F482808
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 834 | 383 | 1668 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0021536|Ga0495670_0021536_203_862 |
| Length | 212 |
| Sequence | MAQAPETHDDALHRRGLMFILSSPSGAGKTTISRKLLEHDGRIGMSVSVTTRPPRPGEVDGKDYIFKSQAQFDQMVEDGHFLEWAHVFGHSYGTPKAQIKAFLFDIDWQGTQQLYQKAETDVVRVFLLPPSLDELRRRLTSRGTDSAEVIAGRMARAQAEISHWDGYDYVVVNDDIDVCFDKVVQILAAERLSRARQTGLIGFVRELTRPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 205 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 208 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 209 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 210 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 211 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 212 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 213 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 214 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 215 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 216 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 217 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 218 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 224 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 284 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 285 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 294 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 306 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 313 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 318 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 320 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 321 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 337 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 339 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 340 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 344 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 345 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 346 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 347 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 348 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 350 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 351 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 354 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 357 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 358 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 359 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 360 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 361 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 362 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 363 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 364 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 365 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 366 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 367 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 368 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 369 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 370 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 371 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 372 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 373 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 374 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 375 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 376 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 377 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 378 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 379 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 380 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 381 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 382 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 383 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.76 |
| Metatranscriptomes | 0.12 |
| Isolates | 3.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.6 |
| Bulb | 0 |
| Endosphere | 10.79 |
| Nodule | 0.12 |
| Rhizoplane | 3.84 |
| Rhizosphere | 73.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495670_0021536 | 3300046691 | Bacteria | 3180 |
| 2 | SwRhRL2b_contig_3660702 | 2162886007 | Bacteria | 11509 |
| 3 | JGI24736J21556_1000235 | 3300001904 | Bacteria | 10063 |
| 4 | JGI24741J21665_1000124 | 3300001915 | Bacteria | 20973 |
| 5 | JGI24752J21851_1000586 | 3300001976 | Bacteria | 4846 |
| 6 | JGI24740J21852_10003311 | 3300001979 | Bacteria | 7098 |
| 7 | JGI24740J21852_10028989 | 3300001979 | Bacteria | 1823 |
| 8 | JGI24740J21852_10058057 | 3300001979 | Bacteria | 1078 |
| 9 | JGI24739J22299_10001891 | 3300001989 | Bacteria | 8000 |
| 10 | JGI24737J22298_10003492 | 3300001990 | Bacteria | 5545 |
| 11 | JGI24737J22298_10006196 | 3300001990 | Bacteria | 4096 |
| 12 | JGI24737J22298_10040310 | 3300001990 | Bacteria | 1434 |
| 13 | JGI24737J22298_10084090 | 3300001990 | Bacteria | 946 |
| 14 | JGI24743J22301_10012544 | 3300001991 | Bacteria | 1543 |
| 15 | JGI24735J21928_10000699 | 3300002067 | Bacteria | 11907 |
| 16 | JGI24735J21928_10009713 | 3300002067 | Bacteria | 3082 |
| 17 | JGI24735J21928_10009810 | 3300002067 | Bacteria | 3066 |
| 18 | JGI24735J21928_10012405 | 3300002067 | Bacteria | 2693 |
| 19 | JGI24735J21928_10012704 | 3300002067 | Bacteria | 2659 |
| 20 | JGI24735J21928_10027489 | 3300002067 | Bacteria | 1705 |
| 21 | JGI24735J21928_10054782 | 3300002067 | Bacteria | 1149 |
| 22 | JGI24738J21930_10002736 | 3300002075 | Bacteria | 4536 |
| 23 | JGI24738J21930_10004755 | 3300002075 | Bacteria | 3302 |
| 24 | JGI24738J21930_10015195 | 3300002075 | Bacteria | 1642 |
| 25 | JGI24738J21930_10020901 | 3300002075 | Bacteria | 1360 |
| 26 | JGI24749J21850_1000352 | 3300002076 | Bacteria | 6855 |
| 27 | JGI24744J21845_10000115 | 3300002077 | Bacteria | 10973 |
| 28 | JGI24035J26624_1003524 | 3300002126 | Bacteria | 1476 |
| 29 | JGI24751J29686_10000208 | 3300002459 | Bacteria | 25368 |
| 30 | JGI25150J39212_1003534 | 3300002774 | Bacteria | 3648 |
| 31 | JGI25151J46595_10037612 | 3300003187 | Bacteria | 1813 |
| 32 | JGI25165J46597_1000534 | 3300003214 | Bacteria | 35395 |
| 33 | JGI25153J46596_10000186 | 3300003215 | Bacteria | 60427 |
| 34 | rootL2_10042168 | 3300003322 | Bacteria | 1995 |
| 35 | Ga0055542_1003000 | 3300003762 | Bacteria | 4916 |
| 36 | Ga0055526_1012603 | 3300003771 | Bacteria | 3669 |
| 37 | Ga0055536_1016085 | 3300003781 | Bacteria | 2521 |
| 38 | Ga0055530_10000064 | 3300003791 | Bacteria | 94475 |
| 39 | Ga0055530_10037267 | 3300003791 | Bacteria | 1218 |
| 40 | Ga0055540_1000768 | 3300003792 | Bacteria | 21808 |
| 41 | Ga0055540_1002060 | 3300003792 | Bacteria | 11094 |
| 42 | Ga0055531_10000073 | 3300003794 | Bacteria | 109510 |
| 43 | Ga0065165_1056282 | 3300005262 | Bacteria | 1094 |
| 44 | Ga0065704_10000192 | 3300005289 | Bacteria | 216848 |
| 45 | Ga0065704_10000914 | 3300005289 | Bacteria | 11453 |
| 46 | Ga0065704_10003296 | 3300005289 | Bacteria | 4388 |
| 47 | Ga0065704_10070989 | 3300005289 | Bacteria | 13960 |
| 48 | Ga0065704_10077790 | 3300005289 | Bacteria | 4619 |
| 49 | Ga0065707_10084356 | 3300005295 | Bacteria | 7311 |
| 50 | Ga0065707_10086371 | 3300005295 | Bacteria | 5505 |
| 51 | Ga0070658_10001154 | 3300005327 | Bacteria | 22529 |
| 52 | Ga0070658_10012339 | 3300005327 | Bacteria | 6861 |
| 53 | Ga0070676_10000448 | 3300005328 | Bacteria | 19663 |
| 54 | Ga0070683_100276977 | 3300005329 | Bacteria | 1596 |
| 55 | Ga0070683_100532952 | 3300005329 | Bacteria | 1122 |
| 56 | Ga0070670_100000024 | 3300005331 | Bacteria | 189811 |
| 57 | Ga0070670_100003502 | 3300005331 | Bacteria | 13049 |
| 58 | Ga0070670_100035441 | 3300005331 | Bacteria | 4295 |
| 59 | Ga0068869_100002661 | 3300005334 | Bacteria | 10794 |
| 60 | Ga0070666_10000111 | 3300005335 | Bacteria | 56117 |
| 61 | Ga0070666_10001747 | 3300005335 | Bacteria | 13257 |
| 62 | Ga0070666_10051148 | 3300005335 | Bacteria | 2781 |
| 63 | Ga0070666_10062591 | 3300005335 | Bacteria | 2521 |
| 64 | Ga0070666_10098313 | 3300005335 | Bacteria | 2015 |
| 65 | Ga0070666_10456715 | 3300005335 | Bacteria | 923 |
| 66 | Ga0068868_100000910 | 3300005338 | Bacteria | 20102 |
| 67 | Ga0070660_100009320 | 3300005339 | Bacteria | 6897 |
| 68 | Ga0070660_100058583 | 3300005339 | Bacteria | 2986 |
| 69 | Ga0070660_100135929 | 3300005339 | Bacteria | 1970 |
| 70 | Ga0070660_100149113 | 3300005339 | Bacteria | 1880 |
| 71 | Ga0070660_100166856 | 3300005339 | Bacteria | 1777 |
| 72 | Ga0070661_100008203 | 3300005344 | Bacteria | 7203 |
| 73 | Ga0070661_100261922 | 3300005344 | Bacteria | 1337 |
| 74 | Ga0070668_100000027 | 3300005347 | Bacteria | 89913 |
| 75 | Ga0070668_100000041 | 3300005347 | Bacteria | 78742 |
| 76 | Ga0070668_100008132 | 3300005347 | Bacteria | 7792 |
| 77 | Ga0070668_100024451 | 3300005347 | Bacteria | 4578 |
| 78 | Ga0070668_100027686 | 3300005347 | Bacteria | 4303 |
| 79 | Ga0070668_100084870 | 3300005347 | Bacteria | 2488 |
| 80 | Ga0070668_100135504 | 3300005347 | Bacteria | 1980 |
| 81 | Ga0070669_100000012 | 3300005353 | Bacteria | 211302 |
| 82 | Ga0070669_100000047 | 3300005353 | Bacteria | 118892 |
| 83 | Ga0070669_100005445 | 3300005353 | Bacteria | 9185 |
| 84 | Ga0070669_100010694 | 3300005353 | Bacteria | 6514 |
| 85 | Ga0070669_100054887 | 3300005353 | Bacteria | 2919 |
| 86 | Ga0070669_100218101 | 3300005353 | Bacteria | 1508 |
| 87 | Ga0070675_100071809 | 3300005354 | Bacteria | 2873 |
| 88 | Ga0070671_100000019 | 3300005355 | Bacteria | 132341 |
| 89 | Ga0070671_100000517 | 3300005355 | Bacteria | 27085 |
| 90 | Ga0070671_100002891 | 3300005355 | Bacteria | 13371 |
| 91 | Ga0070671_100003218 | 3300005355 | Bacteria | 12731 |
| 92 | Ga0070671_100023173 | 3300005355 | Bacteria | 5077 |
| 93 | Ga0070671_100057465 | 3300005355 | Bacteria | 3238 |
| 94 | Ga0070674_100019915 | 3300005356 | Bacteria | 4274 |
| 95 | Ga0070673_100000020 | 3300005364 | Bacteria | 102632 |
| 96 | Ga0070659_100140337 | 3300005366 | Bacteria | 1967 |
| 97 | Ga0070659_100233254 | 3300005366 | Bacteria | 1521 |
| 98 | Ga0070659_100287872 | 3300005366 | Bacteria | 1368 |
| 99 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 100 | Ga0070667_100000058 | 3300005367 | Bacteria | 148071 |
| 101 | Ga0070667_100000143 | 3300005367 | Bacteria | 90358 |
| 102 | Ga0070667_100005804 | 3300005367 | Bacteria | 10302 |
| 103 | Ga0070667_100012087 | 3300005367 | Bacteria | 7148 |
| 104 | Ga0070667_100016472 | 3300005367 | Bacteria | 6117 |
| 105 | Ga0070667_100113572 | 3300005367 | Bacteria | 2351 |
| 106 | Ga0070705_100004405 | 3300005440 | Bacteria | 6859 |
| 107 | Ga0070708_100912558 | 3300005445 | Bacteria | 825 |
| 108 | Ga0070663_100001418 | 3300005455 | Bacteria | 13103 |
| 109 | Ga0070678_100005895 | 3300005456 | Bacteria | 7126 |
| 110 | Ga0070662_100032068 | 3300005457 | Bacteria | 3691 |
| 111 | Ga0070662_100394559 | 3300005457 | Bacteria | 1141 |
| 112 | Ga0068867_100000155 | 3300005459 | Bacteria | 43934 |
| 113 | Ga0070685_10016519 | 3300005466 | Bacteria | 3934 |
| 114 | Ga0070685_10505431 | 3300005466 | Bacteria | 856 |
| 115 | Ga0068853_100070689 | 3300005539 | Bacteria | 3038 |
| 116 | Ga0068853_100086514 | 3300005539 | Bacteria | 2749 |
| 117 | Ga0068853_100089633 | 3300005539 | Bacteria | 2702 |
| 118 | Ga0068853_100265068 | 3300005539 | Bacteria | 1580 |
| 119 | Ga0068853_100315074 | 3300005539 | Bacteria | 1449 |
| 120 | Ga0070665_100001012 | 3300005548 | Bacteria | 35432 |
| 121 | Ga0070665_100010368 | 3300005548 | Bacteria | 9429 |
| 122 | Ga0068855_100002050 | 3300005563 | Bacteria | 24977 |
| 123 | Ga0068855_100121831 | 3300005563 | Bacteria | 2985 |
| 124 | Ga0068855_100629612 | 3300005563 | Bacteria | 1154 |
| 125 | Ga0070664_100014905 | 3300005564 | Bacteria | 6342 |
| 126 | Ga0070664_100490854 | 3300005564 | Bacteria | 1131 |
| 127 | Ga0068857_100013486 | 3300005577 | Bacteria | 7119 |
| 128 | Ga0068857_100059205 | 3300005577 | Bacteria | 3402 |
| 129 | Ga0068857_100108610 | 3300005577 | Bacteria | 2493 |
| 130 | Ga0068857_100121731 | 3300005577 | Bacteria | 2350 |
| 131 | Ga0068857_100309780 | 3300005577 | Bacteria | 1456 |
| 132 | Ga0068854_100002936 | 3300005578 | Bacteria | 10575 |
| 133 | Ga0068854_100268072 | 3300005578 | Bacteria | 1370 |
| 134 | Ga0068854_100340174 | 3300005578 | Bacteria | 1225 |
| 135 | Ga0068856_100008231 | 3300005614 | Bacteria | 10165 |
| 136 | Ga0068856_100019646 | 3300005614 | Bacteria | 6557 |
| 137 | Ga0070702_100041902 | 3300005615 | Bacteria | 2571 |
| 138 | Ga0068852_100010016 | 3300005616 | Bacteria | 7052 |
| 139 | Ga0068852_100483302 | 3300005616 | Bacteria | 1231 |
| 140 | Ga0068852_100491236 | 3300005616 | Bacteria | 1221 |
| 141 | Ga0068852_100493014 | 3300005616 | Bacteria | 1219 |
| 142 | Ga0068859_100038244 | 3300005617 | Bacteria | 4814 |
| 143 | Ga0068859_100062917 | 3300005617 | Bacteria | 3741 |
| 144 | Ga0068859_100092658 | 3300005617 | Bacteria | 3073 |
| 145 | Ga0068859_100190175 | 3300005617 | Bacteria | 2137 |
| 146 | Ga0068859_100588416 | 3300005617 | Bacteria | 1206 |
| 147 | Ga0068864_100000036 | 3300005618 | Bacteria | 189811 |
| 148 | Ga0068864_100000475 | 3300005618 | Bacteria | 34778 |
| 149 | Ga0068864_100004795 | 3300005618 | Bacteria | 11081 |
| 150 | Ga0068864_100159134 | 3300005618 | Bacteria | 2052 |
| 151 | Ga0068861_100002169 | 3300005719 | Bacteria | 12735 |
| 152 | Ga0068861_100005201 | 3300005719 | Bacteria | 8770 |
| 153 | Ga0068861_100021348 | 3300005719 | Bacteria | 4654 |
| 154 | Ga0068851_10013802 | 3300005834 | Bacteria | 3825 |
| 155 | Ga0068851_10077709 | 3300005834 | Bacteria | 1728 |
| 156 | Ga0068851_10160609 | 3300005834 | Bacteria | 1234 |
| 157 | Ga0068863_100000031 | 3300005841 | Bacteria | 175602 |
| 158 | Ga0068863_100001489 | 3300005841 | Bacteria | 23203 |
| 159 | Ga0068863_100002193 | 3300005841 | Bacteria | 19382 |
| 160 | Ga0068863_100005824 | 3300005841 | Bacteria | 12076 |
| 161 | Ga0068863_100007418 | 3300005841 | Bacteria | 10732 |
| 162 | Ga0068863_100031052 | 3300005841 | Bacteria | 5102 |
| 163 | Ga0068858_100000103 | 3300005842 | Bacteria | 88754 |
| 164 | Ga0068858_100021883 | 3300005842 | Bacteria | 5971 |
| 165 | Ga0068858_100204130 | 3300005842 | Bacteria | 1870 |
| 166 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 167 | Ga0068860_100000181 | 3300005843 | Bacteria | 101627 |
| 168 | Ga0068860_100022971 | 3300005843 | Bacteria | 6031 |
| 169 | Ga0068860_100031058 | 3300005843 | Bacteria | 5136 |
| 170 | Ga0068860_100031678 | 3300005843 | Bacteria | 5083 |
| 171 | Ga0068860_100078368 | 3300005843 | Bacteria | 3142 |
| 172 | Ga0068860_100324700 | 3300005843 | Bacteria | 1511 |
| 173 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 174 | Ga0068862_100000187 | 3300005844 | Bacteria | 68303 |
| 175 | Ga0068862_100000884 | 3300005844 | Bacteria | 29162 |
| 176 | Ga0068862_100005927 | 3300005844 | Bacteria | 10176 |
| 177 | Ga0068862_100030592 | 3300005844 | Bacteria | 4538 |
| 178 | Ga0068862_100128025 | 3300005844 | Bacteria | 2243 |
| 179 | Ga0068862_100235818 | 3300005844 | Bacteria | 1661 |
| 180 | Ga0081539_10016956 | 3300005985 | Bacteria | 5158 |
| 181 | Ga0075368_10001355 | 3300006042 | Bacteria | 7790 |
| 182 | Ga0075364_10166195 | 3300006051 | Bacteria | 1491 |
| 183 | Ga0075367_10001026 | 3300006178 | Bacteria | 11507 |
| 184 | Ga0075366_10034983 | 3300006195 | Bacteria | 2961 |
| 185 | Ga0075366_10117135 | 3300006195 | Bacteria | 1604 |
| 186 | Ga0097621_100005590 | 3300006237 | Bacteria | 8863 |
| 187 | Ga0075370_10002503 | 3300006353 | Bacteria | 8532 |
| 188 | Ga0068865_100000272 | 3300006881 | Bacteria | 28389 |
| 189 | Ga0097620_100038244 | 3300006931 | Bacteria | 4814 |
| 190 | Ga0097620_100062917 | 3300006931 | Bacteria | 3741 |
| 191 | Ga0097620_100092661 | 3300006931 | Bacteria | 3073 |
| 192 | Ga0097620_100190181 | 3300006931 | Bacteria | 2137 |
| 193 | Ga0097620_100588387 | 3300006931 | Bacteria | 1206 |
| 194 | Ga0099826_10138471 | 3300006948 | Bacteria | 1410 |
| 195 | Ga0105251_10004489 | 3300009011 | Bacteria | 9471 |
| 196 | Ga0105251_10015704 | 3300009011 | Bacteria | 4126 |
| 197 | Ga0105251_10032668 | 3300009011 | Bacteria | 2591 |
| 198 | Ga0105251_10035471 | 3300009011 | Bacteria | 2461 |
| 199 | Ga0105250_10032780 | 3300009092 | Bacteria | 2086 |
| 200 | Ga0105250_10075779 | 3300009092 | Bacteria | 1361 |
| 201 | Ga0105240_10012649 | 3300009093 | Bacteria | 11636 |
| 202 | Ga0105240_10020042 | 3300009093 | Bacteria | 8928 |
| 203 | Ga0105240_10574747 | 3300009093 | Bacteria | 1244 |
| 204 | Ga0105245_10002130 | 3300009098 | Bacteria | 17920 |
| 205 | Ga0105247_10004441 | 3300009101 | Bacteria | 8942 |
| 206 | Ga0105247_10117922 | 3300009101 | Bacteria | 1716 |
| 207 | Ga0105247_10118724 | 3300009101 | Bacteria | 1711 |
| 208 | Ga0114129_10282114 | 3300009147 | Bacteria | 2219 |
| 209 | Ga0105243_10000711 | 3300009148 | Bacteria | 32092 |
| 210 | Ga0105243_10222341 | 3300009148 | Bacteria | 1670 |
| 211 | Ga0105243_10654438 | 3300009148 | Bacteria | 1019 |
| 212 | Ga0105241_10000807 | 3300009174 | Bacteria | 23818 |
| 213 | Ga0105242_10000320 | 3300009176 | Bacteria | 38566 |
| 214 | Ga0105248_10000091 | 3300009177 | Bacteria | 101191 |
| 215 | Ga0105248_10002773 | 3300009177 | Bacteria | 19480 |
| 216 | Ga0105248_10014281 | 3300009177 | Bacteria | 8743 |
| 217 | Ga0105248_10018898 | 3300009177 | Bacteria | 7619 |
| 218 | Ga0105248_10033589 | 3300009177 | Bacteria | 5732 |
| 219 | Ga0105248_10070358 | 3300009177 | Bacteria | 3929 |
| 220 | Ga0105248_10227998 | 3300009177 | Bacteria | 2097 |
| 221 | Ga0105248_10365850 | 3300009177 | Bacteria | 1624 |
| 222 | Ga0105237_10008796 | 3300009545 | Bacteria | 10890 |
| 223 | Ga0105237_10075759 | 3300009545 | Bacteria | 3355 |
| 224 | Ga0105238_10501816 | 3300009551 | Bacteria | 1214 |
| 225 | Ga0105249_10000553 | 3300009553 | Bacteria | 34593 |
| 226 | Ga0105249_10001384 | 3300009553 | Bacteria | 21229 |
| 227 | Ga0105249_10093615 | 3300009553 | Bacteria | 2815 |
| 228 | Ga0105249_10414876 | 3300009553 | Bacteria | 1379 |
| 229 | Ga0105148_100060 | 3300009978 | Bacteria | 17151 |
| 230 | Ga0105239_10142551 | 3300010375 | Bacteria | 2671 |
| 231 | Ga0105239_10165940 | 3300010375 | Bacteria | 2469 |
| 232 | Ga0105239_10808157 | 3300010375 | Bacteria | 1074 |
| 233 | Ga0105246_10004775 | 3300011119 | Bacteria | 8251 |
| 234 | Ga0157326_1000067 | 3300012513 | Bacteria | 10095 |
| 235 | Ga0157373_10015080 | 3300013100 | Bacteria | 5653 |
| 236 | Ga0157373_10097352 | 3300013100 | Bacteria | 2071 |
| 237 | Ga0157371_10710594 | 3300013102 | Bacteria | 753 |
| 238 | Ga0157370_10000145 | 3300013104 | Bacteria | 86693 |
| 239 | Ga0157370_10013194 | 3300013104 | Bacteria | 8521 |
| 240 | Ga0157370_10704392 | 3300013104 | Bacteria | 922 |
| 241 | Ga0157369_10018860 | 3300013105 | Bacteria | 7729 |
| 242 | Ga0157369_10648922 | 3300013105 | Bacteria | 1088 |
| 243 | Ga0157369_10957018 | 3300013105 | Bacteria | 877 |
| 244 | Ga0157374_10005414 | 3300013296 | Bacteria | 10723 |
| 245 | Ga0157374_10136449 | 3300013296 | Bacteria | 2379 |
| 246 | Ga0157378_10011140 | 3300013297 | Bacteria | 7870 |
| 247 | Ga0163162_10053526 | 3300013306 | Bacteria | 4057 |
| 248 | Ga0163162_10124375 | 3300013306 | Bacteria | 2685 |
| 249 | Ga0163162_10658904 | 3300013306 | Bacteria | 1170 |
| 250 | Ga0157372_10029740 | 3300013307 | Bacteria | 5969 |
| 251 | Ga0157372_10065951 | 3300013307 | Bacteria | 4067 |
| 252 | Ga0157372_10146982 | 3300013307 | Bacteria | 2718 |
| 253 | Ga0157372_10202471 | 3300013307 | Bacteria | 2300 |
| 254 | Ga0157372_10681462 | 3300013307 | Bacteria | 1196 |
| 255 | Ga0157380_10008171 | 3300014326 | Bacteria | 7456 |
| 256 | Ga0157380_10370279 | 3300014326 | Bacteria | 1348 |
| 257 | Ga0157380_10545439 | 3300014326 | Bacteria | 1136 |
| 258 | Ga0157377_10013528 | 3300014745 | Bacteria | 4131 |
| 259 | Ga0157379_10001174 | 3300014968 | Bacteria | 21344 |
| 260 | Ga0157376_10000395 | 3300014969 | Bacteria | 28347 |
| 261 | Ga0183363_1005 | 3300015690 | Bacteria | 403020 |
| 262 | Ga0163161_10038021 | 3300017792 | Bacteria | 3450 |
| 263 | Ga0163161_10057942 | 3300017792 | Bacteria | 2815 |
| 264 | Ga0163161_10153985 | 3300017792 | Bacteria | 1749 |
| 265 | Ga0163161_10364892 | 3300017792 | Bacteria | 1151 |
| 266 | Ga0213874_10064662 | 3300021377 | Bacteria | 1154 |
| 267 | Ga0213876_10200643 | 3300021384 | Bacteria | 1060 |
| 268 | Ga0209147_100881 | 3300025229 | Bacteria | 13827 |
| 269 | Ga0207427_100878 | 3300025231 | Bacteria | 13165 |
| 270 | Ga0207425_1000049 | 3300025245 | Bacteria | 180735 |
| 271 | Ga0209148_1000318 | 3300025254 | Bacteria | 67692 |
| 272 | Ga0209148_1015931 | 3300025254 | Bacteria | 1303 |
| 273 | Ga0209129_1003718 | 3300025258 | Bacteria | 6459 |
| 274 | Ga0209233_1000181 | 3300025261 | Bacteria | 138699 |
| 275 | Ga0209565_1001004 | 3300025263 | Bacteria | 14505 |
| 276 | Ga0209455_1000942 | 3300025272 | Bacteria | 14894 |
| 277 | Ga0209676_1015713 | 3300025292 | Bacteria | 2772 |
| 278 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 279 | Ga0209564_1004346 | 3300025295 | Bacteria | 8727 |
| 280 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 281 | Ga0209758_1026569 | 3300025297 | Bacteria | 2501 |
| 282 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 283 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 284 | Ga0209050_1000108 | 3300025298 | Bacteria | 222534 |
| 285 | Ga0209050_1029301 | 3300025298 | Bacteria | 1764 |
| 286 | Ga0209051_1005046 | 3300025303 | Bacteria | 7858 |
| 287 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 288 | Ga0209257_1035415 | 3300025304 | Bacteria | 1545 |
| 289 | Ga0207697_10000003 | 3300025315 | Bacteria | 90538 |
| 290 | Ga0207656_10084618 | 3300025321 | Bacteria | 1431 |
| 291 | Ga0207656_10088066 | 3300025321 | Bacteria | 1405 |
| 292 | Ga0207656_10104901 | 3300025321 | Bacteria | 1300 |
| 293 | Ga0207713_1019134 | 3300025735 | Bacteria | 3363 |
| 294 | Ga0207713_1020886 | 3300025735 | Bacteria | 3155 |
| 295 | Ga0207710_10006744 | 3300025900 | Bacteria | 4894 |
| 296 | Ga0207710_10012555 | 3300025900 | Bacteria | 3564 |
| 297 | Ga0207710_10019525 | 3300025900 | Bacteria | 2891 |
| 298 | Ga0207710_10310503 | 3300025900 | Bacteria | 798 |
| 299 | Ga0207688_10107208 | 3300025901 | Bacteria | 1619 |
| 300 | Ga0207688_10362667 | 3300025901 | Bacteria | 894 |
| 301 | Ga0207680_10000142 | 3300025903 | Bacteria | 34278 |
| 302 | Ga0207680_10000890 | 3300025903 | Bacteria | 14105 |
| 303 | Ga0207680_10015221 | 3300025903 | Bacteria | 4010 |
| 304 | Ga0207680_10024379 | 3300025903 | Bacteria | 3320 |
| 305 | Ga0207680_10084501 | 3300025903 | Bacteria | 2003 |
| 306 | Ga0207647_10000611 | 3300025904 | Bacteria | 27863 |
| 307 | Ga0207647_10003792 | 3300025904 | Bacteria | 11296 |
| 308 | Ga0207647_10004427 | 3300025904 | Bacteria | 10414 |
| 309 | Ga0207647_10022600 | 3300025904 | Bacteria | 4174 |
| 310 | Ga0207647_10029211 | 3300025904 | Bacteria | 3570 |
| 311 | Ga0207647_10220582 | 3300025904 | Bacteria | 1093 |
| 312 | Ga0207645_10011226 | 3300025907 | Bacteria | 6126 |
| 313 | Ga0207705_10001161 | 3300025909 | Bacteria | 21450 |
| 314 | Ga0207705_10003807 | 3300025909 | Bacteria | 11473 |
| 315 | Ga0207705_10055811 | 3300025909 | Bacteria | 2848 |
| 316 | Ga0207705_10593060 | 3300025909 | Bacteria | 862 |
| 317 | Ga0207654_10098004 | 3300025911 | Bacteria | 1801 |
| 318 | Ga0207695_10011414 | 3300025913 | Bacteria | 10767 |
| 319 | Ga0207695_10058839 | 3300025913 | Bacteria | 3988 |
| 320 | Ga0207695_10346807 | 3300025913 | Bacteria | 1372 |
| 321 | Ga0207671_10021473 | 3300025914 | Bacteria | 4897 |
| 322 | Ga0207671_10042931 | 3300025914 | Bacteria | 3345 |
| 323 | Ga0207671_10141452 | 3300025914 | Bacteria | 1854 |
| 324 | Ga0207657_10002758 | 3300025919 | Bacteria | 18916 |
| 325 | Ga0207657_10005094 | 3300025919 | Bacteria | 13770 |
| 326 | Ga0207657_10030799 | 3300025919 | Bacteria | 4864 |
| 327 | Ga0207657_10041026 | 3300025919 | Bacteria | 4095 |
| 328 | Ga0207657_10154561 | 3300025919 | Bacteria | 1866 |
| 329 | Ga0207649_10234990 | 3300025920 | Bacteria | 1313 |
| 330 | Ga0207652_10718415 | 3300025921 | Bacteria | 891 |
| 331 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 332 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 333 | Ga0207681_10002077 | 3300025923 | Bacteria | 12831 |
| 334 | Ga0207681_10002575 | 3300025923 | Bacteria | 11500 |
| 335 | Ga0207681_10021367 | 3300025923 | Bacteria | 4113 |
| 336 | Ga0207681_10046229 | 3300025923 | Bacteria | 2927 |
| 337 | Ga0207681_10146955 | 3300025923 | Bacteria | 1762 |
| 338 | Ga0207681_10191208 | 3300025923 | Bacteria | 1566 |
| 339 | Ga0207694_10034311 | 3300025924 | Bacteria | 3890 |
| 340 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 341 | Ga0207650_10003369 | 3300025925 | Bacteria | 10999 |
| 342 | Ga0207650_10005182 | 3300025925 | Bacteria | 8892 |
| 343 | Ga0207659_10052745 | 3300025926 | Bacteria | 2899 |
| 344 | Ga0207687_10001173 | 3300025927 | Bacteria | 17895 |
| 345 | Ga0207644_10000031 | 3300025931 | Bacteria | 134402 |
| 346 | Ga0207644_10000066 | 3300025931 | Bacteria | 76450 |
| 347 | Ga0207644_10000293 | 3300025931 | Bacteria | 32998 |
| 348 | Ga0207644_10007460 | 3300025931 | Bacteria | 7131 |
| 349 | Ga0207644_10055644 | 3300025931 | Bacteria | 2852 |
| 350 | Ga0207644_10117952 | 3300025931 | Bacteria | 2016 |
| 351 | Ga0207690_10057882 | 3300025932 | Bacteria | 2620 |
| 352 | Ga0207690_10124879 | 3300025932 | Bacteria | 1875 |
| 353 | Ga0207706_10015901 | 3300025933 | Bacteria | 6801 |
| 354 | Ga0207706_10022403 | 3300025933 | Bacteria | 5670 |
| 355 | Ga0207706_10117259 | 3300025933 | Bacteria | 2342 |
| 356 | Ga0207686_10000181 | 3300025934 | Bacteria | 48566 |
| 357 | Ga0207709_10000750 | 3300025935 | Bacteria | 25694 |
| 358 | Ga0207669_10009649 | 3300025937 | Bacteria | 4612 |
| 359 | Ga0207704_10000048 | 3300025938 | Bacteria | 83529 |
| 360 | Ga0207691_10065054 | 3300025940 | Bacteria | 3302 |
| 361 | Ga0207711_10002409 | 3300025941 | Bacteria | 16703 |
| 362 | Ga0207711_10008194 | 3300025941 | Bacteria | 8748 |
| 363 | Ga0207711_10012761 | 3300025941 | Bacteria | 6979 |
| 364 | Ga0207711_10027237 | 3300025941 | Bacteria | 4801 |
| 365 | Ga0207689_10000378 | 3300025942 | Bacteria | 41915 |
| 366 | Ga0207661_10217487 | 3300025944 | Bacteria | 1687 |
| 367 | Ga0207679_10158754 | 3300025945 | Bacteria | 1849 |
| 368 | Ga0207667_10001267 | 3300025949 | Bacteria | 31686 |
| 369 | Ga0207667_10070214 | 3300025949 | Bacteria | 3646 |
| 370 | Ga0207667_10225965 | 3300025949 | Bacteria | 1917 |
| 371 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 372 | Ga0207712_10000048 | 3300025961 | Bacteria | 160050 |
| 373 | Ga0207712_10018680 | 3300025961 | Bacteria | 4518 |
| 374 | Ga0207712_10029096 | 3300025961 | Bacteria | 3702 |
| 375 | Ga0207712_10058448 | 3300025961 | Bacteria | 2725 |
| 376 | Ga0207712_10068285 | 3300025961 | Bacteria | 2546 |
| 377 | Ga0207712_10383132 | 3300025961 | Bacteria | 1177 |
| 378 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 379 | Ga0207668_10000038 | 3300025972 | Bacteria | 112486 |
| 380 | Ga0207668_10000135 | 3300025972 | Bacteria | 50909 |
| 381 | Ga0207668_10003241 | 3300025972 | Bacteria | 9540 |
| 382 | Ga0207668_10004934 | 3300025972 | Bacteria | 7846 |
| 383 | Ga0207668_10069823 | 3300025972 | Bacteria | 2503 |
| 384 | Ga0207668_10095405 | 3300025972 | Bacteria | 2195 |
| 385 | Ga0207668_10150777 | 3300025972 | Bacteria | 1799 |
| 386 | Ga0207640_10000167 | 3300025981 | Bacteria | 47729 |
| 387 | Ga0207640_10014319 | 3300025981 | Bacteria | 4563 |
| 388 | Ga0207640_10305753 | 3300025981 | Bacteria | 1260 |
| 389 | Ga0207640_10400395 | 3300025981 | Bacteria | 1118 |
| 390 | Ga0207640_10511012 | 3300025981 | Bacteria | 1002 |
| 391 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 392 | Ga0207658_10000037 | 3300025986 | Bacteria | 148087 |
| 393 | Ga0207658_10000164 | 3300025986 | Bacteria | 70677 |
| 394 | Ga0207658_10003835 | 3300025986 | Bacteria | 10588 |
| 395 | Ga0207658_10004090 | 3300025986 | Bacteria | 10173 |
| 396 | Ga0207658_10010872 | 3300025986 | Bacteria | 6194 |
| 397 | Ga0207658_10397755 | 3300025986 | Bacteria | 1210 |
| 398 | Ga0207677_10000711 | 3300026023 | Bacteria | 19645 |
| 399 | Ga0207703_10000538 | 3300026035 | Bacteria | 38989 |
| 400 | Ga0207703_10015775 | 3300026035 | Bacteria | 5892 |
| 401 | Ga0207639_10000138 | 3300026041 | Bacteria | 54326 |
| 402 | Ga0207639_10001072 | 3300026041 | Bacteria | 18552 |
| 403 | Ga0207639_10068669 | 3300026041 | Bacteria | 2762 |
| 404 | Ga0207639_10700124 | 3300026041 | Bacteria | 940 |
| 405 | Ga0207678_10005374 | 3300026067 | Bacteria | 11474 |
| 406 | Ga0207678_10006691 | 3300026067 | Bacteria | 10221 |
| 407 | Ga0207678_10251559 | 3300026067 | Bacteria | 1513 |
| 408 | Ga0207702_10048203 | 3300026078 | Bacteria | 3592 |
| 409 | Ga0207702_10252641 | 3300026078 | Bacteria | 1656 |
| 410 | Ga0207702_10256064 | 3300026078 | Bacteria | 1646 |
| 411 | Ga0207641_10000050 | 3300026088 | Bacteria | 175954 |
| 412 | Ga0207641_10000228 | 3300026088 | Bacteria | 72357 |
| 413 | Ga0207641_10000755 | 3300026088 | Bacteria | 34850 |
| 414 | Ga0207641_10006924 | 3300026088 | Bacteria | 9488 |
| 415 | Ga0207641_10008467 | 3300026088 | Bacteria | 8502 |
| 416 | Ga0207648_10000494 | 3300026089 | Bacteria | 43933 |
| 417 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 418 | Ga0207676_10003587 | 3300026095 | Bacteria | 10968 |
| 419 | Ga0207676_10004090 | 3300026095 | Bacteria | 10289 |
| 420 | Ga0207674_10007528 | 3300026116 | Bacteria | 12691 |
| 421 | Ga0207674_10035934 | 3300026116 | Bacteria | 5167 |
| 422 | Ga0207674_10064320 | 3300026116 | Bacteria | 3700 |
| 423 | Ga0207674_10275701 | 3300026116 | Bacteria | 1630 |
| 424 | Ga0207674_10341218 | 3300026116 | Bacteria | 1448 |
| 425 | Ga0207675_100000071 | 3300026118 | Bacteria | 77575 |
| 426 | Ga0207675_100003319 | 3300026118 | Bacteria | 15755 |
| 427 | Ga0207675_100006708 | 3300026118 | Bacteria | 10884 |
| 428 | Ga0207675_100059135 | 3300026118 | Bacteria | 3577 |
| 429 | Ga0207683_10061493 | 3300026121 | Bacteria | 3305 |
| 430 | Ga0207683_10530257 | 3300026121 | Bacteria | 1088 |
| 431 | Ga0207698_10001828 | 3300026142 | Bacteria | 12444 |
| 432 | Ga0207698_10352718 | 3300026142 | Bacteria | 1390 |
| 433 | Ga0207698_10354531 | 3300026142 | Bacteria | 1387 |
| 434 | Ga0207698_10434633 | 3300026142 | Bacteria | 1263 |
| 435 | Ga0207698_10474974 | 3300026142 | Bacteria | 1212 |
| 436 | Ga0209813_10000036 | 3300027866 | Bacteria | 58545 |
| 437 | Ga0268266_10000471 | 3300028379 | Bacteria | 58314 |
| 438 | Ga0268266_10019776 | 3300028379 | Bacteria | 5738 |
| 439 | Ga0268266_10133519 | 3300028379 | Bacteria | 2222 |
| 440 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 441 | Ga0268265_10000209 | 3300028380 | Bacteria | 68317 |
| 442 | Ga0268265_10000525 | 3300028380 | Bacteria | 39061 |
| 443 | Ga0268265_10004259 | 3300028380 | Bacteria | 9991 |
| 444 | Ga0268265_10014040 | 3300028380 | Bacteria | 5456 |
| 445 | Ga0268265_11121799 | 3300028380 | Bacteria | 781 |
| 446 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 447 | Ga0268264_10000144 | 3300028381 | Bacteria | 168841 |
| 448 | Ga0268264_10000483 | 3300028381 | Bacteria | 52975 |
| 449 | Ga0268264_10004593 | 3300028381 | Bacteria | 11734 |
| 450 | Ga0268264_10019865 | 3300028381 | Bacteria | 5489 |
| 451 | Ga0268264_10064820 | 3300028381 | Bacteria | 3076 |
| 452 | Ga0268264_10143375 | 3300028381 | Bacteria | 2133 |
| 453 | Ga0268264_10321702 | 3300028381 | Bacteria | 1463 |
| 454 | Ga0307513_10213019 | 3300031456 | Bacteria | 1761 |
| 455 | Ga0307408_100074061 | 3300031548 | Bacteria | 2525 |
| 456 | Ga0307408_100427460 | 3300031548 | Bacteria | 1144 |
| 457 | Ga0307508_10049043 | 3300031616 | Bacteria | 3761 |
| 458 | Ga0307405_10263720 | 3300031731 | Bacteria | 1288 |
| 459 | Ga0307405_10407112 | 3300031731 | Bacteria | 1066 |
| 460 | Ga0307413_10120074 | 3300031824 | Bacteria | 1779 |
| 461 | Ga0307413_10187326 | 3300031824 | Bacteria | 1482 |
| 462 | Ga0307412_10004187 | 3300031911 | Bacteria | 8043 |
| 463 | Ga0307412_10048912 | 3300031911 | Bacteria | 2783 |
| 464 | Ga0307412_10089691 | 3300031911 | Bacteria | 2147 |
| 465 | Ga0307412_10463036 | 3300031911 | Bacteria | 1047 |
| 466 | Ga0307409_100462886 | 3300031995 | Bacteria | 1226 |
| 467 | Ga0307416_100064488 | 3300032002 | Bacteria | 3005 |
| 468 | Ga0307416_100064534 | 3300032002 | Bacteria | 3004 |
| 469 | Ga0307416_100229611 | 3300032002 | Bacteria | 1788 |
| 470 | Ga0307414_10039012 | 3300032004 | Bacteria | 3195 |
| 471 | Ga0307414_10050186 | 3300032004 | Bacteria | 2889 |
| 472 | Ga0307414_10078461 | 3300032004 | Bacteria | 2407 |
| 473 | Ga0307414_10178988 | 3300032004 | Bacteria | 1703 |
| 474 | Ga0307414_10461251 | 3300032004 | Bacteria | 1117 |
| 475 | Ga0307414_10686004 | 3300032004 | Bacteria | 926 |
| 476 | Ga0307411_10076149 | 3300032005 | Bacteria | 2293 |
| 477 | Ga0307411_10259352 | 3300032005 | Bacteria | 1372 |
| 478 | Ga0307411_10621453 | 3300032005 | Bacteria | 931 |
| 479 | Ga0307510_10131028 | 3300033180 | Bacteria | 2181 |
| 480 | Ga0373923_0113816 | 3300035111 | Bacteria | 1204 |
| 481 | Ga0373923_0130921 | 3300035111 | Bacteria | 1127 |
| 482 | Ga0395899_0008722 | 3300037312 | Bacteria | 7805 |
| 483 | Ga0395900_0036311 | 3300037418 | Bacteria | 5080 |
| 484 | Ga0395900_0295708 | 3300037418 | Bacteria | 1607 |
| 485 | Ga0395898_0667244 | 3300037466 | Bacteria | 982 |
| 486 | Ga0395905_0021782 | 3300037471 | Bacteria | 6062 |
| 487 | Ga0395905_0104285 | 3300037471 | Bacteria | 2662 |
| 488 | Ga0395905_0237379 | 3300037471 | Bacteria | 1704 |
| 489 | Ga0395905_0477343 | 3300037471 | Bacteria | 1146 |
| 490 | Ga0395905_0592646 | 3300037471 | Bacteria | 1010 |
| 491 | Ga0395905_0842566 | 3300037471 | Bacteria | 820 |
| 492 | Ga0436364_0154840 | 3300037853 | Bacteria | 188668 |
| 493 | Ga0395901_0101619 | 3300038443 | Bacteria | 3017 |
| 494 | Ga0395901_0387218 | 3300038443 | Bacteria | 1438 |
| 495 | Ga0237819_01638 | 3300038705 | Bacteria | 5514 |
| 496 | Ga0436365_0864664 | 3300039437 | Bacteria | 1940 |
| 497 | Ga0436363_1390116 | 3300039450 | Bacteria | 1581 |
| 498 | Ga0439461_0000062 | 3300041410 | Bacteria | 13562 |
| 499 | Ga0439461_0062145 | 3300041410 | Bacteria | 850 |
| 500 | Ga0439465_0002490 | 3300041413 | Bacteria | 6015 |
| 501 | Ga0439465_0002807 | 3300041413 | Bacteria | 5706 |
| 502 | Ga0451807_0610978 | 3300041486 | Bacteria | 1510 |
| 503 | Ga0451807_2451244 | 3300041486 | Bacteria | 937 |
| 504 | Ga0451853_2895476 | 3300041512 | Bacteria | 895 |
| 505 | Ga0439431_0000213 | 3300041997 | Bacteria | 11584 |
| 506 | Ga0439431_0011636 | 3300041997 | Bacteria | 2012 |
| 507 | Ga0439442_002121 | 3300042002 | Bacteria | 3899 |
| 508 | Ga0439445_0001827 | 3300042004 | Bacteria | 4687 |
| 509 | Ga0439445_0072984 | 3300042004 | Bacteria | 951 |
| 510 | Ga0439448_0006066 | 3300042005 | Bacteria | 3465 |
| 511 | Ga0439448_0017764 | 3300042005 | Bacteria | 2174 |
| 512 | Ga0439448_0039712 | 3300042005 | Bacteria | 1518 |
| 513 | Ga0439432_001352 | 3300042006 | Bacteria | 9275 |
| 514 | Ga0439450_054815 | 3300042008 | Bacteria | 954 |
| 515 | Ga0439452_012615 | 3300042010 | Bacteria | 2397 |
| 516 | Ga0439455_0000548 | 3300042012 | Bacteria | 5312 |
| 517 | Ga0439455_0010465 | 3300042012 | Bacteria | 2040 |
| 518 | Ga0439457_023261 | 3300042014 | Bacteria | 1371 |
| 519 | Ga0439462_0000410 | 3300042015 | Bacteria | 8305 |
| 520 | Ga0439462_0051755 | 3300042015 | Bacteria | 1104 |
| 521 | Ga0450922_009002 | 3300042124 | Bacteria | 946 |
| 522 | Ga0439446_0091979 | 3300042156 | Bacteria | 950 |
| 523 | Ga0439458_0002779 | 3300042157 | Bacteria | 4212 |
| 524 | Ga0439458_0004556 | 3300042157 | Bacteria | 3174 |
| 525 | Ga0439458_0005357 | 3300042157 | Bacteria | 2884 |
| 526 | Ga0439434_0000698 | 3300042435 | Bacteria | 9679 |
| 527 | Ga0439434_0028901 | 3300042435 | Bacteria | 1680 |
| 528 | Ga0451577_0335570 | 3300042876 | Bacteria | 1371 |
| 529 | Ga0466972_0013569 | 3300044658 | Bacteria | 4089 |
| 530 | Ga0466973_0178351 | 3300044659 | Bacteria | 1623 |
| 531 | Ga0466965_0158371 | 3300044683 | Bacteria | 1186 |
| 532 | Ga0466966_0217357 | 3300044684 | Bacteria | 1154 |
| 533 | Ga0466961_0030993 | 3300044693 | Bacteria | 3437 |
| 534 | Ga0466963_0006035 | 3300044694 | Bacteria | 7140 |
| 535 | Ga0466964_0009242 | 3300044706 | Bacteria | 3708 |
| 536 | Ga0466964_0049201 | 3300044706 | Bacteria | 1725 |
| 537 | Ga0453684_0146010 | 3300044712 | Bacteria | 2818 |
| 538 | Ga0466970_0048935 | 3300044765 | Bacteria | 2254 |
| 539 | Ga0466957_0351838 | 3300044842 | Bacteria | 999 |
| 540 | Ga0466960_0132825 | 3300044901 | Bacteria | 1315 |
| 541 | Ga0466959_0183124 | 3300045049 | Bacteria | 1464 |
| 542 | Ga0466958_0015445 | 3300045836 | Bacteria | 4375 |
| 543 | Ga0466967_0649818 | 3300045976 | Bacteria | 1043 |
| 544 | Ga0495627_000036 | 3300046453 | Bacteria | 205589 |
| 545 | Ga0495627_000090 | 3300046453 | Bacteria | 109622 |
| 546 | Ga0495627_000287 | 3300046453 | Bacteria | 50673 |
| 547 | Ga0495638_0012358 | 3300046460 | Bacteria | 5855 |
| 548 | Ga0495638_0016175 | 3300046460 | Bacteria | 5000 |
| 549 | Ga0495650_0000684 | 3300046471 | Bacteria | 43971 |
| 550 | Ga0495650_0001816 | 3300046471 | Bacteria | 19170 |
| 551 | Ga0495650_0028746 | 3300046471 | Bacteria | 2545 |
| 552 | Ga0495596_0000601 | 3300046500 | Bacteria | 22617 |
| 553 | Ga0495607_0013398 | 3300046501 | Bacteria | 5375 |
| 554 | Ga0495583_0000252 | 3300046506 | Bacteria | 88617 |
| 555 | Ga0495583_0073090 | 3300046506 | Bacteria | 1504 |
| 556 | Ga0495606_0026435 | 3300046507 | Bacteria | 4138 |
| 557 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 558 | Ga0495610_0000079 | 3300046512 | Bacteria | 115816 |
| 559 | Ga0495610_0001801 | 3300046512 | Bacteria | 18656 |
| 560 | Ga0495610_0028580 | 3300046512 | Bacteria | 2947 |
| 561 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 562 | Ga0495620_0013186 | 3300046515 | Bacteria | 4240 |
| 563 | Ga0495631_0069054 | 3300046518 | Bacteria | 1528 |
| 564 | Ga0495632_0000095 | 3300046519 | Bacteria | 89499 |
| 565 | Ga0495632_0000668 | 3300046519 | Bacteria | 31348 |
| 566 | Ga0495632_0001502 | 3300046519 | Bacteria | 19288 |
| 567 | Ga0495632_0090126 | 3300046519 | Bacteria | 1455 |
| 568 | Ga0495637_0003691 | 3300046520 | Bacteria | 8085 |
| 569 | Ga0495637_0047079 | 3300046520 | Bacteria | 1822 |
| 570 | Ga0495643_0000038 | 3300046522 | Bacteria | 236010 |
| 571 | Ga0495643_0000217 | 3300046522 | Bacteria | 88279 |
| 572 | Ga0495643_0012289 | 3300046522 | Bacteria | 5170 |
| 573 | Ga0495643_0086614 | 3300046522 | Bacteria | 1622 |
| 574 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 575 | Ga0495648_0005139 | 3300046524 | Bacteria | 10954 |
| 576 | Ga0495663_0000028 | 3300046525 | Bacteria | 89526 |
| 577 | Ga0495609_0001277 | 3300046538 | Bacteria | 17177 |
| 578 | Ga0495609_0007581 | 3300046538 | Bacteria | 5396 |
| 579 | Ga0495622_0012565 | 3300046557 | Bacteria | 3923 |
| 580 | Ga0495633_0000340 | 3300046558 | Bacteria | 52440 |
| 581 | Ga0495633_0003319 | 3300046558 | Bacteria | 10807 |
| 582 | Ga0495633_0004974 | 3300046558 | Bacteria | 8294 |
| 583 | Ga0495633_0108375 | 3300046558 | Bacteria | 1288 |
| 584 | Ga0495633_0142170 | 3300046558 | Bacteria | 1109 |
| 585 | Ga0495668_0008492 | 3300046616 | Bacteria | 6400 |
| 586 | Ga0495668_0074488 | 3300046616 | Bacteria | 1864 |
| 587 | Ga0495625_0006657 | 3300046660 | Bacteria | 10249 |
| 588 | Ga0495625_0014445 | 3300046660 | Bacteria | 6302 |
| 589 | Ga0495625_0057803 | 3300046660 | Bacteria | 2757 |
| 590 | Ga0495661_0024460 | 3300046665 | Bacteria | 3909 |
| 591 | Ga0495661_0048707 | 3300046665 | Bacteria | 2574 |
| 592 | Ga0495669_0241249 | 3300046684 | Bacteria | 867 |
| 593 | Ga0495670_0315271 | 3300046691 | Bacteria | 839 |
| 594 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 595 | Ga0495671_0000027 | 3300046692 | Bacteria | 236011 |
| 596 | Ga0495672_0055076 | 3300047320 | Bacteria | 2322 |
| 597 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 598 | Ga0495673_0086819 | 3300047469 | Bacteria | 1285 |
| 599 | Ga0495681_0000048 | 3300047470 | Bacteria | 110216 |
| 600 | Ga0495681_0000077 | 3300047470 | Bacteria | 87471 |
| 601 | Ga0495681_0029019 | 3300047470 | Bacteria | 2837 |
| 602 | Ga0495686_0000469 | 3300047472 | Bacteria | 60229 |
| 603 | Ga0495686_0015005 | 3300047472 | Bacteria | 5309 |
| 604 | Ga0495686_0035001 | 3300047472 | Bacteria | 3231 |
| 605 | Ga0495686_0045796 | 3300047472 | Bacteria | 2767 |
| 606 | Ga0495686_0347710 | 3300047472 | Bacteria | 807 |
| 607 | Ga0495615_0091122 | 3300048090 | Bacteria | 849 |
| 608 | Ga0496100_0063797 | 3300048903 | Bacteria | 2435 |
| 609 | Ga0496101_0035108 | 3300048904 | Bacteria | 3545 |
| 610 | Ga0496101_0641956 | 3300048904 | Bacteria | 839 |
| 611 | Ga0496102_0000267 | 3300048905 | Bacteria | 66761 |
| 612 | Ga0496102_0033928 | 3300048905 | Bacteria | 4589 |
| 613 | Ga0496102_0180466 | 3300048905 | Bacteria | 1989 |
| 614 | Ga0496102_0234679 | 3300048905 | Bacteria | 1729 |
| 615 | Ga0496103_0000139 | 3300048906 | Bacteria | 75158 |
| 616 | Ga0496103_0442886 | 3300048906 | Bacteria | 833 |
| 617 | Ga0496104_0001996 | 3300048907 | Bacteria | 17709 |
| 618 | Ga0496105_0000099 | 3300048908 | Bacteria | 59095 |
| 619 | Ga0496106_0522487 | 3300048909 | Bacteria | 953 |
| 620 | Ga0496107_0020816 | 3300048910 | Bacteria | 4636 |
| 621 | Ga0496107_0660656 | 3300048910 | Bacteria | 770 |
| 622 | Ga0496108_0001779 | 3300048911 | Bacteria | 17174 |
| 623 | Ga0496109_0006311 | 3300048912 | Bacteria | 9982 |
| 624 | Ga0496109_0197981 | 3300048912 | Bacteria | 1889 |
| 625 | Ga0496110_0188045 | 3300048913 | Bacteria | 1875 |
| 626 | Ga0496110_0205913 | 3300048913 | Bacteria | 1788 |
| 627 | Ga0496110_0525296 | 3300048913 | Bacteria | 1076 |
| 628 | Ga0496111_0025926 | 3300048914 | Bacteria | 4137 |
| 629 | Ga0496111_0090959 | 3300048914 | Bacteria | 2236 |
| 630 | Ga0496111_0192483 | 3300048914 | Bacteria | 1516 |
| 631 | Ga0496112_0018899 | 3300048915 | Bacteria | 6493 |
| 632 | Ga0496112_0445998 | 3300048915 | Bacteria | 1232 |
| 633 | Ga0496113_0004509 | 3300048916 | Bacteria | 8576 |
| 634 | Ga0496113_0058450 | 3300048916 | Bacteria | 2901 |
| 635 | Ga0496115_0019907 | 3300048918 | Bacteria | 5170 |
| 636 | Ga0496115_0236213 | 3300048918 | Bacteria | 1507 |
| 637 | Ga0496116_0019293 | 3300048919 | Bacteria | 5223 |
| 638 | Ga0496116_0026853 | 3300048919 | Bacteria | 4200 |
| 639 | Ga0496116_0058256 | 3300048919 | Bacteria | 2520 |
| 640 | Ga0496116_0072004 | 3300048919 | Bacteria | 2186 |
| 641 | Ga0496117_0008650 | 3300048920 | Bacteria | 9634 |
| 642 | Ga0496117_0017167 | 3300048920 | Bacteria | 6058 |
| 643 | Ga0496117_0020177 | 3300048920 | Bacteria | 5443 |
| 644 | Ga0496117_0166070 | 3300048920 | Bacteria | 1287 |
| 645 | Ga0496118_0000606 | 3300048921 | Bacteria | 59016 |
| 646 | Ga0496118_0009747 | 3300048921 | Bacteria | 9635 |
| 647 | Ga0496118_0015390 | 3300048921 | Bacteria | 7082 |
| 648 | Ga0496118_0023847 | 3300048921 | Bacteria | 5301 |
| 649 | Ga0496118_0032113 | 3300048921 | Bacteria | 4335 |
| 650 | Ga0496118_0244241 | 3300048921 | Bacteria | 1025 |
| 651 | Ga0496119_0004210 | 3300048922 | Bacteria | 14446 |
| 652 | Ga0496119_0043741 | 3300048922 | Bacteria | 2827 |
| 653 | Ga0496119_0058202 | 3300048922 | Bacteria | 2330 |
| 654 | Ga0496119_0298168 | 3300048922 | Bacteria | 796 |
| 655 | Ga0496120_0003080 | 3300048923 | Bacteria | 15717 |
| 656 | Ga0496120_0163353 | 3300048923 | Bacteria | 1108 |
| 657 | Ga0496120_0299918 | 3300048923 | Bacteria | 736 |
| 658 | Ga0496121_0000349 | 3300048924 | Bacteria | 96428 |
| 659 | Ga0496121_0006573 | 3300048924 | Bacteria | 14350 |
| 660 | Ga0496121_0009274 | 3300048924 | Bacteria | 11352 |
| 661 | Ga0496121_0013822 | 3300048924 | Bacteria | 8640 |
| 662 | Ga0496121_0023584 | 3300048924 | Bacteria | 5918 |
| 663 | Ga0496121_0138727 | 3300048924 | Bacteria | 1807 |
| 664 | Ga0496121_0153284 | 3300048924 | Bacteria | 1693 |
| 665 | Ga0496122_0000579 | 3300048925 | Bacteria | 75073 |
| 666 | Ga0496122_0003895 | 3300048925 | Bacteria | 19129 |
| 667 | Ga0496122_0005423 | 3300048925 | Bacteria | 15204 |
| 668 | Ga0496122_0007148 | 3300048925 | Bacteria | 12516 |
| 669 | Ga0496122_0009664 | 3300048925 | Bacteria | 10094 |
| 670 | Ga0496122_0059250 | 3300048925 | Bacteria | 2827 |
| 671 | Ga0496122_0141734 | 3300048925 | Bacteria | 1502 |
| 672 | Ga0496122_0166595 | 3300048925 | Bacteria | 1335 |
| 673 | Ga0496122_0219377 | 3300048925 | Bacteria | 1093 |
| 674 | Ga0496123_0000286 | 3300048926 | Bacteria | 98752 |
| 675 | Ga0496123_0001402 | 3300048926 | Bacteria | 33737 |
| 676 | Ga0496123_0002745 | 3300048926 | Bacteria | 21046 |
| 677 | Ga0496123_0002794 | 3300048926 | Bacteria | 20744 |
| 678 | Ga0496123_0056695 | 3300048926 | Bacteria | 2557 |
| 679 | Ga0496123_0101824 | 3300048926 | Bacteria | 1669 |
| 680 | Ga0496123_0106295 | 3300048926 | Bacteria | 1617 |
| 681 | Ga0496123_0120378 | 3300048926 | Bacteria | 1478 |
| 682 | Ga0496123_0147013 | 3300048926 | Bacteria | 1278 |
| 683 | Ga0496124_0001132 | 3300048927 | Bacteria | 41905 |
| 684 | Ga0496124_0001730 | 3300048927 | Bacteria | 30704 |
| 685 | Ga0496124_0008888 | 3300048927 | Bacteria | 10420 |
| 686 | Ga0496124_0049847 | 3300048927 | Bacteria | 3570 |
| 687 | Ga0496124_0050093 | 3300048927 | Bacteria | 3560 |
| 688 | Ga0496124_0067144 | 3300048927 | Bacteria | 2985 |
| 689 | Ga0496124_0132955 | 3300048927 | Bacteria | 1974 |
| 690 | Ga0496124_0258622 | 3300048927 | Bacteria | 1283 |
| 691 | Ga0496124_0269944 | 3300048927 | Bacteria | 1246 |
| 692 | Ga0496124_0278223 | 3300048927 | Bacteria | 1221 |
| 693 | Ga0496124_0344554 | 3300048927 | Bacteria | 1056 |
| 694 | Ga0496124_0348664 | 3300048927 | Bacteria | 1048 |
| 695 | Ga0496125_0004923 | 3300048928 | Bacteria | 15118 |
| 696 | Ga0496125_0012034 | 3300048928 | Bacteria | 8613 |
| 697 | Ga0496125_0012127 | 3300048928 | Bacteria | 8574 |
| 698 | Ga0496125_0016696 | 3300048928 | Bacteria | 7039 |
| 699 | Ga0496125_0018428 | 3300048928 | Bacteria | 6630 |
| 700 | Ga0496125_0021250 | 3300048928 | Bacteria | 6061 |
| 701 | Ga0496125_0038148 | 3300048928 | Bacteria | 4164 |
| 702 | Ga0496125_0060040 | 3300048928 | Bacteria | 3059 |
| 703 | Ga0496125_0079290 | 3300048928 | Bacteria | 2520 |
| 704 | Ga0496125_0107609 | 3300048928 | Bacteria | 2031 |
| 705 | Ga0496125_0283364 | 3300048928 | Bacteria | 1025 |
| 706 | Ga0496125_0392570 | 3300048928 | Bacteria | 814 |
| 707 | Ga0496126_0000619 | 3300048929 | Bacteria | 66827 |
| 708 | Ga0496126_0027985 | 3300048929 | Bacteria | 5375 |
| 709 | Ga0496126_0066961 | 3300048929 | Bacteria | 3210 |
| 710 | Ga0496126_0115084 | 3300048929 | Bacteria | 2339 |
| 711 | Ga0496126_0232662 | 3300048929 | Bacteria | 1543 |
| 712 | Ga0496126_0459179 | 3300048929 | Bacteria | 1024 |
| 713 | Ga0496126_0633079 | 3300048929 | Bacteria | 839 |
| 714 | Ga0501292_000004 | 3300049515 | Bacteria | 159565 |
| 715 | Ga0501294_000758 | 3300049517 | Bacteria | 3568 |
| 716 | Ga0501300_000066 | 3300049523 | Bacteria | 15100 |
| 717 | Ga0501314_001800 | 3300049530 | Bacteria | 1592 |
| 718 | Ga0501032_0085757 | 3300049569 | Bacteria | 2093 |
| 719 | Ga0501034_0016790 | 3300049571 | Bacteria | 7506 |
| 720 | Ga0501034_0204545 | 3300049571 | Bacteria | 1931 |
| 721 | Ga0501037_0745985 | 3300049573 | Bacteria | 649 |
| 722 | Ga0501038_0298223 | 3300049574 | Bacteria | 1265 |
| 723 | Ga0501043_0130029 | 3300049579 | Bacteria | 1973 |
| 724 | Ga0501043_0195947 | 3300049579 | Bacteria | 1569 |
| 725 | Ga0501046_0428815 | 3300049580 | Bacteria | 953 |
| 726 | Ga0501047_0000644 | 3300049581 | Bacteria | 36698 |
| 727 | Ga0501048_0134900 | 3300049582 | Bacteria | 1744 |
| 728 | Ga0501202_014100 | 3300049652 | Bacteria | 1527 |
| 729 | Ga0501222_000505 | 3300049662 | Bacteria | 5796 |
| 730 | Ga0501223_000042 | 3300049663 | Bacteria | 44258 |
| 731 | Ga0501223_000211 | 3300049663 | Bacteria | 14909 |
| 732 | Ga0501223_001716 | 3300049663 | Bacteria | 5000 |
| 733 | Ga0501224_000008 | 3300049664 | Bacteria | 111708 |
| 734 | Ga0501224_009310 | 3300049664 | Bacteria | 1436 |
| 735 | Ga0501227_014569 | 3300049665 | Bacteria | 1746 |
| 736 | Ga0501233_008110 | 3300049668 | Bacteria | 2017 |
| 737 | Ga0501235_000139 | 3300049669 | Bacteria | 12177 |
| 738 | Ga0501249_000549 | 3300049679 | Bacteria | 9020 |
| 739 | Ga0501257_003748 | 3300049686 | Bacteria | 3284 |
| 740 | Ga0501259_000801 | 3300049688 | Bacteria | 5144 |
| 741 | Ga0501261_000010 | 3300049690 | Bacteria | 49364 |
| 742 | Ga0501225_0000073 | 3300049705 | Bacteria | 33154 |
| 743 | Ga0501225_0000520 | 3300049705 | Bacteria | 12018 |
| 744 | Ga0501225_0003808 | 3300049705 | Bacteria | 4533 |
| 745 | Ga0501225_0022874 | 3300049705 | Bacteria | 1725 |
| 746 | Ga0501234_000985 | 3300049707 | Bacteria | 4509 |
| 747 | Ga0501245_000603 | 3300049708 | Bacteria | 4418 |
| 748 | Ga0501245_008999 | 3300049708 | Bacteria | 1429 |
| 749 | Ga0501241_005459 | 3300049758 | Bacteria | 2368 |
| 750 | Ga0501279_000005 | 3300049775 | Bacteria | 153858 |
| 751 | Ga0501280_000038 | 3300049776 | Bacteria | 38694 |
| 752 | Ga0501282_000165 | 3300049778 | Bacteria | 8009 |
| 753 | Ga0501044_0049651 | 3300049823 | Bacteria | 4331 |
| 754 | Ga0501044_0892156 | 3300049823 | Bacteria | 764 |
| 755 | Ga0501226_000042 | 3300049853 | Bacteria | 59224 |
| 756 | nmdc:mga00v17_29710_c1 | 3300050491 | Bacteria | 3209 |
| 757 | nmdc:mga0k408_188043_c1 | 3300050493 | Bacteria | 1232 |
| 758 | nmdc:mga0k408_51881_c1 | 3300050493 | Bacteria | 2376 |
| 759 | nmdc:mga06z11_111_c1 | 3300050494 | Bacteria | 33603 |
| 760 | nmdc:mga04h51_100_c1 | 3300050495 | Bacteria | 25673 |
| 761 | nmdc:mga07m45_1083_c1 | 3300050496 | Bacteria | 12127 |
| 762 | nmdc:mga07m45_82575_c1 | 3300050496 | Bacteria | 1835 |
| 763 | nmdc:mga05p37_228596_c1 | 3300050507 | Bacteria | 2242 |
| 764 | Ga0495619_0327712 | 3300053085 | Bacteria | 1060 |
| 765 | Ga0500643_000539 | 3300053087 | Bacteria | 26512 |
| 766 | Ga0500643_002149 | 3300053087 | Bacteria | 10433 |
| 767 | Ga0500643_004524 | 3300053087 | Bacteria | 6250 |
| 768 | Ga0500643_010045 | 3300053087 | Bacteria | 3559 |
| 769 | Ga0500643_021485 | 3300053087 | Bacteria | 2091 |
| 770 | Ga0500643_045312 | 3300053087 | Bacteria | 1274 |
| 771 | Ga0500643_068092 | 3300053087 | Bacteria | 990 |
| 772 | Ga0500644_0028883 | 3300053088 | Bacteria | 1739 |
| 773 | Ga0500647_0029989 | 3300053091 | Bacteria | 2581 |
| 774 | Ga0500651_0002188 | 3300053093 | Bacteria | 10235 |
| 775 | Ga0500641_0001555 | 3300053096 | Bacteria | 8178 |
| 776 | Ga0500641_0012360 | 3300053096 | Bacteria | 3116 |
| 777 | Ga0500650_0191460 | 3300053098 | Bacteria | 934 |
| 778 | Ga0500556_0000074 | 3300053104 | Bacteria | 98799 |
| 779 | Ga0500557_017166 | 3300053105 | Bacteria | 1993 |
| 780 | Ga0500562_005307 | 3300053108 | Bacteria | 3236 |
| 781 | Ga0500562_073645 | 3300053108 | Bacteria | 922 |
| 782 | Ga0500594_0062933 | 3300053118 | Bacteria | 1074 |
| 783 | Ga0500595_005345 | 3300053119 | Bacteria | 5617 |
| 784 | Ga0500618_005557 | 3300053125 | Bacteria | 3815 |
| 785 | Ga0500618_022875 | 3300053125 | Bacteria | 1516 |
| 786 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 787 | Ga0500642_0001441 | 3300053130 | Bacteria | 6825 |
| 788 | Ga0500652_092939 | 3300053131 | Bacteria | 1260 |
| 789 | Ga0500655_000061 | 3300053133 | Bacteria | 29562 |
| 790 | Ga0500559_0001442 | 3300053136 | Bacteria | 13495 |
| 791 | Ga0500573_0000015 | 3300053140 | Bacteria | 192264 |
| 792 | Ga0500573_0264954 | 3300053140 | Bacteria | 878 |
| 793 | Ga0500616_0003051 | 3300053153 | Bacteria | 13180 |
| 794 | Ga0500622_0000901 | 3300053156 | Bacteria | 25291 |
| 795 | Ga0500622_0003437 | 3300053156 | Bacteria | 10591 |
| 796 | Ga0500622_0016726 | 3300053156 | Bacteria | 3916 |
| 797 | Ga0500624_000085 | 3300053157 | Bacteria | 47798 |
| 798 | Ga0500624_000125 | 3300053157 | Bacteria | 34426 |
| 799 | Ga0500627_0002237 | 3300053158 | Bacteria | 5671 |
| 800 | Ga0500636_0013174 | 3300053177 | Bacteria | 4851 |
| 801 | Ga0500636_0077521 | 3300053177 | Bacteria | 1920 |
| 802 | Ga0500637_0000023 | 3300053178 | Bacteria | 61044 |
| 803 | Ga0500570_000268 | 3300053724 | Bacteria | 17871 |
| 804 | Ga0500645_003833 | 3300053730 | Bacteria | 5966 |
| 805 | Ga0500645_004874 | 3300053730 | Bacteria | 5055 |
| 806 | Ga0500661_000138 | 3300055283 | Bacteria | 12382 |
| 807 | Ga0466962_0001351 | 3300061719 | Bacteria | 11344 |
| 808 | Ga0466962_0046360 | 3300061719 | Bacteria | 2077 |
| 809 | 2511129570 | 2510917021 | Bacteria | 5705459 |
| 810 | 2512644061 | 2512564014 | Bacteria | 4639632 |
| 811 | 2585263904 | 2582581305 | Bacteria | 4895574 |
| 812 | 2600225765 | 2599185359 | Bacteria | 4772316 |
| 813 | 2643730699 | 2643221541 | Bacteria | 5498788 |
| 814 | 2644040835 | 2643221605 | Bacteria | 4772303 |
| 815 | 2644044647 | 2643221606 | Bacteria | 5588032 |
| 816 | 2644391428 | 2643221671 | Bacteria | 5496681 |
| 817 | 2778123851 | 2775507255 | Bacteria | 3945731 |
| 818 | 2809064830 | 2808606401 | Bacteria | 4586670 |
| 819 | 2809080797 | 2808606404 | Bacteria | 4652788 |
| 820 | 2809085162 | 2808606405 | Bacteria | 4586632 |
| 821 | 2819716433 | 2818991466 | Bacteria | 4748179 |
| 822 | 2879165296 | 2879163058 | Bacteria | 4223965 |
| 823 | 2880521862 | 2880518877 | Bacteria | 5012590 |
| 824 | 2919711333 | 2919709256 | Bacteria | 4318106 |
| 825 | 2928028566 | 2928027323 | Bacteria | 4382488 |
| 826 | 2928528758 | 2928526807 | Bacteria | 4760224 |
| 827 | 2928970312 | 2928968154 | Bacteria | 4633371 |
| 828 | 2984555857 | 2984555340 | Bacteria | 4247089 |
| 829 | 2984566034 | 2984564862 | Bacteria | 4339992 |
| 830 | 2990266488 | 2990265787 | Bacteria | 3943888 |
| 831 | 2993357045 | 2993356040 | Bacteria | 4247105 |
| 832 | 2993695714 | 2993693658 | Bacteria | 4040749 |
| 833 | 8054306873 | 8054302542 | Bacteria | 5698134 |
| 834 | 8057101944 | 8057101203 | Bacteria | 5034064 |
| 835 | Ga0495670_0021536 | |||
| 836 | SwRhRL2b_contig_3660702 | |||
| 837 | JGI24736J21556_1000235 | |||
| 838 | JGI24741J21665_1000124 | |||
| 839 | JGI24752J21851_1000586 | |||
| 840 | JGI24740J21852_10003311 | |||
| 841 | JGI24740J21852_10028989 | |||
| 842 | JGI24740J21852_10058057 | |||
| 843 | JGI24739J22299_10001891 | |||
| 844 | JGI24737J22298_10003492 | |||
| 845 | JGI24737J22298_10006196 | |||
| 846 | JGI24737J22298_10040310 | |||
| 847 | JGI24737J22298_10084090 | |||
| 848 | JGI24743J22301_10012544 | |||
| 849 | JGI24735J21928_10000699 | |||
| 850 | JGI24735J21928_10009713 | |||
| 851 | JGI24735J21928_10009810 | |||
| 852 | JGI24735J21928_10012405 | |||
| 853 | JGI24735J21928_10012704 | |||
| 854 | JGI24735J21928_10027489 | |||
| 855 | JGI24735J21928_10054782 | |||
| 856 | JGI24738J21930_10002736 | |||
| 857 | JGI24738J21930_10004755 | |||
| 858 | JGI24738J21930_10015195 | |||
| 859 | JGI24738J21930_10020901 | |||
| 860 | JGI24749J21850_1000352 | |||
| 861 | JGI24744J21845_10000115 | |||
| 862 | JGI24035J26624_1003524 | |||
| 863 | JGI24751J29686_10000208 | |||
| 864 | JGI25150J39212_1003534 | |||
| 865 | JGI25151J46595_10037612 | |||
| 866 | JGI25165J46597_1000534 | |||
| 867 | JGI25153J46596_10000186 | |||
| 868 | rootL2_10042168 | |||
| 869 | Ga0055542_1003000 | |||
| 870 | Ga0055526_1012603 | |||
| 871 | Ga0055536_1016085 | |||
| 872 | Ga0055530_10000064 | |||
| 873 | Ga0055530_10037267 | |||
| 874 | Ga0055540_1000768 | |||
| 875 | Ga0055540_1002060 | |||
| 876 | Ga0055531_10000073 | |||
| 877 | Ga0065165_1056282 | |||
| 878 | Ga0065704_10000192 | |||
| 879 | Ga0065704_10000914 | |||
| 880 | Ga0065704_10003296 | |||
| 881 | Ga0065704_10070989 | |||
| 882 | Ga0065704_10077790 | |||
| 883 | Ga0065707_10084356 | |||
| 884 | Ga0065707_10086371 | |||
| 885 | Ga0070658_10001154 | |||
| 886 | Ga0070658_10012339 | |||
| 887 | Ga0070676_10000448 | |||
| 888 | Ga0070683_100276977 | |||
| 889 | Ga0070683_100532952 | |||
| 890 | Ga0070670_100000024 | |||
| 891 | Ga0070670_100003502 | |||
| 892 | Ga0070670_100035441 | |||
| 893 | Ga0068869_100002661 | |||
| 894 | Ga0070666_10000111 | |||
| 895 | Ga0070666_10001747 | |||
| 896 | Ga0070666_10051148 | |||
| 897 | Ga0070666_10062591 | |||
| 898 | Ga0070666_10098313 | |||
| 899 | Ga0070666_10456715 | |||
| 900 | Ga0068868_100000910 | |||
| 901 | Ga0070660_100009320 | |||
| 902 | Ga0070660_100058583 | |||
| 903 | Ga0070660_100135929 | |||
| 904 | Ga0070660_100149113 | |||
| 905 | Ga0070660_100166856 | |||
| 906 | Ga0070661_100008203 | |||
| 907 | Ga0070661_100261922 | |||
| 908 | Ga0070668_100000027 | |||
| 909 | Ga0070668_100000041 | |||
| 910 | Ga0070668_100008132 | |||
| 911 | Ga0070668_100024451 | |||
| 912 | Ga0070668_100027686 | |||
| 913 | Ga0070668_100084870 | |||
| 914 | Ga0070668_100135504 | |||
| 915 | Ga0070669_100000012 | |||
| 916 | Ga0070669_100000047 | |||
| 917 | Ga0070669_100005445 | |||
| 918 | Ga0070669_100010694 | |||
| 919 | Ga0070669_100054887 | |||
| 920 | Ga0070669_100218101 | |||
| 921 | Ga0070675_100071809 | |||
| 922 | Ga0070671_100000019 | |||
| 923 | Ga0070671_100000517 | |||
| 924 | Ga0070671_100002891 | |||
| 925 | Ga0070671_100003218 | |||
| 926 | Ga0070671_100023173 | |||
| 927 | Ga0070671_100057465 | |||
| 928 | Ga0070674_100019915 | |||
| 929 | Ga0070673_100000020 | |||
| 930 | Ga0070659_100140337 | |||
| 931 | Ga0070659_100233254 | |||
| 932 | Ga0070659_100287872 | |||
| 933 | Ga0070667_100000017 | |||
| 934 | Ga0070667_100000058 | |||
| 935 | Ga0070667_100000143 | |||
| 936 | Ga0070667_100005804 | |||
| 937 | Ga0070667_100012087 | |||
| 938 | Ga0070667_100016472 | |||
| 939 | Ga0070667_100113572 | |||
| 940 | Ga0070705_100004405 | |||
| 941 | Ga0070708_100912558 | |||
| 942 | Ga0070663_100001418 | |||
| 943 | Ga0070678_100005895 | |||
| 944 | Ga0070662_100032068 | |||
| 945 | Ga0070662_100394559 | |||
| 946 | Ga0068867_100000155 | |||
| 947 | Ga0070685_10016519 | |||
| 948 | Ga0070685_10505431 | |||
| 949 | Ga0068853_100070689 | |||
| 950 | Ga0068853_100086514 | |||
| 951 | Ga0068853_100089633 | |||
| 952 | Ga0068853_100265068 | |||
| 953 | Ga0068853_100315074 | |||
| 954 | Ga0070665_100001012 | |||
| 955 | Ga0070665_100010368 | |||
| 956 | Ga0068855_100002050 | |||
| 957 | Ga0068855_100121831 | |||
| 958 | Ga0068855_100629612 | |||
| 959 | Ga0070664_100014905 | |||
| 960 | Ga0070664_100490854 | |||
| 961 | Ga0068857_100013486 | |||
| 962 | Ga0068857_100059205 | |||
| 963 | Ga0068857_100108610 | |||
| 964 | Ga0068857_100121731 | |||
| 965 | Ga0068857_100309780 | |||
| 966 | Ga0068854_100002936 | |||
| 967 | Ga0068854_100268072 | |||
| 968 | Ga0068854_100340174 | |||
| 969 | Ga0068856_100008231 | |||
| 970 | Ga0068856_100019646 | |||
| 971 | Ga0070702_100041902 | |||
| 972 | Ga0068852_100010016 | |||
| 973 | Ga0068852_100483302 | |||
| 974 | Ga0068852_100491236 | |||
| 975 | Ga0068852_100493014 | |||
| 976 | Ga0068859_100038244 | |||
| 977 | Ga0068859_100062917 | |||
| 978 | Ga0068859_100092658 | |||
| 979 | Ga0068859_100190175 | |||
| 980 | Ga0068859_100588416 | |||
| 981 | Ga0068864_100000036 | |||
| 982 | Ga0068864_100000475 | |||
| 983 | Ga0068864_100004795 | |||
| 984 | Ga0068864_100159134 | |||
| 985 | Ga0068861_100002169 | |||
| 986 | Ga0068861_100005201 | |||
| 987 | Ga0068861_100021348 | |||
| 988 | Ga0068851_10013802 | |||
| 989 | Ga0068851_10077709 | |||
| 990 | Ga0068851_10160609 | |||
| 991 | Ga0068863_100000031 | |||
| 992 | Ga0068863_100001489 | |||
| 993 | Ga0068863_100002193 | |||
| 994 | Ga0068863_100005824 | |||
| 995 | Ga0068863_100007418 | |||
| 996 | Ga0068863_100031052 | |||
| 997 | Ga0068858_100000103 | |||
| 998 | Ga0068858_100021883 | |||
| 999 | Ga0068858_100204130 | |||
| 1000 | Ga0068860_100000056 | |||
| 1001 | Ga0068860_100000181 | |||
| 1002 | Ga0068860_100022971 | |||
| 1003 | Ga0068860_100031058 | |||
| 1004 | Ga0068860_100031678 | |||
| 1005 | Ga0068860_100078368 | |||
| 1006 | Ga0068860_100324700 | |||
| 1007 | Ga0068862_100000033 | |||
| 1008 | Ga0068862_100000187 | |||
| 1009 | Ga0068862_100000884 | |||
| 1010 | Ga0068862_100005927 | |||
| 1011 | Ga0068862_100030592 | |||
| 1012 | Ga0068862_100128025 | |||
| 1013 | Ga0068862_100235818 | |||
| 1014 | Ga0081539_10016956 | |||
| 1015 | Ga0075368_10001355 | |||
| 1016 | Ga0075364_10166195 | |||
| 1017 | Ga0075367_10001026 | |||
| 1018 | Ga0075366_10034983 | |||
| 1019 | Ga0075366_10117135 | |||
| 1020 | Ga0097621_100005590 | |||
| 1021 | Ga0075370_10002503 | |||
| 1022 | Ga0068865_100000272 | |||
| 1023 | Ga0097620_100038244 | |||
| 1024 | Ga0097620_100062917 | |||
| 1025 | Ga0097620_100092661 | |||
| 1026 | Ga0097620_100190181 | |||
| 1027 | Ga0097620_100588387 | |||
| 1028 | Ga0099826_10138471 | |||
| 1029 | Ga0105251_10004489 | |||
| 1030 | Ga0105251_10015704 | |||
| 1031 | Ga0105251_10032668 | |||
| 1032 | Ga0105251_10035471 | |||
| 1033 | Ga0105250_10032780 | |||
| 1034 | Ga0105250_10075779 | |||
| 1035 | Ga0105240_10012649 | |||
| 1036 | Ga0105240_10020042 | |||
| 1037 | Ga0105240_10574747 | |||
| 1038 | Ga0105245_10002130 | |||
| 1039 | Ga0105247_10004441 | |||
| 1040 | Ga0105247_10117922 | |||
| 1041 | Ga0105247_10118724 | |||
| 1042 | Ga0114129_10282114 | |||
| 1043 | Ga0105243_10000711 | |||
| 1044 | Ga0105243_10222341 | |||
| 1045 | Ga0105243_10654438 | |||
| 1046 | Ga0105241_10000807 | |||
| 1047 | Ga0105242_10000320 | |||
| 1048 | Ga0105248_10000091 | |||
| 1049 | Ga0105248_10002773 | |||
| 1050 | Ga0105248_10014281 | |||
| 1051 | Ga0105248_10018898 | |||
| 1052 | Ga0105248_10033589 | |||
| 1053 | Ga0105248_10070358 | |||
| 1054 | Ga0105248_10227998 | |||
| 1055 | Ga0105248_10365850 | |||
| 1056 | Ga0105237_10008796 | |||
| 1057 | Ga0105237_10075759 | |||
| 1058 | Ga0105238_10501816 | |||
| 1059 | Ga0105249_10000553 | |||
| 1060 | Ga0105249_10001384 | |||
| 1061 | Ga0105249_10093615 | |||
| 1062 | Ga0105249_10414876 | |||
| 1063 | Ga0105148_100060 | |||
| 1064 | Ga0105239_10142551 | |||
| 1065 | Ga0105239_10165940 | |||
| 1066 | Ga0105239_10808157 | |||
| 1067 | Ga0105246_10004775 | |||
| 1068 | Ga0157326_1000067 | |||
| 1069 | Ga0157373_10015080 | |||
| 1070 | Ga0157373_10097352 | |||
| 1071 | Ga0157371_10710594 | |||
| 1072 | Ga0157370_10000145 | |||
| 1073 | Ga0157370_10013194 | |||
| 1074 | Ga0157370_10704392 | |||
| 1075 | Ga0157369_10018860 | |||
| 1076 | Ga0157369_10648922 | |||
| 1077 | Ga0157369_10957018 | |||
| 1078 | Ga0157374_10005414 | |||
| 1079 | Ga0157374_10136449 | |||
| 1080 | Ga0157378_10011140 | |||
| 1081 | Ga0163162_10053526 | |||
| 1082 | Ga0163162_10124375 | |||
| 1083 | Ga0163162_10658904 | |||
| 1084 | Ga0157372_10029740 | |||
| 1085 | Ga0157372_10065951 | |||
| 1086 | Ga0157372_10146982 | |||
| 1087 | Ga0157372_10202471 | |||
| 1088 | Ga0157372_10681462 | |||
| 1089 | Ga0157380_10008171 | |||
| 1090 | Ga0157380_10370279 | |||
| 1091 | Ga0157380_10545439 | |||
| 1092 | Ga0157377_10013528 | |||
| 1093 | Ga0157379_10001174 | |||
| 1094 | Ga0157376_10000395 | |||
| 1095 | Ga0183363_1005 | |||
| 1096 | Ga0163161_10038021 | |||
| 1097 | Ga0163161_10057942 | |||
| 1098 | Ga0163161_10153985 | |||
| 1099 | Ga0163161_10364892 | |||
| 1100 | Ga0213874_10064662 | |||
| 1101 | Ga0213876_10200643 | |||
| 1102 | Ga0209147_100881 | |||
| 1103 | Ga0207427_100878 | |||
| 1104 | Ga0207425_1000049 | |||
| 1105 | Ga0209148_1000318 | |||
| 1106 | Ga0209148_1015931 | |||
| 1107 | Ga0209129_1003718 | |||
| 1108 | Ga0209233_1000181 | |||
| 1109 | Ga0209565_1001004 | |||
| 1110 | Ga0209455_1000942 | |||
| 1111 | Ga0209676_1015713 | |||
| 1112 | Ga0209025_1000068 | |||
| 1113 | Ga0209564_1004346 | |||
| 1114 | Ga0209758_1000019 | |||
| 1115 | Ga0209758_1026569 | |||
| 1116 | Ga0209050_1000001 | |||
| 1117 | Ga0209050_1000010 | |||
| 1118 | Ga0209050_1000108 | |||
| 1119 | Ga0209050_1029301 | |||
| 1120 | Ga0209051_1005046 | |||
| 1121 | Ga0209257_1000027 | |||
| 1122 | Ga0209257_1035415 | |||
| 1123 | Ga0207697_10000003 | |||
| 1124 | Ga0207656_10084618 | |||
| 1125 | Ga0207656_10088066 | |||
| 1126 | Ga0207656_10104901 | |||
| 1127 | Ga0207713_1019134 | |||
| 1128 | Ga0207713_1020886 | |||
| 1129 | Ga0207710_10006744 | |||
| 1130 | Ga0207710_10012555 | |||
| 1131 | Ga0207710_10019525 | |||
| 1132 | Ga0207710_10310503 | |||
| 1133 | Ga0207688_10107208 | |||
| 1134 | Ga0207688_10362667 | |||
| 1135 | Ga0207680_10000142 | |||
| 1136 | Ga0207680_10000890 | |||
| 1137 | Ga0207680_10015221 | |||
| 1138 | Ga0207680_10024379 | |||
| 1139 | Ga0207680_10084501 | |||
| 1140 | Ga0207647_10000611 | |||
| 1141 | Ga0207647_10003792 | |||
| 1142 | Ga0207647_10004427 | |||
| 1143 | Ga0207647_10022600 | |||
| 1144 | Ga0207647_10029211 | |||
| 1145 | Ga0207647_10220582 | |||
| 1146 | Ga0207645_10011226 | |||
| 1147 | Ga0207705_10001161 | |||
| 1148 | Ga0207705_10003807 | |||
| 1149 | Ga0207705_10055811 | |||
| 1150 | Ga0207705_10593060 | |||
| 1151 | Ga0207654_10098004 | |||
| 1152 | Ga0207695_10011414 | |||
| 1153 | Ga0207695_10058839 | |||
| 1154 | Ga0207695_10346807 | |||
| 1155 | Ga0207671_10021473 | |||
| 1156 | Ga0207671_10042931 | |||
| 1157 | Ga0207671_10141452 | |||
| 1158 | Ga0207657_10002758 | |||
| 1159 | Ga0207657_10005094 | |||
| 1160 | Ga0207657_10030799 | |||
| 1161 | Ga0207657_10041026 | |||
| 1162 | Ga0207657_10154561 | |||
| 1163 | Ga0207649_10234990 | |||
| 1164 | Ga0207652_10718415 | |||
| 1165 | Ga0207681_10000004 | |||
| 1166 | Ga0207681_10000014 | |||
| 1167 | Ga0207681_10002077 | |||
| 1168 | Ga0207681_10002575 | |||
| 1169 | Ga0207681_10021367 | |||
| 1170 | Ga0207681_10046229 | |||
| 1171 | Ga0207681_10146955 | |||
| 1172 | Ga0207681_10191208 | |||
| 1173 | Ga0207694_10034311 | |||
| 1174 | Ga0207650_10000015 | |||
| 1175 | Ga0207650_10003369 | |||
| 1176 | Ga0207650_10005182 | |||
| 1177 | Ga0207659_10052745 | |||
| 1178 | Ga0207687_10001173 | |||
| 1179 | Ga0207644_10000031 | |||
| 1180 | Ga0207644_10000066 | |||
| 1181 | Ga0207644_10000293 | |||
| 1182 | Ga0207644_10007460 | |||
| 1183 | Ga0207644_10055644 | |||
| 1184 | Ga0207644_10117952 | |||
| 1185 | Ga0207690_10057882 | |||
| 1186 | Ga0207690_10124879 | |||
| 1187 | Ga0207706_10015901 | |||
| 1188 | Ga0207706_10022403 | |||
| 1189 | Ga0207706_10117259 | |||
| 1190 | Ga0207686_10000181 | |||
| 1191 | Ga0207709_10000750 | |||
| 1192 | Ga0207669_10009649 | |||
| 1193 | Ga0207704_10000048 | |||
| 1194 | Ga0207691_10065054 | |||
| 1195 | Ga0207711_10002409 | |||
| 1196 | Ga0207711_10008194 | |||
| 1197 | Ga0207711_10012761 | |||
| 1198 | Ga0207711_10027237 | |||
| 1199 | Ga0207689_10000378 | |||
| 1200 | Ga0207661_10217487 | |||
| 1201 | Ga0207679_10158754 | |||
| 1202 | Ga0207667_10001267 | |||
| 1203 | Ga0207667_10070214 | |||
| 1204 | Ga0207667_10225965 | |||
| 1205 | Ga0207651_10000001 | |||
| 1206 | Ga0207712_10000048 | |||
| 1207 | Ga0207712_10018680 | |||
| 1208 | Ga0207712_10029096 | |||
| 1209 | Ga0207712_10058448 | |||
| 1210 | Ga0207712_10068285 | |||
| 1211 | Ga0207712_10383132 | |||
| 1212 | Ga0207668_10000012 | |||
| 1213 | Ga0207668_10000038 | |||
| 1214 | Ga0207668_10000135 | |||
| 1215 | Ga0207668_10003241 | |||
| 1216 | Ga0207668_10004934 | |||
| 1217 | Ga0207668_10069823 | |||
| 1218 | Ga0207668_10095405 | |||
| 1219 | Ga0207668_10150777 | |||
| 1220 | Ga0207640_10000167 | |||
| 1221 | Ga0207640_10014319 | |||
| 1222 | Ga0207640_10305753 | |||
| 1223 | Ga0207640_10400395 | |||
| 1224 | Ga0207640_10511012 | |||
| 1225 | Ga0207658_10000011 | |||
| 1226 | Ga0207658_10000037 | |||
| 1227 | Ga0207658_10000164 | |||
| 1228 | Ga0207658_10003835 | |||
| 1229 | Ga0207658_10004090 | |||
| 1230 | Ga0207658_10010872 | |||
| 1231 | Ga0207658_10397755 | |||
| 1232 | Ga0207677_10000711 | |||
| 1233 | Ga0207703_10000538 | |||
| 1234 | Ga0207703_10015775 | |||
| 1235 | Ga0207639_10000138 | |||
| 1236 | Ga0207639_10001072 | |||
| 1237 | Ga0207639_10068669 | |||
| 1238 | Ga0207639_10700124 | |||
| 1239 | Ga0207678_10005374 | |||
| 1240 | Ga0207678_10006691 | |||
| 1241 | Ga0207678_10251559 | |||
| 1242 | Ga0207702_10048203 | |||
| 1243 | Ga0207702_10252641 | |||
| 1244 | Ga0207702_10256064 | |||
| 1245 | Ga0207641_10000050 | |||
| 1246 | Ga0207641_10000228 | |||
| 1247 | Ga0207641_10000755 | |||
| 1248 | Ga0207641_10006924 | |||
| 1249 | Ga0207641_10008467 | |||
| 1250 | Ga0207648_10000494 | |||
| 1251 | Ga0207676_10000021 | |||
| 1252 | Ga0207676_10003587 | |||
| 1253 | Ga0207676_10004090 | |||
| 1254 | Ga0207674_10007528 | |||
| 1255 | Ga0207674_10035934 | |||
| 1256 | Ga0207674_10064320 | |||
| 1257 | Ga0207674_10275701 | |||
| 1258 | Ga0207674_10341218 | |||
| 1259 | Ga0207675_100000071 | |||
| 1260 | Ga0207675_100003319 | |||
| 1261 | Ga0207675_100006708 | |||
| 1262 | Ga0207675_100059135 | |||
| 1263 | Ga0207683_10061493 | |||
| 1264 | Ga0207683_10530257 | |||
| 1265 | Ga0207698_10001828 | |||
| 1266 | Ga0207698_10352718 | |||
| 1267 | Ga0207698_10354531 | |||
| 1268 | Ga0207698_10434633 | |||
| 1269 | Ga0207698_10474974 | |||
| 1270 | Ga0209813_10000036 | |||
| 1271 | Ga0268266_10000471 | |||
| 1272 | Ga0268266_10019776 | |||
| 1273 | Ga0268266_10133519 | |||
| 1274 | Ga0268265_10000013 | |||
| 1275 | Ga0268265_10000209 | |||
| 1276 | Ga0268265_10000525 | |||
| 1277 | Ga0268265_10004259 | |||
| 1278 | Ga0268265_10014040 | |||
| 1279 | Ga0268265_11121799 | |||
| 1280 | Ga0268264_10000089 | |||
| 1281 | Ga0268264_10000144 | |||
| 1282 | Ga0268264_10000483 | |||
| 1283 | Ga0268264_10004593 | |||
| 1284 | Ga0268264_10019865 | |||
| 1285 | Ga0268264_10064820 | |||
| 1286 | Ga0268264_10143375 | |||
| 1287 | Ga0268264_10321702 | |||
| 1288 | Ga0307513_10213019 | |||
| 1289 | Ga0307408_100074061 | |||
| 1290 | Ga0307408_100427460 | |||
| 1291 | Ga0307508_10049043 | |||
| 1292 | Ga0307405_10263720 | |||
| 1293 | Ga0307405_10407112 | |||
| 1294 | Ga0307413_10120074 | |||
| 1295 | Ga0307413_10187326 | |||
| 1296 | Ga0307412_10004187 | |||
| 1297 | Ga0307412_10048912 | |||
| 1298 | Ga0307412_10089691 | |||
| 1299 | Ga0307412_10463036 | |||
| 1300 | Ga0307409_100462886 | |||
| 1301 | Ga0307416_100064488 | |||
| 1302 | Ga0307416_100064534 | |||
| 1303 | Ga0307416_100229611 | |||
| 1304 | Ga0307414_10039012 | |||
| 1305 | Ga0307414_10050186 | |||
| 1306 | Ga0307414_10078461 | |||
| 1307 | Ga0307414_10178988 | |||
| 1308 | Ga0307414_10461251 | |||
| 1309 | Ga0307414_10686004 | |||
| 1310 | Ga0307411_10076149 | |||
| 1311 | Ga0307411_10259352 | |||
| 1312 | Ga0307411_10621453 | |||
| 1313 | Ga0307510_10131028 | |||
| 1314 | Ga0373923_0113816 | |||
| 1315 | Ga0373923_0130921 | |||
| 1316 | Ga0395899_0008722 | |||
| 1317 | Ga0395900_0036311 | |||
| 1318 | Ga0395900_0295708 | |||
| 1319 | Ga0395898_0667244 | |||
| 1320 | Ga0395905_0021782 | |||
| 1321 | Ga0395905_0104285 | |||
| 1322 | Ga0395905_0237379 | |||
| 1323 | Ga0395905_0477343 | |||
| 1324 | Ga0395905_0592646 | |||
| 1325 | Ga0395905_0842566 | |||
| 1326 | Ga0436364_0154840 | |||
| 1327 | Ga0395901_0101619 | |||
| 1328 | Ga0395901_0387218 | |||
| 1329 | Ga0237819_01638 | |||
| 1330 | Ga0436365_0864664 | |||
| 1331 | Ga0436363_1390116 | |||
| 1332 | Ga0439461_0000062 | |||
| 1333 | Ga0439461_0062145 | |||
| 1334 | Ga0439465_0002490 | |||
| 1335 | Ga0439465_0002807 | |||
| 1336 | Ga0451807_0610978 | |||
| 1337 | Ga0451807_2451244 | |||
| 1338 | Ga0451853_2895476 | |||
| 1339 | Ga0439431_0000213 | |||
| 1340 | Ga0439431_0011636 | |||
| 1341 | Ga0439442_002121 | |||
| 1342 | Ga0439445_0001827 | |||
| 1343 | Ga0439445_0072984 | |||
| 1344 | Ga0439448_0006066 | |||
| 1345 | Ga0439448_0017764 | |||
| 1346 | Ga0439448_0039712 | |||
| 1347 | Ga0439432_001352 | |||
| 1348 | Ga0439450_054815 | |||
| 1349 | Ga0439452_012615 | |||
| 1350 | Ga0439455_0000548 | |||
| 1351 | Ga0439455_0010465 | |||
| 1352 | Ga0439457_023261 | |||
| 1353 | Ga0439462_0000410 | |||
| 1354 | Ga0439462_0051755 | |||
| 1355 | Ga0450922_009002 | |||
| 1356 | Ga0439446_0091979 | |||
| 1357 | Ga0439458_0002779 | |||
| 1358 | Ga0439458_0004556 | |||
| 1359 | Ga0439458_0005357 | |||
| 1360 | Ga0439434_0000698 | |||
| 1361 | Ga0439434_0028901 | |||
| 1362 | Ga0451577_0335570 | |||
| 1363 | Ga0466972_0013569 | |||
| 1364 | Ga0466973_0178351 | |||
| 1365 | Ga0466965_0158371 | |||
| 1366 | Ga0466966_0217357 | |||
| 1367 | Ga0466961_0030993 | |||
| 1368 | Ga0466963_0006035 | |||
| 1369 | Ga0466964_0009242 | |||
| 1370 | Ga0466964_0049201 | |||
| 1371 | Ga0453684_0146010 | |||
| 1372 | Ga0466970_0048935 | |||
| 1373 | Ga0466957_0351838 | |||
| 1374 | Ga0466960_0132825 | |||
| 1375 | Ga0466959_0183124 | |||
| 1376 | Ga0466958_0015445 | |||
| 1377 | Ga0466967_0649818 | |||
| 1378 | Ga0495627_000036 | |||
| 1379 | Ga0495627_000090 | |||
| 1380 | Ga0495627_000287 | |||
| 1381 | Ga0495638_0012358 | |||
| 1382 | Ga0495638_0016175 | |||
| 1383 | Ga0495650_0000684 | |||
| 1384 | Ga0495650_0001816 | |||
| 1385 | Ga0495650_0028746 | |||
| 1386 | Ga0495596_0000601 | |||
| 1387 | Ga0495607_0013398 | |||
| 1388 | Ga0495583_0000252 | |||
| 1389 | Ga0495583_0073090 | |||
| 1390 | Ga0495606_0026435 | |||
| 1391 | Ga0495610_0000015 | |||
| 1392 | Ga0495610_0000079 | |||
| 1393 | Ga0495610_0001801 | |||
| 1394 | Ga0495610_0028580 | |||
| 1395 | Ga0495616_0000010 | |||
| 1396 | Ga0495620_0013186 | |||
| 1397 | Ga0495631_0069054 | |||
| 1398 | Ga0495632_0000095 | |||
| 1399 | Ga0495632_0000668 | |||
| 1400 | Ga0495632_0001502 | |||
| 1401 | Ga0495632_0090126 | |||
| 1402 | Ga0495637_0003691 | |||
| 1403 | Ga0495637_0047079 | |||
| 1404 | Ga0495643_0000038 | |||
| 1405 | Ga0495643_0000217 | |||
| 1406 | Ga0495643_0012289 | |||
| 1407 | Ga0495643_0086614 | |||
| 1408 | Ga0495648_0000018 | |||
| 1409 | Ga0495648_0005139 | |||
| 1410 | Ga0495663_0000028 | |||
| 1411 | Ga0495609_0001277 | |||
| 1412 | Ga0495609_0007581 | |||
| 1413 | Ga0495622_0012565 | |||
| 1414 | Ga0495633_0000340 | |||
| 1415 | Ga0495633_0003319 | |||
| 1416 | Ga0495633_0004974 | |||
| 1417 | Ga0495633_0108375 | |||
| 1418 | Ga0495633_0142170 | |||
| 1419 | Ga0495668_0008492 | |||
| 1420 | Ga0495668_0074488 | |||
| 1421 | Ga0495625_0006657 | |||
| 1422 | Ga0495625_0014445 | |||
| 1423 | Ga0495625_0057803 | |||
| 1424 | Ga0495661_0024460 | |||
| 1425 | Ga0495661_0048707 | |||
| 1426 | Ga0495669_0241249 | |||
| 1427 | Ga0495670_0315271 | |||
| 1428 | Ga0495671_0000011 | |||
| 1429 | Ga0495671_0000027 | |||
| 1430 | Ga0495672_0055076 | |||
| 1431 | Ga0495673_0000013 | |||
| 1432 | Ga0495673_0086819 | |||
| 1433 | Ga0495681_0000048 | |||
| 1434 | Ga0495681_0000077 | |||
| 1435 | Ga0495681_0029019 | |||
| 1436 | Ga0495686_0000469 | |||
| 1437 | Ga0495686_0015005 | |||
| 1438 | Ga0495686_0035001 | |||
| 1439 | Ga0495686_0045796 | |||
| 1440 | Ga0495686_0347710 | |||
| 1441 | Ga0495615_0091122 | |||
| 1442 | Ga0496100_0063797 | |||
| 1443 | Ga0496101_0035108 | |||
| 1444 | Ga0496101_0641956 | |||
| 1445 | Ga0496102_0000267 | |||
| 1446 | Ga0496102_0033928 | |||
| 1447 | Ga0496102_0180466 | |||
| 1448 | Ga0496102_0234679 | |||
| 1449 | Ga0496103_0000139 | |||
| 1450 | Ga0496103_0442886 | |||
| 1451 | Ga0496104_0001996 | |||
| 1452 | Ga0496105_0000099 | |||
| 1453 | Ga0496106_0522487 | |||
| 1454 | Ga0496107_0020816 | |||
| 1455 | Ga0496107_0660656 | |||
| 1456 | Ga0496108_0001779 | |||
| 1457 | Ga0496109_0006311 | |||
| 1458 | Ga0496109_0197981 | |||
| 1459 | Ga0496110_0188045 | |||
| 1460 | Ga0496110_0205913 | |||
| 1461 | Ga0496110_0525296 | |||
| 1462 | Ga0496111_0025926 | |||
| 1463 | Ga0496111_0090959 | |||
| 1464 | Ga0496111_0192483 | |||
| 1465 | Ga0496112_0018899 | |||
| 1466 | Ga0496112_0445998 | |||
| 1467 | Ga0496113_0004509 | |||
| 1468 | Ga0496113_0058450 | |||
| 1469 | Ga0496115_0019907 | |||
| 1470 | Ga0496115_0236213 | |||
| 1471 | Ga0496116_0019293 | |||
| 1472 | Ga0496116_0026853 | |||
| 1473 | Ga0496116_0058256 | |||
| 1474 | Ga0496116_0072004 | |||
| 1475 | Ga0496117_0008650 | |||
| 1476 | Ga0496117_0017167 | |||
| 1477 | Ga0496117_0020177 | |||
| 1478 | Ga0496117_0166070 | |||
| 1479 | Ga0496118_0000606 | |||
| 1480 | Ga0496118_0009747 | |||
| 1481 | Ga0496118_0015390 | |||
| 1482 | Ga0496118_0023847 | |||
| 1483 | Ga0496118_0032113 | |||
| 1484 | Ga0496118_0244241 | |||
| 1485 | Ga0496119_0004210 | |||
| 1486 | Ga0496119_0043741 | |||
| 1487 | Ga0496119_0058202 | |||
| 1488 | Ga0496119_0298168 | |||
| 1489 | Ga0496120_0003080 | |||
| 1490 | Ga0496120_0163353 | |||
| 1491 | Ga0496120_0299918 | |||
| 1492 | Ga0496121_0000349 | |||
| 1493 | Ga0496121_0006573 | |||
| 1494 | Ga0496121_0009274 | |||
| 1495 | Ga0496121_0013822 | |||
| 1496 | Ga0496121_0023584 | |||
| 1497 | Ga0496121_0138727 | |||
| 1498 | Ga0496121_0153284 | |||
| 1499 | Ga0496122_0000579 | |||
| 1500 | Ga0496122_0003895 | |||
| 1501 | Ga0496122_0005423 | |||
| 1502 | Ga0496122_0007148 | |||
| 1503 | Ga0496122_0009664 | |||
| 1504 | Ga0496122_0059250 | |||
| 1505 | Ga0496122_0141734 | |||
| 1506 | Ga0496122_0166595 | |||
| 1507 | Ga0496122_0219377 | |||
| 1508 | Ga0496123_0000286 | |||
| 1509 | Ga0496123_0001402 | |||
| 1510 | Ga0496123_0002745 | |||
| 1511 | Ga0496123_0002794 | |||
| 1512 | Ga0496123_0056695 | |||
| 1513 | Ga0496123_0101824 | |||
| 1514 | Ga0496123_0106295 | |||
| 1515 | Ga0496123_0120378 | |||
| 1516 | Ga0496123_0147013 | |||
| 1517 | Ga0496124_0001132 | |||
| 1518 | Ga0496124_0001730 | |||
| 1519 | Ga0496124_0008888 | |||
| 1520 | Ga0496124_0049847 | |||
| 1521 | Ga0496124_0050093 | |||
| 1522 | Ga0496124_0067144 | |||
| 1523 | Ga0496124_0132955 | |||
| 1524 | Ga0496124_0258622 | |||
| 1525 | Ga0496124_0269944 | |||
| 1526 | Ga0496124_0278223 | |||
| 1527 | Ga0496124_0344554 | |||
| 1528 | Ga0496124_0348664 | |||
| 1529 | Ga0496125_0004923 | |||
| 1530 | Ga0496125_0012034 | |||
| 1531 | Ga0496125_0012127 | |||
| 1532 | Ga0496125_0016696 | |||
| 1533 | Ga0496125_0018428 | |||
| 1534 | Ga0496125_0021250 | |||
| 1535 | Ga0496125_0038148 | |||
| 1536 | Ga0496125_0060040 | |||
| 1537 | Ga0496125_0079290 | |||
| 1538 | Ga0496125_0107609 | |||
| 1539 | Ga0496125_0283364 | |||
| 1540 | Ga0496125_0392570 | |||
| 1541 | Ga0496126_0000619 | |||
| 1542 | Ga0496126_0027985 | |||
| 1543 | Ga0496126_0066961 | |||
| 1544 | Ga0496126_0115084 | |||
| 1545 | Ga0496126_0232662 | |||
| 1546 | Ga0496126_0459179 | |||
| 1547 | Ga0496126_0633079 | |||
| 1548 | Ga0501292_000004 | |||
| 1549 | Ga0501294_000758 | |||
| 1550 | Ga0501300_000066 | |||
| 1551 | Ga0501314_001800 | |||
| 1552 | Ga0501032_0085757 | |||
| 1553 | Ga0501034_0016790 | |||
| 1554 | Ga0501034_0204545 | |||
| 1555 | Ga0501037_0745985 | |||
| 1556 | Ga0501038_0298223 | |||
| 1557 | Ga0501043_0130029 | |||
| 1558 | Ga0501043_0195947 | |||
| 1559 | Ga0501046_0428815 | |||
| 1560 | Ga0501047_0000644 | |||
| 1561 | Ga0501048_0134900 | |||
| 1562 | Ga0501202_014100 | |||
| 1563 | Ga0501222_000505 | |||
| 1564 | Ga0501223_000042 | |||
| 1565 | Ga0501223_000211 | |||
| 1566 | Ga0501223_001716 | |||
| 1567 | Ga0501224_000008 | |||
| 1568 | Ga0501224_009310 | |||
| 1569 | Ga0501227_014569 | |||
| 1570 | Ga0501233_008110 | |||
| 1571 | Ga0501235_000139 | |||
| 1572 | Ga0501249_000549 | |||
| 1573 | Ga0501257_003748 | |||
| 1574 | Ga0501259_000801 | |||
| 1575 | Ga0501261_000010 | |||
| 1576 | Ga0501225_0000073 | |||
| 1577 | Ga0501225_0000520 | |||
| 1578 | Ga0501225_0003808 | |||
| 1579 | Ga0501225_0022874 | |||
| 1580 | Ga0501234_000985 | |||
| 1581 | Ga0501245_000603 | |||
| 1582 | Ga0501245_008999 | |||
| 1583 | Ga0501241_005459 | |||
| 1584 | Ga0501279_000005 | |||
| 1585 | Ga0501280_000038 | |||
| 1586 | Ga0501282_000165 | |||
| 1587 | Ga0501044_0049651 | |||
| 1588 | Ga0501044_0892156 | |||
| 1589 | Ga0501226_000042 | |||
| 1590 | nmdc:mga00v17_29710_c1 | |||
| 1591 | nmdc:mga0k408_188043_c1 | |||
| 1592 | nmdc:mga0k408_51881_c1 | |||
| 1593 | nmdc:mga06z11_111_c1 | |||
| 1594 | nmdc:mga04h51_100_c1 | |||
| 1595 | nmdc:mga07m45_1083_c1 | |||
| 1596 | nmdc:mga07m45_82575_c1 | |||
| 1597 | nmdc:mga05p37_228596_c1 | |||
| 1598 | Ga0495619_0327712 | |||
| 1599 | Ga0500643_000539 | |||
| 1600 | Ga0500643_002149 | |||
| 1601 | Ga0500643_004524 | |||
| 1602 | Ga0500643_010045 | |||
| 1603 | Ga0500643_021485 | |||
| 1604 | Ga0500643_045312 | |||
| 1605 | Ga0500643_068092 | |||
| 1606 | Ga0500644_0028883 | |||
| 1607 | Ga0500647_0029989 | |||
| 1608 | Ga0500651_0002188 | |||
| 1609 | Ga0500641_0001555 | |||
| 1610 | Ga0500641_0012360 | |||
| 1611 | Ga0500650_0191460 | |||
| 1612 | Ga0500556_0000074 | |||
| 1613 | Ga0500557_017166 | |||
| 1614 | Ga0500562_005307 | |||
| 1615 | Ga0500562_073645 | |||
| 1616 | Ga0500594_0062933 | |||
| 1617 | Ga0500595_005345 | |||
| 1618 | Ga0500618_005557 | |||
| 1619 | Ga0500618_022875 | |||
| 1620 | Ga0500642_0000002 | |||
| 1621 | Ga0500642_0001441 | |||
| 1622 | Ga0500652_092939 | |||
| 1623 | Ga0500655_000061 | |||
| 1624 | Ga0500559_0001442 | |||
| 1625 | Ga0500573_0000015 | |||
| 1626 | Ga0500573_0264954 | |||
| 1627 | Ga0500616_0003051 | |||
| 1628 | Ga0500622_0000901 | |||
| 1629 | Ga0500622_0003437 | |||
| 1630 | Ga0500622_0016726 | |||
| 1631 | Ga0500624_000085 | |||
| 1632 | Ga0500624_000125 | |||
| 1633 | Ga0500627_0002237 | |||
| 1634 | Ga0500636_0013174 | |||
| 1635 | Ga0500636_0077521 | |||
| 1636 | Ga0500637_0000023 | |||
| 1637 | Ga0500570_000268 | |||
| 1638 | Ga0500645_003833 | |||
| 1639 | Ga0500645_004874 | |||
| 1640 | Ga0500661_000138 | |||
| 1641 | Ga0466962_0001351 | |||
| 1642 | Ga0466962_0046360 | |||
| 1643 | 2511129570 | |||
| 1644 | 2512644061 | |||
| 1645 | 2585263904 | |||
| 1646 | 2600225765 | |||
| 1647 | 2643730699 | |||
| 1648 | 2644040835 | |||
| 1649 | 2644044647 | |||
| 1650 | 2644391428 | |||
| 1651 | 2778123851 | |||
| 1652 | 2809064830 | |||
| 1653 | 2809080797 | |||
| 1654 | 2809085162 | |||
| 1655 | 2819716433 | |||
| 1656 | 2879165296 | |||
| 1657 | 2880521862 | |||
| 1658 | 2919711333 | |||
| 1659 | 2928028566 | |||
| 1660 | 2928528758 | |||
| 1661 | 2928970312 | |||
| 1662 | 2984555857 | |||
| 1663 | 2984566034 | |||
| 1664 | 2990266488 | |||
| 1665 | 2993357045 | |||
| 1666 | 2993695714 | |||
| 1667 | 8054306873 | |||
| 1668 | 8057101944 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yki-assembly1.cif.gz_A | crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide | 0.9666 | 50 | 100 |
| 7luy-assembly1.cif.gz_F | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.9397 | 18 | 223 |
| 7luy-assembly1.cif.gz_F | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.9302 | 18 | 223 |
| 7luy-assembly2.cif.gz_E | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.9282 | 18 | 223 |
| 7luy-assembly2.cif.gz_E | crystal structure of guanylate kinase from bartonella henselae str. houston-1 | 0.9194 | 18 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94JM2_119_167_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9999 | 51 | 99 | 3.30.63.10 |
| af_Q2QPW1_160_210_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9916 | 51 | 99 | 3.30.63.10 |
| 3tr0A02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9823 | 51 | 110 | 3.30.63.10 |
| af_Q94JM2_119_167_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.98 | 51 | 99 | 3.30.63.10 |
| 3tr0A02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9663 | 51 | 110 | 3.30.63.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1U9Z321-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9639 | 15 | 219 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A0Q8Q189-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9635 | 11 | 223 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A0Q8Q189-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9591 | 11 | 223 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A7V8A964-F1-model_v4 | Guanylate kinase | 0.9578 | 18 | 143 |
GO:0004385
GO:0005829 |
| AF-A0A6I4TDJ5-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9542 | 7 | 219 |
GO:0004385
GO:0005524 GO:0005829 |