F482869

General Info

Members Datasets Scaffolds Average Seq Length
836 413 1672 130

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10327701|Ga0070709_103277012
Length 127
Sequence MDDKEHYDRGMAMRRKTIGAAHVDRAEANKTPFNAEFQDLITRYLWGIWLRPHFDVRTRRVLVIGTLMALGHWEEFRTHVRAAVVEGGFSADDIKEIILQQTIYCGAPAGNRAFKEAAEVLAEVEKK

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
108 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
109 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
110 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
230 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
233 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
356 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
357 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
375 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
376 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
379 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
380 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
381 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
382 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
383 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
384 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
385 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
388 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
389 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
390 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
391 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
392 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
393 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
394 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
395 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
396 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
397 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
400 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
401 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
402 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
403 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
404 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
405 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
406 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
410 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
411 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
412 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
413 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.89
Nodule 0
Rhizoplane 4.55
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10327701 3300005434 Bacteria 1126
2 JGI25153J46596_10000451 3300003215 Bacteria 26293
3 JGI25405J52794_10007872 3300003911 Bacteria 1976
4 Ga0065704_10370002 3300005289 Bacteria 786
5 Ga0065707_10273120 3300005295 Bacteria 1053
6 Ga0070676_10063060 3300005328 Bacteria 2207
7 Ga0070676_10072506 3300005328 Bacteria 2070
8 Ga0070683_100029275 3300005329 Bacteria 4983
9 Ga0070690_100469329 3300005330 Bacteria 936
10 Ga0070677_10839047 3300005333 Bacteria 527
11 Ga0068869_100032558 3300005334 Bacteria 3675
12 Ga0068869_100331442 3300005334 Unclassified 1237
13 Ga0068869_101647058 3300005334 Bacteria 572
14 Ga0070680_100260155 3300005336 Bacteria 1468
15 Ga0070680_100487337 3300005336 Bacteria 1054
16 Ga0070682_100011037 3300005337 Bacteria 5151
17 Ga0070682_101428115 3300005337 Bacteria 592
18 Ga0068868_100025411 3300005338 Bacteria 4505
19 Ga0068868_100222146 3300005338 Bacteria 1582
20 Ga0068868_100235536 3300005338 Bacteria 1537
21 Ga0070660_100026463 3300005339 Bacteria 4319
22 Ga0070660_100459478 3300005339 Unclassified 1057
23 Ga0070689_100030415 3300005340 Bacteria 4099
24 Ga0070687_100039609 3300005343 Bacteria 2369
25 Ga0070687_100105799 3300005343 Bacteria 1584
26 Ga0070661_100009874 3300005344 Bacteria 6622
27 Ga0070661_100051548 3300005344 Bacteria 3012
28 Ga0070661_100089040 3300005344 Bacteria 2285
29 Ga0070668_100130756 3300005347 Bacteria 2015
30 Ga0070669_100090482 3300005353 Bacteria 2294
31 Ga0070669_100200413 3300005353 Bacteria 1570
32 Ga0070675_100019025 3300005354 Bacteria 5471
33 Ga0070675_100152073 3300005354 Bacteria 1985
34 Ga0070675_101054004 3300005354 Bacteria 747
35 Ga0070674_100003201 3300005356 Bacteria 9130
36 Ga0070674_100399189 3300005356 Unclassified 1123
37 Ga0070674_100573970 3300005356 Bacteria 949
38 Ga0070673_100035671 3300005364 Bacteria 3773
39 Ga0070673_100037800 3300005364 Bacteria 3681
40 Ga0070688_100025926 3300005365 Bacteria 3476
41 Ga0070688_100400231 3300005365 Bacteria 1016
42 Ga0070659_100137189 3300005366 Bacteria 1989
43 Ga0070659_100521084 3300005366 Bacteria 1015
44 Ga0070667_100192412 3300005367 Bacteria 1808
45 Ga0070709_10029166 3300005434 Bacteria 3298
46 Ga0070714_100074204 3300005435 Bacteria 2948
47 Ga0070714_100076086 3300005435 Bacteria 2913
48 Ga0070714_100132154 3300005435 Bacteria 2231
49 Ga0070714_100295297 3300005435 Bacteria 1509
50 Ga0070713_100007886 3300005436 Bacteria 7512
51 Ga0070713_100026424 3300005436 Bacteria 4557
52 Ga0070713_100089341 3300005436 Bacteria 2646
53 Ga0070713_100957505 3300005436 Bacteria 825
54 Ga0070710_10013050 3300005437 Bacteria 4146
55 Ga0070710_10027762 3300005437 Bacteria 3022
56 Ga0070710_10078287 3300005437 Bacteria 1923
57 Ga0070701_10011609 3300005438 Bacteria 3947
58 Ga0070711_100018380 3300005439 Bacteria 4462
59 Ga0070711_100038597 3300005439 Bacteria 3212
60 Ga0070711_100049781 3300005439 Unclassified 2870
61 Ga0070711_100089912 3300005439 Bacteria 2210
62 Ga0070711_100299902 3300005439 Bacteria 1278
63 Ga0070711_101202017 3300005439 Bacteria 656
64 Ga0070700_100133228 3300005441 Bacteria 1680
65 Ga0070700_101015071 3300005441 Bacteria 683
66 Ga0070694_100593897 3300005444 Bacteria 891
67 Ga0070663_100012049 3300005455 Bacteria 5455
68 Ga0070663_100014764 3300005455 Bacteria 5021
69 Ga0070663_100145200 3300005455 Bacteria 1815
70 Ga0070663_100910325 3300005455 Bacteria 760
71 Ga0070663_100934877 3300005455 Bacteria 751
72 Ga0070678_100033812 3300005456 Bacteria 3554
73 Ga0070678_100186936 3300005456 Bacteria 1700
74 Ga0070678_100303482 3300005456 Unclassified 1357
75 Ga0070662_100096540 3300005457 Bacteria 2229
76 Ga0070662_100097031 3300005457 Bacteria 2224
77 Ga0070662_101078214 3300005457 Bacteria 689
78 Ga0070681_10058962 3300005458 Bacteria 3818
79 Ga0070681_10150870 3300005458 Bacteria 2250
80 Ga0070681_10350963 3300005458 Bacteria 1385
81 Ga0068867_100013667 3300005459 Bacteria 5749
82 Ga0068867_100505160 3300005459 Bacteria 1040
83 Ga0068867_100714373 3300005459 Bacteria 886
84 Ga0070685_10010366 3300005466 Bacteria 4842
85 Ga0070707_100520934 3300005468 Bacteria 1151
86 Ga0070679_100078960 3300005530 Bacteria 3280
87 Ga0070679_100296231 3300005530 Bacteria 1569
88 Ga0068853_100056680 3300005539 Bacteria 3380
89 Ga0068853_100494417 3300005539 Bacteria 1154
90 Ga0070672_100038899 3300005543 Bacteria 3639
91 Ga0070672_100287197 3300005543 Bacteria 1392
92 Ga0070686_100024813 3300005544 Bacteria 3597
93 Ga0070686_100053923 3300005544 Bacteria 2570
94 Ga0070686_100068645 3300005544 Bacteria 2313
95 Ga0070695_100109057 3300005545 Bacteria 1876
96 Ga0070695_101020650 3300005545 Unclassified 674
97 Ga0070695_101066184 3300005545 Bacteria 660
98 Ga0070696_100027221 3300005546 Bacteria 3893
99 Ga0070693_100105864 3300005547 Bacteria 1721
100 Ga0070665_100073279 3300005548 Bacteria 3431
101 Ga0070665_100175067 3300005548 Bacteria 2146
102 Ga0070665_100292736 3300005548 Bacteria 1630
103 Ga0070665_100344932 3300005548 Bacteria 1494
104 Ga0070665_100861752 3300005548 Bacteria 919
105 Ga0070704_100040056 3300005549 Bacteria 3222
106 Ga0070704_100316065 3300005549 Bacteria 1307
107 Ga0070704_101765706 3300005549 Unclassified 572
108 Ga0068855_100027822 3300005563 Bacteria 6764
109 Ga0068855_100786543 3300005563 Bacteria 1012
110 Ga0070664_100230150 3300005564 Bacteria 1661
111 Ga0070664_100278918 3300005564 Bacteria 1507
112 Ga0068857_100677577 3300005577 Unclassified 978
113 Ga0068854_100245417 3300005578 Bacteria 1428
114 Ga0068856_100465629 3300005614 Bacteria 1285
115 Ga0068856_100886150 3300005614 Bacteria 911
116 Ga0070702_100076741 3300005615 Bacteria 1989
117 Ga0068852_100085350 3300005616 Bacteria 2812
118 Ga0068852_100460973 3300005616 Bacteria 1260
119 Ga0068852_101532522 3300005616 Bacteria 689
120 Ga0068864_100225334 3300005618 Bacteria 1731
121 Ga0068864_100266765 3300005618 Bacteria 1594
122 Ga0068864_100404667 3300005618 Bacteria 1297
123 Ga0068866_10004157 3300005718 Bacteria 5935
124 Ga0068866_10069372 3300005718 Bacteria 1857
125 Ga0068861_100066650 3300005719 Bacteria 2776
126 Ga0068861_100403812 3300005719 Bacteria 1213
127 Ga0068861_102025080 3300005719 Bacteria 575
128 Ga0068863_100243086 3300005841 Bacteria 1737
129 Ga0068863_101150102 3300005841 Bacteria 781
130 Ga0068863_101684944 3300005841 Bacteria 643
131 Ga0068858_100076394 3300005842 Bacteria 3110
132 Ga0068858_100367882 3300005842 Unclassified 1378
133 Ga0068860_100030270 3300005843 Bacteria 5206
134 Ga0068860_100059506 3300005843 Bacteria 3631
135 Ga0068860_100313102 3300005843 Bacteria 1539
136 Ga0068862_100053648 3300005844 Bacteria 3451
137 Ga0068862_100432624 3300005844 Bacteria 1237
138 Ga0081455_10012596 3300005937 Bacteria 8429
139 Ga0081540_1023030 3300005983 Bacteria 3658
140 Ga0081539_10018047 3300005985 Bacteria 4916
141 Ga0070717_10029821 3300006028 Bacteria 4381
142 Ga0070717_10152409 3300006028 Bacteria 2000
143 Ga0070717_10525181 3300006028 Bacteria 1071
144 Ga0075365_10021584 3300006038 Bacteria 4019
145 Ga0075365_10218865 3300006038 Bacteria 1336
146 Ga0075365_10473465 3300006038 Bacteria 885
147 Ga0075365_10674578 3300006038 Bacteria 730
148 Ga0075368_10072008 3300006042 Bacteria 1397
149 Ga0075368_10412211 3300006042 Bacteria 594
150 Ga0075363_100588758 3300006048 Bacteria 666
151 Ga0075364_10042157 3300006051 Bacteria 2965
152 Ga0075364_10687127 3300006051 Bacteria 698
153 Ga0070715_10269870 3300006163 Bacteria 897
154 Ga0070716_100099448 3300006173 Bacteria 1780
155 Ga0070716_100228906 3300006173 Bacteria 1254
156 Ga0070712_100337683 3300006175 Unclassified 1229
157 Ga0070712_100351505 3300006175 Bacteria 1206
158 Ga0070712_101341428 3300006175 Bacteria 624
159 Ga0075362_10057247 3300006177 Bacteria 1756
160 Ga0075362_10116731 3300006177 Bacteria 1260
161 Ga0075362_10458057 3300006177 Bacteria 648
162 Ga0075367_10032558 3300006178 Bacteria 3001
163 Ga0075367_10120213 3300006178 Bacteria 1618
164 Ga0075367_10551856 3300006178 Bacteria 732
165 Ga0075369_10076870 3300006186 Bacteria 1476
166 Ga0075427_10003584 3300006194 Bacteria 2152
167 Ga0075366_10002295 3300006195 Bacteria 9764
168 Ga0075366_10003023 3300006195 Bacteria 8775
169 Ga0075366_10350934 3300006195 Bacteria 905
170 Ga0097621_100040858 3300006237 Bacteria 3730
171 Ga0097621_100711941 3300006237 Bacteria 925
172 Ga0075370_10036981 3300006353 Bacteria 2744
173 Ga0075370_10125298 3300006353 Bacteria 1497
174 Ga0075370_10235235 3300006353 Bacteria 1084
175 Ga0075370_10615575 3300006353 Bacteria 658
176 Ga0068871_100001492 3300006358 Bacteria 15689
177 Ga0075428_100006177 3300006844 Bacteria 13329
178 Ga0075428_100113185 3300006844 Bacteria 2956
179 Ga0075428_100214336 3300006844 Bacteria 2080
180 Ga0075428_100232165 3300006844 Bacteria 1991
181 Ga0075428_100256417 3300006844 Bacteria 1884
182 Ga0075430_100005373 3300006846 Bacteria 10813
183 Ga0075430_100183828 3300006846 Bacteria 1738
184 Ga0075430_100911812 3300006846 Bacteria 724
185 Ga0075431_100000004 3300006847 Bacteria 106006
186 Ga0075431_100031970 3300006847 Bacteria 5422
187 Ga0075431_101245263 3300006847 Bacteria 706
188 Ga0075433_10000774 3300006852 Bacteria 21997
189 Ga0075433_10319780 3300006852 Bacteria 1373
190 Ga0075434_100003565 3300006871 Bacteria 13904
191 Ga0075434_100035766 3300006871 Bacteria 4910
192 Ga0075434_100160330 3300006871 Bacteria 2269
193 Ga0075434_100500751 3300006871 Bacteria 1236
194 Ga0075434_100785992 3300006871 Bacteria 968
195 Ga0075429_100002027 3300006880 Bacteria 16859
196 Ga0075429_100022187 3300006880 Bacteria 5507
197 Ga0075429_100038167 3300006880 Bacteria 4182
198 Ga0068865_100168080 3300006881 Bacteria 1679
199 Ga0075436_100008147 3300006914 Bacteria 7173
200 Ga0075436_100055764 3300006914 Bacteria 2729
201 Ga0075435_100001109 3300007076 Bacteria 17153
202 Ga0075435_100088821 3300007076 Bacteria 2548
203 Ga0075435_100120453 3300007076 Bacteria 2189
204 Ga0099795_10029945 3300007788 Bacteria 1864
205 Ga0105251_10019741 3300009011 Bacteria 3552
206 Ga0105251_10061989 3300009011 Bacteria 1757
207 Ga0111539_10000264 3300009094 Bacteria 62353
208 Ga0111539_10011144 3300009094 Bacteria 11310
209 Ga0111539_10390373 3300009094 Bacteria 1621
210 Ga0111539_11073375 3300009094 Bacteria 936
211 Ga0105245_10032287 3300009098 Bacteria 4636
212 Ga0105245_10221826 3300009098 Bacteria 1824
213 Ga0105245_10631526 3300009098 Bacteria 1100
214 Ga0105245_10638737 3300009098 Bacteria 1094
215 Ga0105245_12055649 3300009098 Bacteria 625
216 Ga0105247_10015467 3300009101 Bacteria 4571
217 Ga0105247_10046563 3300009101 Bacteria 2662
218 Ga0105247_10400808 3300009101 Unclassified 977
219 Ga0114129_10000582 3300009147 Bacteria 45047
220 Ga0114129_10004796 3300009147 Bacteria 19116
221 Ga0114129_10128813 3300009147 Bacteria 3478
222 Ga0114129_11354723 3300009147 Bacteria 880
223 Ga0105243_10348027 3300009148 Bacteria 1360
224 Ga0105243_11768702 3300009148 Bacteria 648
225 Ga0105241_10069786 3300009174 Bacteria 2725
226 Ga0105241_10147833 3300009174 Bacteria 1919
227 Ga0105242_10039140 3300009176 Bacteria 3815
228 Ga0105242_10046930 3300009176 Bacteria 3506
229 Ga0105242_10167634 3300009176 Bacteria 1927
230 Ga0105248_10020670 3300009177 Bacteria 7296
231 Ga0105248_12308692 3300009177 Bacteria 612
232 Ga0105237_10021242 3300009545 Bacteria 6677
233 Ga0105237_10036012 3300009545 Bacteria 5007
234 Ga0105238_10031430 3300009551 Bacteria 5405
235 Ga0105238_10303618 3300009551 Bacteria 1580
236 Ga0105238_10850292 3300009551 Bacteria 929
237 Ga0105249_10044203 3300009553 Bacteria 4051
238 Ga0105249_10612839 3300009553 Bacteria 1144
239 Ga0105249_10730549 3300009553 Bacteria 1051
240 Ga0105249_12326818 3300009553 Unclassified 608
241 Ga0099796_10080966 3300010159 Bacteria 1191
242 Ga0105239_10066565 3300010375 Bacteria 3958
243 Ga0105239_10079780 3300010375 Bacteria 3601
244 Ga0105239_11163935 3300010375 Unclassified 888
245 Ga0105246_10083438 3300011119 Bacteria 2283
246 Ga0105246_10398593 3300011119 Bacteria 1142
247 Ga0105246_11598908 3300011119 Bacteria 616
248 Ga0105246_11701648 3300011119 Unclassified 599
249 Ga0157336_1000965 3300012477 Unclassified 1410
250 Ga0157328_1004969 3300012478 Unclassified 759
251 Ga0157345_1014532 3300012498 Bacteria 736
252 Ga0157339_1015863 3300012505 Unclassified 748
253 Ga0157370_10089522 3300013104 Bacteria 2891
254 Ga0157370_10806582 3300013104 Bacteria 854
255 Ga0157369_10362944 3300013105 Bacteria 1504
256 Ga0157369_11703205 3300013105 Unclassified 641
257 Ga0157369_12431659 3300013105 Bacteria 530
258 Ga0157374_10024335 3300013296 Bacteria 5428
259 Ga0157374_10160259 3300013296 Bacteria 2191
260 Ga0157374_11819032 3300013296 Bacteria 634
261 Ga0157378_10132346 3300013297 Bacteria 2310
262 Ga0157378_10154661 3300013297 Bacteria 2139
263 Ga0157378_12123902 3300013297 Unclassified 612
264 Ga0163162_10141527 3300013306 Bacteria 2519
265 Ga0157375_10033970 3300013308 Bacteria 4854
266 Ga0157375_10543952 3300013308 Bacteria 1323
267 Ga0157375_11457009 3300013308 Bacteria 807
268 Ga0157375_12330599 3300013308 Unclassified 638
269 Ga0163163_10081659 3300014325 Bacteria 3234
270 Ga0157380_10021822 3300014326 Bacteria 4809
271 Ga0157380_10216463 3300014326 Bacteria 1711
272 Ga0157380_10250428 3300014326 Bacteria 1603
273 Ga0157379_10021726 3300014968 Bacteria 5684
274 Ga0157379_10027895 3300014968 Bacteria 5025
275 Ga0163161_10144711 3300017792 Bacteria 1802
276 Ga0163161_10238124 3300017792 Bacteria 1414
277 Ga0163161_10430325 3300017792 Bacteria 1063
278 Ga0213875_10000825 3300021388 Bacteria 23073
279 Ga0209758_1000128 3300025297 Bacteria 186771
280 Ga0209758_1014286 3300025297 Bacteria 4238
281 Ga0207656_10643616 3300025321 Bacteria 542
282 Ga0207713_1059307 3300025735 Bacteria 1469
283 Ga0207692_10005833 3300025898 Bacteria 4964
284 Ga0207692_10033169 3300025898 Bacteria 2488
285 Ga0207692_10169274 3300025898 Bacteria 1265
286 Ga0207710_10004823 3300025900 Bacteria 5854
287 Ga0207710_10011513 3300025900 Bacteria 3722
288 Ga0207710_10011719 3300025900 Bacteria 3687
289 Ga0207688_10024073 3300025901 Bacteria 3338
290 Ga0207680_10113138 3300025903 Bacteria 1764
291 Ga0207680_10363699 3300025903 Bacteria 1018
292 Ga0207680_10511954 3300025903 Bacteria 855
293 Ga0207685_10000610 3300025905 Bacteria 6256
294 Ga0207685_10019007 3300025905 Bacteria 2256
295 Ga0207685_10170028 3300025905 Bacteria 1002
296 Ga0207699_10000479 3300025906 Bacteria 20298
297 Ga0207699_10037149 3300025906 Unclassified 2782
298 Ga0207699_10055215 3300025906 Bacteria 2363
299 Ga0207645_10031488 3300025907 Bacteria 3412
300 Ga0207645_10033882 3300025907 Bacteria 3282
301 Ga0207707_10220397 3300025912 Bacteria 1651
302 Ga0207695_10284500 3300025913 Bacteria 1547
303 Ga0207671_10035535 3300025914 Bacteria 3697
304 Ga0207671_10340224 3300025914 Bacteria 1189
305 Ga0207693_10023634 3300025915 Bacteria 4878
306 Ga0207693_10026141 3300025915 Bacteria 4622
307 Ga0207693_10165455 3300025915 Bacteria 1741
308 Ga0207693_10311268 3300025915 Unclassified 1233
309 Ga0207663_10004450 3300025916 Bacteria 6968
310 Ga0207663_10246389 3300025916 Bacteria 1313
311 Ga0207663_11341799 3300025916 Bacteria 576
312 Ga0207660_10025342 3300025917 Bacteria 4024
313 Ga0207660_10057343 3300025917 Bacteria 2790
314 Ga0207660_10352131 3300025917 Bacteria 1180
315 Ga0207660_10884729 3300025917 Bacteria 729
316 Ga0207662_10725007 3300025918 Bacteria 698
317 Ga0207662_11148823 3300025918 Bacteria 552
318 Ga0207657_10044435 3300025919 Bacteria 3905
319 Ga0207657_10239449 3300025919 Unclassified 1449
320 Ga0207649_10051471 3300025920 Bacteria 2550
321 Ga0207649_10291893 3300025920 Bacteria 1189
322 Ga0207652_10200563 3300025921 Bacteria 1795
323 Ga0207652_10332634 3300025921 Bacteria 1371
324 Ga0207681_10143814 3300025923 Bacteria 1779
325 Ga0207694_10082657 3300025924 Bacteria 2525
326 Ga0207694_10236043 3300025924 Bacteria 1494
327 Ga0207694_11189380 3300025924 Bacteria 645
328 Ga0207650_10857904 3300025925 Unclassified 770
329 Ga0207659_10074978 3300025926 Bacteria 2481
330 Ga0207659_10166085 3300025926 Bacteria 1737
331 Ga0207687_10005103 3300025927 Bacteria 8700
332 Ga0207687_10022385 3300025927 Bacteria 4205
333 Ga0207687_10319954 3300025927 Bacteria 1255
334 Ga0207687_10886031 3300025927 Bacteria 763
335 Ga0207700_10000167 3300025928 Bacteria 39027
336 Ga0207700_10075818 3300025928 Unclassified 2607
337 Ga0207700_10090572 3300025928 Bacteria 2414
338 Ga0207700_10471257 3300025928 Bacteria 1109
339 Ga0207664_10051748 3300025929 Bacteria 3244
340 Ga0207664_10208982 3300025929 Bacteria 1688
341 Ga0207664_10913931 3300025929 Bacteria 788
342 Ga0207664_11375751 3300025929 Bacteria 626
343 Ga0207644_11263977 3300025931 Bacteria 620
344 Ga0207706_10027067 3300025933 Bacteria 5128
345 Ga0207706_10028462 3300025933 Bacteria 4991
346 Ga0207686_10028534 3300025934 Bacteria 3282
347 Ga0207686_10036640 3300025934 Bacteria 2954
348 Ga0207670_10014169 3300025936 Bacteria 4724
349 Ga0207670_10194738 3300025936 Bacteria 1536
350 Ga0207669_10050253 3300025937 Bacteria 2491
351 Ga0207669_10715179 3300025937 Bacteria 824
352 Ga0207669_10851739 3300025937 Bacteria 759
353 Ga0207704_10209427 3300025938 Bacteria 1433
354 Ga0207704_10323167 3300025938 Bacteria 1191
355 Ga0207704_10430102 3300025938 Bacteria 1049
356 Ga0207665_10000417 3300025939 Bacteria 29333
357 Ga0207665_10032973 3300025939 Bacteria 3431
358 Ga0207665_10165839 3300025939 Bacteria 1592
359 Ga0207665_10473230 3300025939 Bacteria 964
360 Ga0207691_10088868 3300025940 Bacteria 2771
361 Ga0207711_10010579 3300025941 Bacteria 7669
362 Ga0207711_10122888 3300025941 Bacteria 2319
363 Ga0207711_10146157 3300025941 Bacteria 2130
364 Ga0207711_10543157 3300025941 Bacteria 1084
365 Ga0207689_10016845 3300025942 Bacteria 6184
366 Ga0207689_10100764 3300025942 Bacteria 2373
367 Ga0207661_10891181 3300025944 Bacteria 819
368 Ga0207679_10224999 3300025945 Bacteria 1580
369 Ga0207679_10577440 3300025945 Bacteria 1011
370 Ga0207667_10036257 3300025949 Bacteria 5288
371 Ga0207667_10547542 3300025949 Bacteria 1171
372 Ga0207651_10088242 3300025960 Bacteria 2260
373 Ga0207651_10871704 3300025960 Bacteria 801
374 Ga0207712_10118829 3300025961 Bacteria 1996
375 Ga0207712_10125669 3300025961 Bacteria 1947
376 Ga0207668_10499984 3300025972 Bacteria 1046
377 Ga0207640_10119704 3300025981 Bacteria 1883
378 Ga0207640_10224699 3300025981 Bacteria 1440
379 Ga0207658_10473972 3300025986 Bacteria 1111
380 Ga0207658_11634945 3300025986 Bacteria 589
381 Ga0207677_10007963 3300026023 Bacteria 5892
382 Ga0207677_10155452 3300026023 Bacteria 1770
383 Ga0207703_10007684 3300026035 Bacteria 8544
384 Ga0207703_10023404 3300026035 Bacteria 4851
385 Ga0207703_10241095 3300026035 Bacteria 1625
386 Ga0207639_10281648 3300026041 Bacteria 1462
387 Ga0207678_10039347 3300026067 Bacteria 4104
388 Ga0207678_10045458 3300026067 Bacteria 3797
389 Ga0207678_10086531 3300026067 Bacteria 2678
390 Ga0207678_10385109 3300026067 Bacteria 1212
391 Ga0207708_10173543 3300026075 Bacteria 1708
392 Ga0207708_10303548 3300026075 Bacteria 1299
393 Ga0207702_11369154 3300026078 Bacteria 701
394 Ga0207641_10150895 3300026088 Bacteria 2104
395 Ga0207648_10022005 3300026089 Bacteria 5727
396 Ga0207648_10131808 3300026089 Bacteria 2200
397 Ga0207676_10128089 3300026095 Bacteria 2153
398 Ga0207676_10797615 3300026095 Bacteria 921
399 Ga0207674_10189101 3300026116 Bacteria 2009
400 Ga0207674_11613978 3300026116 Bacteria 617
401 Ga0207675_100014520 3300026118 Bacteria 7341
402 Ga0207675_100082317 3300026118 Bacteria 3018
403 Ga0207675_100094185 3300026118 Bacteria 2817
404 Ga0207675_100135582 3300026118 Bacteria 2336
405 Ga0207683_10006710 3300026121 Bacteria 9849
406 Ga0207683_10025780 3300026121 Bacteria 5072
407 Ga0207698_10320876 3300026142 Bacteria 1451
408 Ga0207698_11180241 3300026142 Bacteria 779
409 Ga0207698_11931639 3300026142 Bacteria 605
410 Ga0209179_1009340 3300027512 Bacteria 1679
411 Ga0209813_10430212 3300027866 Bacteria 537
412 Ga0207428_10000077 3300027907 Bacteria 136572
413 Ga0207428_10000124 3300027907 Bacteria 105795
414 Ga0268266_10007527 3300028379 Bacteria 9811
415 Ga0268266_10160370 3300028379 Bacteria 2034
416 Ga0268266_10286833 3300028379 Bacteria 1532
417 Ga0268266_11594158 3300028379 Bacteria 628
418 Ga0268265_10086882 3300028380 Bacteria 2486
419 Ga0268264_10032424 3300028381 Bacteria 4286
420 Ga0268264_10205407 3300028381 Bacteria 1805
421 Ga0268264_10506055 3300028381 Unclassified 1179
422 Ga0265334_10104359 3300028573 Bacteria 1023
423 Ga0307515_10052509 3300028794 Bacteria 6044
424 Ga0265340_10096399 3300031247 Bacteria 1378
425 Ga0265314_10123146 3300031711 Bacteria 1629
426 Ga0265342_10019559 3300031712 Bacteria 4362
427 Ga0307405_10633571 3300031731 Bacteria 877
428 Ga0373930_0005686 3300034816 Bacteria 2081
429 Ga0373950_0047525 3300034818 Unclassified 836
430 Ga0373958_0000861 3300034819 Bacteria 3900
431 Ga0373928_0001128 3300035084 Bacteria 5279
432 Ga0373929_0053940 3300035085 Unclassified 925
433 Ga0373934_0029232 3300035086 Bacteria 2151
434 Ga0373934_0165140 3300035086 Bacteria 908
435 Ga0373944_0022380 3300035089 Bacteria 1836
436 Ga0373949_0011856 3300035090 Bacteria 1924
437 Ga0373951_0018544 3300035091 Bacteria 1581
438 Ga0373952_0008869 3300035092 Bacteria 1914
439 Ga0373952_0059208 3300035092 Bacteria 932
440 Ga0373952_0149213 3300035092 Bacteria 655
441 Ga0373923_0222524 3300035111 Bacteria 877
442 Ga0373932_0010998 3300035112 Bacteria 2202
443 Ga0373936_0002621 3300035113 Bacteria 6732
444 Ga0373936_0286327 3300035113 Bacteria 741
445 Ga0373936_0333117 3300035113 Bacteria 689
446 Ga0373936_0557683 3300035113 Bacteria 536
447 Ga0373939_0019016 3300035114 Bacteria 1848
448 Ga0373939_0042748 3300035114 Bacteria 1372
449 Ga0373941_0010368 3300035115 Bacteria 2379
450 Ga0373941_0044484 3300035115 Bacteria 1386
451 Ga0373945_0021108 3300035116 Bacteria 2235
452 Ga0373953_0000535 3300035117 Bacteria 10528
453 Ga0373953_0021944 3300035117 Bacteria 2401
454 Ga0373954_0016324 3300035118 Bacteria 3322
455 Ga0373954_0066251 3300035118 Bacteria 1710
456 Ga0373956_0004566 3300035119 Bacteria 5528
457 Ga0373957_0001349 3300035120 Bacteria 6590
458 Ga0373960_0012071 3300035121 Bacteria 2140
459 Ga0373960_0113785 3300035121 Bacteria 891
460 Ga0373943_0031720 3300035170 Bacteria 2508
461 Ga0373943_0067486 3300035170 Bacteria 1804
462 Ga0373943_0174056 3300035170 Bacteria 1179
463 Ga0373943_0481675 3300035170 Bacteria 723
464 Ga0373946_0000383 3300035171 Bacteria 14419
465 Ga0373946_0019971 3300035171 Bacteria 2585
466 Ga0373946_0029361 3300035171 Bacteria 2188
467 Ga0373955_0000189 3300035172 Bacteria 25440
468 Ga0373955_0137649 3300035172 Bacteria 1429
469 Ga0373942_0098171 3300035207 Unclassified 891
470 Ga0373961_0025429 3300035241 Bacteria 1609
471 Ga0373962_0001215 3300035242 Bacteria 6025
472 Ga0373962_0053965 3300035242 Bacteria 1164
473 Ga0373924_0000144 3300035410 Bacteria 20890
474 Ga0373931_0002333 3300035691 Bacteria 8383
475 Ga0373931_0071186 3300035691 Bacteria 1899
476 Ga0373935_0000012 3300035692 Bacteria 81961
477 Ga0373935_0006395 3300035692 Bacteria 7028
478 Ga0373935_0025002 3300035692 Bacteria 3680
479 Ga0373935_0844415 3300035692 Unclassified 677
480 Ga0373927_0003657 3300035695 Bacteria 10959
481 Ga0373927_0063769 3300035695 Bacteria 2383
482 Ga0373927_0074275 3300035695 Bacteria 2201
483 Ga0373933_0004023 3300035724 Bacteria 8105
484 Ga0373933_0009866 3300035724 Bacteria 5228
485 Ga0373947_0000380 3300035725 Bacteria 25117
486 Ga0373947_0004569 3300035725 Bacteria 8119
487 Ga0373947_0029013 3300035725 Bacteria 3246
488 Ga0373947_0072299 3300035725 Bacteria 2117
489 Ga0373937_0000054 3300036401 Bacteria 102542
490 Ga0373937_0048356 3300036401 Bacteria 3893
491 Ga0373925_0000018 3300037068 Bacteria 174213
492 Ga0373925_0005307 3300037068 Bacteria 9621
493 Ga0373925_0016398 3300037068 Bacteria 5367
494 Ga0373925_0049962 3300037068 Bacteria 3118
495 Ga0436364_0196951 3300037853 Bacteria 1423
496 Ga0436364_0475448 3300037853 Bacteria 15369
497 Ga0436365_1150569 3300039437 Bacteria 944
498 Ga0436365_1511081 3300039437 Bacteria 849
499 Ga0451855_0380325 3300041511 Bacteria 659
500 Ga0439456_110124 3300042013 Bacteria 627
501 Ga0439446_0217345 3300042156 Unclassified 650
502 Ga0439458_0078051 3300042157 Bacteria 842
503 Ga0450909_026430 3300042185 Bacteria 875
504 Ga0439459_0191382 3300042438 Bacteria 554
505 Ga0466957_0382834 3300044842 Bacteria 960
506 Ga0466958_0127470 3300045836 Bacteria 1596
507 Ga0466967_0117783 3300045976 Bacteria 2449
508 Ga0495592_0000001 3300046454 Bacteria 305819
509 Ga0495603_0034913 3300046455 Bacteria 3022
510 Ga0495603_0048520 3300046455 Bacteria 2528
511 Ga0495629_0001166 3300046459 Bacteria 20737
512 Ga0495629_0028266 3300046459 Bacteria 3981
513 Ga0495629_0272527 3300046459 Bacteria 1162
514 Ga0495638_0037126 3300046460 Bacteria 3100
515 Ga0495638_0045055 3300046460 Bacteria 2776
516 Ga0495638_0162286 3300046460 Bacteria 1288
517 Ga0495641_0022876 3300046461 Bacteria 3118
518 Ga0495641_0328664 3300046461 Bacteria 690
519 Ga0495651_0000493 3300046462 Bacteria 30523
520 Ga0495651_0002120 3300046462 Bacteria 15325
521 Ga0495653_0000015 3300046463 Bacteria 213697
522 Ga0495653_0005251 3300046463 Bacteria 10537
523 Ga0495580_0102712 3300046472 Bacteria 1987
524 Ga0495582_0011296 3300046473 Bacteria 4920
525 Ga0495582_0072185 3300046473 Bacteria 1910
526 Ga0495582_0122548 3300046473 Bacteria 1465
527 Ga0495639_0052152 3300046475 Bacteria 1861
528 Ga0495639_0268519 3300046475 Unclassified 846
529 Ga0495662_0000432 3300046476 Bacteria 18771
530 Ga0495664_0000001 3300046477 Bacteria 757730
531 Ga0495664_0421630 3300046477 Bacteria 800
532 Ga0495594_0030069 3300046499 Bacteria 2937
533 Ga0495594_0106464 3300046499 Bacteria 1579
534 Ga0495583_0165179 3300046506 Bacteria 912
535 Ga0495608_0000050 3300046511 Bacteria 96603
536 Ga0495610_0013825 3300046512 Bacteria 4773
537 Ga0495616_0037167 3300046513 Bacteria 2507
538 Ga0495618_0000045 3300046514 Bacteria 94654
539 Ga0495618_0007610 3300046514 Bacteria 6556
540 Ga0495628_0000003 3300046516 Bacteria 470339
541 Ga0495628_0005129 3300046516 Bacteria 11514
542 Ga0495630_0001134 3300046517 Bacteria 18379
543 Ga0495631_0050100 3300046518 Bacteria 1827
544 Ga0495643_0345999 3300046522 Bacteria 667
545 Ga0495648_0288689 3300046524 Bacteria 774
546 Ga0495666_0215187 3300046526 Unclassified 881
547 Ga0495666_0232527 3300046526 Bacteria 842
548 Ga0495652_0000001 3300046529 Bacteria 1045081
549 Ga0495665_0090647 3300046531 Bacteria 1606
550 Ga0495665_0230827 3300046531 Bacteria 955
551 Ga0495640_0000006 3300046533 Bacteria 285419
552 Ga0495640_0009899 3300046533 Bacteria 7396
553 Ga0495586_0157853 3300046535 Bacteria 1278
554 Ga0495587_0000028 3300046536 Bacteria 138663
555 Ga0495587_0000335 3300046536 Bacteria 33563
556 Ga0495597_0236172 3300046542 Bacteria 722
557 Ga0495645_0000004 3300046543 Bacteria 532661
558 Ga0495645_0097342 3300046543 Bacteria 2095
559 Ga0495622_0020809 3300046557 Bacteria 3054
560 Ga0495667_0000001 3300046559 Bacteria 834831
561 Ga0495667_0004928 3300046559 Bacteria 9026
562 Ga0495668_0010955 3300046616 Bacteria 5459
563 Ga0495634_0000751 3300046642 Bacteria 31392
564 Ga0495625_0032385 3300046660 Bacteria 3876
565 Ga0495635_0000007 3300046663 Bacteria 278786
566 Ga0495635_0338244 3300046663 Bacteria 1005
567 Ga0495659_0254943 3300046664 Bacteria 732
568 Ga0495661_0022589 3300046665 Bacteria 4092
569 Ga0495588_0017548 3300046674 Bacteria 3479
570 Ga0495657_0000136 3300046675 Bacteria 65707
571 Ga0495657_0000836 3300046675 Bacteria 27235
572 Ga0495599_0000002 3300046678 Bacteria 348168
573 Ga0495599_0002782 3300046678 Bacteria 10193
574 Ga0495623_0000052 3300046679 Bacteria 71268
575 Ga0495623_0001006 3300046679 Bacteria 19041
576 Ga0495646_0000036 3300046680 Bacteria 81182
577 Ga0495646_0000229 3300046680 Bacteria 27971
578 Ga0495647_0005778 3300046681 Bacteria 4068
579 Ga0495647_0011817 3300046681 Bacteria 2995
580 Ga0495658_0000591 3300046683 Bacteria 19855
581 Ga0495658_0038218 3300046683 Bacteria 2657
582 Ga0495658_0459492 3300046683 Bacteria 814
583 Ga0495669_0022210 3300046684 Bacteria 2756
584 Ga0495613_0056311 3300046689 Bacteria 2887
585 Ga0495613_0096443 3300046689 Bacteria 2138
586 Ga0495613_0269187 3300046689 Bacteria 1185
587 Ga0495624_0023770 3300046690 Bacteria 4039
588 Ga0495624_0327935 3300046690 Bacteria 921
589 Ga0495670_0630271 3300046691 Bacteria 584
590 Ga0495600_0000037 3300046809 Bacteria 78434
591 Ga0495600_0004219 3300046809 Bacteria 8582
592 Ga0495581_0181419 3300047315 Bacteria 1231
593 Ga0495581_0771465 3300047315 Bacteria 552
594 Ga0495604_0000594 3300047317 Bacteria 31291
595 Ga0495604_0002636 3300047317 Bacteria 14401
596 Ga0495674_0000001 3300047319 Bacteria 778665
597 Ga0495674_0039286 3300047319 Bacteria 4243
598 Ga0495676_0096671 3300047321 Bacteria 2195
599 Ga0495680_0000705 3300047322 Bacteria 37488
600 Ga0495680_0009600 3300047322 Bacteria 8690
601 Ga0495680_0013693 3300047322 Bacteria 7062
602 Ga0495675_0000049 3300047444 Bacteria 80913
603 Ga0495675_0000139 3300047444 Bacteria 50643
604 Ga0495677_0098428 3300047445 Bacteria 1106
605 Ga0495684_0000046 3300047471 Bacteria 92658
606 Ga0495684_0015436 3300047471 Bacteria 5877
607 Ga0495684_0098991 3300047471 Bacteria 2205
608 Ga0495686_0245886 3300047472 Bacteria 1007
609 Ga0495593_0000276 3300047673 Bacteria 27921
610 Ga0495593_0005865 3300047673 Bacteria 7239
611 Ga0495593_0150616 3300047673 Bacteria 1176
612 Ga0495602_0000102 3300048088 Bacteria 81094
613 Ga0495602_0000310 3300048088 Bacteria 45025
614 Ga0496100_0019283 3300048903 Bacteria 4065
615 Ga0496100_0374296 3300048903 Bacteria 1080
616 Ga0496101_0017266 3300048904 Bacteria 4893
617 Ga0496101_0035437 3300048904 Bacteria 3529
618 Ga0496102_0063554 3300048905 Bacteria 3380
619 Ga0496102_0224366 3300048905 Bacteria 1771
620 Ga0496102_0790152 3300048905 Bacteria 871
621 Ga0496102_1680731 3300048905 Bacteria 553
622 Ga0496103_0027055 3300048906 Bacteria 3473
623 Ga0496103_0072264 3300048906 Bacteria 2160
624 Ga0496103_0269639 3300048906 Bacteria 1095
625 Ga0496103_0371190 3300048906 Bacteria 919
626 Ga0496105_0003619 3300048908 Bacteria 11480
627 Ga0496105_0455228 3300048908 Bacteria 1009
628 Ga0496105_0745293 3300048908 Unclassified 748
629 Ga0496105_0928373 3300048908 Bacteria 654
630 Ga0496106_0502818 3300048909 Bacteria 973
631 Ga0496106_0936290 3300048909 Bacteria 683
632 Ga0496107_0014805 3300048910 Bacteria 5459
633 Ga0496108_0628349 3300048911 Bacteria 934
634 Ga0496109_0377799 3300048912 Bacteria 1338
635 Ga0496109_0551285 3300048912 Bacteria 1087
636 Ga0496109_1608296 3300048912 Bacteria 584
637 Ga0496110_0139495 3300048913 Bacteria 2191
638 Ga0496110_0170488 3300048913 Bacteria 1974
639 Ga0496110_1326243 3300048913 Bacteria 629
640 Ga0496111_0338641 3300048914 Bacteria 1113
641 Ga0496111_0412592 3300048914 Bacteria 997
642 Ga0496112_0349918 3300048915 Bacteria 1420
643 Ga0496112_0461587 3300048915 Bacteria 1207
644 Ga0496113_0314693 3300048916 Unclassified 1254
645 Ga0496113_0459880 3300048916 Bacteria 1022
646 Ga0496114_0016798 3300048917 Bacteria 5901
647 Ga0496114_0129097 3300048917 Bacteria 2181
648 Ga0496114_0937910 3300048917 Unclassified 747
649 Ga0496115_0065965 3300048918 Bacteria 2925
650 Ga0496115_0538432 3300048918 Bacteria 934
651 Ga0496115_1390942 3300048918 Bacteria 518
652 Ga0496117_0066744 3300048920 Bacteria 2438
653 Ga0496117_0516941 3300048920 Bacteria 575
654 Ga0496118_0130105 3300048921 Bacteria 1618
655 Ga0496118_0292433 3300048921 Bacteria 899
656 Ga0496119_0062842 3300048922 Bacteria 2211
657 Ga0496120_0047528 3300048923 Bacteria 2474
658 Ga0496122_0007556 3300048925 Bacteria 12031
659 Ga0496123_0018162 3300048926 Bacteria 5613
660 Ga0496124_0478917 3300048927 Bacteria 841
661 Ga0496125_0008149 3300048928 Bacteria 11029
662 Ga0496126_0102604 3300048929 Bacteria 2500
663 Ga0496126_0513626 3300048929 Bacteria 956
664 Ga0501031_0016418 3300049568 Bacteria 4808
665 Ga0501033_0130074 3300049570 Bacteria 1824
666 Ga0501033_0186534 3300049570 Bacteria 1485
667 Ga0501033_0470444 3300049570 Bacteria 871
668 Ga0501034_0082497 3300049571 Bacteria 3216
669 Ga0501034_0090212 3300049571 Bacteria 3063
670 Ga0501034_0268504 3300049571 Bacteria 1648
671 Ga0501034_0307647 3300049571 Bacteria 1520
672 Ga0501034_0323732 3300049571 Bacteria 1474
673 Ga0501034_1014440 3300049571 Bacteria 713
674 Ga0501034_1159324 3300049571 Bacteria 652
675 Ga0501036_0025092 3300049572 Bacteria 5027
676 Ga0501036_0089462 3300049572 Bacteria 2601
677 Ga0501036_0098319 3300049572 Bacteria 2474
678 Ga0501037_0201704 3300049573 Bacteria 1405
679 Ga0501037_1096871 3300049573 Bacteria 516
680 Ga0501038_0016217 3300049574 Bacteria 6756
681 Ga0501038_0028684 3300049574 Bacteria 4943
682 Ga0501038_0258324 3300049574 Bacteria 1378
683 Ga0501039_0045929 3300049575 Bacteria 3375
684 Ga0501039_0104316 3300049575 Bacteria 2213
685 Ga0501039_0144786 3300049575 Bacteria 1867
686 Ga0501040_0316142 3300049576 Bacteria 1117
687 Ga0501040_1147647 3300049576 Bacteria 564
688 Ga0501042_0102378 3300049578 Bacteria 2060
689 Ga0501043_0019177 3300049579 Bacteria 5369
690 Ga0501043_0056887 3300049579 Bacteria 3072
691 Ga0501043_0272915 3300049579 Bacteria 1298
692 Ga0501043_0612882 3300049579 Bacteria 803
693 Ga0501046_0183448 3300049580 Bacteria 1564
694 Ga0501046_0235690 3300049580 Bacteria 1351
695 Ga0501047_0111039 3300049581 Bacteria 2624
696 Ga0501047_0921423 3300049581 Bacteria 687
697 Ga0501048_0063295 3300049582 Bacteria 2616
698 Ga0501067_0004860 3300049583 Bacteria 7460
699 Ga0501069_0003799 3300049585 Bacteria 7768
700 Ga0501070_0027233 3300049586 Bacteria 4795
701 Ga0501070_0218215 3300049586 Bacteria 1564
702 Ga0501071_0012614 3300049587 Bacteria 5739
703 Ga0501072_0083980 3300049588 Bacteria 2525
704 Ga0501072_1036748 3300049588 Bacteria 639
705 Ga0501073_0011179 3300049589 Bacteria 6564
706 Ga0501073_1217701 3300049589 Bacteria 517
707 Ga0501074_0004299 3300049590 Bacteria 10168
708 Ga0501075_0653296 3300049591 Bacteria 802
709 Ga0501077_0719363 3300049593 Bacteria 642
710 Ga0501080_0907019 3300049742 Bacteria 768
711 Ga0501083_0007766 3300049744 Bacteria 7598
712 Ga0501083_0020400 3300049744 Bacteria 4611
713 Ga0501035_0161258 3300049822 Bacteria 1941
714 Ga0501035_0706686 3300049822 Bacteria 812
715 Ga0501044_0000658 3300049823 Bacteria 41690
716 Ga0501044_0038948 3300049823 Bacteria 4962
717 Ga0501044_0095855 3300049823 Bacteria 2989
718 Ga0501044_0188764 3300049823 Bacteria 2024
719 Ga0501045_0006093 3300049824 Bacteria 8349
720 nmdc:mga03683_299761_c1 3300050489 Bacteria 754
721 nmdc:mga03683_39603_c1 3300050489 Bacteria 1930
722 nmdc:mga03683_85935_c1 3300050489 Bacteria 1365
723 nmdc:mga03n38_325477_c1 3300050490 Bacteria 831
724 nmdc:mga00v17_13662_c1 3300050491 Bacteria 4513
725 nmdc:mga00v17_708672_c1 3300050491 Unclassified 645
726 nmdc:mga0yw44_261655_c1 3300050492 Unclassified 1153
727 nmdc:mga0yw44_346494_c1 3300050492 Bacteria 1000
728 nmdc:mga0yw44_60998_c1 3300050492 Bacteria 2312
729 nmdc:mga0yw44_81733_c1 3300050492 Bacteria 2026
730 nmdc:mga0k408_1462_c1 3300050493 Bacteria 12747
731 nmdc:mga0k408_1844_c1 3300050493 Bacteria 11385
732 nmdc:mga0k408_357330_c1 3300050493 Bacteria 871
733 nmdc:mga06z11_182623_c1 3300050494 Bacteria 1210
734 nmdc:mga06z11_39709_c1 3300050494 Bacteria 2344
735 nmdc:mga06z11_40894_c1 3300050494 Bacteria 2317
736 nmdc:mga04h51_275978_c1 3300050495 Bacteria 680
737 nmdc:mga07m45_146502_c1 3300050496 Bacteria 1369
738 nmdc:mga07m45_38160_c1 3300050496 Bacteria 2681
739 nmdc:mga07m45_397962_c1 3300050496 Bacteria 799
740 nmdc:mga05p37_40_c1 3300050507 Bacteria 108168
741 nmdc:mga05p37_45_c1 3300050507 Bacteria 81140
742 nmdc:mga05p37_468580_c1 3300050507 Bacteria 1454
743 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
744 nmdc:mga09592_1209_c1 3300050508 Bacteria 20701
745 nmdc:mga09592_1336201_c1 3300050508 Bacteria 588
746 nmdc:mga09592_656215_c1 3300050508 Bacteria 895
747 nmdc:mga09592_86157_c1 3300050508 Bacteria 2680
748 nmdc:mga0qj67_173461_c1 3300050509 Bacteria 1751
749 nmdc:mga0qj67_64_c1 3300050509 Bacteria 77795
750 nmdc:mga0qj67_701_c1 3300050509 Bacteria 22836
751 nmdc:mga06r32_119_c1 3300050510 Bacteria 56718
752 nmdc:mga06r32_1313663_c1 3300050510 Bacteria 667
753 nmdc:mga06r32_227_c1 3300050510 Bacteria 45651
754 nmdc:mga06r32_566205_c1 3300050510 Bacteria 1109
755 nmdc:mga08y16_1666_c1 3300050511 Bacteria 22506
756 nmdc:mga08y16_276_c1 3300050511 Bacteria 46701
757 nmdc:mga08y16_816268_c1 3300050511 Bacteria 924
758 nmdc:mga08y16_85434_c1 3300050511 Bacteria 3288
759 nmdc:mga0n895_174077_c1 3300050512 Bacteria 2184
760 nmdc:mga0n895_198795_c1 3300050512 Bacteria 2036
761 nmdc:mga0n895_199695_c1 3300050512 Bacteria 2031
762 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
763 nmdc:mga0rr50_1248007_c1 3300050513 Bacteria 631
764 nmdc:mga0rr50_2604_c1 3300050513 Bacteria 10227
765 nmdc:mga0rr50_260557_c1 3300050513 Bacteria 1443
766 nmdc:mga0rr50_6523_c1 3300050513 Bacteria 7116
767 nmdc:mga0rr50_847266_c1 3300050513 Bacteria 780
768 nmdc:mga08x19_3763_c1 3300050514 Bacteria 9027
769 nmdc:mga08x19_77412_c1 3300050514 Bacteria 2178
770 nmdc:mga0a205_160090_c1 3300050515 Bacteria 2148
771 nmdc:mga0a205_4901_c1 3300050515 Bacteria 12033
772 nmdc:mga0sz30_153649_c1 3300050516 Unclassified 1019
773 Ga0495601_0000006 3300053077 Bacteria 373770
774 Ga0495601_0002402 3300053077 Bacteria 10631
775 Ga0495601_0009866 3300053077 Bacteria 5653
776 Ga0495612_0000004 3300053078 Bacteria 286946
777 Ga0495612_0000363 3300053078 Bacteria 18267
778 Ga0495612_0545302 3300053078 Bacteria 534
779 Ga0495595_0000686 3300053084 Bacteria 12928
780 Ga0495595_0001090 3300053084 Bacteria 10512
781 Ga0495619_0000027 3300053085 Bacteria 165001
782 Ga0495619_0000076 3300053085 Bacteria 73965
783 Ga0495619_0028972 3300053085 Bacteria 3575
784 Ga0495619_0054191 3300053085 Bacteria 2653
785 Ga0500643_008270 3300053087 Bacteria 4101
786 Ga0500581_122909 3300053089 Bacteria 1251
787 Ga0500646_0013918 3300053090 Bacteria 2086
788 Ga0500651_0050579 3300053093 Bacteria 2607
789 Ga0500651_0249125 3300053093 Bacteria 1033
790 Ga0500651_0389029 3300053093 Bacteria 785
791 Ga0500566_0000554 3300053094 Bacteria 20984
792 Ga0500566_0490348 3300053094 Bacteria 531
793 Ga0500641_0006384 3300053096 Bacteria 4185
794 Ga0500641_0038333 3300053096 Bacteria 1925
795 Ga0500641_0062149 3300053096 Unclassified 1557
796 Ga0500650_0000453 3300053098 Bacteria 10240
797 Ga0500554_123319 3300053102 Bacteria 874
798 Ga0500556_0000024 3300053104 Bacteria 167556
799 Ga0500557_180305 3300053105 Bacteria 686
800 Ga0500562_064340 3300053108 Bacteria 987
801 Ga0500562_218382 3300053108 Bacteria 515
802 Ga0500592_051237 3300053116 Bacteria 671
803 Ga0500594_0039681 3300053118 Bacteria 1281
804 Ga0500595_080387 3300053119 Bacteria 955
805 Ga0500608_001306 3300053122 Bacteria 8879
806 Ga0500618_037853 3300053125 Bacteria 1114
807 Ga0500642_0000035 3300053130 Bacteria 106656
808 Ga0500652_001014 3300053131 Bacteria 9174
809 Ga0500658_0248219 3300053134 Bacteria 818
810 Ga0500559_0000985 3300053136 Bacteria 17756
811 Ga0500568_0000681 3300053139 Bacteria 24452
812 Ga0500577_0014168 3300053142 Bacteria 2457
813 Ga0500589_225706 3300053147 Bacteria 703
814 Ga0500590_042072 3300053148 Bacteria 2347
815 Ga0500604_0027190 3300053151 Bacteria 1653
816 Ga0500616_0000084 3300053153 Bacteria 195562
817 Ga0500616_0000122 3300053153 Bacteria 140228
818 Ga0500616_0063846 3300053153 Bacteria 1898
819 Ga0500622_0004924 3300053156 Bacteria 8151
820 Ga0500627_0025099 3300053158 Bacteria 2446
821 Ga0500633_0007027 3300053160 Bacteria 2807
822 Ga0500634_0021612 3300053161 Bacteria 3489
823 Ga0500634_0060398 3300053161 Bacteria 2013
824 Ga0500636_0012748 3300053177 Bacteria 4927
825 Ga0500637_0293867 3300053178 Bacteria 889
826 Ga0500570_203755 3300053724 Bacteria 595
827 Ga0500645_018880 3300053730 Bacteria 2148
828 Ga0501084_0127538 3300054114 Bacteria 2142
829 Ga0501084_0149358 3300054114 Bacteria 1969
830 Ga0501082_0021837 3300060353 Bacteria 5517
831 Ga0501082_1310245 3300060353 Bacteria 633
832 Ga0530510_0674520 3300061734 Bacteria 787
833 2643755530 2643221547 Bacteria 4740017
834 2857528823 2857524615 Bacteria 6615449
835 2893069020 2893066018 Bacteria 6158120
836 2919079249 2919073203 Bacteria 6531949
837 Ga0070709_10327701
838 JGI25153J46596_10000451
839 JGI25405J52794_10007872
840 Ga0065704_10370002
841 Ga0065707_10273120
842 Ga0070676_10063060
843 Ga0070676_10072506
844 Ga0070683_100029275
845 Ga0070690_100469329
846 Ga0070677_10839047
847 Ga0068869_100032558
848 Ga0068869_100331442
849 Ga0068869_101647058
850 Ga0070680_100260155
851 Ga0070680_100487337
852 Ga0070682_100011037
853 Ga0070682_101428115
854 Ga0068868_100025411
855 Ga0068868_100222146
856 Ga0068868_100235536
857 Ga0070660_100026463
858 Ga0070660_100459478
859 Ga0070689_100030415
860 Ga0070687_100039609
861 Ga0070687_100105799
862 Ga0070661_100009874
863 Ga0070661_100051548
864 Ga0070661_100089040
865 Ga0070668_100130756
866 Ga0070669_100090482
867 Ga0070669_100200413
868 Ga0070675_100019025
869 Ga0070675_100152073
870 Ga0070675_101054004
871 Ga0070674_100003201
872 Ga0070674_100399189
873 Ga0070674_100573970
874 Ga0070673_100035671
875 Ga0070673_100037800
876 Ga0070688_100025926
877 Ga0070688_100400231
878 Ga0070659_100137189
879 Ga0070659_100521084
880 Ga0070667_100192412
881 Ga0070709_10029166
882 Ga0070714_100074204
883 Ga0070714_100076086
884 Ga0070714_100132154
885 Ga0070714_100295297
886 Ga0070713_100007886
887 Ga0070713_100026424
888 Ga0070713_100089341
889 Ga0070713_100957505
890 Ga0070710_10013050
891 Ga0070710_10027762
892 Ga0070710_10078287
893 Ga0070701_10011609
894 Ga0070711_100018380
895 Ga0070711_100038597
896 Ga0070711_100049781
897 Ga0070711_100089912
898 Ga0070711_100299902
899 Ga0070711_101202017
900 Ga0070700_100133228
901 Ga0070700_101015071
902 Ga0070694_100593897
903 Ga0070663_100012049
904 Ga0070663_100014764
905 Ga0070663_100145200
906 Ga0070663_100910325
907 Ga0070663_100934877
908 Ga0070678_100033812
909 Ga0070678_100186936
910 Ga0070678_100303482
911 Ga0070662_100096540
912 Ga0070662_100097031
913 Ga0070662_101078214
914 Ga0070681_10058962
915 Ga0070681_10150870
916 Ga0070681_10350963
917 Ga0068867_100013667
918 Ga0068867_100505160
919 Ga0068867_100714373
920 Ga0070685_10010366
921 Ga0070707_100520934
922 Ga0070679_100078960
923 Ga0070679_100296231
924 Ga0068853_100056680
925 Ga0068853_100494417
926 Ga0070672_100038899
927 Ga0070672_100287197
928 Ga0070686_100024813
929 Ga0070686_100053923
930 Ga0070686_100068645
931 Ga0070695_100109057
932 Ga0070695_101020650
933 Ga0070695_101066184
934 Ga0070696_100027221
935 Ga0070693_100105864
936 Ga0070665_100073279
937 Ga0070665_100175067
938 Ga0070665_100292736
939 Ga0070665_100344932
940 Ga0070665_100861752
941 Ga0070704_100040056
942 Ga0070704_100316065
943 Ga0070704_101765706
944 Ga0068855_100027822
945 Ga0068855_100786543
946 Ga0070664_100230150
947 Ga0070664_100278918
948 Ga0068857_100677577
949 Ga0068854_100245417
950 Ga0068856_100465629
951 Ga0068856_100886150
952 Ga0070702_100076741
953 Ga0068852_100085350
954 Ga0068852_100460973
955 Ga0068852_101532522
956 Ga0068864_100225334
957 Ga0068864_100266765
958 Ga0068864_100404667
959 Ga0068866_10004157
960 Ga0068866_10069372
961 Ga0068861_100066650
962 Ga0068861_100403812
963 Ga0068861_102025080
964 Ga0068863_100243086
965 Ga0068863_101150102
966 Ga0068863_101684944
967 Ga0068858_100076394
968 Ga0068858_100367882
969 Ga0068860_100030270
970 Ga0068860_100059506
971 Ga0068860_100313102
972 Ga0068862_100053648
973 Ga0068862_100432624
974 Ga0081455_10012596
975 Ga0081540_1023030
976 Ga0081539_10018047
977 Ga0070717_10029821
978 Ga0070717_10152409
979 Ga0070717_10525181
980 Ga0075365_10021584
981 Ga0075365_10218865
982 Ga0075365_10473465
983 Ga0075365_10674578
984 Ga0075368_10072008
985 Ga0075368_10412211
986 Ga0075363_100588758
987 Ga0075364_10042157
988 Ga0075364_10687127
989 Ga0070715_10269870
990 Ga0070716_100099448
991 Ga0070716_100228906
992 Ga0070712_100337683
993 Ga0070712_100351505
994 Ga0070712_101341428
995 Ga0075362_10057247
996 Ga0075362_10116731
997 Ga0075362_10458057
998 Ga0075367_10032558
999 Ga0075367_10120213
1000 Ga0075367_10551856
1001 Ga0075369_10076870
1002 Ga0075427_10003584
1003 Ga0075366_10002295
1004 Ga0075366_10003023
1005 Ga0075366_10350934
1006 Ga0097621_100040858
1007 Ga0097621_100711941
1008 Ga0075370_10036981
1009 Ga0075370_10125298
1010 Ga0075370_10235235
1011 Ga0075370_10615575
1012 Ga0068871_100001492
1013 Ga0075428_100006177
1014 Ga0075428_100113185
1015 Ga0075428_100214336
1016 Ga0075428_100232165
1017 Ga0075428_100256417
1018 Ga0075430_100005373
1019 Ga0075430_100183828
1020 Ga0075430_100911812
1021 Ga0075431_100000004
1022 Ga0075431_100031970
1023 Ga0075431_101245263
1024 Ga0075433_10000774
1025 Ga0075433_10319780
1026 Ga0075434_100003565
1027 Ga0075434_100035766
1028 Ga0075434_100160330
1029 Ga0075434_100500751
1030 Ga0075434_100785992
1031 Ga0075429_100002027
1032 Ga0075429_100022187
1033 Ga0075429_100038167
1034 Ga0068865_100168080
1035 Ga0075436_100008147
1036 Ga0075436_100055764
1037 Ga0075435_100001109
1038 Ga0075435_100088821
1039 Ga0075435_100120453
1040 Ga0099795_10029945
1041 Ga0105251_10019741
1042 Ga0105251_10061989
1043 Ga0111539_10000264
1044 Ga0111539_10011144
1045 Ga0111539_10390373
1046 Ga0111539_11073375
1047 Ga0105245_10032287
1048 Ga0105245_10221826
1049 Ga0105245_10631526
1050 Ga0105245_10638737
1051 Ga0105245_12055649
1052 Ga0105247_10015467
1053 Ga0105247_10046563
1054 Ga0105247_10400808
1055 Ga0114129_10000582
1056 Ga0114129_10004796
1057 Ga0114129_10128813
1058 Ga0114129_11354723
1059 Ga0105243_10348027
1060 Ga0105243_11768702
1061 Ga0105241_10069786
1062 Ga0105241_10147833
1063 Ga0105242_10039140
1064 Ga0105242_10046930
1065 Ga0105242_10167634
1066 Ga0105248_10020670
1067 Ga0105248_12308692
1068 Ga0105237_10021242
1069 Ga0105237_10036012
1070 Ga0105238_10031430
1071 Ga0105238_10303618
1072 Ga0105238_10850292
1073 Ga0105249_10044203
1074 Ga0105249_10612839
1075 Ga0105249_10730549
1076 Ga0105249_12326818
1077 Ga0099796_10080966
1078 Ga0105239_10066565
1079 Ga0105239_10079780
1080 Ga0105239_11163935
1081 Ga0105246_10083438
1082 Ga0105246_10398593
1083 Ga0105246_11598908
1084 Ga0105246_11701648
1085 Ga0157336_1000965
1086 Ga0157328_1004969
1087 Ga0157345_1014532
1088 Ga0157339_1015863
1089 Ga0157370_10089522
1090 Ga0157370_10806582
1091 Ga0157369_10362944
1092 Ga0157369_11703205
1093 Ga0157369_12431659
1094 Ga0157374_10024335
1095 Ga0157374_10160259
1096 Ga0157374_11819032
1097 Ga0157378_10132346
1098 Ga0157378_10154661
1099 Ga0157378_12123902
1100 Ga0163162_10141527
1101 Ga0157375_10033970
1102 Ga0157375_10543952
1103 Ga0157375_11457009
1104 Ga0157375_12330599
1105 Ga0163163_10081659
1106 Ga0157380_10021822
1107 Ga0157380_10216463
1108 Ga0157380_10250428
1109 Ga0157379_10021726
1110 Ga0157379_10027895
1111 Ga0163161_10144711
1112 Ga0163161_10238124
1113 Ga0163161_10430325
1114 Ga0213875_10000825
1115 Ga0209758_1000128
1116 Ga0209758_1014286
1117 Ga0207656_10643616
1118 Ga0207713_1059307
1119 Ga0207692_10005833
1120 Ga0207692_10033169
1121 Ga0207692_10169274
1122 Ga0207710_10004823
1123 Ga0207710_10011513
1124 Ga0207710_10011719
1125 Ga0207688_10024073
1126 Ga0207680_10113138
1127 Ga0207680_10363699
1128 Ga0207680_10511954
1129 Ga0207685_10000610
1130 Ga0207685_10019007
1131 Ga0207685_10170028
1132 Ga0207699_10000479
1133 Ga0207699_10037149
1134 Ga0207699_10055215
1135 Ga0207645_10031488
1136 Ga0207645_10033882
1137 Ga0207707_10220397
1138 Ga0207695_10284500
1139 Ga0207671_10035535
1140 Ga0207671_10340224
1141 Ga0207693_10023634
1142 Ga0207693_10026141
1143 Ga0207693_10165455
1144 Ga0207693_10311268
1145 Ga0207663_10004450
1146 Ga0207663_10246389
1147 Ga0207663_11341799
1148 Ga0207660_10025342
1149 Ga0207660_10057343
1150 Ga0207660_10352131
1151 Ga0207660_10884729
1152 Ga0207662_10725007
1153 Ga0207662_11148823
1154 Ga0207657_10044435
1155 Ga0207657_10239449
1156 Ga0207649_10051471
1157 Ga0207649_10291893
1158 Ga0207652_10200563
1159 Ga0207652_10332634
1160 Ga0207681_10143814
1161 Ga0207694_10082657
1162 Ga0207694_10236043
1163 Ga0207694_11189380
1164 Ga0207650_10857904
1165 Ga0207659_10074978
1166 Ga0207659_10166085
1167 Ga0207687_10005103
1168 Ga0207687_10022385
1169 Ga0207687_10319954
1170 Ga0207687_10886031
1171 Ga0207700_10000167
1172 Ga0207700_10075818
1173 Ga0207700_10090572
1174 Ga0207700_10471257
1175 Ga0207664_10051748
1176 Ga0207664_10208982
1177 Ga0207664_10913931
1178 Ga0207664_11375751
1179 Ga0207644_11263977
1180 Ga0207706_10027067
1181 Ga0207706_10028462
1182 Ga0207686_10028534
1183 Ga0207686_10036640
1184 Ga0207670_10014169
1185 Ga0207670_10194738
1186 Ga0207669_10050253
1187 Ga0207669_10715179
1188 Ga0207669_10851739
1189 Ga0207704_10209427
1190 Ga0207704_10323167
1191 Ga0207704_10430102
1192 Ga0207665_10000417
1193 Ga0207665_10032973
1194 Ga0207665_10165839
1195 Ga0207665_10473230
1196 Ga0207691_10088868
1197 Ga0207711_10010579
1198 Ga0207711_10122888
1199 Ga0207711_10146157
1200 Ga0207711_10543157
1201 Ga0207689_10016845
1202 Ga0207689_10100764
1203 Ga0207661_10891181
1204 Ga0207679_10224999
1205 Ga0207679_10577440
1206 Ga0207667_10036257
1207 Ga0207667_10547542
1208 Ga0207651_10088242
1209 Ga0207651_10871704
1210 Ga0207712_10118829
1211 Ga0207712_10125669
1212 Ga0207668_10499984
1213 Ga0207640_10119704
1214 Ga0207640_10224699
1215 Ga0207658_10473972
1216 Ga0207658_11634945
1217 Ga0207677_10007963
1218 Ga0207677_10155452
1219 Ga0207703_10007684
1220 Ga0207703_10023404
1221 Ga0207703_10241095
1222 Ga0207639_10281648
1223 Ga0207678_10039347
1224 Ga0207678_10045458
1225 Ga0207678_10086531
1226 Ga0207678_10385109
1227 Ga0207708_10173543
1228 Ga0207708_10303548
1229 Ga0207702_11369154
1230 Ga0207641_10150895
1231 Ga0207648_10022005
1232 Ga0207648_10131808
1233 Ga0207676_10128089
1234 Ga0207676_10797615
1235 Ga0207674_10189101
1236 Ga0207674_11613978
1237 Ga0207675_100014520
1238 Ga0207675_100082317
1239 Ga0207675_100094185
1240 Ga0207675_100135582
1241 Ga0207683_10006710
1242 Ga0207683_10025780
1243 Ga0207698_10320876
1244 Ga0207698_11180241
1245 Ga0207698_11931639
1246 Ga0209179_1009340
1247 Ga0209813_10430212
1248 Ga0207428_10000077
1249 Ga0207428_10000124
1250 Ga0268266_10007527
1251 Ga0268266_10160370
1252 Ga0268266_10286833
1253 Ga0268266_11594158
1254 Ga0268265_10086882
1255 Ga0268264_10032424
1256 Ga0268264_10205407
1257 Ga0268264_10506055
1258 Ga0265334_10104359
1259 Ga0307515_10052509
1260 Ga0265340_10096399
1261 Ga0265314_10123146
1262 Ga0265342_10019559
1263 Ga0307405_10633571
1264 Ga0373930_0005686
1265 Ga0373950_0047525
1266 Ga0373958_0000861
1267 Ga0373928_0001128
1268 Ga0373929_0053940
1269 Ga0373934_0029232
1270 Ga0373934_0165140
1271 Ga0373944_0022380
1272 Ga0373949_0011856
1273 Ga0373951_0018544
1274 Ga0373952_0008869
1275 Ga0373952_0059208
1276 Ga0373952_0149213
1277 Ga0373923_0222524
1278 Ga0373932_0010998
1279 Ga0373936_0002621
1280 Ga0373936_0286327
1281 Ga0373936_0333117
1282 Ga0373936_0557683
1283 Ga0373939_0019016
1284 Ga0373939_0042748
1285 Ga0373941_0010368
1286 Ga0373941_0044484
1287 Ga0373945_0021108
1288 Ga0373953_0000535
1289 Ga0373953_0021944
1290 Ga0373954_0016324
1291 Ga0373954_0066251
1292 Ga0373956_0004566
1293 Ga0373957_0001349
1294 Ga0373960_0012071
1295 Ga0373960_0113785
1296 Ga0373943_0031720
1297 Ga0373943_0067486
1298 Ga0373943_0174056
1299 Ga0373943_0481675
1300 Ga0373946_0000383
1301 Ga0373946_0019971
1302 Ga0373946_0029361
1303 Ga0373955_0000189
1304 Ga0373955_0137649
1305 Ga0373942_0098171
1306 Ga0373961_0025429
1307 Ga0373962_0001215
1308 Ga0373962_0053965
1309 Ga0373924_0000144
1310 Ga0373931_0002333
1311 Ga0373931_0071186
1312 Ga0373935_0000012
1313 Ga0373935_0006395
1314 Ga0373935_0025002
1315 Ga0373935_0844415
1316 Ga0373927_0003657
1317 Ga0373927_0063769
1318 Ga0373927_0074275
1319 Ga0373933_0004023
1320 Ga0373933_0009866
1321 Ga0373947_0000380
1322 Ga0373947_0004569
1323 Ga0373947_0029013
1324 Ga0373947_0072299
1325 Ga0373937_0000054
1326 Ga0373937_0048356
1327 Ga0373925_0000018
1328 Ga0373925_0005307
1329 Ga0373925_0016398
1330 Ga0373925_0049962
1331 Ga0436364_0196951
1332 Ga0436364_0475448
1333 Ga0436365_1150569
1334 Ga0436365_1511081
1335 Ga0451855_0380325
1336 Ga0439456_110124
1337 Ga0439446_0217345
1338 Ga0439458_0078051
1339 Ga0450909_026430
1340 Ga0439459_0191382
1341 Ga0466957_0382834
1342 Ga0466958_0127470
1343 Ga0466967_0117783
1344 Ga0495592_0000001
1345 Ga0495603_0034913
1346 Ga0495603_0048520
1347 Ga0495629_0001166
1348 Ga0495629_0028266
1349 Ga0495629_0272527
1350 Ga0495638_0037126
1351 Ga0495638_0045055
1352 Ga0495638_0162286
1353 Ga0495641_0022876
1354 Ga0495641_0328664
1355 Ga0495651_0000493
1356 Ga0495651_0002120
1357 Ga0495653_0000015
1358 Ga0495653_0005251
1359 Ga0495580_0102712
1360 Ga0495582_0011296
1361 Ga0495582_0072185
1362 Ga0495582_0122548
1363 Ga0495639_0052152
1364 Ga0495639_0268519
1365 Ga0495662_0000432
1366 Ga0495664_0000001
1367 Ga0495664_0421630
1368 Ga0495594_0030069
1369 Ga0495594_0106464
1370 Ga0495583_0165179
1371 Ga0495608_0000050
1372 Ga0495610_0013825
1373 Ga0495616_0037167
1374 Ga0495618_0000045
1375 Ga0495618_0007610
1376 Ga0495628_0000003
1377 Ga0495628_0005129
1378 Ga0495630_0001134
1379 Ga0495631_0050100
1380 Ga0495643_0345999
1381 Ga0495648_0288689
1382 Ga0495666_0215187
1383 Ga0495666_0232527
1384 Ga0495652_0000001
1385 Ga0495665_0090647
1386 Ga0495665_0230827
1387 Ga0495640_0000006
1388 Ga0495640_0009899
1389 Ga0495586_0157853
1390 Ga0495587_0000028
1391 Ga0495587_0000335
1392 Ga0495597_0236172
1393 Ga0495645_0000004
1394 Ga0495645_0097342
1395 Ga0495622_0020809
1396 Ga0495667_0000001
1397 Ga0495667_0004928
1398 Ga0495668_0010955
1399 Ga0495634_0000751
1400 Ga0495625_0032385
1401 Ga0495635_0000007
1402 Ga0495635_0338244
1403 Ga0495659_0254943
1404 Ga0495661_0022589
1405 Ga0495588_0017548
1406 Ga0495657_0000136
1407 Ga0495657_0000836
1408 Ga0495599_0000002
1409 Ga0495599_0002782
1410 Ga0495623_0000052
1411 Ga0495623_0001006
1412 Ga0495646_0000036
1413 Ga0495646_0000229
1414 Ga0495647_0005778
1415 Ga0495647_0011817
1416 Ga0495658_0000591
1417 Ga0495658_0038218
1418 Ga0495658_0459492
1419 Ga0495669_0022210
1420 Ga0495613_0056311
1421 Ga0495613_0096443
1422 Ga0495613_0269187
1423 Ga0495624_0023770
1424 Ga0495624_0327935
1425 Ga0495670_0630271
1426 Ga0495600_0000037
1427 Ga0495600_0004219
1428 Ga0495581_0181419
1429 Ga0495581_0771465
1430 Ga0495604_0000594
1431 Ga0495604_0002636
1432 Ga0495674_0000001
1433 Ga0495674_0039286
1434 Ga0495676_0096671
1435 Ga0495680_0000705
1436 Ga0495680_0009600
1437 Ga0495680_0013693
1438 Ga0495675_0000049
1439 Ga0495675_0000139
1440 Ga0495677_0098428
1441 Ga0495684_0000046
1442 Ga0495684_0015436
1443 Ga0495684_0098991
1444 Ga0495686_0245886
1445 Ga0495593_0000276
1446 Ga0495593_0005865
1447 Ga0495593_0150616
1448 Ga0495602_0000102
1449 Ga0495602_0000310
1450 Ga0496100_0019283
1451 Ga0496100_0374296
1452 Ga0496101_0017266
1453 Ga0496101_0035437
1454 Ga0496102_0063554
1455 Ga0496102_0224366
1456 Ga0496102_0790152
1457 Ga0496102_1680731
1458 Ga0496103_0027055
1459 Ga0496103_0072264
1460 Ga0496103_0269639
1461 Ga0496103_0371190
1462 Ga0496105_0003619
1463 Ga0496105_0455228
1464 Ga0496105_0745293
1465 Ga0496105_0928373
1466 Ga0496106_0502818
1467 Ga0496106_0936290
1468 Ga0496107_0014805
1469 Ga0496108_0628349
1470 Ga0496109_0377799
1471 Ga0496109_0551285
1472 Ga0496109_1608296
1473 Ga0496110_0139495
1474 Ga0496110_0170488
1475 Ga0496110_1326243
1476 Ga0496111_0338641
1477 Ga0496111_0412592
1478 Ga0496112_0349918
1479 Ga0496112_0461587
1480 Ga0496113_0314693
1481 Ga0496113_0459880
1482 Ga0496114_0016798
1483 Ga0496114_0129097
1484 Ga0496114_0937910
1485 Ga0496115_0065965
1486 Ga0496115_0538432
1487 Ga0496115_1390942
1488 Ga0496117_0066744
1489 Ga0496117_0516941
1490 Ga0496118_0130105
1491 Ga0496118_0292433
1492 Ga0496119_0062842
1493 Ga0496120_0047528
1494 Ga0496122_0007556
1495 Ga0496123_0018162
1496 Ga0496124_0478917
1497 Ga0496125_0008149
1498 Ga0496126_0102604
1499 Ga0496126_0513626
1500 Ga0501031_0016418
1501 Ga0501033_0130074
1502 Ga0501033_0186534
1503 Ga0501033_0470444
1504 Ga0501034_0082497
1505 Ga0501034_0090212
1506 Ga0501034_0268504
1507 Ga0501034_0307647
1508 Ga0501034_0323732
1509 Ga0501034_1014440
1510 Ga0501034_1159324
1511 Ga0501036_0025092
1512 Ga0501036_0089462
1513 Ga0501036_0098319
1514 Ga0501037_0201704
1515 Ga0501037_1096871
1516 Ga0501038_0016217
1517 Ga0501038_0028684
1518 Ga0501038_0258324
1519 Ga0501039_0045929
1520 Ga0501039_0104316
1521 Ga0501039_0144786
1522 Ga0501040_0316142
1523 Ga0501040_1147647
1524 Ga0501042_0102378
1525 Ga0501043_0019177
1526 Ga0501043_0056887
1527 Ga0501043_0272915
1528 Ga0501043_0612882
1529 Ga0501046_0183448
1530 Ga0501046_0235690
1531 Ga0501047_0111039
1532 Ga0501047_0921423
1533 Ga0501048_0063295
1534 Ga0501067_0004860
1535 Ga0501069_0003799
1536 Ga0501070_0027233
1537 Ga0501070_0218215
1538 Ga0501071_0012614
1539 Ga0501072_0083980
1540 Ga0501072_1036748
1541 Ga0501073_0011179
1542 Ga0501073_1217701
1543 Ga0501074_0004299
1544 Ga0501075_0653296
1545 Ga0501077_0719363
1546 Ga0501080_0907019
1547 Ga0501083_0007766
1548 Ga0501083_0020400
1549 Ga0501035_0161258
1550 Ga0501035_0706686
1551 Ga0501044_0000658
1552 Ga0501044_0038948
1553 Ga0501044_0095855
1554 Ga0501044_0188764
1555 Ga0501045_0006093
1556 nmdc:mga03683_299761_c1
1557 nmdc:mga03683_39603_c1
1558 nmdc:mga03683_85935_c1
1559 nmdc:mga03n38_325477_c1
1560 nmdc:mga00v17_13662_c1
1561 nmdc:mga00v17_708672_c1
1562 nmdc:mga0yw44_261655_c1
1563 nmdc:mga0yw44_346494_c1
1564 nmdc:mga0yw44_60998_c1
1565 nmdc:mga0yw44_81733_c1
1566 nmdc:mga0k408_1462_c1
1567 nmdc:mga0k408_1844_c1
1568 nmdc:mga0k408_357330_c1
1569 nmdc:mga06z11_182623_c1
1570 nmdc:mga06z11_39709_c1
1571 nmdc:mga06z11_40894_c1
1572 nmdc:mga04h51_275978_c1
1573 nmdc:mga07m45_146502_c1
1574 nmdc:mga07m45_38160_c1
1575 nmdc:mga07m45_397962_c1
1576 nmdc:mga05p37_40_c1
1577 nmdc:mga05p37_45_c1
1578 nmdc:mga05p37_468580_c1
1579 nmdc:mga09592_1055_c1
1580 nmdc:mga09592_1209_c1
1581 nmdc:mga09592_1336201_c1
1582 nmdc:mga09592_656215_c1
1583 nmdc:mga09592_86157_c1
1584 nmdc:mga0qj67_173461_c1
1585 nmdc:mga0qj67_64_c1
1586 nmdc:mga0qj67_701_c1
1587 nmdc:mga06r32_119_c1
1588 nmdc:mga06r32_1313663_c1
1589 nmdc:mga06r32_227_c1
1590 nmdc:mga06r32_566205_c1
1591 nmdc:mga08y16_1666_c1
1592 nmdc:mga08y16_276_c1
1593 nmdc:mga08y16_816268_c1
1594 nmdc:mga08y16_85434_c1
1595 nmdc:mga0n895_174077_c1
1596 nmdc:mga0n895_198795_c1
1597 nmdc:mga0n895_199695_c1
1598 nmdc:mga0n895_50_c1
1599 nmdc:mga0rr50_1248007_c1
1600 nmdc:mga0rr50_2604_c1
1601 nmdc:mga0rr50_260557_c1
1602 nmdc:mga0rr50_6523_c1
1603 nmdc:mga0rr50_847266_c1
1604 nmdc:mga08x19_3763_c1
1605 nmdc:mga08x19_77412_c1
1606 nmdc:mga0a205_160090_c1
1607 nmdc:mga0a205_4901_c1
1608 nmdc:mga0sz30_153649_c1
1609 Ga0495601_0000006
1610 Ga0495601_0002402
1611 Ga0495601_0009866
1612 Ga0495612_0000004
1613 Ga0495612_0000363
1614 Ga0495612_0545302
1615 Ga0495595_0000686
1616 Ga0495595_0001090
1617 Ga0495619_0000027
1618 Ga0495619_0000076
1619 Ga0495619_0028972
1620 Ga0495619_0054191
1621 Ga0500643_008270
1622 Ga0500581_122909
1623 Ga0500646_0013918
1624 Ga0500651_0050579
1625 Ga0500651_0249125
1626 Ga0500651_0389029
1627 Ga0500566_0000554
1628 Ga0500566_0490348
1629 Ga0500641_0006384
1630 Ga0500641_0038333
1631 Ga0500641_0062149
1632 Ga0500650_0000453
1633 Ga0500554_123319
1634 Ga0500556_0000024
1635 Ga0500557_180305
1636 Ga0500562_064340
1637 Ga0500562_218382
1638 Ga0500592_051237
1639 Ga0500594_0039681
1640 Ga0500595_080387
1641 Ga0500608_001306
1642 Ga0500618_037853
1643 Ga0500642_0000035
1644 Ga0500652_001014
1645 Ga0500658_0248219
1646 Ga0500559_0000985
1647 Ga0500568_0000681
1648 Ga0500577_0014168
1649 Ga0500589_225706
1650 Ga0500590_042072
1651 Ga0500604_0027190
1652 Ga0500616_0000084
1653 Ga0500616_0000122
1654 Ga0500616_0063846
1655 Ga0500622_0004924
1656 Ga0500627_0025099
1657 Ga0500633_0007027
1658 Ga0500634_0021612
1659 Ga0500634_0060398
1660 Ga0500636_0012748
1661 Ga0500637_0293867
1662 Ga0500570_203755
1663 Ga0500645_018880
1664 Ga0501084_0127538
1665 Ga0501084_0149358
1666 Ga0501082_0021837
1667 Ga0501082_1310245
1668 Ga0530510_0674520
1669 2643755530
1670 2857528823
1671 2893069020
1672 2919079249

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

35

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8691 6 122
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8623 5 122
3d7i-assembly1.cif.gz_B crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from methanococcus jannaschii at 1.75 a resolution 0.8621 32 120
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8357 5 122
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8287 6 122
ID Description Score Start End Superfamily
af_I6Y4S7_2_118_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8631 1 126 1.20.1290.10
2af7G00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8521 7 122 1.20.1290.10
af_I6Y4S7_2_118_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8494 1 126 1.20.1290.10
af_Q5A3K0_131_323_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8387 6 106 1.20.1290.10
2af7D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8355 6 122 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A127ETX9-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9962 1 129 GO:0051920
AF-A0A537UMB0-F1-model_v4 Gamma-carboxymuconolactone decarboxylase 0.9865 33 129 GO:0051920
AF-A0A2T7TQ50-F1-model_v4 Carboxymuconolactone decarboxylase 0.9839 1 87 GO:0051920
AF-D5VDH3-F1-model_v4 3-oxoadipate enol-lactonase 0.9801 3 125 GO:0042952
GO:0047570
GO:0051920
AF-A0A2V9QWS8-F1-model_v4 3-oxoadipate enol-lactonase 0.9745 7 126 GO:0042952
GO:0047570
GO:0051920

Map