |||
| 957 | Ga0207713_1032451 | |||
| 958 | Ga0207671_10001354 | |||
| 959 | Ga0207649_10000577 | |||
| 960 | Ga0207681_10006717 | |||
| 961 | Ga0207650_10000068 | |||
| 962 | Ga0207706_10004228 | |||
| 963 | Ga0207686_10046243 | |||
| 964 | Ga0207709_10003872 | |||
| 965 | Ga0207709_10013552 | |||
| 966 | Ga0207709_10430934 | |||
| 967 | Ga0207679_10001702 | |||
| 968 | Ga0207640_10133741 | |||
| 969 | Ga0209281_1000009 | |||
| 970 | Ga0209281_1000063 | |||
| 971 | Ga0209389_1000007 | |||
| 972 | Ga0207428_10009356 | |||
| 973 | Ga0207428_10052476 | |||
| 974 | Ga0207428_10064906 | |||
| 975 | Ga0207428_10142031 | |||
| 976 | Ga0207428_10155921 | |||
| 977 | Ga0207428_10256962 | |||
| 978 | Ga0307408_100000018 | |||
| 979 | Ga0307408_100014570 | |||
| 980 | Ga0307408_100094845 | |||
| 981 | Ga0307405_10000137 | |||
| 982 | Ga0307405_10005300 | |||
| 983 | Ga0307405_10074088 | |||
| 984 | Ga0307405_10392857 | |||
| 985 | Ga0307406_10183447 | |||
| 986 | Ga0307406_10324395 | |||
| 987 | Ga0307407_10208722 | |||
| 988 | Ga0307412_10029725 | |||
| 989 | Ga0307412_10115139 | |||
| 990 | Ga0307416_100234527 | |||
| 991 | Ga0307414_10052408 | |||
| 992 | Ga0307414_10088530 | |||
| 993 | Ga0307414_10193598 | |||
| 994 | Ga0307411_10020277 | |||
| 995 | Ga0307411_10075767 | |||
| 996 | Ga0439438_003908 | |||
| 997 | Ga0439438_004339 | |||
| 998 | Ga0439438_005962 | |||
| 999 | Ga0439438_013043 | |||
| 1000 | Ga0439438_017339 | |||
| 1001 | Ga0439447_003607 | |||
| 1002 | Ga0439447_004429 | |||
| 1003 | Ga0439447_009200 | |||
| 1004 | Ga0439447_015362 | |||
| 1005 | Ga0439466_0002538 | |||
| 1006 | Ga0439466_0004357 | |||
| 1007 | Ga0439466_0006691 | |||
| 1008 | Ga0439466_0009076 | |||
| 1009 | Ga0439466_0015463 | |||
| 1010 | Ga0439466_0030632 | |||
| 1011 | Ga0439465_0008365 | |||
| 1012 | Ga0439431_0002411 | |||
| 1013 | Ga0439432_000171 | |||
| 1014 | Ga0439432_007279 | |||
| 1015 | Ga0439432_010393 | |||
| 1016 | Ga0439432_013015 | |||
| 1017 | Ga0439451_010572 | |||
| 1018 | Ga0439451_016675 | |||
| 1019 | Ga0439451_036055 | |||
| 1020 | Ga0439452_000677 | |||
| 1021 | Ga0439452_003056 | |||
| 1022 | Ga0439452_004545 | |||
| 1023 | Ga0439452_004693 | |||
| 1024 | Ga0439452_007797 | |||
| 1025 | Ga0439452_009314 | |||
| 1026 | Ga0439452_010565 | |||
| 1027 | Ga0439452_018732 | |||
| 1028 | Ga0439456_004218 | |||
| 1029 | Ga0439463_002247 | |||
| 1030 | Ga0439463_004592 | |||
| 1031 | Ga0450911_002259 | |||
| 1032 | Ga0450911_002820 | |||
| 1033 | Ga0450911_003118 | |||
| 1034 | Ga0450911_010864 | |||
| 1035 | Ga0450920_000960 | |||
| 1036 | Ga0450922_000360 | |||
| 1037 | Ga0450890_000606 | |||
| 1038 | Ga0450894_002753 | |||
| 1039 | Ga0450898_000712 | |||
| 1040 | Ga0450899_001487 | |||
| 1041 | Ga0450902_001289 | |||
| 1042 | Ga0450902_003671 | |||
| 1043 | Ga0450902_006821 | |||
| 1044 | Ga0450903_001686 | |||
| 1045 | Ga0450903_001697 | |||
| 1046 | Ga0450905_001436 | |||
| 1047 | Ga0450906_003228 | |||
| 1048 | Ga0450907_000140 | |||
| 1049 | Ga0450907_025237 | |||
| 1050 | Ga0450910_002522 | |||
| 1051 | Ga0450910_009742 | |||
| 1052 | Ga0439446_0028856 | |||
| 1053 | Ga0450908_001543 | |||
| 1054 | Ga0450908_005901 | |||
| 1055 | Ga0450909_002131 | |||
| 1056 | Ga0439434_0002427 | |||
| 1057 | Ga0439434_0004141 | |||
| 1058 | Ga0439464_0000443 | |||
| 1059 | Ga0439464_0016060 | |||
| 1060 | Ga0439460_0002498 | |||
| 1061 | Ga0439460_0005265 | |||
| 1062 | Ga0450901_002227 | |||
| 1063 | Ga0439440_0001299 | |||
| 1064 | Ga0439440_0012945 | |||
| 1065 | Ga0439440_0040919 | |||
| 1066 | Ga0451576_0000591 | |||
| 1067 | Ga0495617_000826 | |||
| 1068 | Ga0495617_005450 | |||
| 1069 | Ga0495617_007936 | |||
| 1070 | Ga0495617_008755 | |||
| 1071 | Ga0495617_009711 | |||
| 1072 | Ga0495617_065742 | |||
| 1073 | Ga0495627_005583 | |||
| 1074 | Ga0495603_0004426 | |||
| 1075 | Ga0495603_0036666 | |||
| 1076 | Ga0495590_0002605 | |||
| 1077 | Ga0495590_0006559 | |||
| 1078 | Ga0495590_0025540 | |||
| 1079 | Ga0495590_0070917 | |||
| 1080 | Ga0495591_000174 | |||
| 1081 | Ga0495591_000697 | |||
| 1082 | Ga0495591_000809 | |||
| 1083 | Ga0495591_001735 | |||
| 1084 | Ga0495591_008718 | |||
| 1085 | Ga0495591_015979 | |||
| 1086 | Ga0495591_031472 | |||
| 1087 | Ga0495629_0093107 | |||
| 1088 | Ga0495638_0003448 | |||
| 1089 | Ga0495638_0011837 | |||
| 1090 | Ga0495638_0021838 | |||
| 1091 | Ga0495638_0036107 | |||
| 1092 | Ga0495638_0058887 | |||
| 1093 | Ga0495638_0123132 | |||
| 1094 | Ga0495638_0223700 | |||
| 1095 | Ga0495653_0049230 | |||
| 1096 | Ga0495653_0288031 | |||
| 1097 | Ga0495650_0001051 | |||
| 1098 | Ga0495650_0002388 | |||
| 1099 | Ga0495650_0006072 | |||
| 1100 | Ga0495650_0008122 | |||
| 1101 | Ga0495650_0011840 | |||
| 1102 | Ga0495650_0031224 | |||
| 1103 | Ga0495580_0326583 | |||
| 1104 | Ga0495582_0015874 | |||
| 1105 | Ga0495605_0000076 | |||
| 1106 | Ga0495605_0001638 | |||
| 1107 | Ga0495605_0002121 | |||
| 1108 | Ga0495605_0002432 | |||
| 1109 | Ga0495605_0011566 | |||
| 1110 | Ga0495605_0017220 | |||
| 1111 | Ga0495605_0023402 | |||
| 1112 | Ga0495605_0036829 | |||
| 1113 | Ga0495639_0000563 | |||
| 1114 | Ga0495639_0007071 | |||
| 1115 | Ga0495639_0041389 | |||
| 1116 | Ga0495584_0001241 | |||
| 1117 | Ga0495584_0001301 | |||
| 1118 | Ga0495584_0002919 | |||
| 1119 | Ga0495584_0003118 | |||
| 1120 | Ga0495584_0004135 | |||
| 1121 | Ga0495584_0004362 | |||
| 1122 | Ga0495584_0007572 | |||
| 1123 | Ga0495584_0014709 | |||
| 1124 | Ga0495584_0151165 | |||
| 1125 | Ga0495585_0000545 | |||
| 1126 | Ga0495585_0024521 | |||
| 1127 | Ga0495585_0029212 | |||
| 1128 | Ga0495585_0042777 | |||
| 1129 | Ga0495585_0153079 | |||
| 1130 | Ga0495594_0089341 | |||
| 1131 | Ga0495607_0000799 | |||
| 1132 | Ga0495607_0002369 | |||
| 1133 | Ga0495607_0011916 | |||
| 1134 | Ga0495607_0021849 | |||
| 1135 | Ga0495607_0034393 | |||
| 1136 | Ga0495607_0039962 | |||
| 1137 | Ga0495607_0043919 | |||
| 1138 | Ga0495607_0063519 | |||
| 1139 | Ga0495607_0148839 | |||
| 1140 | Ga0495607_0176741 | |||
| 1141 | Ga0495583_0000172 | |||
| 1142 | Ga0495583_0000813 | |||
| 1143 | Ga0495583_0005099 | |||
| 1144 | Ga0495583_0008503 | |||
| 1145 | Ga0495583_0014007 | |||
| 1146 | Ga0495583_0044567 | |||
| 1147 | Ga0495606_0000028 | |||
| 1148 | Ga0495606_0000684 | |||
| 1149 | Ga0495606_0002075 | |||
| 1150 | Ga0495606_0003306 | |||
| 1151 | Ga0495606_0012296 | |||
| 1152 | Ga0495606_0065931 | |||
| 1153 | Ga0495610_0001089 | |||
| 1154 | Ga0495610_0004091 | |||
| 1155 | Ga0495610_0012001 | |||
| 1156 | Ga0495610_0012622 | |||
| 1157 | Ga0495610_0017558 | |||
| 1158 | Ga0495610_0020005 | |||
| 1159 | Ga0495610_0020231 | |||
| 1160 | Ga0495610_0054924 | |||
| 1161 | Ga0495610_0056084 | |||
| 1162 | Ga0495616_0017235 | |||
| 1163 | Ga0495616_0021128 | |||
| 1164 | Ga0495616_0025932 | |||
| 1165 | Ga0495616_0052285 | |||
| 1166 | Ga0495620_0000011 | |||
| 1167 | Ga0495620_0000314 | |||
| 1168 | Ga0495620_0004729 | |||
| 1169 | Ga0495620_0006281 | |||
| 1170 | Ga0495620_0015603 | |||
| 1171 | Ga0495620_0015924 | |||
| 1172 | Ga0495630_0026502 | |||
| 1173 | Ga0495630_0050454 | |||
| 1174 | Ga0495631_0000275 | |||
| 1175 | Ga0495631_0008361 | |||
| 1176 | Ga0495631_0015699 | |||
| 1177 | Ga0495631_0031460 | |||
| 1178 | Ga0495631_0072768 | |||
| 1179 | Ga0495632_0001446 | |||
| 1180 | Ga0495632_0001462 | |||
| 1181 | Ga0495632_0002289 | |||
| 1182 | Ga0495632_0017216 | |||
| 1183 | Ga0495632_0030936 | |||
| 1184 | Ga0495632_0031263 | |||
| 1185 | Ga0495632_0034581 | |||
| 1186 | Ga0495632_0159273 | |||
| 1187 | Ga0495637_0000027 | |||
| 1188 | Ga0495637_0001476 | |||
| 1189 | Ga0495637_0009577 | |||
| 1190 | Ga0495637_0014696 | |||
| 1191 | Ga0495637_0021018 | |||
| 1192 | Ga0495637_0046539 | |||
| 1193 | Ga0495637_0047143 | |||
| 1194 | Ga0495637_0058025 | |||
| 1195 | Ga0495643_0005300 | |||
| 1196 | Ga0495643_0005423 | |||
| 1197 | Ga0495643_0009526 | |||
| 1198 | Ga0495643_0011839 | |||
| 1199 | Ga0495643_0013261 | |||
| 1200 | Ga0495643_0051388 | |||
| 1201 | Ga0495643_0073857 | |||
| 1202 | Ga0495644_0007674 | |||
| 1203 | Ga0495644_0007800 | |||
| 1204 | Ga0495644_0008624 | |||
| 1205 | Ga0495644_0026710 | |||
| 1206 | Ga0495644_0061101 | |||
| 1207 | Ga0495648_0008539 | |||
| 1208 | Ga0495648_0012258 | |||
| 1209 | Ga0495648_0012950 | |||
| 1210 | Ga0495648_0014240 | |||
| 1211 | Ga0495648_0017267 | |||
| 1212 | Ga0495648_0026536 | |||
| 1213 | Ga0495648_0027428 | |||
| 1214 | Ga0495648_0027839 | |||
| 1215 | Ga0495648_0053570 | |||
| 1216 | Ga0495648_0062290 | |||
| 1217 | Ga0495648_0066672 | |||
| 1218 | Ga0495648_0089331 | |||
| 1219 | Ga0495648_0116059 | |||
| 1220 | Ga0495648_0134845 | |||
| 1221 | Ga0495666_0001581 | |||
| 1222 | Ga0495666_0013234 | |||
| 1223 | Ga0495666_0027206 | |||
| 1224 | Ga0495666_0040580 | |||
| 1225 | Ga0495666_0097428 | |||
| 1226 | Ga0495642_0000067 | |||
| 1227 | Ga0495642_0000334 | |||
| 1228 | Ga0495642_0017588 | |||
| 1229 | Ga0495654_0000658 | |||
| 1230 | Ga0495654_0001188 | |||
| 1231 | Ga0495654_0005001 | |||
| 1232 | Ga0495654_0015040 | |||
| 1233 | Ga0495654_0023658 | |||
| 1234 | Ga0495654_0029233 | |||
| 1235 | Ga0495654_0030989 | |||
| 1236 | Ga0495654_0032361 | |||
| 1237 | Ga0495654_0034513 | |||
| 1238 | Ga0495654_0046604 | |||
| 1239 | Ga0495654_0055750 | |||
| 1240 | Ga0495654_0074947 | |||
| 1241 | Ga0495586_0014791 | |||
| 1242 | Ga0495587_0030587 | |||
| 1243 | Ga0495609_0000206 | |||
| 1244 | Ga0495609_0006540 | |||
| 1245 | Ga0495609_0034354 | |||
| 1246 | Ga0495597_0007463 | |||
| 1247 | Ga0495597_0011774 | |||
| 1248 | Ga0495597_0055416 | |||
| 1249 | Ga0495597_0080126 | |||
| 1250 | Ga0495597_0090277 | |||
| 1251 | Ga0495645_0033668 | |||
| 1252 | Ga0495622_0000638 | |||
| 1253 | Ga0495622_0004006 | |||
| 1254 | Ga0495622_0005661 | |||
| 1255 | Ga0495622_0008757 | |||
| 1256 | Ga0495622_0015265 | |||
| 1257 | Ga0495622_0033067 | |||
| 1258 | Ga0495633_0023203 | |||
| 1259 | Ga0495633_0036921 | |||
| 1260 | Ga0495633_0038234 | |||
| 1261 | Ga0495656_0015464 | |||
| 1262 | Ga0495668_0003932 | |||
| 1263 | Ga0495668_0020336 | |||
| 1264 | Ga0495634_0004634 | |||
| 1265 | Ga0495634_0089760 | |||
| 1266 | Ga0495611_0004712 | |||
| 1267 | Ga0495611_0039564 | |||
| 1268 | Ga0495611_0201529 | |||
| 1269 | Ga0495625_0000296 | |||
| 1270 | Ga0495625_0003091 | |||
| 1271 | Ga0495625_0020945 | |||
| 1272 | Ga0495625_0030847 | |||
| 1273 | Ga0495625_0036429 | |||
| 1274 | Ga0495625_0224082 | |||
| 1275 | Ga0495635_0001148 | |||
| 1276 | Ga0495659_0000598 | |||
| 1277 | Ga0495659_0004432 | |||
| 1278 | Ga0495659_0014043 | |||
| 1279 | Ga0495661_0000119 | |||
| 1280 | Ga0495661_0014902 | |||
| 1281 | Ga0495661_0016659 | |||
| 1282 | Ga0495661_0020600 | |||
| 1283 | Ga0495661_0039361 | |||
| 1284 | Ga0495661_0040715 | |||
| 1285 | Ga0495661_0064652 | |||
| 1286 | Ga0495588_0007905 | |||
| 1287 | Ga0495588_0104023 | |||
| 1288 | Ga0495657_0253755 | |||
| 1289 | Ga0495623_0004954 | |||
| 1290 | Ga0495623_0096825 | |||
| 1291 | Ga0495646_0018087 | |||
| 1292 | Ga0495669_0063712 | |||
| 1293 | Ga0495670_0004075 | |||
| 1294 | Ga0495670_0012001 | |||
| 1295 | Ga0495670_0024729 | |||
| 1296 | Ga0495670_0031010 | |||
| 1297 | Ga0495670_0032593 | |||
| 1298 | Ga0495670_0043503 | |||
| 1299 | Ga0495670_0063342 | |||
| 1300 | Ga0495670_0082414 | |||
| 1301 | Ga0495670_0162304 | |||
| 1302 | Ga0495671_0001916 | |||
| 1303 | Ga0495671_0002561 | |||
| 1304 | Ga0495671_0004284 | |||
| 1305 | Ga0495671_0009697 | |||
| 1306 | Ga0495671_0010657 | |||
| 1307 | Ga0495671_0018723 | |||
| 1308 | Ga0495671_0031902 | |||
| 1309 | Ga0495671_0033160 | |||
| 1310 | Ga0495671_0039221 | |||
| 1311 | Ga0495671_0090269 | |||
| 1312 | Ga0495671_0118828 | |||
| 1313 | Ga0495649_0002307 | |||
| 1314 | Ga0495649_0010671 | |||
| 1315 | Ga0495649_0015118 | |||
| 1316 | Ga0495649_0019652 | |||
| 1317 | Ga0495649_0022717 | |||
| 1318 | Ga0495649_0029786 | |||
| 1319 | Ga0495649_0033607 | |||
| 1320 | Ga0495649_0037245 | |||
| 1321 | Ga0495589_0000220 | |||
| 1322 | Ga0495589_0000931 | |||
| 1323 | Ga0495589_0003983 | |||
| 1324 | Ga0495589_0056847 | |||
| 1325 | Ga0495660_0002659 | |||
| 1326 | Ga0495660_0007182 | |||
| 1327 | Ga0495660_0012139 | |||
| 1328 | Ga0495660_0017838 | |||
| 1329 | Ga0495660_0018431 | |||
| 1330 | Ga0495660_0021115 | |||
| 1331 | Ga0495660_0043482 | |||
| 1332 | Ga0495660_0051552 | |||
| 1333 | Ga0495660_0127604 | |||
| 1334 | Ga0495660_0167537 | |||
| 1335 | Ga0495581_0003194 | |||
| 1336 | Ga0495581_0025995 | |||
| 1337 | Ga0495604_0010786 | |||
| 1338 | Ga0495636_0051151 | |||
| 1339 | Ga0495674_0028321 | |||
| 1340 | Ga0495672_0000553 | |||
| 1341 | Ga0495672_0008074 | |||
| 1342 | Ga0495672_0010919 | |||
| 1343 | Ga0495672_0012559 | |||
| 1344 | Ga0495672_0014257 | |||
| 1345 | Ga0495672_0017997 | |||
| 1346 | Ga0495672_0025140 | |||
| 1347 | Ga0495672_0029851 | |||
| 1348 | Ga0495672_0030038 | |||
| 1349 | Ga0495672_0036031 | |||
| 1350 | Ga0495672_0050232 | |||
| 1351 | Ga0495672_0058772 | |||
| 1352 | Ga0495672_0106168 | |||
| 1353 | Ga0495676_0000003 | |||
| 1354 | Ga0495680_0009996 | |||
| 1355 | Ga0495680_0026818 | |||
| 1356 | Ga0495680_0050829 | |||
| 1357 | Ga0495680_0054160 | |||
| 1358 | Ga0495683_0000382 | |||
| 1359 | Ga0495683_0000852 | |||
| 1360 | Ga0495683_0009550 | |||
| 1361 | Ga0495683_0011676 | |||
| 1362 | Ga0495683_0013000 | |||
| 1363 | Ga0495683_0016722 | |||
| 1364 | Ga0495683_0057577 | |||
| 1365 | Ga0495683_0106566 | |||
| 1366 | Ga0495687_004098 | |||
| 1367 | Ga0495687_004969 | |||
| 1368 | Ga0495687_007403 | |||
| 1369 | Ga0495687_053972 | |||
| 1370 | Ga0495675_0020419 | |||
| 1371 | Ga0495677_0000621 | |||
| 1372 | Ga0495679_001158 | |||
| 1373 | Ga0495679_003272 | |||
| 1374 | Ga0495679_009848 | |||
| 1375 | Ga0495685_012289 | |||
| 1376 | Ga0495673_0000602 | |||
| 1377 | Ga0495673_0000782 | |||
| 1378 | Ga0495673_0002393 | |||
| 1379 | Ga0495673_0003440 | |||
| 1380 | Ga0495673_0010563 | |||
| 1381 | Ga0495673_0016804 | |||
| 1382 | Ga0495673_0029565 | |||
| 1383 | Ga0495673_0035647 | |||
| 1384 | Ga0495673_0038941 | |||
| 1385 | Ga0495673_0052623 | |||
| 1386 | Ga0495681_0005092 | |||
| 1387 | Ga0495681_0007269 | |||
| 1388 | Ga0495681_0009412 | |||
| 1389 | Ga0495681_0010033 | |||
| 1390 | Ga0495681_0011556 | |||
| 1391 | Ga0495681_0012260 | |||
| 1392 | Ga0495681_0014950 | |||
| 1393 | Ga0495681_0017403 | |||
| 1394 | Ga0495681_0023982 | |||
| 1395 | Ga0495681_0027234 | |||
| 1396 | Ga0495681_0033300 | |||
| 1397 | Ga0495684_0035996 | |||
| 1398 | Ga0495686_0010813 | |||
| 1399 | Ga0495686_0047400 | |||
| 1400 | Ga0495593_0008220 | |||
| 1401 | Ga0495593_0023197 | |||
| 1402 | Ga0495614_0036271 | |||
| 1403 | Ga0495626_0000086 | |||
| 1404 | Ga0495626_0001191 | |||
| 1405 | Ga0495626_0001541 | |||
| 1406 | Ga0495626_0002350 | |||
| 1407 | Ga0495626_0005638 | |||
| 1408 | Ga0495626_0005927 | |||
| 1409 | Ga0495626_0099461 | |||
| 1410 | Ga0496102_0000073 | |||
| 1411 | Ga0496102_0055901 | |||
| 1412 | Ga0496103_0051494 | |||
| 1413 | Ga0496104_0409534 | |||
| 1414 | Ga0496110_0150873 | |||
| 1415 | Ga0496110_0215226 | |||
| 1416 | Ga0496111_0159412 | |||
| 1417 | Ga0496111_0334201 | |||
| 1418 | Ga0496114_0102327 | |||
| 1419 | Ga0496115_0021197 | |||
| 1420 | Ga0496116_0000995 | |||
| 1421 | Ga0496116_0015721 | |||
| 1422 | Ga0496117_0013130 | |||
| 1423 | Ga0496117_0014592 | |||
| 1424 | Ga0496117_0022977 | |||
| 1425 | Ga0496117_0024212 | |||
| 1426 | Ga0496117_0024679 | |||
| 1427 | Ga0496117_0025585 | |||
| 1428 | Ga0496117_0044827 | |||
| 1429 | Ga0496117_0103369 | |||
| 1430 | Ga0496117_0200285 | |||
| 1431 | Ga0496118_0020357 | |||
| 1432 | Ga0496118_0022302 | |||
| 1433 | Ga0496118_0023787 | |||
| 1434 | Ga0496118_0025532 | |||
| 1435 | Ga0496118_0031708 | |||
| 1436 | Ga0496118_0044031 | |||
| 1437 | Ga0496118_0052541 | |||
| 1438 | Ga0496118_0054404 | |||
| 1439 | Ga0496118_0083386 | |||
| 1440 | Ga0496118_0112752 | |||
| 1441 | Ga0496118_0117878 | |||
| 1442 | Ga0496119_0002172 | |||
| 1443 | Ga0496119_0007243 | |||
| 1444 | Ga0496120_0002014 | |||
| 1445 | Ga0496120_0005044 | |||
| 1446 | Ga0496120_0146785 | |||
| 1447 | Ga0496121_0001663 | |||
| 1448 | Ga0496121_0005421 | |||
| 1449 | Ga0496121_0026738 | |||
| 1450 | Ga0496121_0028037 | |||
| 1451 | Ga0496121_0030367 | |||
| 1452 | Ga0496121_0094563 | |||
| 1453 | Ga0496121_0175145 | |||
| 1454 | Ga0496121_0191632 | |||
| 1455 | Ga0496121_0358548 | |||
| 1456 | Ga0496122_0000244 | |||
| 1457 | Ga0496122_0005970 | |||
| 1458 | Ga0496122_0019091 | |||
| 1459 | Ga0496122_0028352 | |||
| 1460 | Ga0496122_0032031 | |||
| 1461 | Ga0496122_0040945 | |||
| 1462 | Ga0496122_0045809 | |||
| 1463 | Ga0496122_0135941 | |||
| 1464 | Ga0496123_0000201 | |||
| 1465 | Ga0496123_0011426 | |||
| 1466 | Ga0496123_0013135 | |||
| 1467 | Ga0496123_0024807 | |||
| 1468 | Ga0496123_0039495 | |||
| 1469 | Ga0496123_0050969 | |||
| 1470 | Ga0496123_0152347 | |||
| 1471 | Ga0496124_0003104 | |||
| 1472 | Ga0496124_0018543 | |||
| 1473 | Ga0496124_0019143 | |||
| 1474 | Ga0496124_0029065 | |||
| 1475 | Ga0496124_0029690 | |||
| 1476 | Ga0496124_0038621 | |||
| 1477 | Ga0496124_0051265 | |||
| 1478 | Ga0496124_0087049 | |||
| 1479 | Ga0496124_0094458 | |||
| 1480 | Ga0496124_0114604 | |||
| 1481 | Ga0496125_0000862 | |||
| 1482 | Ga0496125_0024867 | |||
| 1483 | Ga0496125_0024937 | |||
| 1484 | Ga0496125_0024954 | |||
| 1485 | Ga0496125_0039292 | |||
| 1486 | Ga0496125_0042139 | |||
| 1487 | Ga0496125_0065178 | |||
| 1488 | Ga0496125_0101603 | |||
| 1489 | Ga0496126_0004738 | |||
| 1490 | Ga0496126_0033523 | |||
| 1491 | Ga0496126_0145215 | |||
| 1492 | Ga0495678_008440 | |||
| 1493 | Ga0495678_008505 | |||
| 1494 | Ga0495678_009902 | |||
| 1495 | Ga0495678_013485 | |||
| 1496 | Ga0495678_021785 | |||
| 1497 | Ga0495678_046866 | |||
| 1498 | Ga0495678_061761 | |||
| 1499 | Ga0495678_064843 | |||
| 1500 | Ga0495682_0000138 | |||
| 1501 | Ga0495682_0004702 | |||
| 1502 | Ga0495682_0018407 | |||
| 1503 | Ga0495682_0023955 | |||
| 1504 | Ga0495682_0035889 | |||
| 1505 | Ga0501032_0010934 | |||
| 1506 | Ga0501034_0000003 | |||
| 1507 | Ga0501034_0235891 | |||
| 1508 | Ga0501034_0428665 | |||
| 1509 | Ga0501037_0234027 | |||
| 1510 | Ga0501226_000017 | |||
| 1511 | nmdc:mga00v17_69450_c1 | |||
| 1512 | nmdc:mga00v17_78588_c1 | |||
| 1513 | Ga0500659_0063600 | |||
| 1514 | 2511258060 | |||
| 1515 | 2511271543 | |||
| 1516 | 2511302942 | |||
| 1517 | 2511322862 | |||
| 1518 | 2511329322 | |||
| 1519 | 2511331381 | |||
| 1520 | 2511336178 | |||
| 1521 | 2511342237 | |||
| 1522 | 2511354953 | |||
| 1523 | 2511362726 | |||
| 1524 | 2511824964 | |||
| 1525 | 2555669224 | |||
| 1526 | 2599357878 | |||
| 1527 | 2599361631 | |||
| 1528 | 2599367953 | |||
| 1529 | 2599374742 | |||
| 1530 | 2599383043 | |||
| 1531 | 2599389574 | |||
| 1532 | 2599393600 | |||
| 1533 | 2599397862 | |||
| 1534 | 2599405367 | |||
| 1535 | 2599452309 | |||
| 1536 | 2599464694 | |||
| 1537 | 2599468244 | |||
| 1538 | 2599493717 | |||
| 1539 | 2599502315 | |||
| 1540 | 2599513312 | |||
| 1541 | 2599518188 | |||
| 1542 | 2599612842 | |||
| 1543 | 2599769044 | |||
| 1544 | 2599877985 | |||
| 1545 | 2599884843 | |||
| 1546 | 2599891988 | |||
| 1547 | 2599895979 | |||
| 1548 | 2599932623 | |||
| 1549 | 2599943375 | |||
| 1550 | 2599952207 | |||
| 1551 | 2599954486 | |||
| 1552 | 2599957864 | |||
| 1553 | 2599966787 | |||
| 1554 | 2599970390 | |||
| 1555 | 2599978066 | |||
| 1556 | 2599983799 | |||
| 1557 | 2599988695 | |||
| 1558 | 2599993354 | |||
| 1559 | 2600001401 | |||
| 1560 | 2600004039 | |||
| 1561 | 2600012207 | |||
| 1562 | 2600015587 | |||
| 1563 | 2600021941 | |||
| 1564 | 2600028546 | |||
| 1565 | 2600037538 | |||
| 1566 | 2600042867 | |||
| 1567 | 2600048604 | |||
| 1568 | 2600050795 | |||
| 1569 | 2600060077 | |||
| 1570 | 2600063298 | |||
| 1571 | 2600072673 | |||
| 1572 | 2600075215 | |||
| 1573 | 2600217416 | |||
| 1574 | 2600357713 | |||
| 1575 | 2600365632 | |||
| 1576 | 2600446630 | |||
| 1577 | 2601777586 | |||
| 1578 | 2602010829 | |||
| 1579 | 2621298795 | |||
| 1580 | 2624492660 | |||
| 1581 | 2643841653 | |||
| 1582 | 2643956968 | |||
| 1583 | 2644024891 | |||
| 1584 | 2644186760 | |||
| 1585 | 2644283938 | |||
| 1586 | 2652544946 | |||
| 1587 | 2671088671 | |||
| 1588 | 2671098273 | |||
| 1589 | 2671126289 | |||
| 1590 | 2677900729 | |||
| 1591 | 2678263601 | |||
| 1592 | 2729145489 | |||
| 1593 | 2738672044 | |||
| 1594 | 2738750437 | |||
| 1595 | 2738810032 | |||
| 1596 | 2738859478 | |||
| 1597 | 2738897392 | |||
| 1598 | 2739197683 | |||
| 1599 | 2739258597 | |||
| 1600 | 2739286375 | |||
| 1601 | 2739291688 | |||
| 1602 | 2745009932 | |||
| 1603 | 2774123241 | |||
| 1604 | 2784315765 | |||
| 1605 | 2794594850 | |||
| 1606 | 2808856270 | |||
| 1607 | 2808924710 | |||
| 1608 | 2808932978 | |||
| 1609 | 2808938991 | |||
| 1610 | 2808943241 | |||
| 1611 | 2808946708 | |||
| 1612 | 2808955123 | |||
| 1613 | 2808958309 | |||
| 1614 | 2808964762 | |||
| 1615 | 2808977000 | |||
| 1616 | 2808992155 | |||
| 1617 | 2809002100 | |||
| 1618 | 2812368046 | |||
| 1619 | 2817492044 | |||
| 1620 | 2819703344 | |||
| 1621 | 2823423410 | |||
| 1622 | 2825651975 | |||
| 1623 | 2834032858 | |||
| 1624 | 2842858150 | |||
| 1625 | 2844669659 | |||
| 1626 | 2852613666 | |||
| 1627 | 2852668598 | |||
| 1628 | 2860342340 | |||
| 1629 | 2904550568 | |||
| 1630 | 2913039677 | |||
| 1631 | 2917073027 | |||
| 1632 | 2919156765 | |||
| 1633 | 2919459020 | |||
| 1634 | 2919484767 | |||
| 1635 | 2919505220 | |||
| 1636 | 2919702646 | |||
| 1637 | 2923522098 | |||
| 1638 | 2923588446 | |||
| 1639 | 2926066897 | |||
| 1640 | 2929147582 | |||
| 1641 | 2931375147 | |||
| 1642 | 2931394537 | |||
| 1643 | 2931402423 | |||
| 1644 | 2935359443 | |||
| 1645 | 2939638499 | |||
| 1646 | 2945934226 | |||
| 1647 | 2988728860 | |||
| 1648 | 3007514619 | |||
| 1649 | 3007808261 | |||
| 1650 | 3007869135 | |||
| 1651 | 637319559 | |||
| 1652 | 639788133 | |||
| 1653 | 640488211 | |||
| 1654 | 651176165 | |||
| 1655 | 8011354595 | |||
| 1656 | 8019775663 | |||
| 1657 | 8019781052 | |||
| 1658 | 8034963697 | |||
| 1659 | 8052497779 | |||
| 1660 | 8054507050 | |||
| 1661 | 8055820115 | |||
| 1662 | 8055883312 | |||
| 1663 | 8056129298 | |||
| 1664 | 8056135481 | |||
| 1665 | 8056146203 | |||
| 1666 | 8056157623 | |||
| 1667 | 8056165253 | |||
| 1668 | 8057799663 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xfr-assembly1.cif.gz_A | metallo-beta-lactamase from pontibacter korlensis | 0.8631 | 22 | 246 |
| 4nq5-assembly1.cif.gz_A | bacillus cereus zn-dependent metallo-beta-lactamase at ph 7 complexed with compound cs319 | 0.8568 | 26 | 245 |
| 1bmc-assembly1.cif.gz_A | structure of a zinc metallo-beta-lactamase from bacillus cereus | 0.8555 | 26 | 245 |
| 3kns-assembly4.cif.gz_D | bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) | 0.8543 | 22 | 245 |
| 3fai-assembly1.cif.gz_A | the di zinc carbapenemase cpha n220g mutant | 0.8528 | 21 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HZQ1_3_96_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8574 | 152 | 234 | 3.60.15.10 |
| 1x8gA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8535 | 21 | 245 | 3.60.15.10 |
| 1x8gA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8359 | 21 | 245 | 3.60.15.10 |
| 3l6nA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8253 | 19 | 245 | 3.60.15.10 |
| 4nq7A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8241 | 26 | 245 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0K7C7-F1-model_v4 | deleted | 0.9808 | 11 | 152 |
|
| AF-A0A431KTK1-F1-model_v4 | Quinoprotein relay system zinc metallohydrolase 1 | 0.9789 | 12 | 268 |
GO:0016787
|
| AF-A0A1X1QQ21-F1-model_v4 | MBL fold metallo-hydrolase | 0.9755 | 18 | 298 |
GO:0016787
|
| AF-A0A661F283-F1-model_v4 | MBL fold metallo-hydrolase | 0.973 | 12 | 191 |
GO:0016787
|
| AF-A0A2P8EN68-F1-model_v4 | Quinoprotein relay system zinc metallohydrolase 1 | 0.9726 | 12 | 297 |
GO:0016787
|