F482883

General Info

Members Datasets Scaffolds Average Seq Length
836 250 1672 173

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11080176|Ga0157369_110801761
Length 204
Sequence VRLLGASANAQRFFAAPNISSTVCKDSIMADQEPTPGGNGSGEPGDEPQVSILAQYIKDLSVENPSAPQVFQWQVQPTLDVQFNINLEKVADDVHEIMLKIEVTARSENGVHFVVDLSYAGLFGLRNMPEEALPPFLLIEAPRLMFPFVRQIIADAVINTGFPPLLLDPIDFASAYVAQLQAAQQGGESNGSDEQSASDSPSEA

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
241 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
242 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
243 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.55
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_11080176 3300013105 Bacteria 820
2 MBSR1b_contig_4799473 2162886012 Bacteria 1343
3 JGI24746J21847_1002084 3300001977 Bacteria 3196
4 JGI24740J21852_10096864 3300001979 Bacteria 755
5 JGI24739J22299_10003420 3300001989 Bacteria 6056
6 JGI24735J21928_10013884 3300002067 Bacteria 2527
7 JGI24738J21930_10000035 3300002075 Bacteria 25714
8 JGI24749J21850_1003195 3300002076 Bacteria 2288
9 JGI24033J26618_1020308 3300002155 Bacteria 847
10 JGI24034J26672_10026050 3300002239 Bacteria 937
11 JGI24742J22300_10063245 3300002244 Bacteria 682
12 JGI24751J29686_10030402 3300002459 Bacteria 1120
13 Ga0065165_1007899 3300005262 Bacteria 5103
14 Ga0065712_10152941 3300005290 Bacteria 1356
15 Ga0065715_10000359 3300005293 Bacteria 22373
16 Ga0065707_10246837 3300005295 Bacteria 1138
17 Ga0070658_10039227 3300005327 Bacteria 3820
18 Ga0070658_10042549 3300005327 Bacteria 3669
19 Ga0070658_10080678 3300005327 Bacteria 2672
20 Ga0070658_10090495 3300005327 Bacteria 2521
21 Ga0070658_10189446 3300005327 Bacteria 1733
22 Ga0070658_10267703 3300005327 Bacteria 1452
23 Ga0070676_10020596 3300005328 Bacteria 3685
24 Ga0070676_10134996 3300005328 Bacteria 1564
25 Ga0070676_10193920 3300005328 Bacteria 1328
26 Ga0070676_10203435 3300005328 Bacteria 1299
27 Ga0070676_10265174 3300005328 Bacteria 1151
28 Ga0070676_10314617 3300005328 Bacteria 1066
29 Ga0070683_100514256 3300005329 Bacteria 1144
30 Ga0070690_100233144 3300005330 Bacteria 1295
31 Ga0070690_100387312 3300005330 Bacteria 1023
32 Ga0070690_100529427 3300005330 Bacteria 886
33 Ga0070670_100021668 3300005331 Bacteria 5525
34 Ga0070670_100023463 3300005331 Bacteria 5310
35 Ga0070670_100151406 3300005331 Bacteria 2007
36 Ga0070670_100401835 3300005331 Bacteria 1209
37 Ga0070670_100645807 3300005331 Bacteria 949
38 Ga0070677_10000999 3300005333 Bacteria 9157
39 Ga0070677_10208222 3300005333 Bacteria 948
40 Ga0068869_100045744 3300005334 Bacteria 3153
41 Ga0068869_100091921 3300005334 Bacteria 2283
42 Ga0068869_100455567 3300005334 Bacteria 1061
43 Ga0068869_100916811 3300005334 Bacteria 759
44 Ga0070666_10043591 3300005335 Bacteria 3004
45 Ga0070666_10120410 3300005335 Bacteria 1820
46 Ga0070680_100168601 3300005336 Bacteria 1842
47 Ga0070680_101512107 3300005336 Bacteria 581
48 Ga0070682_100286970 3300005337 Bacteria 1202
49 Ga0068868_100000881 3300005338 Bacteria 20375
50 Ga0068868_100165723 3300005338 Bacteria 1828
51 Ga0068868_100316980 3300005338 Bacteria 1328
52 Ga0070660_100004031 3300005339 Bacteria 10144
53 Ga0070660_100006513 3300005339 Bacteria 8099
54 Ga0070660_100010556 3300005339 Bacteria 6527
55 Ga0070660_100022082 3300005339 Bacteria 4702
56 Ga0070660_100080308 3300005339 Bacteria 2559
57 Ga0070660_100121153 3300005339 Bacteria 2088
58 Ga0070660_100306187 3300005339 Bacteria 1303
59 Ga0070689_100237840 3300005340 Bacteria 1499
60 Ga0070689_100874312 3300005340 Bacteria 794
61 Ga0070687_100294506 3300005343 Bacteria 1027
62 Ga0070687_100378139 3300005343 Bacteria 922
63 Ga0070661_100077892 3300005344 Bacteria 2445
64 Ga0070661_100079500 3300005344 Bacteria 2420
65 Ga0070661_100092146 3300005344 Bacteria 2245
66 Ga0070661_100118586 3300005344 Bacteria 1980
67 Ga0070661_100221448 3300005344 Bacteria 1451
68 Ga0070661_100414310 3300005344 Bacteria 1067
69 Ga0070661_100453561 3300005344 Bacteria 1020
70 Ga0070661_100775135 3300005344 Bacteria 785
71 Ga0070661_100940087 3300005344 Bacteria 715
72 Ga0070692_10024658 3300005345 Bacteria 2958
73 Ga0070692_10064690 3300005345 Bacteria 1934
74 Ga0070692_10462774 3300005345 Bacteria 814
75 Ga0070668_100010358 3300005347 Bacteria 6924
76 Ga0070668_100027610 3300005347 Bacteria 4309
77 Ga0070668_100032292 3300005347 Bacteria 3984
78 Ga0070668_100161674 3300005347 Bacteria 1817
79 Ga0070668_100304141 3300005347 Bacteria 1338
80 Ga0070668_100430959 3300005347 Bacteria 1130
81 Ga0070668_100452668 3300005347 Bacteria 1104
82 Ga0070669_100002615 3300005353 Bacteria 13015
83 Ga0070669_100030619 3300005353 Bacteria 3884
84 Ga0070669_100074454 3300005353 Bacteria 2517
85 Ga0070669_100081765 3300005353 Bacteria 2407
86 Ga0070669_100821550 3300005353 Bacteria 791
87 Ga0070669_101381627 3300005353 Bacteria 611
88 Ga0070675_100004653 3300005354 Bacteria 10479
89 Ga0070675_100163451 3300005354 Bacteria 1916
90 Ga0070675_101107614 3300005354 Bacteria 728
91 Ga0070671_100004406 3300005355 Bacteria 11129
92 Ga0070671_100013680 3300005355 Bacteria 6544
93 Ga0070671_100014729 3300005355 Bacteria 6321
94 Ga0070671_100035593 3300005355 Bacteria 4125
95 Ga0070671_100040586 3300005355 Bacteria 3866
96 Ga0070671_100125193 3300005355 Bacteria 2164
97 Ga0070671_100187950 3300005355 Bacteria 1750
98 Ga0070671_100308212 3300005355 Bacteria 1348
99 Ga0070671_100643322 3300005355 Bacteria 918
100 Ga0070674_100002641 3300005356 Bacteria 9913
101 Ga0070674_100046481 3300005356 Bacteria 2970
102 Ga0070674_100060210 3300005356 Bacteria 2646
103 Ga0070673_100003488 3300005364 Bacteria 9795
104 Ga0070673_100065813 3300005364 Bacteria 2893
105 Ga0070673_100102861 3300005364 Bacteria 2356
106 Ga0070673_100144859 3300005364 Bacteria 2007
107 Ga0070673_100165338 3300005364 Bacteria 1884
108 Ga0070673_100479821 3300005364 Bacteria 1122
109 Ga0070673_101297026 3300005364 Bacteria 684
110 Ga0070688_100171660 3300005365 Bacteria 1497
111 Ga0070659_100001058 3300005366 Bacteria 20125
112 Ga0070659_100001497 3300005366 Bacteria 16828
113 Ga0070659_100001672 3300005366 Bacteria 15938
114 Ga0070659_100197158 3300005366 Bacteria 1656
115 Ga0070659_100329388 3300005366 Bacteria 1278
116 Ga0070659_100335773 3300005366 Bacteria 1265
117 Ga0070659_100355688 3300005366 Bacteria 1229
118 Ga0070667_100003302 3300005367 Bacteria 13792
119 Ga0070667_100003455 3300005367 Bacteria 13460
120 Ga0070667_100040579 3300005367 Bacteria 3903
121 Ga0070667_100056316 3300005367 Bacteria 3321
122 Ga0070667_100063842 3300005367 Bacteria 3122
123 Ga0070667_100068000 3300005367 Bacteria 3030
124 Ga0070667_100073795 3300005367 Bacteria 2909
125 Ga0070667_100331256 3300005367 Bacteria 1375
126 Ga0070667_100588176 3300005367 Bacteria 1025
127 Ga0070709_10004923 3300005434 Bacteria 7213
128 Ga0070714_100045950 3300005435 Bacteria 3702
129 Ga0070714_100048939 3300005435 Bacteria 3597
130 Ga0070714_101222361 3300005435 Bacteria 733
131 Ga0070713_100041173 3300005436 Bacteria 3762
132 Ga0070705_100395338 3300005440 Bacteria 1022
133 Ga0070700_100034056 3300005441 Bacteria 3073
134 Ga0070694_100287168 3300005444 Bacteria 1256
135 Ga0070694_100348458 3300005444 Bacteria 1147
136 Ga0070663_100006460 3300005455 Bacteria 7055
137 Ga0070663_100028142 3300005455 Bacteria 3823
138 Ga0070663_100100509 3300005455 Bacteria 2157
139 Ga0070663_100258189 3300005455 Bacteria 1381
140 Ga0070663_100266408 3300005455 Bacteria 1360
141 Ga0070663_100307328 3300005455 Bacteria 1271
142 Ga0070663_100348667 3300005455 Bacteria 1198
143 Ga0070663_100396648 3300005455 Bacteria 1127
144 Ga0070663_100794110 3300005455 Bacteria 811
145 Ga0070678_100132696 3300005456 Bacteria 1981
146 Ga0070662_100002895 3300005457 Bacteria 10656
147 Ga0070662_100008482 3300005457 Bacteria 6706
148 Ga0070662_100050029 3300005457 Bacteria 3014
149 Ga0070662_100053901 3300005457 Bacteria 2913
150 Ga0070662_100070347 3300005457 Bacteria 2578
151 Ga0070662_100177610 3300005457 Bacteria 1676
152 Ga0070662_100251782 3300005457 Bacteria 1420
153 Ga0070662_100327368 3300005457 Bacteria 1251
154 Ga0070681_10149323 3300005458 Bacteria 2264
155 Ga0070681_10427998 3300005458 Bacteria 1236
156 Ga0068867_100005296 3300005459 Bacteria 9108
157 Ga0068867_100006073 3300005459 Bacteria 8562
158 Ga0068867_100099499 3300005459 Bacteria 2219
159 Ga0068867_100120324 3300005459 Bacteria 2028
160 Ga0068867_100155741 3300005459 Bacteria 1798
161 Ga0068867_100156551 3300005459 Bacteria 1794
162 Ga0068867_100728036 3300005459 Bacteria 878
163 Ga0070685_10131747 3300005466 Bacteria 1564
164 Ga0070679_100129150 3300005530 Bacteria 2508
165 Ga0070679_100303524 3300005530 Bacteria 1547
166 Ga0070679_100418171 3300005530 Bacteria 1286
167 Ga0068853_100007792 3300005539 Bacteria 8589
168 Ga0068853_100033639 3300005539 Bacteria 4350
169 Ga0068853_100118282 3300005539 Bacteria 2361
170 Ga0068853_100185963 3300005539 Bacteria 1886
171 Ga0070672_100003490 3300005543 Bacteria 10188
172 Ga0070672_100008903 3300005543 Bacteria 6895
173 Ga0070672_100081691 3300005543 Bacteria 2591
174 Ga0070672_100109649 3300005543 Bacteria 2248
175 Ga0070672_100457398 3300005543 Bacteria 1100
176 Ga0070672_100482430 3300005543 Bacteria 1071
177 Ga0070672_100619425 3300005543 Bacteria 944
178 Ga0070686_100519189 3300005544 Bacteria 927
179 Ga0070686_100611490 3300005544 Bacteria 860
180 Ga0070695_100329580 3300005545 Bacteria 1137
181 Ga0070696_100271458 3300005546 Bacteria 1290
182 Ga0070693_100060368 3300005547 Bacteria 2201
183 Ga0070693_100075771 3300005547 Bacteria 1993
184 Ga0070693_100183163 3300005547 Bacteria 1350
185 Ga0070693_100782394 3300005547 Bacteria 706
186 Ga0070665_100012854 3300005548 Bacteria 8428
187 Ga0070665_100274026 3300005548 Bacteria 1689
188 Ga0070665_100628837 3300005548 Bacteria 1086
189 Ga0070665_100969566 3300005548 Bacteria 863
190 Ga0070665_101347760 3300005548 Bacteria 723
191 Ga0068855_100031999 3300005563 Bacteria 6280
192 Ga0068855_100554548 3300005563 Bacteria 1244
193 Ga0070664_100025432 3300005564 Bacteria 4907
194 Ga0070664_100029545 3300005564 Bacteria 4570
195 Ga0070664_100035533 3300005564 Bacteria 4183
196 Ga0070664_100039633 3300005564 Bacteria 3970
197 Ga0070664_100047598 3300005564 Bacteria 3623
198 Ga0070664_100066220 3300005564 Bacteria 3084
199 Ga0070664_100115285 3300005564 Bacteria 2348
200 Ga0070664_100135938 3300005564 Bacteria 2161
201 Ga0070664_100175131 3300005564 Bacteria 1904
202 Ga0070664_100182252 3300005564 Bacteria 1867
203 Ga0068857_100003503 3300005577 Bacteria 13106
204 Ga0068857_100045474 3300005577 Bacteria 3895
205 Ga0068857_100051053 3300005577 Bacteria 3667
206 Ga0068857_100219570 3300005577 Bacteria 1736
207 Ga0068857_101142212 3300005577 Bacteria 753
208 Ga0068854_100004302 3300005578 Bacteria 8970
209 Ga0068854_100037092 3300005578 Bacteria 3419
210 Ga0068854_100071112 3300005578 Bacteria 2544
211 Ga0068854_100100937 3300005578 Bacteria 2163
212 Ga0068854_100388055 3300005578 Bacteria 1152
213 Ga0068854_100545485 3300005578 Bacteria 983
214 Ga0068856_100033259 3300005614 Bacteria 5048
215 Ga0068856_100034293 3300005614 Bacteria 4971
216 Ga0068856_100080624 3300005614 Bacteria 3228
217 Ga0068856_100119211 3300005614 Bacteria 2640
218 Ga0068856_100327431 3300005614 Bacteria 1550
219 Ga0068856_100394677 3300005614 Bacteria 1403
220 Ga0068856_100753644 3300005614 Bacteria 994
221 Ga0070702_100289376 3300005615 Bacteria 1128
222 Ga0070702_100622095 3300005615 Bacteria 813
223 Ga0068852_100001990 3300005616 Bacteria 13925
224 Ga0068852_100024314 3300005616 Bacteria 4894
225 Ga0068852_100050120 3300005616 Bacteria 3576
226 Ga0068852_100068158 3300005616 Bacteria 3113
227 Ga0068852_100256482 3300005616 Bacteria 1677
228 Ga0068852_100722874 3300005616 Bacteria 1007
229 Ga0068859_100008163 3300005617 Bacteria 10621
230 Ga0068859_100012474 3300005617 Bacteria 8547
231 Ga0068859_100036370 3300005617 Bacteria 4943
232 Ga0068859_100142831 3300005617 Bacteria 2467
233 Ga0068859_100162923 3300005617 Bacteria 2309
234 Ga0068859_100164555 3300005617 Bacteria 2298
235 Ga0068859_101131378 3300005617 Bacteria 862
236 Ga0068859_101265103 3300005617 Bacteria 813
237 Ga0068864_100003128 3300005618 Bacteria 13675
238 Ga0068864_100221533 3300005618 Bacteria 1746
239 Ga0068864_100290357 3300005618 Bacteria 1529
240 Ga0068866_10137169 3300005718 Bacteria 1399
241 Ga0068866_10348395 3300005718 Bacteria 940
242 Ga0068866_10412079 3300005718 Bacteria 874
243 Ga0068861_100004768 3300005719 Bacteria 9116
244 Ga0068861_100320117 3300005719 Bacteria 1350
245 Ga0068861_100326971 3300005719 Bacteria 1337
246 Ga0068861_100414096 3300005719 Bacteria 1199
247 Ga0068861_100440753 3300005719 Bacteria 1165
248 Ga0068861_100602286 3300005719 Bacteria 1009
249 Ga0068851_10024620 3300005834 Bacteria 2948
250 Ga0068851_10069144 3300005834 Bacteria 1823
251 Ga0068851_10099492 3300005834 Bacteria 1541
252 Ga0068851_10107123 3300005834 Bacteria 1489
253 Ga0068870_10073710 3300005840 Bacteria 1868
254 Ga0068870_10129155 3300005840 Bacteria 1466
255 Ga0068863_100037056 3300005841 Bacteria 4644
256 Ga0068863_100082035 3300005841 Bacteria 3055
257 Ga0068863_100411949 3300005841 Bacteria 1323
258 Ga0068863_100502325 3300005841 Bacteria 1194
259 Ga0068863_100528036 3300005841 Bacteria 1164
260 Ga0068863_100546393 3300005841 Bacteria 1143
261 Ga0068858_100005468 3300005842 Bacteria 12438
262 Ga0068858_100005690 3300005842 Bacteria 12183
263 Ga0068858_100015129 3300005842 Bacteria 7256
264 Ga0068858_100017238 3300005842 Bacteria 6776
265 Ga0068858_100022221 3300005842 Bacteria 5923
266 Ga0068860_100012703 3300005843 Bacteria 8285
267 Ga0068860_100059624 3300005843 Bacteria 3628
268 Ga0068860_100388980 3300005843 Bacteria 1378
269 Ga0068860_100697212 3300005843 Bacteria 1025
270 Ga0068862_100005443 3300005844 Bacteria 10639
271 Ga0068862_100009248 3300005844 Bacteria 8159
272 Ga0068862_100009717 3300005844 Bacteria 7951
273 Ga0068862_100063009 3300005844 Bacteria 3190
274 Ga0068862_100128028 3300005844 Bacteria 2243
275 Ga0068862_100721894 3300005844 Bacteria 967
276 Ga0070716_100044247 3300006173 Bacteria 2493
277 Ga0070712_100619233 3300006175 Bacteria 917
278 Ga0097621_100014323 3300006237 Bacteria 5932
279 Ga0097621_100218325 3300006237 Bacteria 1660
280 Ga0068871_100006417 3300006358 Bacteria 8321
281 Ga0068871_100105553 3300006358 Bacteria 2364
282 Ga0068871_100112809 3300006358 Bacteria 2288
283 Ga0068871_100125634 3300006358 Bacteria 2171
284 Ga0075433_10011424 3300006852 Bacteria 7152
285 Ga0075434_100510961 3300006871 Bacteria 1222
286 Ga0075434_100791979 3300006871 Bacteria 964
287 Ga0068865_100033541 3300006881 Bacteria 3438
288 Ga0068865_100157238 3300006881 Bacteria 1730
289 Ga0068865_100251528 3300006881 Bacteria 1395
290 Ga0068865_100329609 3300006881 Bacteria 1230
291 Ga0068865_100731295 3300006881 Bacteria 848
292 Ga0075436_100213878 3300006914 Bacteria 1367
293 Ga0097620_100008163 3300006931 Bacteria 10621
294 Ga0097620_100012475 3300006931 Bacteria 8547
295 Ga0097620_100036370 3300006931 Bacteria 4943
296 Ga0097620_100142837 3300006931 Bacteria 2467
297 Ga0097620_100162921 3300006931 Bacteria 2309
298 Ga0097620_100164561 3300006931 Bacteria 2298
299 Ga0097620_101131388 3300006931 Bacteria 862
300 Ga0097620_101264927 3300006931 Bacteria 813
301 Ga0075435_100261170 3300007076 Bacteria 1476
302 Ga0105240_10109964 3300009093 Bacteria 3336
303 Ga0111539_10072986 3300009094 Bacteria 4046
304 Ga0111539_10736500 3300009094 Bacteria 1147
305 Ga0105245_10000285 3300009098 Bacteria 48237
306 Ga0105245_10021177 3300009098 Bacteria 5701
307 Ga0114129_10357020 3300009147 Bacteria 1935
308 Ga0105241_10042296 3300009174 Bacteria 3446
309 Ga0105241_10144371 3300009174 Bacteria 1941
310 Ga0105248_10020125 3300009177 Bacteria 7394
311 Ga0105248_10046924 3300009177 Bacteria 4843
312 Ga0105248_10051371 3300009177 Bacteria 4625
313 Ga0105248_10088873 3300009177 Bacteria 3477
314 Ga0105248_10197743 3300009177 Bacteria 2265
315 Ga0105248_10608041 3300009177 Bacteria 1233
316 Ga0105248_11964412 3300009177 Bacteria 664
317 Ga0105237_10024240 3300009545 Bacteria 6208
318 Ga0105238_10110443 3300009551 Bacteria 2730
319 Ga0105238_10611228 3300009551 Bacteria 1098
320 Ga0105238_10743978 3300009551 Bacteria 994
321 Ga0105249_10010129 3300009553 Bacteria 8276
322 Ga0105249_10024423 3300009553 Bacteria 5432
323 Ga0105249_10113737 3300009553 Bacteria 2562
324 Ga0105249_10125011 3300009553 Bacteria 2448
325 Ga0105249_10309443 3300009553 Bacteria 1587
326 Ga0105249_10338919 3300009553 Bacteria 1520
327 Ga0105249_10384045 3300009553 Bacteria 1431
328 Ga0105239_10064925 3300010375 Bacteria 4008
329 Ga0105239_11480589 3300010375 Unclassified 784
330 Ga0105246_10012160 3300011119 Bacteria 5365
331 Ga0105246_10156921 3300011119 Bacteria 1729
332 Ga0157373_10011849 3300013100 Bacteria 6405
333 Ga0157373_10012019 3300013100 Bacteria 6364
334 Ga0157373_10016553 3300013100 Bacteria 5376
335 Ga0157373_10030375 3300013100 Bacteria 3888
336 Ga0157373_10116265 3300013100 Bacteria 1880
337 Ga0157373_10185086 3300013100 Bacteria 1467
338 Ga0157371_10002316 3300013102 Bacteria 18311
339 Ga0157371_10263314 3300013102 Bacteria 1243
340 Ga0157371_10366232 3300013102 Bacteria 1051
341 Ga0157370_10134409 3300013104 Bacteria 2306
342 Ga0157370_10619460 3300013104 Bacteria 990
343 Ga0157370_11060271 3300013104 Bacteria 733
344 Ga0157369_10048804 3300013105 Bacteria 4592
345 Ga0157369_10100375 3300013105 Bacteria 3085
346 Ga0157374_10054329 3300013296 Bacteria 3736
347 Ga0157374_10867581 3300013296 Bacteria 920
348 Ga0157378_10001258 3300013297 Bacteria 22842
349 Ga0157378_10186971 3300013297 Bacteria 1951
350 Ga0157378_10482727 3300013297 Bacteria 1235
351 Ga0163162_10037174 3300013306 Bacteria 4857
352 Ga0163162_10161998 3300013306 Bacteria 2359
353 Ga0163162_10391485 3300013306 Bacteria 1522
354 Ga0163162_10437872 3300013306 Bacteria 1439
355 Ga0163162_10820375 3300013306 Bacteria 1047
356 Ga0163162_11016229 3300013306 Bacteria 938
357 Ga0157372_10031246 3300013307 Bacteria 5830
358 Ga0157372_10317258 3300013307 Bacteria 1814
359 Ga0157372_10619193 3300013307 Bacteria 1261
360 Ga0157372_10734106 3300013307 Bacteria 1148
361 Ga0157375_10004348 3300013308 Bacteria 12300
362 Ga0157375_10058033 3300013308 Bacteria 3828
363 Ga0157375_10205827 3300013308 Bacteria 2124
364 Ga0157375_10398105 3300013308 Bacteria 1544
365 Ga0157375_10875080 3300013308 Bacteria 1044
366 Ga0157375_12579454 3300013308 Bacteria 607
367 Ga0163163_10091516 3300014325 Bacteria 3056
368 Ga0163163_10189906 3300014325 Bacteria 2103
369 Ga0157380_10005051 3300014326 Bacteria 9205
370 Ga0157380_10108324 3300014326 Bacteria 2329
371 Ga0157380_10226606 3300014326 Bacteria 1676
372 Ga0157379_10125893 3300014968 Bacteria 2305
373 Ga0163161_10000753 3300017792 Bacteria 25411
374 Ga0163161_10210395 3300017792 Bacteria 1502
375 Ga0207666_1004870 3300025271 Bacteria 1697
376 Ga0207673_1003610 3300025290 Bacteria 1818
377 Ga0207697_10000158 3300025315 Bacteria 33821
378 Ga0207697_10002568 3300025315 Bacteria 9344
379 Ga0207697_10035271 3300025315 Bacteria 2047
380 Ga0207697_10068977 3300025315 Bacteria 1480
381 Ga0207656_10015597 3300025321 Bacteria 2943
382 Ga0207682_10001693 3300025893 Bacteria 10102
383 Ga0207682_10093071 3300025893 Bacteria 1309
384 Ga0207642_10391403 3300025899 Bacteria 830
385 Ga0207710_10139445 3300025900 Bacteria 1170
386 Ga0207688_10000317 3300025901 Bacteria 22230
387 Ga0207688_10024903 3300025901 Bacteria 3283
388 Ga0207688_10081281 3300025901 Bacteria 1851
389 Ga0207688_10278317 3300025901 Bacteria 1019
390 Ga0207688_10325488 3300025901 Bacteria 944
391 Ga0207680_10023816 3300025903 Bacteria 3350
392 Ga0207680_10083708 3300025903 Bacteria 2011
393 Ga0207680_10451379 3300025903 Bacteria 912
394 Ga0207680_10688954 3300025903 Bacteria 732
395 Ga0207647_10000253 3300025904 Bacteria 43758
396 Ga0207647_10083225 3300025904 Bacteria 1916
397 Ga0207645_10002074 3300025907 Bacteria 16043
398 Ga0207645_10026481 3300025907 Bacteria 3746
399 Ga0207645_10027619 3300025907 Bacteria 3663
400 Ga0207645_10035096 3300025907 Bacteria 3220
401 Ga0207645_10128078 3300025907 Bacteria 1651
402 Ga0207645_10138155 3300025907 Bacteria 1587
403 Ga0207645_10159546 3300025907 Bacteria 1475
404 Ga0207645_10214075 3300025907 Bacteria 1269
405 Ga0207643_10052521 3300025908 Bacteria 2315
406 Ga0207643_10418670 3300025908 Bacteria 849
407 Ga0207705_10016274 3300025909 Bacteria 5334
408 Ga0207705_10039435 3300025909 Bacteria 3385
409 Ga0207705_10043066 3300025909 Bacteria 3242
410 Ga0207705_10046964 3300025909 Bacteria 3104
411 Ga0207705_10097504 3300025909 Bacteria 2159
412 Ga0207705_10108167 3300025909 Bacteria 2052
413 Ga0207705_10145067 3300025909 Bacteria 1775
414 Ga0207705_10170976 3300025909 Bacteria 1636
415 Ga0207705_10362739 3300025909 Bacteria 1117
416 Ga0207705_10724521 3300025909 Bacteria 773
417 Ga0207654_10152514 3300025911 Bacteria 1484
418 Ga0207707_10169859 3300025912 Bacteria 1906
419 Ga0207707_10992692 3300025912 Bacteria 689
420 Ga0207671_10195065 3300025914 Bacteria 1580
421 Ga0207693_10058526 3300025915 Bacteria 3018
422 Ga0207660_10243517 3300025917 Bacteria 1417
423 Ga0207662_10213130 3300025918 Bacteria 1254
424 Ga0207662_10286789 3300025918 Bacteria 1091
425 Ga0207657_10002291 3300025919 Bacteria 20732
426 Ga0207657_10011406 3300025919 Bacteria 8823
427 Ga0207657_10019294 3300025919 Bacteria 6479
428 Ga0207657_10030898 3300025919 Bacteria 4855
429 Ga0207657_10042043 3300025919 Bacteria 4036
430 Ga0207657_10045766 3300025919 Bacteria 3837
431 Ga0207657_10047166 3300025919 Bacteria 3769
432 Ga0207657_10059739 3300025919 Bacteria 3274
433 Ga0207657_10065000 3300025919 Bacteria 3111
434 Ga0207657_10068358 3300025919 Bacteria 3018
435 Ga0207649_10018682 3300025920 Bacteria 3948
436 Ga0207649_10043290 3300025920 Bacteria 2752
437 Ga0207649_10103742 3300025920 Bacteria 1887
438 Ga0207649_10146307 3300025920 Bacteria 1622
439 Ga0207649_10210951 3300025920 Bacteria 1378
440 Ga0207649_10290304 3300025920 Bacteria 1192
441 Ga0207649_10325052 3300025920 Bacteria 1131
442 Ga0207649_10341208 3300025920 Bacteria 1106
443 Ga0207649_10342527 3300025920 Bacteria 1104
444 Ga0207649_10970190 3300025920 Bacteria 668
445 Ga0207652_10220732 3300025921 Bacteria 1708
446 Ga0207652_10375825 3300025921 Bacteria 1283
447 Ga0207652_10537128 3300025921 Bacteria 1051
448 Ga0207681_10027069 3300025923 Bacteria 3705
449 Ga0207681_10030507 3300025923 Bacteria 3515
450 Ga0207681_10061807 3300025923 Bacteria 2576
451 Ga0207681_10213239 3300025923 Bacteria 1489
452 Ga0207694_10392709 3300025924 Bacteria 1153
453 Ga0207650_10003054 3300025925 Bacteria 11531
454 Ga0207650_10018631 3300025925 Bacteria 4873
455 Ga0207650_10101953 3300025925 Bacteria 2210
456 Ga0207650_10279773 3300025925 Bacteria 1358
457 Ga0207650_10520785 3300025925 Bacteria 995
458 Ga0207659_10018172 3300025926 Bacteria 4605
459 Ga0207659_10127013 3300025926 Bacteria 1963
460 Ga0207659_10300153 3300025926 Bacteria 1319
461 Ga0207687_10031400 3300025927 Bacteria 3589
462 Ga0207664_10021302 3300025929 Bacteria 4817
463 Ga0207664_10041131 3300025929 Bacteria 3600
464 Ga0207664_10993026 3300025929 Bacteria 752
465 Ga0207664_11547157 3300025929 Bacteria 585
466 Ga0207644_10005273 3300025931 Bacteria 8437
467 Ga0207644_10007766 3300025931 Bacteria 7003
468 Ga0207644_10010963 3300025931 Bacteria 5987
469 Ga0207644_10020310 3300025931 Bacteria 4516
470 Ga0207644_10030225 3300025931 Bacteria 3765
471 Ga0207644_10108980 3300025931 Bacteria 2091
472 Ga0207644_10566374 3300025931 Bacteria 941
473 Ga0207690_10011180 3300025932 Bacteria 5358
474 Ga0207690_10057356 3300025932 Bacteria 2631
475 Ga0207690_10096713 3300025932 Bacteria 2100
476 Ga0207690_10201824 3300025932 Bacteria 1511
477 Ga0207690_10300446 3300025932 Bacteria 1256
478 Ga0207690_10459685 3300025932 Bacteria 1024
479 Ga0207690_10486476 3300025932 Bacteria 997
480 Ga0207706_10000434 3300025933 Bacteria 44818
481 Ga0207706_10000643 3300025933 Bacteria 37034
482 Ga0207706_10035989 3300025933 Bacteria 4399
483 Ga0207706_10044379 3300025933 Bacteria 3940
484 Ga0207706_10046085 3300025933 Bacteria 3861
485 Ga0207706_10139178 3300025933 Bacteria 2135
486 Ga0207706_10219339 3300025933 Bacteria 1665
487 Ga0207709_10253862 3300025935 Bacteria 1286
488 Ga0207669_10013845 3300025937 Bacteria 4024
489 Ga0207669_10091532 3300025937 Bacteria 1981
490 Ga0207704_10126284 3300025938 Bacteria 1762
491 Ga0207704_10580661 3300025938 Bacteria 915
492 Ga0207665_10043994 3300025939 Bacteria 2987
493 Ga0207691_10000848 3300025940 Bacteria 30357
494 Ga0207691_10000852 3300025940 Bacteria 30260
495 Ga0207691_10019525 3300025940 Bacteria 6412
496 Ga0207691_10107428 3300025940 Bacteria 2484
497 Ga0207691_10156533 3300025940 Bacteria 2001
498 Ga0207691_10538504 3300025940 Bacteria 990
499 Ga0207691_10816601 3300025940 Bacteria 783
500 Ga0207711_10003912 3300025941 Bacteria 12815
501 Ga0207711_10018660 3300025941 Bacteria 5767
502 Ga0207711_10071281 3300025941 Bacteria 3015
503 Ga0207689_10000017 3300025942 Bacteria 117159
504 Ga0207689_10030990 3300025942 Bacteria 4455
505 Ga0207689_10035239 3300025942 Bacteria 4158
506 Ga0207689_10044482 3300025942 Bacteria 3671
507 Ga0207661_10297569 3300025944 Bacteria 1446
508 Ga0207661_10750479 3300025944 Bacteria 898
509 Ga0207679_10046450 3300025945 Bacteria 3148
510 Ga0207679_10057851 3300025945 Bacteria 2870
511 Ga0207679_10129703 3300025945 Bacteria 2021
512 Ga0207679_10239311 3300025945 Bacteria 1537
513 Ga0207679_10291908 3300025945 Bacteria 1402
514 Ga0207679_10347057 3300025945 Bacteria 1292
515 Ga0207679_10433273 3300025945 Bacteria 1163
516 Ga0207679_10596421 3300025945 Bacteria 995
517 Ga0207679_10622649 3300025945 Bacteria 974
518 Ga0207679_10670877 3300025945 Bacteria 939
519 Ga0207667_10040202 3300025949 Bacteria 4980
520 Ga0207667_10144280 3300025949 Bacteria 2451
521 Ga0207667_10258564 3300025949 Bacteria 1780
522 Ga0207651_10006199 3300025960 Bacteria 6227
523 Ga0207651_10105685 3300025960 Bacteria 2101
524 Ga0207651_10126106 3300025960 Bacteria 1951
525 Ga0207651_10144365 3300025960 Bacteria 1843
526 Ga0207651_10178665 3300025960 Bacteria 1681
527 Ga0207651_10186524 3300025960 Bacteria 1651
528 Ga0207651_11025459 3300025960 Bacteria 738
529 Ga0207712_10008327 3300025961 Bacteria 6555
530 Ga0207712_10116830 3300025961 Bacteria 2011
531 Ga0207712_10520344 3300025961 Bacteria 1019
532 Ga0207668_10000223 3300025972 Bacteria 38523
533 Ga0207668_10002049 3300025972 Bacteria 11759
534 Ga0207668_10013108 3300025972 Bacteria 5096
535 Ga0207668_10157443 3300025972 Bacteria 1766
536 Ga0207668_10173511 3300025972 Bacteria 1693
537 Ga0207668_10179524 3300025972 Bacteria 1668
538 Ga0207668_10259117 3300025972 Bacteria 1416
539 Ga0207640_10003828 3300025981 Bacteria 8117
540 Ga0207640_10065521 3300025981 Bacteria 2424
541 Ga0207640_10286453 3300025981 Bacteria 1297
542 Ga0207640_10353592 3300025981 Bacteria 1181
543 Ga0207658_10008048 3300025986 Bacteria 7182
544 Ga0207658_10034535 3300025986 Bacteria 3615
545 Ga0207658_10035614 3300025986 Bacteria 3566
546 Ga0207658_10068482 3300025986 Bacteria 2678
547 Ga0207658_10104199 3300025986 Bacteria 2228
548 Ga0207658_10173408 3300025986 Bacteria 1779
549 Ga0207658_10238712 3300025986 Bacteria 1538
550 Ga0207658_10558136 3300025986 Bacteria 1025
551 Ga0207658_10643497 3300025986 Bacteria 955
552 Ga0207677_10042390 3300026023 Bacteria 3017
553 Ga0207703_10002927 3300026035 Bacteria 14530
554 Ga0207703_10057641 3300026035 Bacteria 3168
555 Ga0207639_10040564 3300026041 Bacteria 3475
556 Ga0207639_10055955 3300026041 Bacteria 3021
557 Ga0207639_10186625 3300026041 Bacteria 1768
558 Ga0207639_10234929 3300026041 Bacteria 1591
559 Ga0207639_10304656 3300026041 Bacteria 1409
560 Ga0207639_10386680 3300026041 Bacteria 1258
561 Ga0207678_10009957 3300026067 Bacteria 8340
562 Ga0207678_10014935 3300026067 Bacteria 6832
563 Ga0207678_10028426 3300026067 Bacteria 4882
564 Ga0207678_10029181 3300026067 Bacteria 4815
565 Ga0207678_10083355 3300026067 Bacteria 2735
566 Ga0207678_10108507 3300026067 Bacteria 2368
567 Ga0207678_10200088 3300026067 Bacteria 1708
568 Ga0207678_10459229 3300026067 Bacteria 1108
569 Ga0207702_10012040 3300026078 Bacteria 7192
570 Ga0207702_10196688 3300026078 Bacteria 1866
571 Ga0207702_10227452 3300026078 Bacteria 1741
572 Ga0207702_10881061 3300026078 Bacteria 887
573 Ga0207702_11485388 3300026078 Bacteria 671
574 Ga0207641_10016993 3300026088 Bacteria 5956
575 Ga0207641_10019912 3300026088 Bacteria 5508
576 Ga0207641_10113956 3300026088 Bacteria 2401
577 Ga0207641_10649009 3300026088 Bacteria 1036
578 Ga0207641_10653234 3300026088 Bacteria 1033
579 Ga0207648_10001216 3300026089 Bacteria 28854
580 Ga0207648_10006444 3300026089 Bacteria 11662
581 Ga0207648_10097123 3300026089 Bacteria 2578
582 Ga0207648_10106101 3300026089 Bacteria 2465
583 Ga0207648_10532373 3300026089 Bacteria 1077
584 Ga0207676_10003642 3300026095 Bacteria 10901
585 Ga0207676_10005620 3300026095 Bacteria 8874
586 Ga0207676_10012995 3300026095 Bacteria 5978
587 Ga0207676_10606861 3300026095 Bacteria 1052
588 Ga0207676_10866113 3300026095 Bacteria 884
589 Ga0207674_10004077 3300026116 Bacteria 17703
590 Ga0207674_10007596 3300026116 Bacteria 12631
591 Ga0207674_10044074 3300026116 Bacteria 4597
592 Ga0207674_10052412 3300026116 Bacteria 4162
593 Ga0207674_10196538 3300026116 Bacteria 1966
594 Ga0207675_100025642 3300026118 Bacteria 5486
595 Ga0207675_100387047 3300026118 Bacteria 1376
596 Ga0207675_100493467 3300026118 Bacteria 1218
597 Ga0207675_100520192 3300026118 Bacteria 1186
598 Ga0207675_100538729 3300026118 Bacteria 1165
599 Ga0207683_10006197 3300026121 Bacteria 10251
600 Ga0207683_10092191 3300026121 Bacteria 2700
601 Ga0207698_10018409 3300026142 Bacteria 4758
602 Ga0207698_10020485 3300026142 Bacteria 4554
603 Ga0207698_10184857 3300026142 Bacteria 1850
604 Ga0207698_10411484 3300026142 Bacteria 1295
605 Ga0209974_10121778 3300027876 Bacteria 925
606 Ga0207428_10462014 3300027907 Bacteria 925
607 Ga0268266_10005814 3300028379 Bacteria 11417
608 Ga0268266_10009325 3300028379 Bacteria 8653
609 Ga0268266_10156875 3300028379 Bacteria 2056
610 Ga0268266_10264521 3300028379 Bacteria 1595
611 Ga0268265_10001836 3300028380 Bacteria 16950
612 Ga0268265_10004795 3300028380 Bacteria 9321
613 Ga0268265_10023329 3300028380 Bacteria 4360
614 Ga0268265_10024003 3300028380 Bacteria 4307
615 Ga0268265_10119081 3300028380 Bacteria 2172
616 Ga0268265_10323675 3300028380 Bacteria 1397
617 Ga0268265_10432723 3300028380 Bacteria 1224
618 Ga0268265_10727765 3300028380 Bacteria 961
619 Ga0268265_11977389 3300028380 Bacteria 590
620 Ga0268264_10008809 3300028381 Bacteria 8368
621 Ga0268264_10112581 3300028381 Bacteria 2386
622 Ga0268264_10126648 3300028381 Bacteria 2258
623 Ga0268264_10419922 3300028381 Bacteria 1289
624 Ga0268264_10795517 3300028381 Bacteria 944
625 Ga0307408_100017171 3300031548 Bacteria 4842
626 Ga0307408_100162669 3300031548 Bacteria 1774
627 Ga0307405_10027843 3300031731 Bacteria 3283
628 Ga0307405_10035968 3300031731 Bacteria 2963
629 Ga0307405_10068674 3300031731 Bacteria 2269
630 Ga0307413_10001438 3300031824 Bacteria 9021
631 Ga0307413_10018300 3300031824 Bacteria 3672
632 Ga0307413_10036235 3300031824 Bacteria 2838
633 Ga0307413_10061660 3300031824 Bacteria 2315
634 Ga0307413_10099897 3300031824 Bacteria 1914
635 Ga0307413_10272732 3300031824 Bacteria 1267
636 Ga0307413_10584816 3300031824 Bacteria 911
637 Ga0307413_10664031 3300031824 Unclassified 861
638 Ga0307413_11634054 3300031824 Bacteria 573
639 Ga0307410_10003596 3300031852 Bacteria 7809
640 Ga0307410_10102415 3300031852 Bacteria 2054
641 Ga0307410_10107957 3300031852 Bacteria 2009
642 Ga0307410_10120784 3300031852 Bacteria 1910
643 Ga0307410_10292254 3300031852 Bacteria 1283
644 Ga0307410_10323010 3300031852 Bacteria 1225
645 Ga0307410_10903272 3300031852 Bacteria 757
646 Ga0307406_10023830 3300031901 Bacteria 3647
647 Ga0307406_10028520 3300031901 Bacteria 3373
648 Ga0307406_10049479 3300031901 Bacteria 2660
649 Ga0307406_10879292 3300031901 Bacteria 761
650 Ga0307407_10031384 3300031903 Bacteria 2877
651 Ga0307407_10079831 3300031903 Bacteria 1975
652 Ga0307407_10154385 3300031903 Bacteria 1495
653 Ga0307407_10437810 3300031903 Bacteria 946
654 Ga0307407_10468582 3300031903 Bacteria 918
655 Ga0307407_10626557 3300031903 Bacteria 803
656 Ga0307412_10003166 3300031911 Bacteria 9145
657 Ga0307412_10021619 3300031911 Bacteria 3933
658 Ga0307412_10040504 3300031911 Bacteria 3014
659 Ga0307412_10040782 3300031911 Bacteria 3005
660 Ga0307412_10123510 3300031911 Bacteria 1868
661 Ga0307412_10126569 3300031911 Bacteria 1849
662 Ga0307412_10139254 3300031911 Bacteria 1775
663 Ga0307412_10145585 3300031911 Bacteria 1741
664 Ga0307409_100012427 3300031995 Bacteria 5425
665 Ga0307409_100071970 3300031995 Bacteria 2751
666 Ga0307409_100092353 3300031995 Bacteria 2483
667 Ga0307409_100110065 3300031995 Bacteria 2308
668 Ga0307409_100206867 3300031995 Bacteria 1760
669 Ga0307409_100248552 3300031995 Bacteria 1624
670 Ga0307409_100261875 3300031995 Bacteria 1587
671 Ga0307409_100512531 3300031995 Bacteria 1170
672 Ga0307409_100940745 3300031995 Bacteria 880
673 Ga0307416_100019713 3300032002 Bacteria 4790
674 Ga0307416_100069269 3300032002 Bacteria 2919
675 Ga0307416_100095314 3300032002 Bacteria 2569
676 Ga0307416_100110262 3300032002 Bacteria 2423
677 Ga0307416_100251120 3300032002 Bacteria 1721
678 Ga0307416_100269105 3300032002 Bacteria 1671
679 Ga0307416_100323330 3300032002 Bacteria 1546
680 Ga0307416_100342345 3300032002 Bacteria 1509
681 Ga0307416_100393236 3300032002 Bacteria 1421
682 Ga0307416_100754779 3300032002 Bacteria 1066
683 Ga0307416_101098934 3300032002 Bacteria 900
684 Ga0307414_10011458 3300032004 Bacteria 5201
685 Ga0307414_10062534 3300032004 Bacteria 2642
686 Ga0307414_10076654 3300032004 Bacteria 2430
687 Ga0307414_10112593 3300032004 Bacteria 2075
688 Ga0307414_10184606 3300032004 Bacteria 1681
689 Ga0307414_10215482 3300032004 Bacteria 1573
690 Ga0307414_10316850 3300032004 Bacteria 1326
691 Ga0307414_10416692 3300032004 Bacteria 1170
692 Ga0307414_10442417 3300032004 Bacteria 1138
693 Ga0307414_10500915 3300032004 Bacteria 1075
694 Ga0307414_11823705 3300032004 Bacteria 567
695 Ga0307411_10010399 3300032005 Bacteria 4957
696 Ga0307411_10010853 3300032005 Bacteria 4881
697 Ga0307411_10034033 3300032005 Bacteria 3166
698 Ga0307411_10060334 3300032005 Bacteria 2518
699 Ga0307411_10067388 3300032005 Bacteria 2408
700 Ga0307411_10186000 3300032005 Bacteria 1581
701 Ga0307411_10605556 3300032005 Bacteria 942
702 Ga0307411_11497776 3300032005 Unclassified 620
703 Ga0307415_100015345 3300032126 Bacteria 4533
704 Ga0307415_100042531 3300032126 Bacteria 3024
705 Ga0307415_100087449 3300032126 Bacteria 2245
706 Ga0307415_100097844 3300032126 Bacteria 2143
707 Ga0307415_100157722 3300032126 Bacteria 1755
708 Ga0307415_100176127 3300032126 Bacteria 1673
709 Ga0307415_100275699 3300032126 Bacteria 1380
710 Ga0307415_101111476 3300032126 Bacteria 740
711 Ga0373928_0120256 3300035084 Bacteria 703
712 Ga0373940_0039047 3300035088 Bacteria 1298
713 Ga0373943_0379166 3300035170 Bacteria 814
714 Ga0373961_0134814 3300035241 Bacteria 830
715 Ga0373931_0106924 3300035691 Bacteria 1582
716 Ga0373935_0104235 3300035692 Bacteria 1874
717 Ga0395899_0018993 3300037312 Bacteria 5223
718 Ga0395899_0426216 3300037312 Bacteria 873
719 Ga0395900_0000995 3300037418 Bacteria 36856
720 Ga0395900_0959091 3300037418 Bacteria 776
721 Ga0395898_0139400 3300037466 Bacteria 2322
722 Ga0395905_0000538 3300037471 Bacteria 51665
723 Ga0395905_0001688 3300037471 Bacteria 26037
724 Ga0395905_0070915 3300037471 Bacteria 3266
725 Ga0395905_0072272 3300037471 Bacteria 3234
726 Ga0395905_0206676 3300037471 Bacteria 1840
727 Ga0395905_0238254 3300037471 Bacteria 1700
728 Ga0395905_0272120 3300037471 Bacteria 1580
729 Ga0395905_0273431 3300037471 Bacteria 1575
730 Ga0395905_0416594 3300037471 Bacteria 1239
731 Ga0436364_0996148 3300037853 Bacteria 15568
732 Ga0395901_0002926 3300038443 Bacteria 17249
733 Ga0395901_0075005 3300038443 Bacteria 3528
734 Ga0395901_0129440 3300038443 Bacteria 2652
735 Ga0395901_0345500 3300038443 Bacteria 1536
736 Ga0395901_0362197 3300038443 Bacteria 1495
737 Ga0436363_0512431 3300039450 Bacteria 739
738 Ga0439455_0206100 3300042012 Bacteria 570
739 Ga0439464_0011183 3300042439 Bacteria 2374
740 Ga0466972_0060740 3300044658 Bacteria 1813
741 Ga0466966_0006596 3300044684 Bacteria 7685
742 Ga0466966_0109592 3300044684 Bacteria 1703
743 Ga0466961_0086810 3300044693 Bacteria 1977
744 Ga0466963_0013165 3300044694 Bacteria 5075
745 Ga0466963_0255861 3300044694 Bacteria 1229
746 Ga0466963_0644470 3300044694 Bacteria 748
747 Ga0466964_0177765 3300044706 Bacteria 1007
748 Ga0466970_0036271 3300044765 Bacteria 2612
749 Ga0466970_0082363 3300044765 Bacteria 1740
750 Ga0466957_0057200 3300044842 Bacteria 2386
751 Ga0466957_0101764 3300044842 Bacteria 1812
752 Ga0466957_0103953 3300044842 Bacteria 1794
753 Ga0466957_0256232 3300044842 Bacteria 1165
754 Ga0466957_0304485 3300044842 Bacteria 1072
755 Ga0466959_0052885 3300045049 Bacteria 2972
756 Ga0466958_0087472 3300045836 Bacteria 1924
757 Ga0466958_0142901 3300045836 Bacteria 1507
758 Ga0466967_0057824 3300045976 Bacteria 3425
759 Ga0466967_0058464 3300045976 Bacteria 3408
760 Ga0466967_0193286 3300045976 Bacteria 1924
761 Ga0466967_0195336 3300045976 Bacteria 1914
762 Ga0466967_0245626 3300045976 Bacteria 1708
763 Ga0466967_0598131 3300045976 Bacteria 1088
764 Ga0495596_0051414 3300046500 Bacteria 1614
765 Ga0495643_0173046 3300046522 Bacteria 1055
766 Ga0495663_0003697 3300046525 Bacteria 4375
767 Ga0495663_0045954 3300046525 Bacteria 1340
768 Ga0495663_0123884 3300046525 Bacteria 867
769 Ga0495598_0019117 3300046537 Bacteria 1791
770 Ga0495621_0000350 3300046539 Bacteria 11260
771 Ga0495621_0005701 3300046539 Bacteria 3597
772 Ga0495633_0031633 3300046558 Bacteria 2563
773 Ga0495668_0077947 3300046616 Bacteria 1819
774 Ga0495659_0024873 3300046664 Bacteria 2045
775 Ga0495669_0032311 3300046684 Bacteria 2300
776 Ga0495669_0156759 3300046684 Bacteria 1079
777 Ga0495669_0204177 3300046684 Bacteria 945
778 Ga0495669_0283457 3300046684 Bacteria 797
779 Ga0495669_0438175 3300046684 Bacteria 634
780 Ga0495670_0010361 3300046691 Bacteria 4580
781 Ga0495670_0012515 3300046691 Bacteria 4175
782 Ga0495672_0287285 3300047320 Bacteria 784
783 Ga0495677_0024518 3300047445 Bacteria 2188
784 Ga0495677_0165252 3300047445 Bacteria 855
785 Ga0495685_090595 3300047447 Bacteria 1014
786 Ga0495615_0021854 3300048090 Bacteria 1448
787 Ga0496100_0978721 3300048903 Bacteria 665
788 Ga0496101_0065195 3300048904 Bacteria 2655
789 Ga0496102_0286092 3300048905 Unclassified 1554
790 Ga0496102_0708678 3300048905 Bacteria 929
791 Ga0496102_0744269 3300048905 Bacteria 903
792 Ga0496104_0288642 3300048907 Bacteria 1553
793 Ga0496104_0483621 3300048907 Bacteria 1149
794 Ga0496106_0021199 3300048909 Bacteria 4824
795 Ga0496106_0641263 3300048909 Bacteria 849
796 Ga0496106_1045706 3300048909 Bacteria 641
797 Ga0496107_0006978 3300048910 Bacteria 7784
798 Ga0496107_0145011 3300048910 Unclassified 1755
799 Ga0496107_0188797 3300048910 Unclassified 1531
800 Ga0496107_0358123 3300048910 Bacteria 1086
801 Ga0496107_0435222 3300048910 Bacteria 975
802 Ga0496107_0487973 3300048910 Bacteria 914
803 Ga0496108_0011900 3300048911 Bacteria 7078
804 Ga0496108_0044078 3300048911 Bacteria 3725
805 Ga0496109_0020941 3300048912 Bacteria 5780
806 Ga0496109_0024307 3300048912 Bacteria 5385
807 Ga0496109_0556202 3300048912 Bacteria 1082
808 Ga0496109_0896009 3300048912 Bacteria 825
809 Ga0496109_1091865 3300048912 Bacteria 735
810 Ga0496109_1187975 3300048912 Bacteria 700
811 Ga0496110_0010516 3300048913 Bacteria 7533
812 Ga0496110_0055960 3300048913 Bacteria 3471
813 Ga0496111_0018962 3300048914 Bacteria 4769
814 Ga0496111_0053188 3300048914 Bacteria 2925
815 Ga0496111_0085906 3300048914 Bacteria 2301
816 Ga0496111_0816828 3300048914 Bacteria 674
817 Ga0496112_0136255 3300048915 Bacteria 2425
818 Ga0496112_0146453 3300048915 Bacteria 2330
819 Ga0496112_0239961 3300048915 Bacteria 1765
820 Ga0496113_0086813 3300048916 Bacteria 2404
821 Ga0496113_0222581 3300048916 Bacteria 1504
822 Ga0496114_0005747 3300048917 Bacteria 9734
823 Ga0496114_0271573 3300048917 Bacteria 1494
824 Ga0496115_0001982 3300048918 Bacteria 14619
825 Ga0501225_0062255 3300049705 Bacteria 1051
826 Ga0501225_0086878 3300049705 Bacteria 903
827 Ga0501268_002439 3300049765 Bacteria 2450
828 Ga0501273_010716 3300049770 Bacteria 1131
829 Ga0501204_014099 3300049850 Bacteria 978
830 nmdc:mga05p37_388427_c1 3300050507 Bacteria 1633
831 nmdc:mga08y16_987285_c1 3300050511 Bacteria 823
832 nmdc:mga0n895_435921_c1 3300050512 Bacteria 1324
833 nmdc:mga0rr50_229314_c1 3300050513 Bacteria 1536
834 nmdc:mga0a205_5296_c1 3300050515 Bacteria 11612
835 Ga0500658_0000073 3300053134 Bacteria 46171
836 2896430587 2896429255 Bacteria 2557483
837 Ga0157369_11080176
838 MBSR1b_contig_4799473
839 JGI24746J21847_1002084
840 JGI24740J21852_10096864
841 JGI24739J22299_10003420
842 JGI24735J21928_10013884
843 JGI24738J21930_10000035
844 JGI24749J21850_1003195
845 JGI24033J26618_1020308
846 JGI24034J26672_10026050
847 JGI24742J22300_10063245
848 JGI24751J29686_10030402
849 Ga0065165_1007899
850 Ga0065712_10152941
851 Ga0065715_10000359
852 Ga0065707_10246837
853 Ga0070658_10039227
854 Ga0070658_10042549
855 Ga0070658_10080678
856 Ga0070658_10090495
857 Ga0070658_10189446
858 Ga0070658_10267703
859 Ga0070676_10020596
860 Ga0070676_10134996
861 Ga0070676_10193920
862 Ga0070676_10203435
863 Ga0070676_10265174
864 Ga0070676_10314617
865 Ga0070683_100514256
866 Ga0070690_100233144
867 Ga0070690_100387312
868 Ga0070690_100529427
869 Ga0070670_100021668
870 Ga0070670_100023463
871 Ga0070670_100151406
872 Ga0070670_100401835
873 Ga0070670_100645807
874 Ga0070677_10000999
875 Ga0070677_10208222
876 Ga0068869_100045744
877 Ga0068869_100091921
878 Ga0068869_100455567
879 Ga0068869_100916811
880 Ga0070666_10043591
881 Ga0070666_10120410
882 Ga0070680_100168601
883 Ga0070680_101512107
884 Ga0070682_100286970
885 Ga0068868_100000881
886 Ga0068868_100165723
887 Ga0068868_100316980
888 Ga0070660_100004031
889 Ga0070660_100006513
890 Ga0070660_100010556
891 Ga0070660_100022082
892 Ga0070660_100080308
893 Ga0070660_100121153
894 Ga0070660_100306187
895 Ga0070689_100237840
896 Ga0070689_100874312
897 Ga0070687_100294506
898 Ga0070687_100378139
899 Ga0070661_100077892
900 Ga0070661_100079500
901 Ga0070661_100092146
902 Ga0070661_100118586
903 Ga0070661_100221448
904 Ga0070661_100414310
905 Ga0070661_100453561
906 Ga0070661_100775135
907 Ga0070661_100940087
908 Ga0070692_10024658
909 Ga0070692_10064690
910 Ga0070692_10462774
911 Ga0070668_100010358
912 Ga0070668_100027610
913 Ga0070668_100032292
914 Ga0070668_100161674
915 Ga0070668_100304141
916 Ga0070668_100430959
917 Ga0070668_100452668
918 Ga0070669_100002615
919 Ga0070669_100030619
920 Ga0070669_100074454
921 Ga0070669_100081765
922 Ga0070669_100821550
923 Ga0070669_101381627
924 Ga0070675_100004653
925 Ga0070675_100163451
926 Ga0070675_101107614
927 Ga0070671_100004406
928 Ga0070671_100013680
929 Ga0070671_100014729
930 Ga0070671_100035593
931 Ga0070671_100040586
932 Ga0070671_100125193
933 Ga0070671_100187950
934 Ga0070671_100308212
935 Ga0070671_100643322
936 Ga0070674_100002641
937 Ga0070674_100046481
938 Ga0070674_100060210
939 Ga0070673_100003488
940 Ga0070673_100065813
941 Ga0070673_100102861
942 Ga0070673_100144859
943 Ga0070673_100165338
944 Ga0070673_100479821
945 Ga0070673_101297026
946 Ga0070688_100171660
947 Ga0070659_100001058
948 Ga0070659_100001497
949 Ga0070659_100001672
950 Ga0070659_100197158
951 Ga0070659_100329388
952 Ga0070659_100335773
953 Ga0070659_100355688
954 Ga0070667_100003302
955 Ga0070667_100003455
956 Ga0070667_100040579
957 Ga0070667_100056316
958 Ga0070667_100063842
959 Ga0070667_100068000
960 Ga0070667_100073795
961 Ga0070667_100331256
962 Ga0070667_100588176
963 Ga0070709_10004923
964 Ga0070714_100045950
965 Ga0070714_100048939
966 Ga0070714_101222361
967 Ga0070713_100041173
968 Ga0070705_100395338
969 Ga0070700_100034056
970 Ga0070694_100287168
971 Ga0070694_100348458
972 Ga0070663_100006460
973 Ga0070663_100028142
974 Ga0070663_100100509
975 Ga0070663_100258189
976 Ga0070663_100266408
977 Ga0070663_100307328
978 Ga0070663_100348667
979 Ga0070663_100396648
980 Ga0070663_100794110
981 Ga0070678_100132696
982 Ga0070662_100002895
983 Ga0070662_100008482
984 Ga0070662_100050029
985 Ga0070662_100053901
986 Ga0070662_100070347
987 Ga0070662_100177610
988 Ga0070662_100251782
989 Ga0070662_100327368
990 Ga0070681_10149323
991 Ga0070681_10427998
992 Ga0068867_100005296
993 Ga0068867_100006073
994 Ga0068867_100099499
995 Ga0068867_100120324
996 Ga0068867_100155741
997 Ga0068867_100156551
998 Ga0068867_100728036
999 Ga0070685_10131747
1000 Ga0070679_100129150
1001 Ga0070679_100303524
1002 Ga0070679_100418171
1003 Ga0068853_100007792
1004 Ga0068853_100033639
1005 Ga0068853_100118282
1006 Ga0068853_100185963
1007 Ga0070672_100003490
1008 Ga0070672_100008903
1009 Ga0070672_100081691
1010 Ga0070672_100109649
1011 Ga0070672_100457398
1012 Ga0070672_100482430
1013 Ga0070672_100619425
1014 Ga0070686_100519189
1015 Ga0070686_100611490
1016 Ga0070695_100329580
1017 Ga0070696_100271458
1018 Ga0070693_100060368
1019 Ga0070693_100075771
1020 Ga0070693_100183163
1021 Ga0070693_100782394
1022 Ga0070665_100012854
1023 Ga0070665_100274026
1024 Ga0070665_100628837
1025 Ga0070665_100969566
1026 Ga0070665_101347760
1027 Ga0068855_100031999
1028 Ga0068855_100554548
1029 Ga0070664_100025432
1030 Ga0070664_100029545
1031 Ga0070664_100035533
1032 Ga0070664_100039633
1033 Ga0070664_100047598
1034 Ga0070664_100066220
1035 Ga0070664_100115285
1036 Ga0070664_100135938
1037 Ga0070664_100175131
1038 Ga0070664_100182252
1039 Ga0068857_100003503
1040 Ga0068857_100045474
1041 Ga0068857_100051053
1042 Ga0068857_100219570
1043 Ga0068857_101142212
1044 Ga0068854_100004302
1045 Ga0068854_100037092
1046 Ga0068854_100071112
1047 Ga0068854_100100937
1048 Ga0068854_100388055
1049 Ga0068854_100545485
1050 Ga0068856_100033259
1051 Ga0068856_100034293
1052 Ga0068856_100080624
1053 Ga0068856_100119211
1054 Ga0068856_100327431
1055 Ga0068856_100394677
1056 Ga0068856_100753644
1057 Ga0070702_100289376
1058 Ga0070702_100622095
1059 Ga0068852_100001990
1060 Ga0068852_100024314
1061 Ga0068852_100050120
1062 Ga0068852_100068158
1063 Ga0068852_100256482
1064 Ga0068852_100722874
1065 Ga0068859_100008163
1066 Ga0068859_100012474
1067 Ga0068859_100036370
1068 Ga0068859_100142831
1069 Ga0068859_100162923
1070 Ga0068859_100164555
1071 Ga0068859_101131378
1072 Ga0068859_101265103
1073 Ga0068864_100003128
1074 Ga0068864_100221533
1075 Ga0068864_100290357
1076 Ga0068866_10137169
1077 Ga0068866_10348395
1078 Ga0068866_10412079
1079 Ga0068861_100004768
1080 Ga0068861_100320117
1081 Ga0068861_100326971
1082 Ga0068861_100414096
1083 Ga0068861_100440753
1084 Ga0068861_100602286
1085 Ga0068851_10024620
1086 Ga0068851_10069144
1087 Ga0068851_10099492
1088 Ga0068851_10107123
1089 Ga0068870_10073710
1090 Ga0068870_10129155
1091 Ga0068863_100037056
1092 Ga0068863_100082035
1093 Ga0068863_100411949
1094 Ga0068863_100502325
1095 Ga0068863_100528036
1096 Ga0068863_100546393
1097 Ga0068858_100005468
1098 Ga0068858_100005690
1099 Ga0068858_100015129
1100 Ga0068858_100017238
1101 Ga0068858_100022221
1102 Ga0068860_100012703
1103 Ga0068860_100059624
1104 Ga0068860_100388980
1105 Ga0068860_100697212
1106 Ga0068862_100005443
1107 Ga0068862_100009248
1108 Ga0068862_100009717
1109 Ga0068862_100063009
1110 Ga0068862_100128028
1111 Ga0068862_100721894
1112 Ga0070716_100044247
1113 Ga0070712_100619233
1114 Ga0097621_100014323
1115 Ga0097621_100218325
1116 Ga0068871_100006417
1117 Ga0068871_100105553
1118 Ga0068871_100112809
1119 Ga0068871_100125634
1120 Ga0075433_10011424
1121 Ga0075434_100510961
1122 Ga0075434_100791979
1123 Ga0068865_100033541
1124 Ga0068865_100157238
1125 Ga0068865_100251528
1126 Ga0068865_100329609
1127 Ga0068865_100731295
1128 Ga0075436_100213878
1129 Ga0097620_100008163
1130 Ga0097620_100012475
1131 Ga0097620_100036370
1132 Ga0097620_100142837
1133 Ga0097620_100162921
1134 Ga0097620_100164561
1135 Ga0097620_101131388
1136 Ga0097620_101264927
1137 Ga0075435_100261170
1138 Ga0105240_10109964
1139 Ga0111539_10072986
1140 Ga0111539_10736500
1141 Ga0105245_10000285
1142 Ga0105245_10021177
1143 Ga0114129_10357020
1144 Ga0105241_10042296
1145 Ga0105241_10144371
1146 Ga0105248_10020125
1147 Ga0105248_10046924
1148 Ga0105248_10051371
1149 Ga0105248_10088873
1150 Ga0105248_10197743
1151 Ga0105248_10608041
1152 Ga0105248_11964412
1153 Ga0105237_10024240
1154 Ga0105238_10110443
1155 Ga0105238_10611228
1156 Ga0105238_10743978
1157 Ga0105249_10010129
1158 Ga0105249_10024423
1159 Ga0105249_10113737
1160 Ga0105249_10125011
1161 Ga0105249_10309443
1162 Ga0105249_10338919
1163 Ga0105249_10384045
1164 Ga0105239_10064925
1165 Ga0105239_11480589
1166 Ga0105246_10012160
1167 Ga0105246_10156921
1168 Ga0157373_10011849
1169 Ga0157373_10012019
1170 Ga0157373_10016553
1171 Ga0157373_10030375
1172 Ga0157373_10116265
1173 Ga0157373_10185086
1174 Ga0157371_10002316
1175 Ga0157371_10263314
1176 Ga0157371_10366232
1177 Ga0157370_10134409
1178 Ga0157370_10619460
1179 Ga0157370_11060271
1180 Ga0157369_10048804
1181 Ga0157369_10100375
1182 Ga0157374_10054329
1183 Ga0157374_10867581
1184 Ga0157378_10001258
1185 Ga0157378_10186971
1186 Ga0157378_10482727
1187 Ga0163162_10037174
1188 Ga0163162_10161998
1189 Ga0163162_10391485
1190 Ga0163162_10437872
1191 Ga0163162_10820375
1192 Ga0163162_11016229
1193 Ga0157372_10031246
1194 Ga0157372_10317258
1195 Ga0157372_10619193
1196 Ga0157372_10734106
1197 Ga0157375_10004348
1198 Ga0157375_10058033
1199 Ga0157375_10205827
1200 Ga0157375_10398105
1201 Ga0157375_10875080
1202 Ga0157375_12579454
1203 Ga0163163_10091516
1204 Ga0163163_10189906
1205 Ga0157380_10005051
1206 Ga0157380_10108324
1207 Ga0157380_10226606
1208 Ga0157379_10125893
1209 Ga0163161_10000753
1210 Ga0163161_10210395
1211 Ga0207666_1004870
1212 Ga0207673_1003610
1213 Ga0207697_10000158
1214 Ga0207697_10002568
1215 Ga0207697_10035271
1216 Ga0207697_10068977
1217 Ga0207656_10015597
1218 Ga0207682_10001693
1219 Ga0207682_10093071
1220 Ga0207642_10391403
1221 Ga0207710_10139445
1222 Ga0207688_10000317
1223 Ga0207688_10024903
1224 Ga0207688_10081281
1225 Ga0207688_10278317
1226 Ga0207688_10325488
1227 Ga0207680_10023816
1228 Ga0207680_10083708
1229 Ga0207680_10451379
1230 Ga0207680_10688954
1231 Ga0207647_10000253
1232 Ga0207647_10083225
1233 Ga0207645_10002074
1234 Ga0207645_10026481
1235 Ga0207645_10027619
1236 Ga0207645_10035096
1237 Ga0207645_10128078
1238 Ga0207645_10138155
1239 Ga0207645_10159546
1240 Ga0207645_10214075
1241 Ga0207643_10052521
1242 Ga0207643_10418670
1243 Ga0207705_10016274
1244 Ga0207705_10039435
1245 Ga0207705_10043066
1246 Ga0207705_10046964
1247 Ga0207705_10097504
1248 Ga0207705_10108167
1249 Ga0207705_10145067
1250 Ga0207705_10170976
1251 Ga0207705_10362739
1252 Ga0207705_10724521
1253 Ga0207654_10152514
1254 Ga0207707_10169859
1255 Ga0207707_10992692
1256 Ga0207671_10195065
1257 Ga0207693_10058526
1258 Ga0207660_10243517
1259 Ga0207662_10213130
1260 Ga0207662_10286789
1261 Ga0207657_10002291
1262 Ga0207657_10011406
1263 Ga0207657_10019294
1264 Ga0207657_10030898
1265 Ga0207657_10042043
1266 Ga0207657_10045766
1267 Ga0207657_10047166
1268 Ga0207657_10059739
1269 Ga0207657_10065000
1270 Ga0207657_10068358
1271 Ga0207649_10018682
1272 Ga0207649_10043290
1273 Ga0207649_10103742
1274 Ga0207649_10146307
1275 Ga0207649_10210951
1276 Ga0207649_10290304
1277 Ga0207649_10325052
1278 Ga0207649_10341208
1279 Ga0207649_10342527
1280 Ga0207649_10970190
1281 Ga0207652_10220732
1282 Ga0207652_10375825
1283 Ga0207652_10537128
1284 Ga0207681_10027069
1285 Ga0207681_10030507
1286 Ga0207681_10061807
1287 Ga0207681_10213239
1288 Ga0207694_10392709
1289 Ga0207650_10003054
1290 Ga0207650_10018631
1291 Ga0207650_10101953
1292 Ga0207650_10279773
1293 Ga0207650_10520785
1294 Ga0207659_10018172
1295 Ga0207659_10127013
1296 Ga0207659_10300153
1297 Ga0207687_10031400
1298 Ga0207664_10021302
1299 Ga0207664_10041131
1300 Ga0207664_10993026
1301 Ga0207664_11547157
1302 Ga0207644_10005273
1303 Ga0207644_10007766
1304 Ga0207644_10010963
1305 Ga0207644_10020310
1306 Ga0207644_10030225
1307 Ga0207644_10108980
1308 Ga0207644_10566374
1309 Ga0207690_10011180
1310 Ga0207690_10057356
1311 Ga0207690_10096713
1312 Ga0207690_10201824
1313 Ga0207690_10300446
1314 Ga0207690_10459685
1315 Ga0207690_10486476
1316 Ga0207706_10000434
1317 Ga0207706_10000643
1318 Ga0207706_10035989
1319 Ga0207706_10044379
1320 Ga0207706_10046085
1321 Ga0207706_10139178
1322 Ga0207706_10219339
1323 Ga0207709_10253862
1324 Ga0207669_10013845
1325 Ga0207669_10091532
1326 Ga0207704_10126284
1327 Ga0207704_10580661
1328 Ga0207665_10043994
1329 Ga0207691_10000848
1330 Ga0207691_10000852
1331 Ga0207691_10019525
1332 Ga0207691_10107428
1333 Ga0207691_10156533
1334 Ga0207691_10538504
1335 Ga0207691_10816601
1336 Ga0207711_10003912
1337 Ga0207711_10018660
1338 Ga0207711_10071281
1339 Ga0207689_10000017
1340 Ga0207689_10030990
1341 Ga0207689_10035239
1342 Ga0207689_10044482
1343 Ga0207661_10297569
1344 Ga0207661_10750479
1345 Ga0207679_10046450
1346 Ga0207679_10057851
1347 Ga0207679_10129703
1348 Ga0207679_10239311
1349 Ga0207679_10291908
1350 Ga0207679_10347057
1351 Ga0207679_10433273
1352 Ga0207679_10596421
1353 Ga0207679_10622649
1354 Ga0207679_10670877
1355 Ga0207667_10040202
1356 Ga0207667_10144280
1357 Ga0207667_10258564
1358 Ga0207651_10006199
1359 Ga0207651_10105685
1360 Ga0207651_10126106
1361 Ga0207651_10144365
1362 Ga0207651_10178665
1363 Ga0207651_10186524
1364 Ga0207651_11025459
1365 Ga0207712_10008327
1366 Ga0207712_10116830
1367 Ga0207712_10520344
1368 Ga0207668_10000223
1369 Ga0207668_10002049
1370 Ga0207668_10013108
1371 Ga0207668_10157443
1372 Ga0207668_10173511
1373 Ga0207668_10179524
1374 Ga0207668_10259117
1375 Ga0207640_10003828
1376 Ga0207640_10065521
1377 Ga0207640_10286453
1378 Ga0207640_10353592
1379 Ga0207658_10008048
1380 Ga0207658_10034535
1381 Ga0207658_10035614
1382 Ga0207658_10068482
1383 Ga0207658_10104199
1384 Ga0207658_10173408
1385 Ga0207658_10238712
1386 Ga0207658_10558136
1387 Ga0207658_10643497
1388 Ga0207677_10042390
1389 Ga0207703_10002927
1390 Ga0207703_10057641
1391 Ga0207639_10040564
1392 Ga0207639_10055955
1393 Ga0207639_10186625
1394 Ga0207639_10234929
1395 Ga0207639_10304656
1396 Ga0207639_10386680
1397 Ga0207678_10009957
1398 Ga0207678_10014935
1399 Ga0207678_10028426
1400 Ga0207678_10029181
1401 Ga0207678_10083355
1402 Ga0207678_10108507
1403 Ga0207678_10200088
1404 Ga0207678_10459229
1405 Ga0207702_10012040
1406 Ga0207702_10196688
1407 Ga0207702_10227452
1408 Ga0207702_10881061
1409 Ga0207702_11485388
1410 Ga0207641_10016993
1411 Ga0207641_10019912
1412 Ga0207641_10113956
1413 Ga0207641_10649009
1414 Ga0207641_10653234
1415 Ga0207648_10001216
1416 Ga0207648_10006444
1417 Ga0207648_10097123
1418 Ga0207648_10106101
1419 Ga0207648_10532373
1420 Ga0207676_10003642
1421 Ga0207676_10005620
1422 Ga0207676_10012995
1423 Ga0207676_10606861
1424 Ga0207676_10866113
1425 Ga0207674_10004077
1426 Ga0207674_10007596
1427 Ga0207674_10044074
1428 Ga0207674_10052412
1429 Ga0207674_10196538
1430 Ga0207675_100025642
1431 Ga0207675_100387047
1432 Ga0207675_100493467
1433 Ga0207675_100520192
1434 Ga0207675_100538729
1435 Ga0207683_10006197
1436 Ga0207683_10092191
1437 Ga0207698_10018409
1438 Ga0207698_10020485
1439 Ga0207698_10184857
1440 Ga0207698_10411484
1441 Ga0209974_10121778
1442 Ga0207428_10462014
1443 Ga0268266_10005814
1444 Ga0268266_10009325
1445 Ga0268266_10156875
1446 Ga0268266_10264521
1447 Ga0268265_10001836
1448 Ga0268265_10004795
1449 Ga0268265_10023329
1450 Ga0268265_10024003
1451 Ga0268265_10119081
1452 Ga0268265_10323675
1453 Ga0268265_10432723
1454 Ga0268265_10727765
1455 Ga0268265_11977389
1456 Ga0268264_10008809
1457 Ga0268264_10112581
1458 Ga0268264_10126648
1459 Ga0268264_10419922
1460 Ga0268264_10795517
1461 Ga0307408_100017171
1462 Ga0307408_100162669
1463 Ga0307405_10027843
1464 Ga0307405_10035968
1465 Ga0307405_10068674
1466 Ga0307413_10001438
1467 Ga0307413_10018300
1468 Ga0307413_10036235
1469 Ga0307413_10061660
1470 Ga0307413_10099897
1471 Ga0307413_10272732
1472 Ga0307413_10584816
1473 Ga0307413_10664031
1474 Ga0307413_11634054
1475 Ga0307410_10003596
1476 Ga0307410_10102415
1477 Ga0307410_10107957
1478 Ga0307410_10120784
1479 Ga0307410_10292254
1480 Ga0307410_10323010
1481 Ga0307410_10903272
1482 Ga0307406_10023830
1483 Ga0307406_10028520
1484 Ga0307406_10049479
1485 Ga0307406_10879292
1486 Ga0307407_10031384
1487 Ga0307407_10079831
1488 Ga0307407_10154385
1489 Ga0307407_10437810
1490 Ga0307407_10468582
1491 Ga0307407_10626557
1492 Ga0307412_10003166
1493 Ga0307412_10021619
1494 Ga0307412_10040504
1495 Ga0307412_10040782
1496 Ga0307412_10123510
1497 Ga0307412_10126569
1498 Ga0307412_10139254
1499 Ga0307412_10145585
1500 Ga0307409_100012427
1501 Ga0307409_100071970
1502 Ga0307409_100092353
1503 Ga0307409_100110065
1504 Ga0307409_100206867
1505 Ga0307409_100248552
1506 Ga0307409_100261875
1507 Ga0307409_100512531
1508 Ga0307409_100940745
1509 Ga0307416_100019713
1510 Ga0307416_100069269
1511 Ga0307416_100095314
1512 Ga0307416_100110262
1513 Ga0307416_100251120
1514 Ga0307416_100269105
1515 Ga0307416_100323330
1516 Ga0307416_100342345
1517 Ga0307416_100393236
1518 Ga0307416_100754779
1519 Ga0307416_101098934
1520 Ga0307414_10011458
1521 Ga0307414_10062534
1522 Ga0307414_10076654
1523 Ga0307414_10112593
1524 Ga0307414_10184606
1525 Ga0307414_10215482
1526 Ga0307414_10316850
1527 Ga0307414_10416692
1528 Ga0307414_10442417
1529 Ga0307414_10500915
1530 Ga0307414_11823705
1531 Ga0307411_10010399
1532 Ga0307411_10010853
1533 Ga0307411_10034033
1534 Ga0307411_10060334
1535 Ga0307411_10067388
1536 Ga0307411_10186000
1537 Ga0307411_10605556
1538 Ga0307411_11497776
1539 Ga0307415_100015345
1540 Ga0307415_100042531
1541 Ga0307415_100087449
1542 Ga0307415_100097844
1543 Ga0307415_100157722
1544 Ga0307415_100176127
1545 Ga0307415_100275699
1546 Ga0307415_101111476
1547 Ga0373928_0120256
1548 Ga0373940_0039047
1549 Ga0373943_0379166
1550 Ga0373961_0134814
1551 Ga0373931_0106924
1552 Ga0373935_0104235
1553 Ga0395899_0018993
1554 Ga0395899_0426216
1555 Ga0395900_0000995
1556 Ga0395900_0959091
1557 Ga0395898_0139400
1558 Ga0395905_0000538
1559 Ga0395905_0001688
1560 Ga0395905_0070915
1561 Ga0395905_0072272
1562 Ga0395905_0206676
1563 Ga0395905_0238254
1564 Ga0395905_0272120
1565 Ga0395905_0273431
1566 Ga0395905_0416594
1567 Ga0436364_0996148
1568 Ga0395901_0002926
1569 Ga0395901_0075005
1570 Ga0395901_0129440
1571 Ga0395901_0345500
1572 Ga0395901_0362197
1573 Ga0436363_0512431
1574 Ga0439455_0206100
1575 Ga0439464_0011183
1576 Ga0466972_0060740
1577 Ga0466966_0006596
1578 Ga0466966_0109592
1579 Ga0466961_0086810
1580 Ga0466963_0013165
1581 Ga0466963_0255861
1582 Ga0466963_0644470
1583 Ga0466964_0177765
1584 Ga0466970_0036271
1585 Ga0466970_0082363
1586 Ga0466957_0057200
1587 Ga0466957_0101764
1588 Ga0466957_0103953
1589 Ga0466957_0256232
1590 Ga0466957_0304485
1591 Ga0466959_0052885
1592 Ga0466958_0087472
1593 Ga0466958_0142901
1594 Ga0466967_0057824
1595 Ga0466967_0058464
1596 Ga0466967_0193286
1597 Ga0466967_0195336
1598 Ga0466967_0245626
1599 Ga0466967_0598131
1600 Ga0495596_0051414
1601 Ga0495643_0173046
1602 Ga0495663_0003697
1603 Ga0495663_0045954
1604 Ga0495663_0123884
1605 Ga0495598_0019117
1606 Ga0495621_0000350
1607 Ga0495621_0005701
1608 Ga0495633_0031633
1609 Ga0495668_0077947
1610 Ga0495659_0024873
1611 Ga0495669_0032311
1612 Ga0495669_0156759
1613 Ga0495669_0204177
1614 Ga0495669_0283457
1615 Ga0495669_0438175
1616 Ga0495670_0010361
1617 Ga0495670_0012515
1618 Ga0495672_0287285
1619 Ga0495677_0024518
1620 Ga0495677_0165252
1621 Ga0495685_090595
1622 Ga0495615_0021854
1623 Ga0496100_0978721
1624 Ga0496101_0065195
1625 Ga0496102_0286092
1626 Ga0496102_0708678
1627 Ga0496102_0744269
1628 Ga0496104_0288642
1629 Ga0496104_0483621
1630 Ga0496106_0021199
1631 Ga0496106_0641263
1632 Ga0496106_1045706
1633 Ga0496107_0006978
1634 Ga0496107_0145011
1635 Ga0496107_0188797
1636 Ga0496107_0358123
1637 Ga0496107_0435222
1638 Ga0496107_0487973
1639 Ga0496108_0011900
1640 Ga0496108_0044078
1641 Ga0496109_0020941
1642 Ga0496109_0024307
1643 Ga0496109_0556202
1644 Ga0496109_0896009
1645 Ga0496109_1091865
1646 Ga0496109_1187975
1647 Ga0496110_0010516
1648 Ga0496110_0055960
1649 Ga0496111_0018962
1650 Ga0496111_0053188
1651 Ga0496111_0085906
1652 Ga0496111_0816828
1653 Ga0496112_0136255
1654 Ga0496112_0146453
1655 Ga0496112_0239961
1656 Ga0496113_0086813
1657 Ga0496113_0222581
1658 Ga0496114_0005747
1659 Ga0496114_0271573
1660 Ga0496115_0001982
1661 Ga0501225_0062255
1662 Ga0501225_0086878
1663 Ga0501268_002439
1664 Ga0501273_010716
1665 Ga0501204_014099
1666 nmdc:mga05p37_388427_c1
1667 nmdc:mga08y16_987285_c1
1668 nmdc:mga0n895_435921_c1
1669 nmdc:mga0rr50_229314_c1
1670 nmdc:mga0a205_5296_c1
1671 Ga0500658_0000073
1672 2896430587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02556

SecB

Preprotein translocase subunit SecB

43

183

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.9598 23 152
1fx3-assembly1.cif.gz_D crystal structure of h. influenzae secb 0.9436 23 154
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.9387 23 152
1ozb-assembly2.cif.gz_G crystal structure of secb complexed with seca c-terminus 0.9341 19 154
1ozb-assembly1.cif.gz_A crystal structure of secb complexed with seca c-terminus 0.9306 23 163
ID Description Score Start End Superfamily
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.9572 23 155 3.10.420.10
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.9301 23 155 3.10.420.10
af_P95257_21_163_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7576 24 144 3.10.420.10
5jtlB00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7576 18 169 3.10.420.10
af_Q57803_2_154_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7547 24 161 3.10.420.10
ID Description Score Start End GO Terms
AF-A0A2E5NPE3-F1-model_v4 Protein-export chaperone SecB 0.9739 30 163 GO:0015031
GO:0051082
GO:0051262
AF-A0A2E2YF56-F1-model_v4 Protein-export protein SecB 0.9653 25 155 GO:0005737
GO:0006457
GO:0015031
GO:0051082
GO:0051262
AF-A0A5C9CQ51-F1-model_v4 Preprotein translocase subunit SecB 0.9653 35 159 GO:0015031
GO:0051082
GO:0051262
AF-A0A7J6ZP74-F1-model_v4 deleted 0.9648 34 159
AF-A0A7X3LZW4-F1-model_v4 Protein-export protein SecB 0.9646 21 156 GO:0005737
GO:0006457
GO:0015031
GO:0051082
GO:0051262

Map