F482808

General Info

Members Datasets Scaffolds Average Seq Length
834 383 1668 218

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0021536|Ga0495670_0021536_203_862
Length 212
Sequence MAQAPETHDDALHRRGLMFILSSPSGAGKTTISRKLLEHDGRIGMSVSVTTRPPRPGEVDGKDYIFKSQAQFDQMVEDGHFLEWAHVFGHSYGTPKAQIKAFLFDIDWQGTQQLYQKAETDVVRVFLLPPSLDELRRRLTSRGTDSAEVIAGRMARAQAEISHWDGYDYVVVNDDIDVCFDKVVQILAAERLSRARQTGLIGFVRELTRPEA

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
293 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
294 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
295 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
305 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
308 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
309 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
310 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
311 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
312 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
313 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
314 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
315 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
316 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
317 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
318 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
319 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
320 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
321 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
336 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
337 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
338 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
339 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
340 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
345 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
346 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
347 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
351 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
352 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
353 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
354 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
359 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
360 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
361 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
362 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
363 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
364 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
365 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
366 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
367 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
368 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
369 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
370 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
371 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
372 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
373 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
374 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
375 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
376 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
377 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
378 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
379 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
380 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
381 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
382 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
383 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0.12
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 10.79
Nodule 0.12
Rhizoplane 3.84
Rhizosphere 73.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0021536 3300046691 Bacteria 3180
2 SwRhRL2b_contig_3660702 2162886007 Bacteria 11509
3 JGI24736J21556_1000235 3300001904 Bacteria 10063
4 JGI24741J21665_1000124 3300001915 Bacteria 20973
5 JGI24752J21851_1000586 3300001976 Bacteria 4846
6 JGI24740J21852_10003311 3300001979 Bacteria 7098
7 JGI24740J21852_10028989 3300001979 Bacteria 1823
8 JGI24740J21852_10058057 3300001979 Bacteria 1078
9 JGI24739J22299_10001891 3300001989 Bacteria 8000
10 JGI24737J22298_10003492 3300001990 Bacteria 5545
11 JGI24737J22298_10006196 3300001990 Bacteria 4096
12 JGI24737J22298_10040310 3300001990 Bacteria 1434
13 JGI24737J22298_10084090 3300001990 Bacteria 946
14 JGI24743J22301_10012544 3300001991 Bacteria 1543
15 JGI24735J21928_10000699 3300002067 Bacteria 11907
16 JGI24735J21928_10009713 3300002067 Bacteria 3082
17 JGI24735J21928_10009810 3300002067 Bacteria 3066
18 JGI24735J21928_10012405 3300002067 Bacteria 2693
19 JGI24735J21928_10012704 3300002067 Bacteria 2659
20 JGI24735J21928_10027489 3300002067 Bacteria 1705
21 JGI24735J21928_10054782 3300002067 Bacteria 1149
22 JGI24738J21930_10002736 3300002075 Bacteria 4536
23 JGI24738J21930_10004755 3300002075 Bacteria 3302
24 JGI24738J21930_10015195 3300002075 Bacteria 1642
25 JGI24738J21930_10020901 3300002075 Bacteria 1360
26 JGI24749J21850_1000352 3300002076 Bacteria 6855
27 JGI24744J21845_10000115 3300002077 Bacteria 10973
28 JGI24035J26624_1003524 3300002126 Bacteria 1476
29 JGI24751J29686_10000208 3300002459 Bacteria 25368
30 JGI25150J39212_1003534 3300002774 Bacteria 3648
31 JGI25151J46595_10037612 3300003187 Bacteria 1813
32 JGI25165J46597_1000534 3300003214 Bacteria 35395
33 JGI25153J46596_10000186 3300003215 Bacteria 60427
34 rootL2_10042168 3300003322 Bacteria 1995
35 Ga0055542_1003000 3300003762 Bacteria 4916
36 Ga0055526_1012603 3300003771 Bacteria 3669
37 Ga0055536_1016085 3300003781 Bacteria 2521
38 Ga0055530_10000064 3300003791 Bacteria 94475
39 Ga0055530_10037267 3300003791 Bacteria 1218
40 Ga0055540_1000768 3300003792 Bacteria 21808
41 Ga0055540_1002060 3300003792 Bacteria 11094
42 Ga0055531_10000073 3300003794 Bacteria 109510
43 Ga0065165_1056282 3300005262 Bacteria 1094
44 Ga0065704_10000192 3300005289 Bacteria 216848
45 Ga0065704_10000914 3300005289 Bacteria 11453
46 Ga0065704_10003296 3300005289 Bacteria 4388
47 Ga0065704_10070989 3300005289 Bacteria 13960
48 Ga0065704_10077790 3300005289 Bacteria 4619
49 Ga0065707_10084356 3300005295 Bacteria 7311
50 Ga0065707_10086371 3300005295 Bacteria 5505
51 Ga0070658_10001154 3300005327 Bacteria 22529
52 Ga0070658_10012339 3300005327 Bacteria 6861
53 Ga0070676_10000448 3300005328 Bacteria 19663
54 Ga0070683_100276977 3300005329 Bacteria 1596
55 Ga0070683_100532952 3300005329 Bacteria 1122
56 Ga0070670_100000024 3300005331 Bacteria 189811
57 Ga0070670_100003502 3300005331 Bacteria 13049
58 Ga0070670_100035441 3300005331 Bacteria 4295
59 Ga0068869_100002661 3300005334 Bacteria 10794
60 Ga0070666_10000111 3300005335 Bacteria 56117
61 Ga0070666_10001747 3300005335 Bacteria 13257
62 Ga0070666_10051148 3300005335 Bacteria 2781
63 Ga0070666_10062591 3300005335 Bacteria 2521
64 Ga0070666_10098313 3300005335 Bacteria 2015
65 Ga0070666_10456715 3300005335 Bacteria 923
66 Ga0068868_100000910 3300005338 Bacteria 20102
67 Ga0070660_100009320 3300005339 Bacteria 6897
68 Ga0070660_100058583 3300005339 Bacteria 2986
69 Ga0070660_100135929 3300005339 Bacteria 1970
70 Ga0070660_100149113 3300005339 Bacteria 1880
71 Ga0070660_100166856 3300005339 Bacteria 1777
72 Ga0070661_100008203 3300005344 Bacteria 7203
73 Ga0070661_100261922 3300005344 Bacteria 1337
74 Ga0070668_100000027 3300005347 Bacteria 89913
75 Ga0070668_100000041 3300005347 Bacteria 78742
76 Ga0070668_100008132 3300005347 Bacteria 7792
77 Ga0070668_100024451 3300005347 Bacteria 4578
78 Ga0070668_100027686 3300005347 Bacteria 4303
79 Ga0070668_100084870 3300005347 Bacteria 2488
80 Ga0070668_100135504 3300005347 Bacteria 1980
81 Ga0070669_100000012 3300005353 Bacteria 211302
82 Ga0070669_100000047 3300005353 Bacteria 118892
83 Ga0070669_100005445 3300005353 Bacteria 9185
84 Ga0070669_100010694 3300005353 Bacteria 6514
85 Ga0070669_100054887 3300005353 Bacteria 2919
86 Ga0070669_100218101 3300005353 Bacteria 1508
87 Ga0070675_100071809 3300005354 Bacteria 2873
88 Ga0070671_100000019 3300005355 Bacteria 132341
89 Ga0070671_100000517 3300005355 Bacteria 27085
90 Ga0070671_100002891 3300005355 Bacteria 13371
91 Ga0070671_100003218 3300005355 Bacteria 12731
92 Ga0070671_100023173 3300005355 Bacteria 5077
93 Ga0070671_100057465 3300005355 Bacteria 3238
94 Ga0070674_100019915 3300005356 Bacteria 4274
95 Ga0070673_100000020 3300005364 Bacteria 102632
96 Ga0070659_100140337 3300005366 Bacteria 1967
97 Ga0070659_100233254 3300005366 Bacteria 1521
98 Ga0070659_100287872 3300005366 Bacteria 1368
99 Ga0070667_100000017 3300005367 Bacteria 230531
100 Ga0070667_100000058 3300005367 Bacteria 148071
101 Ga0070667_100000143 3300005367 Bacteria 90358
102 Ga0070667_100005804 3300005367 Bacteria 10302
103 Ga0070667_100012087 3300005367 Bacteria 7148
104 Ga0070667_100016472 3300005367 Bacteria 6117
105 Ga0070667_100113572 3300005367 Bacteria 2351
106 Ga0070705_100004405 3300005440 Bacteria 6859
107 Ga0070708_100912558 3300005445 Bacteria 825
108 Ga0070663_100001418 3300005455 Bacteria 13103
109 Ga0070678_100005895 3300005456 Bacteria 7126
110 Ga0070662_100032068 3300005457 Bacteria 3691
111 Ga0070662_100394559 3300005457 Bacteria 1141
112 Ga0068867_100000155 3300005459 Bacteria 43934
113 Ga0070685_10016519 3300005466 Bacteria 3934
114 Ga0070685_10505431 3300005466 Bacteria 856
115 Ga0068853_100070689 3300005539 Bacteria 3038
116 Ga0068853_100086514 3300005539 Bacteria 2749
117 Ga0068853_100089633 3300005539 Bacteria 2702
118 Ga0068853_100265068 3300005539 Bacteria 1580
119 Ga0068853_100315074 3300005539 Bacteria 1449
120 Ga0070665_100001012 3300005548 Bacteria 35432
121 Ga0070665_100010368 3300005548 Bacteria 9429
122 Ga0068855_100002050 3300005563 Bacteria 24977
123 Ga0068855_100121831 3300005563 Bacteria 2985
124 Ga0068855_100629612 3300005563 Bacteria 1154
125 Ga0070664_100014905 3300005564 Bacteria 6342
126 Ga0070664_100490854 3300005564 Bacteria 1131
127 Ga0068857_100013486 3300005577 Bacteria 7119
128 Ga0068857_100059205 3300005577 Bacteria 3402
129 Ga0068857_100108610 3300005577 Bacteria 2493
130 Ga0068857_100121731 3300005577 Bacteria 2350
131 Ga0068857_100309780 3300005577 Bacteria 1456
132 Ga0068854_100002936 3300005578 Bacteria 10575
133 Ga0068854_100268072 3300005578 Bacteria 1370
134 Ga0068854_100340174 3300005578 Bacteria 1225
135 Ga0068856_100008231 3300005614 Bacteria 10165
136 Ga0068856_100019646 3300005614 Bacteria 6557
137 Ga0070702_100041902 3300005615 Bacteria 2571
138 Ga0068852_100010016 3300005616 Bacteria 7052
139 Ga0068852_100483302 3300005616 Bacteria 1231
140 Ga0068852_100491236 3300005616 Bacteria 1221
141 Ga0068852_100493014 3300005616 Bacteria 1219
142 Ga0068859_100038244 3300005617 Bacteria 4814
143 Ga0068859_100062917 3300005617 Bacteria 3741
144 Ga0068859_100092658 3300005617 Bacteria 3073
145 Ga0068859_100190175 3300005617 Bacteria 2137
146 Ga0068859_100588416 3300005617 Bacteria 1206
147 Ga0068864_100000036 3300005618 Bacteria 189811
148 Ga0068864_100000475 3300005618 Bacteria 34778
149 Ga0068864_100004795 3300005618 Bacteria 11081
150 Ga0068864_100159134 3300005618 Bacteria 2052
151 Ga0068861_100002169 3300005719 Bacteria 12735
152 Ga0068861_100005201 3300005719 Bacteria 8770
153 Ga0068861_100021348 3300005719 Bacteria 4654
154 Ga0068851_10013802 3300005834 Bacteria 3825
155 Ga0068851_10077709 3300005834 Bacteria 1728
156 Ga0068851_10160609 3300005834 Bacteria 1234
157 Ga0068863_100000031 3300005841 Bacteria 175602
158 Ga0068863_100001489 3300005841 Bacteria 23203
159 Ga0068863_100002193 3300005841 Bacteria 19382
160 Ga0068863_100005824 3300005841 Bacteria 12076
161 Ga0068863_100007418 3300005841 Bacteria 10732
162 Ga0068863_100031052 3300005841 Bacteria 5102
163 Ga0068858_100000103 3300005842 Bacteria 88754
164 Ga0068858_100021883 3300005842 Bacteria 5971
165 Ga0068858_100204130 3300005842 Bacteria 1870
166 Ga0068860_100000056 3300005843 Bacteria 202751
167 Ga0068860_100000181 3300005843 Bacteria 101627
168 Ga0068860_100022971 3300005843 Bacteria 6031
169 Ga0068860_100031058 3300005843 Bacteria 5136
170 Ga0068860_100031678 3300005843 Bacteria 5083
171 Ga0068860_100078368 3300005843 Bacteria 3142
172 Ga0068860_100324700 3300005843 Bacteria 1511
173 Ga0068862_100000033 3300005844 Bacteria 176515
174 Ga0068862_100000187 3300005844 Bacteria 68303
175 Ga0068862_100000884 3300005844 Bacteria 29162
176 Ga0068862_100005927 3300005844 Bacteria 10176
177 Ga0068862_100030592 3300005844 Bacteria 4538
178 Ga0068862_100128025 3300005844 Bacteria 2243
179 Ga0068862_100235818 3300005844 Bacteria 1661
180 Ga0081539_10016956 3300005985 Bacteria 5158
181 Ga0075368_10001355 3300006042 Bacteria 7790
182 Ga0075364_10166195 3300006051 Bacteria 1491
183 Ga0075367_10001026 3300006178 Bacteria 11507
184 Ga0075366_10034983 3300006195 Bacteria 2961
185 Ga0075366_10117135 3300006195 Bacteria 1604
186 Ga0097621_100005590 3300006237 Bacteria 8863
187 Ga0075370_10002503 3300006353 Bacteria 8532
188 Ga0068865_100000272 3300006881 Bacteria 28389
189 Ga0097620_100038244 3300006931 Bacteria 4814
190 Ga0097620_100062917 3300006931 Bacteria 3741
191 Ga0097620_100092661 3300006931 Bacteria 3073
192 Ga0097620_100190181 3300006931 Bacteria 2137
193 Ga0097620_100588387 3300006931 Bacteria 1206
194 Ga0099826_10138471 3300006948 Bacteria 1410
195 Ga0105251_10004489 3300009011 Bacteria 9471
196 Ga0105251_10015704 3300009011 Bacteria 4126
197 Ga0105251_10032668 3300009011 Bacteria 2591
198 Ga0105251_10035471 3300009011 Bacteria 2461
199 Ga0105250_10032780 3300009092 Bacteria 2086
200 Ga0105250_10075779 3300009092 Bacteria 1361
201 Ga0105240_10012649 3300009093 Bacteria 11636
202 Ga0105240_10020042 3300009093 Bacteria 8928
203 Ga0105240_10574747 3300009093 Bacteria 1244
204 Ga0105245_10002130 3300009098 Bacteria 17920
205 Ga0105247_10004441 3300009101 Bacteria 8942
206 Ga0105247_10117922 3300009101 Bacteria 1716
207 Ga0105247_10118724 3300009101 Bacteria 1711
208 Ga0114129_10282114 3300009147 Bacteria 2219
209 Ga0105243_10000711 3300009148 Bacteria 32092
210 Ga0105243_10222341 3300009148 Bacteria 1670
211 Ga0105243_10654438 3300009148 Bacteria 1019
212 Ga0105241_10000807 3300009174 Bacteria 23818
213 Ga0105242_10000320 3300009176 Bacteria 38566
214 Ga0105248_10000091 3300009177 Bacteria 101191
215 Ga0105248_10002773 3300009177 Bacteria 19480
216 Ga0105248_10014281 3300009177 Bacteria 8743
217 Ga0105248_10018898 3300009177 Bacteria 7619
218 Ga0105248_10033589 3300009177 Bacteria 5732
219 Ga0105248_10070358 3300009177 Bacteria 3929
220 Ga0105248_10227998 3300009177 Bacteria 2097
221 Ga0105248_10365850 3300009177 Bacteria 1624
222 Ga0105237_10008796 3300009545 Bacteria 10890
223 Ga0105237_10075759 3300009545 Bacteria 3355
224 Ga0105238_10501816 3300009551 Bacteria 1214
225 Ga0105249_10000553 3300009553 Bacteria 34593
226 Ga0105249_10001384 3300009553 Bacteria 21229
227 Ga0105249_10093615 3300009553 Bacteria 2815
228 Ga0105249_10414876 3300009553 Bacteria 1379
229 Ga0105148_100060 3300009978 Bacteria 17151
230 Ga0105239_10142551 3300010375 Bacteria 2671
231 Ga0105239_10165940 3300010375 Bacteria 2469
232 Ga0105239_10808157 3300010375 Bacteria 1074
233 Ga0105246_10004775 3300011119 Bacteria 8251
234 Ga0157326_1000067 3300012513 Bacteria 10095
235 Ga0157373_10015080 3300013100 Bacteria 5653
236 Ga0157373_10097352 3300013100 Bacteria 2071
237 Ga0157371_10710594 3300013102 Bacteria 753
238 Ga0157370_10000145 3300013104 Bacteria 86693
239 Ga0157370_10013194 3300013104 Bacteria 8521
240 Ga0157370_10704392 3300013104 Bacteria 922
241 Ga0157369_10018860 3300013105 Bacteria 7729
242 Ga0157369_10648922 3300013105 Bacteria 1088
243 Ga0157369_10957018 3300013105 Bacteria 877
244 Ga0157374_10005414 3300013296 Bacteria 10723
245 Ga0157374_10136449 3300013296 Bacteria 2379
246 Ga0157378_10011140 3300013297 Bacteria 7870
247 Ga0163162_10053526 3300013306 Bacteria 4057
248 Ga0163162_10124375 3300013306 Bacteria 2685
249 Ga0163162_10658904 3300013306 Bacteria 1170
250 Ga0157372_10029740 3300013307 Bacteria 5969
251 Ga0157372_10065951 3300013307 Bacteria 4067
252 Ga0157372_10146982 3300013307 Bacteria 2718
253 Ga0157372_10202471 3300013307 Bacteria 2300
254 Ga0157372_10681462 3300013307 Bacteria 1196
255 Ga0157380_10008171 3300014326 Bacteria 7456
256 Ga0157380_10370279 3300014326 Bacteria 1348
257 Ga0157380_10545439 3300014326 Bacteria 1136
258 Ga0157377_10013528 3300014745 Bacteria 4131
259 Ga0157379_10001174 3300014968 Bacteria 21344
260 Ga0157376_10000395 3300014969 Bacteria 28347
261 Ga0183363_1005 3300015690 Bacteria 403020
262 Ga0163161_10038021 3300017792 Bacteria 3450
263 Ga0163161_10057942 3300017792 Bacteria 2815
264 Ga0163161_10153985 3300017792 Bacteria 1749
265 Ga0163161_10364892 3300017792 Bacteria 1151
266 Ga0213874_10064662 3300021377 Bacteria 1154
267 Ga0213876_10200643 3300021384 Bacteria 1060
268 Ga0209147_100881 3300025229 Bacteria 13827
269 Ga0207427_100878 3300025231 Bacteria 13165
270 Ga0207425_1000049 3300025245 Bacteria 180735
271 Ga0209148_1000318 3300025254 Bacteria 67692
272 Ga0209148_1015931 3300025254 Bacteria 1303
273 Ga0209129_1003718 3300025258 Bacteria 6459
274 Ga0209233_1000181 3300025261 Bacteria 138699
275 Ga0209565_1001004 3300025263 Bacteria 14505
276 Ga0209455_1000942 3300025272 Bacteria 14894
277 Ga0209676_1015713 3300025292 Bacteria 2772
278 Ga0209025_1000068 3300025294 Bacteria 294129
279 Ga0209564_1004346 3300025295 Bacteria 8727
280 Ga0209758_1000019 3300025297 Bacteria 743682
281 Ga0209758_1026569 3300025297 Bacteria 2501
282 Ga0209050_1000001 3300025298 Bacteria 3563507
283 Ga0209050_1000010 3300025298 Bacteria 980454
284 Ga0209050_1000108 3300025298 Bacteria 222534
285 Ga0209050_1029301 3300025298 Bacteria 1764
286 Ga0209051_1005046 3300025303 Bacteria 7858
287 Ga0209257_1000027 3300025304 Bacteria 703541
288 Ga0209257_1035415 3300025304 Bacteria 1545
289 Ga0207697_10000003 3300025315 Bacteria 90538
290 Ga0207656_10084618 3300025321 Bacteria 1431
291 Ga0207656_10088066 3300025321 Bacteria 1405
292 Ga0207656_10104901 3300025321 Bacteria 1300
293 Ga0207713_1019134 3300025735 Bacteria 3363
294 Ga0207713_1020886 3300025735 Bacteria 3155
295 Ga0207710_10006744 3300025900 Bacteria 4894
296 Ga0207710_10012555 3300025900 Bacteria 3564
297 Ga0207710_10019525 3300025900 Bacteria 2891
298 Ga0207710_10310503 3300025900 Bacteria 798
299 Ga0207688_10107208 3300025901 Bacteria 1619
300 Ga0207688_10362667 3300025901 Bacteria 894
301 Ga0207680_10000142 3300025903 Bacteria 34278
302 Ga0207680_10000890 3300025903 Bacteria 14105
303 Ga0207680_10015221 3300025903 Bacteria 4010
304 Ga0207680_10024379 3300025903 Bacteria 3320
305 Ga0207680_10084501 3300025903 Bacteria 2003
306 Ga0207647_10000611 3300025904 Bacteria 27863
307 Ga0207647_10003792 3300025904 Bacteria 11296
308 Ga0207647_10004427 3300025904 Bacteria 10414
309 Ga0207647_10022600 3300025904 Bacteria 4174
310 Ga0207647_10029211 3300025904 Bacteria 3570
311 Ga0207647_10220582 3300025904 Bacteria 1093
312 Ga0207645_10011226 3300025907 Bacteria 6126
313 Ga0207705_10001161 3300025909 Bacteria 21450
314 Ga0207705_10003807 3300025909 Bacteria 11473
315 Ga0207705_10055811 3300025909 Bacteria 2848
316 Ga0207705_10593060 3300025909 Bacteria 862
317 Ga0207654_10098004 3300025911 Bacteria 1801
318 Ga0207695_10011414 3300025913 Bacteria 10767
319 Ga0207695_10058839 3300025913 Bacteria 3988
320 Ga0207695_10346807 3300025913 Bacteria 1372
321 Ga0207671_10021473 3300025914 Bacteria 4897
322 Ga0207671_10042931 3300025914 Bacteria 3345
323 Ga0207671_10141452 3300025914 Bacteria 1854
324 Ga0207657_10002758 3300025919 Bacteria 18916
325 Ga0207657_10005094 3300025919 Bacteria 13770
326 Ga0207657_10030799 3300025919 Bacteria 4864
327 Ga0207657_10041026 3300025919 Bacteria 4095
328 Ga0207657_10154561 3300025919 Bacteria 1866
329 Ga0207649_10234990 3300025920 Bacteria 1313
330 Ga0207652_10718415 3300025921 Bacteria 891
331 Ga0207681_10000004 3300025923 Bacteria 559005
332 Ga0207681_10000014 3300025923 Bacteria 353422
333 Ga0207681_10002077 3300025923 Bacteria 12831
334 Ga0207681_10002575 3300025923 Bacteria 11500
335 Ga0207681_10021367 3300025923 Bacteria 4113
336 Ga0207681_10046229 3300025923 Bacteria 2927
337 Ga0207681_10146955 3300025923 Bacteria 1762
338 Ga0207681_10191208 3300025923 Bacteria 1566
339 Ga0207694_10034311 3300025924 Bacteria 3890
340 Ga0207650_10000015 3300025925 Bacteria 369173
341 Ga0207650_10003369 3300025925 Bacteria 10999
342 Ga0207650_10005182 3300025925 Bacteria 8892
343 Ga0207659_10052745 3300025926 Bacteria 2899
344 Ga0207687_10001173 3300025927 Bacteria 17895
345 Ga0207644_10000031 3300025931 Bacteria 134402
346 Ga0207644_10000066 3300025931 Bacteria 76450
347 Ga0207644_10000293 3300025931 Bacteria 32998
348 Ga0207644_10007460 3300025931 Bacteria 7131
349 Ga0207644_10055644 3300025931 Bacteria 2852
350 Ga0207644_10117952 3300025931 Bacteria 2016
351 Ga0207690_10057882 3300025932 Bacteria 2620
352 Ga0207690_10124879 3300025932 Bacteria 1875
353 Ga0207706_10015901 3300025933 Bacteria 6801
354 Ga0207706_10022403 3300025933 Bacteria 5670
355 Ga0207706_10117259 3300025933 Bacteria 2342
356 Ga0207686_10000181 3300025934 Bacteria 48566
357 Ga0207709_10000750 3300025935 Bacteria 25694
358 Ga0207669_10009649 3300025937 Bacteria 4612
359 Ga0207704_10000048 3300025938 Bacteria 83529
360 Ga0207691_10065054 3300025940 Bacteria 3302
361 Ga0207711_10002409 3300025941 Bacteria 16703
362 Ga0207711_10008194 3300025941 Bacteria 8748
363 Ga0207711_10012761 3300025941 Bacteria 6979
364 Ga0207711_10027237 3300025941 Bacteria 4801
365 Ga0207689_10000378 3300025942 Bacteria 41915
366 Ga0207661_10217487 3300025944 Bacteria 1687
367 Ga0207679_10158754 3300025945 Bacteria 1849
368 Ga0207667_10001267 3300025949 Bacteria 31686
369 Ga0207667_10070214 3300025949 Bacteria 3646
370 Ga0207667_10225965 3300025949 Bacteria 1917
371 Ga0207651_10000001 3300025960 Bacteria 516823
372 Ga0207712_10000048 3300025961 Bacteria 160050
373 Ga0207712_10018680 3300025961 Bacteria 4518
374 Ga0207712_10029096 3300025961 Bacteria 3702
375 Ga0207712_10058448 3300025961 Bacteria 2725
376 Ga0207712_10068285 3300025961 Bacteria 2546
377 Ga0207712_10383132 3300025961 Bacteria 1177
378 Ga0207668_10000012 3300025972 Bacteria 182541
379 Ga0207668_10000038 3300025972 Bacteria 112486
380 Ga0207668_10000135 3300025972 Bacteria 50909
381 Ga0207668_10003241 3300025972 Bacteria 9540
382 Ga0207668_10004934 3300025972 Bacteria 7846
383 Ga0207668_10069823 3300025972 Bacteria 2503
384 Ga0207668_10095405 3300025972 Bacteria 2195
385 Ga0207668_10150777 3300025972 Bacteria 1799
386 Ga0207640_10000167 3300025981 Bacteria 47729
387 Ga0207640_10014319 3300025981 Bacteria 4563
388 Ga0207640_10305753 3300025981 Bacteria 1260
389 Ga0207640_10400395 3300025981 Bacteria 1118
390 Ga0207640_10511012 3300025981 Bacteria 1002
391 Ga0207658_10000011 3300025986 Bacteria 239620
392 Ga0207658_10000037 3300025986 Bacteria 148087
393 Ga0207658_10000164 3300025986 Bacteria 70677
394 Ga0207658_10003835 3300025986 Bacteria 10588
395 Ga0207658_10004090 3300025986 Bacteria 10173
396 Ga0207658_10010872 3300025986 Bacteria 6194
397 Ga0207658_10397755 3300025986 Bacteria 1210
398 Ga0207677_10000711 3300026023 Bacteria 19645
399 Ga0207703_10000538 3300026035 Bacteria 38989
400 Ga0207703_10015775 3300026035 Bacteria 5892
401 Ga0207639_10000138 3300026041 Bacteria 54326
402 Ga0207639_10001072 3300026041 Bacteria 18552
403 Ga0207639_10068669 3300026041 Bacteria 2762
404 Ga0207639_10700124 3300026041 Bacteria 940
405 Ga0207678_10005374 3300026067 Bacteria 11474
406 Ga0207678_10006691 3300026067 Bacteria 10221
407 Ga0207678_10251559 3300026067 Bacteria 1513
408 Ga0207702_10048203 3300026078 Bacteria 3592
409 Ga0207702_10252641 3300026078 Bacteria 1656
410 Ga0207702_10256064 3300026078 Bacteria 1646
411 Ga0207641_10000050 3300026088 Bacteria 175954
412 Ga0207641_10000228 3300026088 Bacteria 72357
413 Ga0207641_10000755 3300026088 Bacteria 34850
414 Ga0207641_10006924 3300026088 Bacteria 9488
415 Ga0207641_10008467 3300026088 Bacteria 8502
416 Ga0207648_10000494 3300026089 Bacteria 43933
417 Ga0207676_10000021 3300026095 Bacteria 296572
418 Ga0207676_10003587 3300026095 Bacteria 10968
419 Ga0207676_10004090 3300026095 Bacteria 10289
420 Ga0207674_10007528 3300026116 Bacteria 12691
421 Ga0207674_10035934 3300026116 Bacteria 5167
422 Ga0207674_10064320 3300026116 Bacteria 3700
423 Ga0207674_10275701 3300026116 Bacteria 1630
424 Ga0207674_10341218 3300026116 Bacteria 1448
425 Ga0207675_100000071 3300026118 Bacteria 77575
426 Ga0207675_100003319 3300026118 Bacteria 15755
427 Ga0207675_100006708 3300026118 Bacteria 10884
428 Ga0207675_100059135 3300026118 Bacteria 3577
429 Ga0207683_10061493 3300026121 Bacteria 3305
430 Ga0207683_10530257 3300026121 Bacteria 1088
431 Ga0207698_10001828 3300026142 Bacteria 12444
432 Ga0207698_10352718 3300026142 Bacteria 1390
433 Ga0207698_10354531 3300026142 Bacteria 1387
434 Ga0207698_10434633 3300026142 Bacteria 1263
435 Ga0207698_10474974 3300026142 Bacteria 1212
436 Ga0209813_10000036 3300027866 Bacteria 58545
437 Ga0268266_10000471 3300028379 Bacteria 58314
438 Ga0268266_10019776 3300028379 Bacteria 5738
439 Ga0268266_10133519 3300028379 Bacteria 2222
440 Ga0268265_10000013 3300028380 Bacteria 341536
441 Ga0268265_10000209 3300028380 Bacteria 68317
442 Ga0268265_10000525 3300028380 Bacteria 39061
443 Ga0268265_10004259 3300028380 Bacteria 9991
444 Ga0268265_10014040 3300028380 Bacteria 5456
445 Ga0268265_11121799 3300028380 Bacteria 781
446 Ga0268264_10000089 3300028381 Bacteria 234760
447 Ga0268264_10000144 3300028381 Bacteria 168841
448 Ga0268264_10000483 3300028381 Bacteria 52975
449 Ga0268264_10004593 3300028381 Bacteria 11734
450 Ga0268264_10019865 3300028381 Bacteria 5489
451 Ga0268264_10064820 3300028381 Bacteria 3076
452 Ga0268264_10143375 3300028381 Bacteria 2133
453 Ga0268264_10321702 3300028381 Bacteria 1463
454 Ga0307513_10213019 3300031456 Bacteria 1761
455 Ga0307408_100074061 3300031548 Bacteria 2525
456 Ga0307408_100427460 3300031548 Bacteria 1144
457 Ga0307508_10049043 3300031616 Bacteria 3761
458 Ga0307405_10263720 3300031731 Bacteria 1288
459 Ga0307405_10407112 3300031731 Bacteria 1066
460 Ga0307413_10120074 3300031824 Bacteria 1779
461 Ga0307413_10187326 3300031824 Bacteria 1482
462 Ga0307412_10004187 3300031911 Bacteria 8043
463 Ga0307412_10048912 3300031911 Bacteria 2783
464 Ga0307412_10089691 3300031911 Bacteria 2147
465 Ga0307412_10463036 3300031911 Bacteria 1047
466 Ga0307409_100462886 3300031995 Bacteria 1226
467 Ga0307416_100064488 3300032002 Bacteria 3005
468 Ga0307416_100064534 3300032002 Bacteria 3004
469 Ga0307416_100229611 3300032002 Bacteria 1788
470 Ga0307414_10039012 3300032004 Bacteria 3195
471 Ga0307414_10050186 3300032004 Bacteria 2889
472 Ga0307414_10078461 3300032004 Bacteria 2407
473 Ga0307414_10178988 3300032004 Bacteria 1703
474 Ga0307414_10461251 3300032004 Bacteria 1117
475 Ga0307414_10686004 3300032004 Bacteria 926
476 Ga0307411_10076149 3300032005 Bacteria 2293
477 Ga0307411_10259352 3300032005 Bacteria 1372
478 Ga0307411_10621453 3300032005 Bacteria 931
479 Ga0307510_10131028 3300033180 Bacteria 2181
480 Ga0373923_0113816 3300035111 Bacteria 1204
481 Ga0373923_0130921 3300035111 Bacteria 1127
482 Ga0395899_0008722 3300037312 Bacteria 7805
483 Ga0395900_0036311 3300037418 Bacteria 5080
484 Ga0395900_0295708 3300037418 Bacteria 1607
485 Ga0395898_0667244 3300037466 Bacteria 982
486 Ga0395905_0021782 3300037471 Bacteria 6062
487 Ga0395905_0104285 3300037471 Bacteria 2662
488 Ga0395905_0237379 3300037471 Bacteria 1704
489 Ga0395905_0477343 3300037471 Bacteria 1146
490 Ga0395905_0592646 3300037471 Bacteria 1010
491 Ga0395905_0842566 3300037471 Bacteria 820
492 Ga0436364_0154840 3300037853 Bacteria 188668
493 Ga0395901_0101619 3300038443 Bacteria 3017
494 Ga0395901_0387218 3300038443 Bacteria 1438
495 Ga0237819_01638 3300038705 Bacteria 5514
496 Ga0436365_0864664 3300039437 Bacteria 1940
497 Ga0436363_1390116 3300039450 Bacteria 1581
498 Ga0439461_0000062 3300041410 Bacteria 13562
499 Ga0439461_0062145 3300041410 Bacteria 850
500 Ga0439465_0002490 3300041413 Bacteria 6015
501 Ga0439465_0002807 3300041413 Bacteria 5706
502 Ga0451807_0610978 3300041486 Bacteria 1510
503 Ga0451807_2451244 3300041486 Bacteria 937
504 Ga0451853_2895476 3300041512 Bacteria 895
505 Ga0439431_0000213 3300041997 Bacteria 11584
506 Ga0439431_0011636 3300041997 Bacteria 2012
507 Ga0439442_002121 3300042002 Bacteria 3899
508 Ga0439445_0001827 3300042004 Bacteria 4687
509 Ga0439445_0072984 3300042004 Bacteria 951
510 Ga0439448_0006066 3300042005 Bacteria 3465
511 Ga0439448_0017764 3300042005 Bacteria 2174
512 Ga0439448_0039712 3300042005 Bacteria 1518
513 Ga0439432_001352 3300042006 Bacteria 9275
514 Ga0439450_054815 3300042008 Bacteria 954
515 Ga0439452_012615 3300042010 Bacteria 2397
516 Ga0439455_0000548 3300042012 Bacteria 5312
517 Ga0439455_0010465 3300042012 Bacteria 2040
518 Ga0439457_023261 3300042014 Bacteria 1371
519 Ga0439462_0000410 3300042015 Bacteria 8305
520 Ga0439462_0051755 3300042015 Bacteria 1104
521 Ga0450922_009002 3300042124 Bacteria 946
522 Ga0439446_0091979 3300042156 Bacteria 950
523 Ga0439458_0002779 3300042157 Bacteria 4212
524 Ga0439458_0004556 3300042157 Bacteria 3174
525 Ga0439458_0005357 3300042157 Bacteria 2884
526 Ga0439434_0000698 3300042435 Bacteria 9679
527 Ga0439434_0028901 3300042435 Bacteria 1680
528 Ga0451577_0335570 3300042876 Bacteria 1371
529 Ga0466972_0013569 3300044658 Bacteria 4089
530 Ga0466973_0178351 3300044659 Bacteria 1623
531 Ga0466965_0158371 3300044683 Bacteria 1186
532 Ga0466966_0217357 3300044684 Bacteria 1154
533 Ga0466961_0030993 3300044693 Bacteria 3437
534 Ga0466963_0006035 3300044694 Bacteria 7140
535 Ga0466964_0009242 3300044706 Bacteria 3708
536 Ga0466964_0049201 3300044706 Bacteria 1725
537 Ga0453684_0146010 3300044712 Bacteria 2818
538 Ga0466970_0048935 3300044765 Bacteria 2254
539 Ga0466957_0351838 3300044842 Bacteria 999
540 Ga0466960_0132825 3300044901 Bacteria 1315
541 Ga0466959_0183124 3300045049 Bacteria 1464
542 Ga0466958_0015445 3300045836 Bacteria 4375
543 Ga0466967_0649818 3300045976 Bacteria 1043
544 Ga0495627_000036 3300046453 Bacteria 205589
545 Ga0495627_000090 3300046453 Bacteria 109622
546 Ga0495627_000287 3300046453 Bacteria 50673
547 Ga0495638_0012358 3300046460 Bacteria 5855
548 Ga0495638_0016175 3300046460 Bacteria 5000
549 Ga0495650_0000684 3300046471 Bacteria 43971
550 Ga0495650_0001816 3300046471 Bacteria 19170
551 Ga0495650_0028746 3300046471 Bacteria 2545
552 Ga0495596_0000601 3300046500 Bacteria 22617
553 Ga0495607_0013398 3300046501 Bacteria 5375
554 Ga0495583_0000252 3300046506 Bacteria 88617
555 Ga0495583_0073090 3300046506 Bacteria 1504
556 Ga0495606_0026435 3300046507 Bacteria 4138
557 Ga0495610_0000015 3300046512 Bacteria 391489
558 Ga0495610_0000079 3300046512 Bacteria 115816
559 Ga0495610_0001801 3300046512 Bacteria 18656
560 Ga0495610_0028580 3300046512 Bacteria 2947
561 Ga0495616_0000010 3300046513 Bacteria 224378
562 Ga0495620_0013186 3300046515 Bacteria 4240
563 Ga0495631_0069054 3300046518 Bacteria 1528
564 Ga0495632_0000095 3300046519 Bacteria 89499
565 Ga0495632_0000668 3300046519 Bacteria 31348
566 Ga0495632_0001502 3300046519 Bacteria 19288
567 Ga0495632_0090126 3300046519 Bacteria 1455
568 Ga0495637_0003691 3300046520 Bacteria 8085
569 Ga0495637_0047079 3300046520 Bacteria 1822
570 Ga0495643_0000038 3300046522 Bacteria 236010
571 Ga0495643_0000217 3300046522 Bacteria 88279
572 Ga0495643_0012289 3300046522 Bacteria 5170
573 Ga0495643_0086614 3300046522 Bacteria 1622
574 Ga0495648_0000018 3300046524 Bacteria 282490
575 Ga0495648_0005139 3300046524 Bacteria 10954
576 Ga0495663_0000028 3300046525 Bacteria 89526
577 Ga0495609_0001277 3300046538 Bacteria 17177
578 Ga0495609_0007581 3300046538 Bacteria 5396
579 Ga0495622_0012565 3300046557 Bacteria 3923
580 Ga0495633_0000340 3300046558 Bacteria 52440
581 Ga0495633_0003319 3300046558 Bacteria 10807
582 Ga0495633_0004974 3300046558 Bacteria 8294
583 Ga0495633_0108375 3300046558 Bacteria 1288
584 Ga0495633_0142170 3300046558 Bacteria 1109
585 Ga0495668_0008492 3300046616 Bacteria 6400
586 Ga0495668_0074488 3300046616 Bacteria 1864
587 Ga0495625_0006657 3300046660 Bacteria 10249
588 Ga0495625_0014445 3300046660 Bacteria 6302
589 Ga0495625_0057803 3300046660 Bacteria 2757
590 Ga0495661_0024460 3300046665 Bacteria 3909
591 Ga0495661_0048707 3300046665 Bacteria 2574
592 Ga0495669_0241249 3300046684 Bacteria 867
593 Ga0495670_0315271 3300046691 Bacteria 839
594 Ga0495671_0000011 3300046692 Bacteria 365582
595 Ga0495671_0000027 3300046692 Bacteria 236011
596 Ga0495672_0055076 3300047320 Bacteria 2322
597 Ga0495673_0000013 3300047469 Bacteria 612902
598 Ga0495673_0086819 3300047469 Bacteria 1285
599 Ga0495681_0000048 3300047470 Bacteria 110216
600 Ga0495681_0000077 3300047470 Bacteria 87471
601 Ga0495681_0029019 3300047470 Bacteria 2837
602 Ga0495686_0000469 3300047472 Bacteria 60229
603 Ga0495686_0015005 3300047472 Bacteria 5309
604 Ga0495686_0035001 3300047472 Bacteria 3231
605 Ga0495686_0045796 3300047472 Bacteria 2767
606 Ga0495686_0347710 3300047472 Bacteria 807
607 Ga0495615_0091122 3300048090 Bacteria 849
608 Ga0496100_0063797 3300048903 Bacteria 2435
609 Ga0496101_0035108 3300048904 Bacteria 3545
610 Ga0496101_0641956 3300048904 Bacteria 839
611 Ga0496102_0000267 3300048905 Bacteria 66761
612 Ga0496102_0033928 3300048905 Bacteria 4589
613 Ga0496102_0180466 3300048905 Bacteria 1989
614 Ga0496102_0234679 3300048905 Bacteria 1729
615 Ga0496103_0000139 3300048906 Bacteria 75158
616 Ga0496103_0442886 3300048906 Bacteria 833
617 Ga0496104_0001996 3300048907 Bacteria 17709
618 Ga0496105_0000099 3300048908 Bacteria 59095
619 Ga0496106_0522487 3300048909 Bacteria 953
620 Ga0496107_0020816 3300048910 Bacteria 4636
621 Ga0496107_0660656 3300048910 Bacteria 770
622 Ga0496108_0001779 3300048911 Bacteria 17174
623 Ga0496109_0006311 3300048912 Bacteria 9982
624 Ga0496109_0197981 3300048912 Bacteria 1889
625 Ga0496110_0188045 3300048913 Bacteria 1875
626 Ga0496110_0205913 3300048913 Bacteria 1788
627 Ga0496110_0525296 3300048913 Bacteria 1076
628 Ga0496111_0025926 3300048914 Bacteria 4137
629 Ga0496111_0090959 3300048914 Bacteria 2236
630 Ga0496111_0192483 3300048914 Bacteria 1516
631 Ga0496112_0018899 3300048915 Bacteria 6493
632 Ga0496112_0445998 3300048915 Bacteria 1232
633 Ga0496113_0004509 3300048916 Bacteria 8576
634 Ga0496113_0058450 3300048916 Bacteria 2901
635 Ga0496115_0019907 3300048918 Bacteria 5170
636 Ga0496115_0236213 3300048918 Bacteria 1507
637 Ga0496116_0019293 3300048919 Bacteria 5223
638 Ga0496116_0026853 3300048919 Bacteria 4200
639 Ga0496116_0058256 3300048919 Bacteria 2520
640 Ga0496116_0072004 3300048919 Bacteria 2186
641 Ga0496117_0008650 3300048920 Bacteria 9634
642 Ga0496117_0017167 3300048920 Bacteria 6058
643 Ga0496117_0020177 3300048920 Bacteria 5443
644 Ga0496117_0166070 3300048920 Bacteria 1287
645 Ga0496118_0000606 3300048921 Bacteria 59016
646 Ga0496118_0009747 3300048921 Bacteria 9635
647 Ga0496118_0015390 3300048921 Bacteria 7082
648 Ga0496118_0023847 3300048921 Bacteria 5301
649 Ga0496118_0032113 3300048921 Bacteria 4335
650 Ga0496118_0244241 3300048921 Bacteria 1025
651 Ga0496119_0004210 3300048922 Bacteria 14446
652 Ga0496119_0043741 3300048922 Bacteria 2827
653 Ga0496119_0058202 3300048922 Bacteria 2330
654 Ga0496119_0298168 3300048922 Bacteria 796
655 Ga0496120_0003080 3300048923 Bacteria 15717
656 Ga0496120_0163353 3300048923 Bacteria 1108
657 Ga0496120_0299918 3300048923 Bacteria 736
658 Ga0496121_0000349 3300048924 Bacteria 96428
659 Ga0496121_0006573 3300048924 Bacteria 14350
660 Ga0496121_0009274 3300048924 Bacteria 11352
661 Ga0496121_0013822 3300048924 Bacteria 8640
662 Ga0496121_0023584 3300048924 Bacteria 5918
663 Ga0496121_0138727 3300048924 Bacteria 1807
664 Ga0496121_0153284 3300048924 Bacteria 1693
665 Ga0496122_0000579 3300048925 Bacteria 75073
666 Ga0496122_0003895 3300048925 Bacteria 19129
667 Ga0496122_0005423 3300048925 Bacteria 15204
668 Ga0496122_0007148 3300048925 Bacteria 12516
669 Ga0496122_0009664 3300048925 Bacteria 10094
670 Ga0496122_0059250 3300048925 Bacteria 2827
671 Ga0496122_0141734 3300048925 Bacteria 1502
672 Ga0496122_0166595 3300048925 Bacteria 1335
673 Ga0496122_0219377 3300048925 Bacteria 1093
674 Ga0496123_0000286 3300048926 Bacteria 98752
675 Ga0496123_0001402 3300048926 Bacteria 33737
676 Ga0496123_0002745 3300048926 Bacteria 21046
677 Ga0496123_0002794 3300048926 Bacteria 20744
678 Ga0496123_0056695 3300048926 Bacteria 2557
679 Ga0496123_0101824 3300048926 Bacteria 1669
680 Ga0496123_0106295 3300048926 Bacteria 1617
681 Ga0496123_0120378 3300048926 Bacteria 1478
682 Ga0496123_0147013 3300048926 Bacteria 1278
683 Ga0496124_0001132 3300048927 Bacteria 41905
684 Ga0496124_0001730 3300048927 Bacteria 30704
685 Ga0496124_0008888 3300048927 Bacteria 10420
686 Ga0496124_0049847 3300048927 Bacteria 3570
687 Ga0496124_0050093 3300048927 Bacteria 3560
688 Ga0496124_0067144 3300048927 Bacteria 2985
689 Ga0496124_0132955 3300048927 Bacteria 1974
690 Ga0496124_0258622 3300048927 Bacteria 1283
691 Ga0496124_0269944 3300048927 Bacteria 1246
692 Ga0496124_0278223 3300048927 Bacteria 1221
693 Ga0496124_0344554 3300048927 Bacteria 1056
694 Ga0496124_0348664 3300048927 Bacteria 1048
695 Ga0496125_0004923 3300048928 Bacteria 15118
696 Ga0496125_0012034 3300048928 Bacteria 8613
697 Ga0496125_0012127 3300048928 Bacteria 8574
698 Ga0496125_0016696 3300048928 Bacteria 7039
699 Ga0496125_0018428 3300048928 Bacteria 6630
700 Ga0496125_0021250 3300048928 Bacteria 6061
701 Ga0496125_0038148 3300048928 Bacteria 4164
702 Ga0496125_0060040 3300048928 Bacteria 3059
703 Ga0496125_0079290 3300048928 Bacteria 2520
704 Ga0496125_0107609 3300048928 Bacteria 2031
705 Ga0496125_0283364 3300048928 Bacteria 1025
706 Ga0496125_0392570 3300048928 Bacteria 814
707 Ga0496126_0000619 3300048929 Bacteria 66827
708 Ga0496126_0027985 3300048929 Bacteria 5375
709 Ga0496126_0066961 3300048929 Bacteria 3210
710 Ga0496126_0115084 3300048929 Bacteria 2339
711 Ga0496126_0232662 3300048929 Bacteria 1543
712 Ga0496126_0459179 3300048929 Bacteria 1024
713 Ga0496126_0633079 3300048929 Bacteria 839
714 Ga0501292_000004 3300049515 Bacteria 159565
715 Ga0501294_000758 3300049517 Bacteria 3568
716 Ga0501300_000066 3300049523 Bacteria 15100
717 Ga0501314_001800 3300049530 Bacteria 1592
718 Ga0501032_0085757 3300049569 Bacteria 2093
719 Ga0501034_0016790 3300049571 Bacteria 7506
720 Ga0501034_0204545 3300049571 Bacteria 1931
721 Ga0501037_0745985 3300049573 Bacteria 649
722 Ga0501038_0298223 3300049574 Bacteria 1265
723 Ga0501043_0130029 3300049579 Bacteria 1973
724 Ga0501043_0195947 3300049579 Bacteria 1569
725 Ga0501046_0428815 3300049580 Bacteria 953
726 Ga0501047_0000644 3300049581 Bacteria 36698
727 Ga0501048_0134900 3300049582 Bacteria 1744
728 Ga0501202_014100 3300049652 Bacteria 1527
729 Ga0501222_000505 3300049662 Bacteria 5796
730 Ga0501223_000042 3300049663 Bacteria 44258
731 Ga0501223_000211 3300049663 Bacteria 14909
732 Ga0501223_001716 3300049663 Bacteria 5000
733 Ga0501224_000008 3300049664 Bacteria 111708
734 Ga0501224_009310 3300049664 Bacteria 1436
735 Ga0501227_014569 3300049665 Bacteria 1746
736 Ga0501233_008110 3300049668 Bacteria 2017
737 Ga0501235_000139 3300049669 Bacteria 12177
738 Ga0501249_000549 3300049679 Bacteria 9020
739 Ga0501257_003748 3300049686 Bacteria 3284
740 Ga0501259_000801 3300049688 Bacteria 5144
741 Ga0501261_000010 3300049690 Bacteria 49364
742 Ga0501225_0000073 3300049705 Bacteria 33154
743 Ga0501225_0000520 3300049705 Bacteria 12018
744 Ga0501225_0003808 3300049705 Bacteria 4533
745 Ga0501225_0022874 3300049705 Bacteria 1725
746 Ga0501234_000985 3300049707 Bacteria 4509
747 Ga0501245_000603 3300049708 Bacteria 4418
748 Ga0501245_008999 3300049708 Bacteria 1429
749 Ga0501241_005459 3300049758 Bacteria 2368
750 Ga0501279_000005 3300049775 Bacteria 153858
751 Ga0501280_000038 3300049776 Bacteria 38694
752 Ga0501282_000165 3300049778 Bacteria 8009
753 Ga0501044_0049651 3300049823 Bacteria 4331
754 Ga0501044_0892156 3300049823 Bacteria 764
755 Ga0501226_000042 3300049853 Bacteria 59224
756 nmdc:mga00v17_29710_c1 3300050491 Bacteria 3209
757 nmdc:mga0k408_188043_c1 3300050493 Bacteria 1232
758 nmdc:mga0k408_51881_c1 3300050493 Bacteria 2376
759 nmdc:mga06z11_111_c1 3300050494 Bacteria 33603
760 nmdc:mga04h51_100_c1 3300050495 Bacteria 25673
761 nmdc:mga07m45_1083_c1 3300050496 Bacteria 12127
762 nmdc:mga07m45_82575_c1 3300050496 Bacteria 1835
763 nmdc:mga05p37_228596_c1 3300050507 Bacteria 2242
764 Ga0495619_0327712 3300053085 Bacteria 1060
765 Ga0500643_000539 3300053087 Bacteria 26512
766 Ga0500643_002149 3300053087 Bacteria 10433
767 Ga0500643_004524 3300053087 Bacteria 6250
768 Ga0500643_010045 3300053087 Bacteria 3559
769 Ga0500643_021485 3300053087 Bacteria 2091
770 Ga0500643_045312 3300053087 Bacteria 1274
771 Ga0500643_068092 3300053087 Bacteria 990
772 Ga0500644_0028883 3300053088 Bacteria 1739
773 Ga0500647_0029989 3300053091 Bacteria 2581
774 Ga0500651_0002188 3300053093 Bacteria 10235
775 Ga0500641_0001555 3300053096 Bacteria 8178
776 Ga0500641_0012360 3300053096 Bacteria 3116
777 Ga0500650_0191460 3300053098 Bacteria 934
778 Ga0500556_0000074 3300053104 Bacteria 98799
779 Ga0500557_017166 3300053105 Bacteria 1993
780 Ga0500562_005307 3300053108 Bacteria 3236
781 Ga0500562_073645 3300053108 Bacteria 922
782 Ga0500594_0062933 3300053118 Bacteria 1074
783 Ga0500595_005345 3300053119 Bacteria 5617
784 Ga0500618_005557 3300053125 Bacteria 3815
785 Ga0500618_022875 3300053125 Bacteria 1516
786 Ga0500642_0000002 3300053130 Bacteria 795093
787 Ga0500642_0001441 3300053130 Bacteria 6825
788 Ga0500652_092939 3300053131 Bacteria 1260
789 Ga0500655_000061 3300053133 Bacteria 29562
790 Ga0500559_0001442 3300053136 Bacteria 13495
791 Ga0500573_0000015 3300053140 Bacteria 192264
792 Ga0500573_0264954 3300053140 Bacteria 878
793 Ga0500616_0003051 3300053153 Bacteria 13180
794 Ga0500622_0000901 3300053156 Bacteria 25291
795 Ga0500622_0003437 3300053156 Bacteria 10591
796 Ga0500622_0016726 3300053156 Bacteria 3916
797 Ga0500624_000085 3300053157 Bacteria 47798
798 Ga0500624_000125 3300053157 Bacteria 34426
799 Ga0500627_0002237 3300053158 Bacteria 5671
800 Ga0500636_0013174 3300053177 Bacteria 4851
801 Ga0500636_0077521 3300053177 Bacteria 1920
802 Ga0500637_0000023 3300053178 Bacteria 61044
803 Ga0500570_000268 3300053724 Bacteria 17871
804 Ga0500645_003833 3300053730 Bacteria 5966
805 Ga0500645_004874 3300053730 Bacteria 5055
806 Ga0500661_000138 3300055283 Bacteria 12382
807 Ga0466962_0001351 3300061719 Bacteria 11344
808 Ga0466962_0046360 3300061719 Bacteria 2077
809 2511129570 2510917021 Bacteria 5705459
810 2512644061 2512564014 Bacteria 4639632
811 2585263904 2582581305 Bacteria 4895574
812 2600225765 2599185359 Bacteria 4772316
813 2643730699 2643221541 Bacteria 5498788
814 2644040835 2643221605 Bacteria 4772303
815 2644044647 2643221606 Bacteria 5588032
816 2644391428 2643221671 Bacteria 5496681
817 2778123851 2775507255 Bacteria 3945731
818 2809064830 2808606401 Bacteria 4586670
819 2809080797 2808606404 Bacteria 4652788
820 2809085162 2808606405 Bacteria 4586632
821 2819716433 2818991466 Bacteria 4748179
822 2879165296 2879163058 Bacteria 4223965
823 2880521862 2880518877 Bacteria 5012590
824 2919711333 2919709256 Bacteria 4318106
825 2928028566 2928027323 Bacteria 4382488
826 2928528758 2928526807 Bacteria 4760224
827 2928970312 2928968154 Bacteria 4633371
828 2984555857 2984555340 Bacteria 4247089
829 2984566034 2984564862 Bacteria 4339992
830 2990266488 2990265787 Bacteria 3943888
831 2993357045 2993356040 Bacteria 4247105
832 2993695714 2993693658 Bacteria 4040749
833 8054306873 8054302542 Bacteria 5698134
834 8057101944 8057101203 Bacteria 5034064
835 Ga0495670_0021536
836 SwRhRL2b_contig_3660702
837 JGI24736J21556_1000235
838 JGI24741J21665_1000124
839 JGI24752J21851_1000586
840 JGI24740J21852_10003311
841 JGI24740J21852_10028989
842 JGI24740J21852_10058057
843 JGI24739J22299_10001891
844 JGI24737J22298_10003492
845 JGI24737J22298_10006196
846 JGI24737J22298_10040310
847 JGI24737J22298_10084090
848 JGI24743J22301_10012544
849 JGI24735J21928_10000699
850 JGI24735J21928_10009713
851 JGI24735J21928_10009810
852 JGI24735J21928_10012405
853 JGI24735J21928_10012704
854 JGI24735J21928_10027489
855 JGI24735J21928_10054782
856 JGI24738J21930_10002736
857 JGI24738J21930_10004755
858 JGI24738J21930_10015195
859 JGI24738J21930_10020901
860 JGI24749J21850_1000352
861 JGI24744J21845_10000115
862 JGI24035J26624_1003524
863 JGI24751J29686_10000208
864 JGI25150J39212_1003534
865 JGI25151J46595_10037612
866 JGI25165J46597_1000534
867 JGI25153J46596_10000186
868 rootL2_10042168
869 Ga0055542_1003000
870 Ga0055526_1012603
871 Ga0055536_1016085
872 Ga0055530_10000064
873 Ga0055530_10037267
874 Ga0055540_1000768
875 Ga0055540_1002060
876 Ga0055531_10000073
877 Ga0065165_1056282
878 Ga0065704_10000192
879 Ga0065704_10000914
880 Ga0065704_10003296
881 Ga0065704_10070989
882 Ga0065704_10077790
883 Ga0065707_10084356
884 Ga0065707_10086371
885 Ga0070658_10001154
886 Ga0070658_10012339
887 Ga0070676_10000448
888 Ga0070683_100276977
889 Ga0070683_100532952
890 Ga0070670_100000024
891 Ga0070670_100003502
892 Ga0070670_100035441
893 Ga0068869_100002661
894 Ga0070666_10000111
895 Ga0070666_10001747
896 Ga0070666_10051148
897 Ga0070666_10062591
898 Ga0070666_10098313
899 Ga0070666_10456715
900 Ga0068868_100000910
901 Ga0070660_100009320
902 Ga0070660_100058583
903 Ga0070660_100135929
904 Ga0070660_100149113
905 Ga0070660_100166856
906 Ga0070661_100008203
907 Ga0070661_100261922
908 Ga0070668_100000027
909 Ga0070668_100000041
910 Ga0070668_100008132
911 Ga0070668_100024451
912 Ga0070668_100027686
913 Ga0070668_100084870
914 Ga0070668_100135504
915 Ga0070669_100000012
916 Ga0070669_100000047
917 Ga0070669_100005445
918 Ga0070669_100010694
919 Ga0070669_100054887
920 Ga0070669_100218101
921 Ga0070675_100071809
922 Ga0070671_100000019
923 Ga0070671_100000517
924 Ga0070671_100002891
925 Ga0070671_100003218
926 Ga0070671_100023173
927 Ga0070671_100057465
928 Ga0070674_100019915
929 Ga0070673_100000020
930 Ga0070659_100140337
931 Ga0070659_100233254
932 Ga0070659_100287872
933 Ga0070667_100000017
934 Ga0070667_100000058
935 Ga0070667_100000143
936 Ga0070667_100005804
937 Ga0070667_100012087
938 Ga0070667_100016472
939 Ga0070667_100113572
940 Ga0070705_100004405
941 Ga0070708_100912558
942 Ga0070663_100001418
943 Ga0070678_100005895
944 Ga0070662_100032068
945 Ga0070662_100394559
946 Ga0068867_100000155
947 Ga0070685_10016519
948 Ga0070685_10505431
949 Ga0068853_100070689
950 Ga0068853_100086514
951 Ga0068853_100089633
952 Ga0068853_100265068
953 Ga0068853_100315074
954 Ga0070665_100001012
955 Ga0070665_100010368
956 Ga0068855_100002050
957 Ga0068855_100121831
958 Ga0068855_100629612
959 Ga0070664_100014905
960 Ga0070664_100490854
961 Ga0068857_100013486
962 Ga0068857_100059205
963 Ga0068857_100108610
964 Ga0068857_100121731
965 Ga0068857_100309780
966 Ga0068854_100002936
967 Ga0068854_100268072
968 Ga0068854_100340174
969 Ga0068856_100008231
970 Ga0068856_100019646
971 Ga0070702_100041902
972 Ga0068852_100010016
973 Ga0068852_100483302
974 Ga0068852_100491236
975 Ga0068852_100493014
976 Ga0068859_100038244
977 Ga0068859_100062917
978 Ga0068859_100092658
979 Ga0068859_100190175
980 Ga0068859_100588416
981 Ga0068864_100000036
982 Ga0068864_100000475
983 Ga0068864_100004795
984 Ga0068864_100159134
985 Ga0068861_100002169
986 Ga0068861_100005201
987 Ga0068861_100021348
988 Ga0068851_10013802
989 Ga0068851_10077709
990 Ga0068851_10160609
991 Ga0068863_100000031
992 Ga0068863_100001489
993 Ga0068863_100002193
994 Ga0068863_100005824
995 Ga0068863_100007418
996 Ga0068863_100031052
997 Ga0068858_100000103
998 Ga0068858_100021883
999 Ga0068858_100204130
1000 Ga0068860_100000056
1001 Ga0068860_100000181
1002 Ga0068860_100022971
1003 Ga0068860_100031058
1004 Ga0068860_100031678
1005 Ga0068860_100078368
1006 Ga0068860_100324700
1007 Ga0068862_100000033
1008 Ga0068862_100000187
1009 Ga0068862_100000884
1010 Ga0068862_100005927
1011 Ga0068862_100030592
1012 Ga0068862_100128025
1013 Ga0068862_100235818
1014 Ga0081539_10016956
1015 Ga0075368_10001355
1016 Ga0075364_10166195
1017 Ga0075367_10001026
1018 Ga0075366_10034983
1019 Ga0075366_10117135
1020 Ga0097621_100005590
1021 Ga0075370_10002503
1022 Ga0068865_100000272
1023 Ga0097620_100038244
1024 Ga0097620_100062917
1025 Ga0097620_100092661
1026 Ga0097620_100190181
1027 Ga0097620_100588387
1028 Ga0099826_10138471
1029 Ga0105251_10004489
1030 Ga0105251_10015704
1031 Ga0105251_10032668
1032 Ga0105251_10035471
1033 Ga0105250_10032780
1034 Ga0105250_10075779
1035 Ga0105240_10012649
1036 Ga0105240_10020042
1037 Ga0105240_10574747
1038 Ga0105245_10002130
1039 Ga0105247_10004441
1040 Ga0105247_10117922
1041 Ga0105247_10118724
1042 Ga0114129_10282114
1043 Ga0105243_10000711
1044 Ga0105243_10222341
1045 Ga0105243_10654438
1046 Ga0105241_10000807
1047 Ga0105242_10000320
1048 Ga0105248_10000091
1049 Ga0105248_10002773
1050 Ga0105248_10014281
1051 Ga0105248_10018898
1052 Ga0105248_10033589
1053 Ga0105248_10070358
1054 Ga0105248_10227998
1055 Ga0105248_10365850
1056 Ga0105237_10008796
1057 Ga0105237_10075759
1058 Ga0105238_10501816
1059 Ga0105249_10000553
1060 Ga0105249_10001384
1061 Ga0105249_10093615
1062 Ga0105249_10414876
1063 Ga0105148_100060
1064 Ga0105239_10142551
1065 Ga0105239_10165940
1066 Ga0105239_10808157
1067 Ga0105246_10004775
1068 Ga0157326_1000067
1069 Ga0157373_10015080
1070 Ga0157373_10097352
1071 Ga0157371_10710594
1072 Ga0157370_10000145
1073 Ga0157370_10013194
1074 Ga0157370_10704392
1075 Ga0157369_10018860
1076 Ga0157369_10648922
1077 Ga0157369_10957018
1078 Ga0157374_10005414
1079 Ga0157374_10136449
1080 Ga0157378_10011140
1081 Ga0163162_10053526
1082 Ga0163162_10124375
1083 Ga0163162_10658904
1084 Ga0157372_10029740
1085 Ga0157372_10065951
1086 Ga0157372_10146982
1087 Ga0157372_10202471
1088 Ga0157372_10681462
1089 Ga0157380_10008171
1090 Ga0157380_10370279
1091 Ga0157380_10545439
1092 Ga0157377_10013528
1093 Ga0157379_10001174
1094 Ga0157376_10000395
1095 Ga0183363_1005
1096 Ga0163161_10038021
1097 Ga0163161_10057942
1098 Ga0163161_10153985
1099 Ga0163161_10364892
1100 Ga0213874_10064662
1101 Ga0213876_10200643
1102 Ga0209147_100881
1103 Ga0207427_100878
1104 Ga0207425_1000049
1105 Ga0209148_1000318
1106 Ga0209148_1015931
1107 Ga0209129_1003718
1108 Ga0209233_1000181
1109 Ga0209565_1001004
1110 Ga0209455_1000942
1111 Ga0209676_1015713
1112 Ga0209025_1000068
1113 Ga0209564_1004346
1114 Ga0209758_1000019
1115 Ga0209758_1026569
1116 Ga0209050_1000001
1117 Ga0209050_1000010
1118 Ga0209050_1000108
1119 Ga0209050_1029301
1120 Ga0209051_1005046
1121 Ga0209257_1000027
1122 Ga0209257_1035415
1123 Ga0207697_10000003
1124 Ga0207656_10084618
1125 Ga0207656_10088066
1126 Ga0207656_10104901
1127 Ga0207713_1019134
1128 Ga0207713_1020886
1129 Ga0207710_10006744
1130 Ga0207710_10012555
1131 Ga0207710_10019525
1132 Ga0207710_10310503
1133 Ga0207688_10107208
1134 Ga0207688_10362667
1135 Ga0207680_10000142
1136 Ga0207680_10000890
1137 Ga0207680_10015221
1138 Ga0207680_10024379
1139 Ga0207680_10084501
1140 Ga0207647_10000611
1141 Ga0207647_10003792
1142 Ga0207647_10004427
1143 Ga0207647_10022600
1144 Ga0207647_10029211
1145 Ga0207647_10220582
1146 Ga0207645_10011226
1147 Ga0207705_10001161
1148 Ga0207705_10003807
1149 Ga0207705_10055811
1150 Ga0207705_10593060
1151 Ga0207654_10098004
1152 Ga0207695_10011414
1153 Ga0207695_10058839
1154 Ga0207695_10346807
1155 Ga0207671_10021473
1156 Ga0207671_10042931
1157 Ga0207671_10141452
1158 Ga0207657_10002758
1159 Ga0207657_10005094
1160 Ga0207657_10030799
1161 Ga0207657_10041026
1162 Ga0207657_10154561
1163 Ga0207649_10234990
1164 Ga0207652_10718415
1165 Ga0207681_10000004
1166 Ga0207681_10000014
1167 Ga0207681_10002077
1168 Ga0207681_10002575
1169 Ga0207681_10021367
1170 Ga0207681_10046229
1171 Ga0207681_10146955
1172 Ga0207681_10191208
1173 Ga0207694_10034311
1174 Ga0207650_10000015
1175 Ga0207650_10003369
1176 Ga0207650_10005182
1177 Ga0207659_10052745
1178 Ga0207687_10001173
1179 Ga0207644_10000031
1180 Ga0207644_10000066
1181 Ga0207644_10000293
1182 Ga0207644_10007460
1183 Ga0207644_10055644
1184 Ga0207644_10117952
1185 Ga0207690_10057882
1186 Ga0207690_10124879
1187 Ga0207706_10015901
1188 Ga0207706_10022403
1189 Ga0207706_10117259
1190 Ga0207686_10000181
1191 Ga0207709_10000750
1192 Ga0207669_10009649
1193 Ga0207704_10000048
1194 Ga0207691_10065054
1195 Ga0207711_10002409
1196 Ga0207711_10008194
1197 Ga0207711_10012761
1198 Ga0207711_10027237
1199 Ga0207689_10000378
1200 Ga0207661_10217487
1201 Ga0207679_10158754
1202 Ga0207667_10001267
1203 Ga0207667_10070214
1204 Ga0207667_10225965
1205 Ga0207651_10000001
1206 Ga0207712_10000048
1207 Ga0207712_10018680
1208 Ga0207712_10029096
1209 Ga0207712_10058448
1210 Ga0207712_10068285
1211 Ga0207712_10383132
1212 Ga0207668_10000012
1213 Ga0207668_10000038
1214 Ga0207668_10000135
1215 Ga0207668_10003241
1216 Ga0207668_10004934
1217 Ga0207668_10069823
1218 Ga0207668_10095405
1219 Ga0207668_10150777
1220 Ga0207640_10000167
1221 Ga0207640_10014319
1222 Ga0207640_10305753
1223 Ga0207640_10400395
1224 Ga0207640_10511012
1225 Ga0207658_10000011
1226 Ga0207658_10000037
1227 Ga0207658_10000164
1228 Ga0207658_10003835
1229 Ga0207658_10004090
1230 Ga0207658_10010872
1231 Ga0207658_10397755
1232 Ga0207677_10000711
1233 Ga0207703_10000538
1234 Ga0207703_10015775
1235 Ga0207639_10000138
1236 Ga0207639_10001072
1237 Ga0207639_10068669
1238 Ga0207639_10700124
1239 Ga0207678_10005374
1240 Ga0207678_10006691
1241 Ga0207678_10251559
1242 Ga0207702_10048203
1243 Ga0207702_10252641
1244 Ga0207702_10256064
1245 Ga0207641_10000050
1246 Ga0207641_10000228
1247 Ga0207641_10000755
1248 Ga0207641_10006924
1249 Ga0207641_10008467
1250 Ga0207648_10000494
1251 Ga0207676_10000021
1252 Ga0207676_10003587
1253 Ga0207676_10004090
1254 Ga0207674_10007528
1255 Ga0207674_10035934
1256 Ga0207674_10064320
1257 Ga0207674_10275701
1258 Ga0207674_10341218
1259 Ga0207675_100000071
1260 Ga0207675_100003319
1261 Ga0207675_100006708
1262 Ga0207675_100059135
1263 Ga0207683_10061493
1264 Ga0207683_10530257
1265 Ga0207698_10001828
1266 Ga0207698_10352718
1267 Ga0207698_10354531
1268 Ga0207698_10434633
1269 Ga0207698_10474974
1270 Ga0209813_10000036
1271 Ga0268266_10000471
1272 Ga0268266_10019776
1273 Ga0268266_10133519
1274 Ga0268265_10000013
1275 Ga0268265_10000209
1276 Ga0268265_10000525
1277 Ga0268265_10004259
1278 Ga0268265_10014040
1279 Ga0268265_11121799
1280 Ga0268264_10000089
1281 Ga0268264_10000144
1282 Ga0268264_10000483
1283 Ga0268264_10004593
1284 Ga0268264_10019865
1285 Ga0268264_10064820
1286 Ga0268264_10143375
1287 Ga0268264_10321702
1288 Ga0307513_10213019
1289 Ga0307408_100074061
1290 Ga0307408_100427460
1291 Ga0307508_10049043
1292 Ga0307405_10263720
1293 Ga0307405_10407112
1294 Ga0307413_10120074
1295 Ga0307413_10187326
1296 Ga0307412_10004187
1297 Ga0307412_10048912
1298 Ga0307412_10089691
1299 Ga0307412_10463036
1300 Ga0307409_100462886
1301 Ga0307416_100064488
1302 Ga0307416_100064534
1303 Ga0307416_100229611
1304 Ga0307414_10039012
1305 Ga0307414_10050186
1306 Ga0307414_10078461
1307 Ga0307414_10178988
1308 Ga0307414_10461251
1309 Ga0307414_10686004
1310 Ga0307411_10076149
1311 Ga0307411_10259352
1312 Ga0307411_10621453
1313 Ga0307510_10131028
1314 Ga0373923_0113816
1315 Ga0373923_0130921
1316 Ga0395899_0008722
1317 Ga0395900_0036311
1318 Ga0395900_0295708
1319 Ga0395898_0667244
1320 Ga0395905_0021782
1321 Ga0395905_0104285
1322 Ga0395905_0237379
1323 Ga0395905_0477343
1324 Ga0395905_0592646
1325 Ga0395905_0842566
1326 Ga0436364_0154840
1327 Ga0395901_0101619
1328 Ga0395901_0387218
1329 Ga0237819_01638
1330 Ga0436365_0864664
1331 Ga0436363_1390116
1332 Ga0439461_0000062
1333 Ga0439461_0062145
1334 Ga0439465_0002490
1335 Ga0439465_0002807
1336 Ga0451807_0610978
1337 Ga0451807_2451244
1338 Ga0451853_2895476
1339 Ga0439431_0000213
1340 Ga0439431_0011636
1341 Ga0439442_002121
1342 Ga0439445_0001827
1343 Ga0439445_0072984
1344 Ga0439448_0006066
1345 Ga0439448_0017764
1346 Ga0439448_0039712
1347 Ga0439432_001352
1348 Ga0439450_054815
1349 Ga0439452_012615
1350 Ga0439455_0000548
1351 Ga0439455_0010465
1352 Ga0439457_023261
1353 Ga0439462_0000410
1354 Ga0439462_0051755
1355 Ga0450922_009002
1356 Ga0439446_0091979
1357 Ga0439458_0002779
1358 Ga0439458_0004556
1359 Ga0439458_0005357
1360 Ga0439434_0000698
1361 Ga0439434_0028901
1362 Ga0451577_0335570
1363 Ga0466972_0013569
1364 Ga0466973_0178351
1365 Ga0466965_0158371
1366 Ga0466966_0217357
1367 Ga0466961_0030993
1368 Ga0466963_0006035
1369 Ga0466964_0009242
1370 Ga0466964_0049201
1371 Ga0453684_0146010
1372 Ga0466970_0048935
1373 Ga0466957_0351838
1374 Ga0466960_0132825
1375 Ga0466959_0183124
1376 Ga0466958_0015445
1377 Ga0466967_0649818
1378 Ga0495627_000036
1379 Ga0495627_000090
1380 Ga0495627_000287
1381 Ga0495638_0012358
1382 Ga0495638_0016175
1383 Ga0495650_0000684
1384 Ga0495650_0001816
1385 Ga0495650_0028746
1386 Ga0495596_0000601
1387 Ga0495607_0013398
1388 Ga0495583_0000252
1389 Ga0495583_0073090
1390 Ga0495606_0026435
1391 Ga0495610_0000015
1392 Ga0495610_0000079
1393 Ga0495610_0001801
1394 Ga0495610_0028580
1395 Ga0495616_0000010
1396 Ga0495620_0013186
1397 Ga0495631_0069054
1398 Ga0495632_0000095
1399 Ga0495632_0000668
1400 Ga0495632_0001502
1401 Ga0495632_0090126
1402 Ga0495637_0003691
1403 Ga0495637_0047079
1404 Ga0495643_0000038
1405 Ga0495643_0000217
1406 Ga0495643_0012289
1407 Ga0495643_0086614
1408 Ga0495648_0000018
1409 Ga0495648_0005139
1410 Ga0495663_0000028
1411 Ga0495609_0001277
1412 Ga0495609_0007581
1413 Ga0495622_0012565
1414 Ga0495633_0000340
1415 Ga0495633_0003319
1416 Ga0495633_0004974
1417 Ga0495633_0108375
1418 Ga0495633_0142170
1419 Ga0495668_0008492
1420 Ga0495668_0074488
1421 Ga0495625_0006657
1422 Ga0495625_0014445
1423 Ga0495625_0057803
1424 Ga0495661_0024460
1425 Ga0495661_0048707
1426 Ga0495669_0241249
1427 Ga0495670_0315271
1428 Ga0495671_0000011
1429 Ga0495671_0000027
1430 Ga0495672_0055076
1431 Ga0495673_0000013
1432 Ga0495673_0086819
1433 Ga0495681_0000048
1434 Ga0495681_0000077
1435 Ga0495681_0029019
1436 Ga0495686_0000469
1437 Ga0495686_0015005
1438 Ga0495686_0035001
1439 Ga0495686_0045796
1440 Ga0495686_0347710
1441 Ga0495615_0091122
1442 Ga0496100_0063797
1443 Ga0496101_0035108
1444 Ga0496101_0641956
1445 Ga0496102_0000267
1446 Ga0496102_0033928
1447 Ga0496102_0180466
1448 Ga0496102_0234679
1449 Ga0496103_0000139
1450 Ga0496103_0442886
1451 Ga0496104_0001996
1452 Ga0496105_0000099
1453 Ga0496106_0522487
1454 Ga0496107_0020816
1455 Ga0496107_0660656
1456 Ga0496108_0001779
1457 Ga0496109_0006311
1458 Ga0496109_0197981
1459 Ga0496110_0188045
1460 Ga0496110_0205913
1461 Ga0496110_0525296
1462 Ga0496111_0025926
1463 Ga0496111_0090959
1464 Ga0496111_0192483
1465 Ga0496112_0018899
1466 Ga0496112_0445998
1467 Ga0496113_0004509
1468 Ga0496113_0058450
1469 Ga0496115_0019907
1470 Ga0496115_0236213
1471 Ga0496116_0019293
1472 Ga0496116_0026853
1473 Ga0496116_0058256
1474 Ga0496116_0072004
1475 Ga0496117_0008650
1476 Ga0496117_0017167
1477 Ga0496117_0020177
1478 Ga0496117_0166070
1479 Ga0496118_0000606
1480 Ga0496118_0009747
1481 Ga0496118_0015390
1482 Ga0496118_0023847
1483 Ga0496118_0032113
1484 Ga0496118_0244241
1485 Ga0496119_0004210
1486 Ga0496119_0043741
1487 Ga0496119_0058202
1488 Ga0496119_0298168
1489 Ga0496120_0003080
1490 Ga0496120_0163353
1491 Ga0496120_0299918
1492 Ga0496121_0000349
1493 Ga0496121_0006573
1494 Ga0496121_0009274
1495 Ga0496121_0013822
1496 Ga0496121_0023584
1497 Ga0496121_0138727
1498 Ga0496121_0153284
1499 Ga0496122_0000579
1500 Ga0496122_0003895
1501 Ga0496122_0005423
1502 Ga0496122_0007148
1503 Ga0496122_0009664
1504 Ga0496122_0059250
1505 Ga0496122_0141734
1506 Ga0496122_0166595
1507 Ga0496122_0219377
1508 Ga0496123_0000286
1509 Ga0496123_0001402
1510 Ga0496123_0002745
1511 Ga0496123_0002794
1512 Ga0496123_0056695
1513 Ga0496123_0101824
1514 Ga0496123_0106295
1515 Ga0496123_0120378
1516 Ga0496123_0147013
1517 Ga0496124_0001132
1518 Ga0496124_0001730
1519 Ga0496124_0008888
1520 Ga0496124_0049847
1521 Ga0496124_0050093
1522 Ga0496124_0067144
1523 Ga0496124_0132955
1524 Ga0496124_0258622
1525 Ga0496124_0269944
1526 Ga0496124_0278223
1527 Ga0496124_0344554
1528 Ga0496124_0348664
1529 Ga0496125_0004923
1530 Ga0496125_0012034
1531 Ga0496125_0012127
1532 Ga0496125_0016696
1533 Ga0496125_0018428
1534 Ga0496125_0021250
1535 Ga0496125_0038148
1536 Ga0496125_0060040
1537 Ga0496125_0079290
1538 Ga0496125_0107609
1539 Ga0496125_0283364
1540 Ga0496125_0392570
1541 Ga0496126_0000619
1542 Ga0496126_0027985
1543 Ga0496126_0066961
1544 Ga0496126_0115084
1545 Ga0496126_0232662
1546 Ga0496126_0459179
1547 Ga0496126_0633079
1548 Ga0501292_000004
1549 Ga0501294_000758
1550 Ga0501300_000066
1551 Ga0501314_001800
1552 Ga0501032_0085757
1553 Ga0501034_0016790
1554 Ga0501034_0204545
1555 Ga0501037_0745985
1556 Ga0501038_0298223
1557 Ga0501043_0130029
1558 Ga0501043_0195947
1559 Ga0501046_0428815
1560 Ga0501047_0000644
1561 Ga0501048_0134900
1562 Ga0501202_014100
1563 Ga0501222_000505
1564 Ga0501223_000042
1565 Ga0501223_000211
1566 Ga0501223_001716
1567 Ga0501224_000008
1568 Ga0501224_009310
1569 Ga0501227_014569
1570 Ga0501233_008110
1571 Ga0501235_000139
1572 Ga0501249_000549
1573 Ga0501257_003748
1574 Ga0501259_000801
1575 Ga0501261_000010
1576 Ga0501225_0000073
1577 Ga0501225_0000520
1578 Ga0501225_0003808
1579 Ga0501225_0022874
1580 Ga0501234_000985
1581 Ga0501245_000603
1582 Ga0501245_008999
1583 Ga0501241_005459
1584 Ga0501279_000005
1585 Ga0501280_000038
1586 Ga0501282_000165
1587 Ga0501044_0049651
1588 Ga0501044_0892156
1589 Ga0501226_000042
1590 nmdc:mga00v17_29710_c1
1591 nmdc:mga0k408_188043_c1
1592 nmdc:mga0k408_51881_c1
1593 nmdc:mga06z11_111_c1
1594 nmdc:mga04h51_100_c1
1595 nmdc:mga07m45_1083_c1
1596 nmdc:mga07m45_82575_c1
1597 nmdc:mga05p37_228596_c1
1598 Ga0495619_0327712
1599 Ga0500643_000539
1600 Ga0500643_002149
1601 Ga0500643_004524
1602 Ga0500643_010045
1603 Ga0500643_021485
1604 Ga0500643_045312
1605 Ga0500643_068092
1606 Ga0500644_0028883
1607 Ga0500647_0029989
1608 Ga0500651_0002188
1609 Ga0500641_0001555
1610 Ga0500641_0012360
1611 Ga0500650_0191460
1612 Ga0500556_0000074
1613 Ga0500557_017166
1614 Ga0500562_005307
1615 Ga0500562_073645
1616 Ga0500594_0062933
1617 Ga0500595_005345
1618 Ga0500618_005557
1619 Ga0500618_022875
1620 Ga0500642_0000002
1621 Ga0500642_0001441
1622 Ga0500652_092939
1623 Ga0500655_000061
1624 Ga0500559_0001442
1625 Ga0500573_0000015
1626 Ga0500573_0264954
1627 Ga0500616_0003051
1628 Ga0500622_0000901
1629 Ga0500622_0003437
1630 Ga0500622_0016726
1631 Ga0500624_000085
1632 Ga0500624_000125
1633 Ga0500627_0002237
1634 Ga0500636_0013174
1635 Ga0500636_0077521
1636 Ga0500637_0000023
1637 Ga0500570_000268
1638 Ga0500645_003833
1639 Ga0500645_004874
1640 Ga0500661_000138
1641 Ga0466962_0001351
1642 Ga0466962_0046360
1643 2511129570
1644 2512644061
1645 2585263904
1646 2600225765
1647 2643730699
1648 2644040835
1649 2644044647
1650 2644391428
1651 2778123851
1652 2809064830
1653 2809080797
1654 2809085162
1655 2819716433
1656 2879165296
1657 2880521862
1658 2919711333
1659 2928028566
1660 2928528758
1661 2928970312
1662 2984555857
1663 2984566034
1664 2990266488
1665 2993357045
1666 2993695714
1667 8054306873
1668 8057101944

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

15

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9666 50 100
7luy-assembly1.cif.gz_F crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9397 18 223
7luy-assembly1.cif.gz_F crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9302 18 223
7luy-assembly2.cif.gz_E crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9282 18 223
7luy-assembly2.cif.gz_E crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9194 18 223
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9999 51 99 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9916 51 99 3.30.63.10
3tr0A02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9823 51 110 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.98 51 99 3.30.63.10
3tr0A02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9663 51 110 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A1U9Z321-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9639 15 219 GO:0004385
GO:0005524
GO:0005829
AF-A0A0Q8Q189-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9635 11 223 GO:0004385
GO:0005524
GO:0005829
AF-A0A0Q8Q189-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9591 11 223 GO:0004385
GO:0005524
GO:0005829
AF-A0A7V8A964-F1-model_v4 Guanylate kinase 0.9578 18 143 GO:0004385
GO:0005829
AF-A0A6I4TDJ5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9542 7 219 GO:0004385
GO:0005524
GO:0005829

Map