F482887

General Info

Members Datasets Scaffolds Average Seq Length
836 400 1672 200

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10004368|Ga0207694_100043682
Length 226
Sequence LNPLLPDMPSPNPSRKREGDFQKECEMTKVLVLYYSSYGHLEQMADAVAEGARSAGAEVDIRRVPETAPAEVAIAAGFKVDTAHPTIGGVAELANYDAIIVGAPTRFGRMPSQMASFLDQAGGLWFTGALNGKVGGAFTSTATQHGGQETTLFSIITNLLHFGLTIVGLDYGFAGQSGVKEVHGNSPYGATTIADSDGSRQPSSVELDGARYQGRRIAEVAGKLAA

Samples

Sample ID Description Type Environment
1 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
83 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
202 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
209 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
210 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
211 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
273 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
314 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
319 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
320 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
329 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
346 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
347 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
352 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
355 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
356 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
357 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
358 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
359 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
360 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
363 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
369 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
370 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
371 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
372 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
373 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
374 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
377 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
390 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
391 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
392 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
393 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
394 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
395 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
396 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
397 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
398 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
399 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
400 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.29
Metatranscriptomes 2.27
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.43
Nodule 0.48
Rhizoplane 4.78
Rhizosphere 69.02
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207694_10004368 3300025924 Bacteria 11042
2 JGI24741J21665_1004560 3300001915 Bacteria 3044
3 JGI24740J21852_10015017 3300001979 Bacteria 2839
4 JGI24740J21852_10058307 3300001979 Bacteria 1074
5 JGI24739J22299_10001701 3300001989 Bacteria 8365
6 JGI24737J22298_10006194 3300001990 Bacteria 4096
7 JGI24737J22298_10028777 3300001990 Bacteria 1745
8 JGI24735J21928_10005514 3300002067 Bacteria 4195
9 JGI24742J22300_10007013 3300002244 Bacteria 1856
10 JGI25159J45721_1001111 3300002987 Bacteria 11488
11 JGI25165J46597_1000095 3300003214 Bacteria 163883
12 JGI25165J46597_1033269 3300003214 Bacteria 665
13 JGI25153J46596_10000070 3300003215 Bacteria 117125
14 Ga0055532_1008694 3300003758 Bacteria 1257
15 Ga0055525_1000203 3300003759 Bacteria 68926
16 Ga0055542_1000040 3300003762 Bacteria 214035
17 Ga0055542_1024935 3300003762 Bacteria 820
18 Ga0055529_1000037 3300003763 Bacteria 237307
19 Ga0055529_1008275 3300003763 Bacteria 1387
20 Ga0055536_1010073 3300003781 Bacteria 3807
21 Ga0055536_1011254 3300003781 Bacteria 3451
22 Ga0055536_1011520 3300003781 Bacteria 3381
23 Ga0055530_10005838 3300003791 Bacteria 5707
24 Ga0055530_10009279 3300003791 Bacteria 3807
25 Ga0055530_10017340 3300003791 Bacteria 2261
26 Ga0055531_10008976 3300003794 Bacteria 5173
27 Ga0055543_1001755 3300004625 Bacteria 8103
28 Ga0065165_1000034 3300005262 Bacteria 214644
29 Ga0065165_1000201 3300005262 Bacteria 103327
30 Ga0065165_1019972 3300005262 Bacteria 2375
31 Ga0065704_10002132 3300005289 Bacteria 5808
32 Ga0065704_10103203 3300005289 Bacteria 2179
33 Ga0070658_10000493 3300005327 Bacteria 34309
34 Ga0070658_10214969 3300005327 Bacteria 1625
35 Ga0070683_100003434 3300005329 Bacteria 12861
36 Ga0070683_100129620 3300005329 Bacteria 2386
37 Ga0070670_100222087 3300005331 Bacteria 1644
38 Ga0070666_10012958 3300005335 Bacteria 5277
39 Ga0070680_100101269 3300005336 Bacteria 2391
40 Ga0070682_100557312 3300005337 Bacteria 898
41 Ga0070660_100018126 3300005339 Bacteria 5138
42 Ga0070661_100007029 3300005344 Bacteria 7766
43 Ga0070661_100732717 3300005344 Bacteria 807
44 Ga0070668_100029073 3300005347 Bacteria 4196
45 Ga0070668_100051660 3300005347 Bacteria 3168
46 Ga0070668_100146008 3300005347 Bacteria 1910
47 Ga0070669_100108785 3300005353 Bacteria 2101
48 Ga0070669_100792781 3300005353 Bacteria 805
49 Ga0070675_100902593 3300005354 Bacteria 810
50 Ga0070671_100077914 3300005355 Bacteria 2770
51 Ga0070671_100867727 3300005355 Bacteria 788
52 Ga0070674_100094329 3300005356 Bacteria 2167
53 Ga0070673_100065542 3300005364 Bacteria 2898
54 Ga0070667_100000641 3300005367 Bacteria 33965
55 Ga0070667_100443740 3300005367 Bacteria 1185
56 Ga0070711_100518536 3300005439 Bacteria 985
57 Ga0070663_100061428 3300005455 Bacteria 2706
58 Ga0070663_100150234 3300005455 Bacteria 1786
59 Ga0070678_100000151 3300005456 Bacteria 28884
60 Ga0070662_100107064 3300005457 Bacteria 2125
61 Ga0070681_10088271 3300005458 Bacteria 3053
62 Ga0070681_10531691 3300005458 Bacteria 1089
63 Ga0068867_100125191 3300005459 Bacteria 1991
64 Ga0070706_100167714 3300005467 Bacteria 2050
65 Ga0070679_100171386 3300005530 Bacteria 2143
66 Ga0070684_100019470 3300005535 Bacteria 5614
67 Ga0068853_100059993 3300005539 Bacteria 3286
68 Ga0068853_100486010 3300005539 Bacteria 1164
69 Ga0070665_100000023 3300005548 Bacteria 375278
70 Ga0070665_100070111 3300005548 Bacteria 3512
71 Ga0070665_100126039 3300005548 Bacteria 2563
72 Ga0070665_100136898 3300005548 Bacteria 2452
73 Ga0070665_100386040 3300005548 Bacteria 1408
74 Ga0068855_100000578 3300005563 Bacteria 44980
75 Ga0068855_100006609 3300005563 Bacteria 14087
76 Ga0068855_100212232 3300005563 Bacteria 2175
77 Ga0068855_100284476 3300005563 Bacteria 1835
78 Ga0068855_101195589 3300005563 Bacteria 791
79 Ga0070664_100079939 3300005564 Bacteria 2815
80 Ga0068857_100507882 3300005577 Bacteria 1132
81 Ga0068854_100065040 3300005578 Bacteria 2650
82 Ga0068856_100005054 3300005614 Bacteria 13058
83 Ga0068856_100614898 3300005614 Bacteria 1107
84 Ga0068852_100028904 3300005616 Bacteria 4545
85 Ga0068859_100442449 3300005617 Bacteria 1396
86 Ga0068864_100043363 3300005618 Bacteria 3852
87 Ga0068861_100119692 3300005719 Bacteria 2122
88 Ga0068861_100241584 3300005719 Bacteria 1536
89 Ga0068851_10006331 3300005834 Bacteria 5401
90 Ga0068863_100000047 3300005841 Bacteria 140249
91 Ga0068858_100001609 3300005842 Bacteria 23039
92 Ga0068860_100000083 3300005843 Bacteria 168189
93 Ga0068860_100033785 3300005843 Bacteria 4908
94 Ga0068862_100031630 3300005844 Bacteria 4469
95 Ga0075365_10483784 3300006038 Bacteria 875
96 Ga0075368_10004678 3300006042 Bacteria 4654
97 Ga0075363_100074975 3300006048 Bacteria 1843
98 Ga0075364_10062738 3300006051 Bacteria 2439
99 Ga0075367_10000432 3300006178 Bacteria 15550
100 Ga0075369_10184509 3300006186 Bacteria 960
101 Ga0075369_10286418 3300006186 Bacteria 768
102 Ga0075366_10057177 3300006195 Bacteria 2318
103 Ga0075366_10515073 3300006195 Bacteria 740
104 Ga0097621_100308053 3300006237 Bacteria 1400
105 Ga0075370_10024908 3300006353 Bacteria 3308
106 Ga0068871_100424830 3300006358 Bacteria 1187
107 Ga0075431_100146462 3300006847 Bacteria 2434
108 Ga0075429_100766057 3300006880 Bacteria 845
109 Ga0097620_100442457 3300006931 Bacteria 1396
110 Ga0079104_1000233 3300006946 Bacteria 75184
111 Ga0099794_10076257 3300007265 Bacteria 1648
112 Ga0105240_10001958 3300009093 Bacteria 34069
113 Ga0105240_10008326 3300009093 Bacteria 14839
114 Ga0105240_10339483 3300009093 Bacteria 1707
115 Ga0105240_11744777 3300009093 Bacteria 649
116 Ga0105245_10002151 3300009098 Bacteria 17853
117 Ga0105247_10108411 3300009101 Bacteria 1784
118 Ga0105243_10000847 3300009148 Bacteria 29024
119 Ga0105243_10009064 3300009148 Bacteria 7601
120 Ga0105237_10042893 3300009545 Bacteria 4559
121 Ga0105237_10168162 3300009545 Bacteria 2192
122 Ga0105237_10473179 3300009545 Bacteria 1259
123 Ga0105237_10497327 3300009545 Bacteria 1226
124 Ga0105238_10006093 3300009551 Bacteria 11960
125 Ga0105238_10008522 3300009551 Bacteria 10261
126 Ga0105238_10028456 3300009551 Bacteria 5693
127 Ga0105238_10128901 3300009551 Bacteria 2508
128 Ga0105238_10301227 3300009551 Bacteria 1587
129 Ga0105238_10414726 3300009551 Bacteria 1341
130 Ga0105148_100126 3300009978 Bacteria 11756
131 Ga0105028_101109 3300009993 Bacteria 2848
132 Ga0105239_10033754 3300010375 Bacteria 5618
133 Ga0105239_10100056 3300010375 Bacteria 3206
134 Ga0105239_10819860 3300010375 Bacteria 1066
135 Ga0157373_10343162 3300013100 Bacteria 1065
136 Ga0157371_10000029 3300013102 Bacteria 252131
137 Ga0157371_10000149 3300013102 Bacteria 101593
138 Ga0157370_10000127 3300013104 Bacteria 90772
139 Ga0157370_10157576 3300013104 Bacteria 2112
140 Ga0157370_10494962 3300013104 Bacteria 1123
141 Ga0157369_10097084 3300013105 Unclassified 3143
142 Ga0157369_10979721 3300013105 Bacteria 866
143 Ga0157374_10413154 3300013296 Bacteria 1347
144 Ga0157378_10107733 3300013297 Bacteria 2550
145 Ga0157378_10377941 3300013297 Bacteria 1391
146 Ga0157372_10021887 3300013307 Bacteria 6911
147 Ga0182008_10010811 3300014497 Bacteria 4874
148 Ga0182008_10081456 3300014497 Unclassified 1593
149 Ga0182008_10282673 3300014497 Bacteria 864
150 Ga0182006_1000066 3300015261 Bacteria 151095
151 Ga0182006_1008015 3300015261 Bacteria 4800
152 Ga0182007_10026530 3300015262 Unclassified 2006
153 Ga0182007_10028669 3300015262 Bacteria 1911
154 Ga0182007_10039739 3300015262 Bacteria 1573
155 Ga0182005_1000045 3300015265 Bacteria 138175
156 Ga0182005_1015093 3300015265 Unclassified 2156
157 Ga0183365_10004 3300015684 Bacteria 333304
158 Ga0163161_10018355 3300017792 Bacteria 4903
159 Ga0163161_10175512 3300017792 Bacteria 1640
160 Ga0163161_10549019 3300017792 Bacteria 947
161 Ga0206355_1722878 3300020076 Bacteria 793
162 Ga0213876_10013112 3300021384 Bacteria 4404
163 Ga0209674_100408 3300025226 Bacteria 21338
164 Ga0209672_105007 3300025228 Bacteria 2345
165 Ga0209147_101509 3300025229 Bacteria 8174
166 Ga0209563_100147 3300025230 Bacteria 69021
167 Ga0209437_101033 3300025233 Bacteria 9416
168 Ga0209437_102846 3300025233 Bacteria 3247
169 Ga0209646_1019045 3300025246 Bacteria 1001
170 Ga0209026_1017308 3300025250 Bacteria 1155
171 Ga0209677_109799 3300025253 Bacteria 1674
172 Ga0209148_1000011 3300025254 Bacteria 1196503
173 Ga0209148_1001708 3300025254 Bacteria 9684
174 Ga0209233_1000052 3300025261 Bacteria 445813
175 Ga0209233_1021386 3300025261 Bacteria 1676
176 Ga0209233_1040117 3300025261 Bacteria 1021
177 Ga0209455_1000006 3300025272 Bacteria 1196503
178 Ga0209455_1000528 3300025272 Bacteria 26777
179 Ga0209455_1005748 3300025272 Bacteria 3774
180 Ga0209130_1000016 3300025284 Bacteria 395540
181 Ga0209676_1000031 3300025292 Bacteria 478976
182 Ga0209676_1000057 3300025292 Bacteria 361061
183 Ga0209676_1009299 3300025292 Bacteria 4255
184 Ga0209564_1025690 3300025295 Bacteria 1972
185 Ga0209758_1000023 3300025297 Bacteria 612453
186 Ga0209050_1000135 3300025298 Bacteria 184020
187 Ga0209050_1000522 3300025298 Bacteria 63985
188 Ga0209050_1001148 3300025298 Bacteria 31730
189 Ga0209256_1015077 3300025299 Bacteria 2728
190 Ga0209256_1015450 3300025299 Bacteria 2669
191 Ga0209051_1000720 3300025303 Bacteria 36140
192 Ga0209051_1001452 3300025303 Bacteria 20096
193 Ga0209051_1022249 3300025303 Bacteria 2673
194 Ga0209257_1000050 3300025304 Bacteria 439325
195 Ga0209257_1015126 3300025304 Bacteria 3243
196 Ga0207656_10008808 3300025321 Bacteria 3731
197 Ga0207710_10092745 3300025900 Bacteria 1416
198 Ga0207688_10028488 3300025901 Bacteria 3072
199 Ga0207680_10011782 3300025903 Bacteria 4431
200 Ga0207647_10005180 3300025904 Bacteria 9593
201 Ga0207647_10020030 3300025904 Bacteria 4491
202 Ga0207699_10347450 3300025906 Bacteria 1046
203 Ga0207645_10028085 3300025907 Bacteria 3633
204 Ga0207645_10039222 3300025907 Bacteria 3035
205 Ga0207705_10001210 3300025909 Bacteria 20932
206 Ga0207684_10629550 3300025910 Bacteria 915
207 Ga0207707_10028648 3300025912 Bacteria 4867
208 Ga0207695_10011982 3300025913 Bacteria 10433
209 Ga0207695_10034335 3300025913 Bacteria 5517
210 Ga0207695_10467702 3300025913 Bacteria 1143
211 Ga0207695_10533118 3300025913 Bacteria 1056
212 Ga0207671_10017854 3300025914 Bacteria 5458
213 Ga0207671_10021399 3300025914 Bacteria 4907
214 Ga0207671_10026997 3300025914 Bacteria 4295
215 Ga0207671_10246904 3300025914 Bacteria 1403
216 Ga0207663_10392401 3300025916 Bacteria 1060
217 Ga0207660_10085410 3300025917 Bacteria 2328
218 Ga0207657_10019604 3300025919 Bacteria 6415
219 Ga0207649_10000710 3300025920 Bacteria 21878
220 Ga0207649_10027081 3300025920 Bacteria 3361
221 Ga0207649_10097031 3300025920 Bacteria 1943
222 Ga0207649_10642154 3300025920 Bacteria 819
223 Ga0207652_10172685 3300025921 Bacteria 1940
224 Ga0207681_10157779 3300025923 Bacteria 1707
225 Ga0207694_10018654 3300025924 Bacteria 5245
226 Ga0207694_10072771 3300025924 Bacteria 2688
227 Ga0207694_10084123 3300025924 Bacteria 2502
228 Ga0207694_10288462 3300025924 Bacteria 1349
229 Ga0207694_10487408 3300025924 Bacteria 1032
230 Ga0207650_10234968 3300025925 Bacteria 1480
231 Ga0207687_10000798 3300025927 Bacteria 21269
232 Ga0207706_10105523 3300025933 Bacteria 2479
233 Ga0207706_10169919 3300025933 Bacteria 1916
234 Ga0207709_10000039 3300025935 Bacteria 260127
235 Ga0207669_10000117 3300025937 Bacteria 39781
236 Ga0207669_10000382 3300025937 Bacteria 19815
237 Ga0207711_10578814 3300025941 Bacteria 1047
238 Ga0207661_10002953 3300025944 Bacteria 11757
239 Ga0207679_10947931 3300025945 Bacteria 788
240 Ga0207667_10000002 3300025949 Bacteria 895662
241 Ga0207667_10003995 3300025949 Bacteria 18117
242 Ga0207667_10033611 3300025949 Bacteria 5512
243 Ga0207651_10360248 3300025960 Bacteria 1227
244 Ga0207668_10000459 3300025972 Bacteria 25616
245 Ga0207668_10101088 3300025972 Bacteria 2142
246 Ga0207668_10744655 3300025972 Bacteria 864
247 Ga0207640_10151241 3300025981 Bacteria 1705
248 Ga0207658_10000539 3300025986 Bacteria 34304
249 Ga0207658_10073092 3300025986 Bacteria 2602
250 Ga0207703_10000847 3300026035 Bacteria 30021
251 Ga0207639_10017056 3300026041 Bacteria 5146
252 Ga0207639_10030241 3300026041 Bacteria 3971
253 Ga0207639_10172214 3300026041 Bacteria 1834
254 Ga0207639_10407957 3300026041 Bacteria 1225
255 Ga0207678_10016640 3300026067 Bacteria 6460
256 Ga0207678_10036071 3300026067 Bacteria 4304
257 Ga0207678_10078493 3300026067 Bacteria 2828
258 Ga0207702_10024157 3300026078 Bacteria 5042
259 Ga0207702_10034995 3300026078 Bacteria 4200
260 Ga0207641_10000079 3300026088 Bacteria 141110
261 Ga0207648_10047537 3300026089 Bacteria 3761
262 Ga0207676_10102002 3300026095 Bacteria 2381
263 Ga0207674_10024940 3300026116 Bacteria 6382
264 Ga0207674_10034505 3300026116 Bacteria 5287
265 Ga0207683_10000496 3300026121 Bacteria 36404
266 Ga0207683_10021185 3300026121 Bacteria 5562
267 Ga0207698_10004357 3300026142 Bacteria 8617
268 Ga0207698_10080544 3300026142 Bacteria 2624
269 Ga0209281_1000076 3300027111 Bacteria 263350
270 Ga0209179_1014034 3300027512 Bacteria 1465
271 Ga0209813_10000193 3300027866 Bacteria 19061
272 Ga0268266_10000002 3300028379 Bacteria 3059047
273 Ga0268266_10098802 3300028379 Bacteria 2569
274 Ga0268266_10144375 3300028379 Bacteria 2138
275 Ga0268266_10312702 3300028379 Bacteria 1468
276 Ga0268266_10393901 3300028379 Bacteria 1308
277 Ga0268265_10000441 3300028380 Bacteria 43786
278 Ga0268264_10000055 3300028381 Bacteria 314947
279 Ga0268264_10022045 3300028381 Bacteria 5198
280 Ga0268264_11507938 3300028381 Bacteria 683
281 Ga0265334_10108569 3300028573 Bacteria 999
282 Ga0307517_10055671 3300028786 Bacteria 3878
283 Ga0307515_10048081 3300028794 Bacteria 6460
284 Ga0307515_10105375 3300028794 Bacteria 3358
285 Ga0307515_10373205 3300028794 Bacteria 1062
286 Ga0265338_10069689 3300028800 Bacteria 3019
287 Ga0307511_10004068 3300030521 Bacteria 14953
288 Ga0265330_10000281 3300031235 Bacteria 37503
289 Ga0265332_10000008 3300031238 Bacteria 301609
290 Ga0265320_10001142 3300031240 Bacteria 19529
291 Ga0265320_10025201 3300031240 Bacteria 3131
292 Ga0265325_10002464 3300031241 Bacteria 12475
293 Ga0265325_10003681 3300031241 Bacteria 9926
294 Ga0265325_10014671 3300031241 Bacteria 4421
295 Ga0265340_10014774 3300031247 Bacteria 4070
296 Ga0265340_10026996 3300031247 Bacteria 2897
297 Ga0265340_10223790 3300031247 Bacteria 843
298 Ga0265339_10013193 3300031249 Bacteria 5012
299 Ga0265331_10009489 3300031250 Bacteria 5460
300 Ga0265327_10000039 3300031251 Bacteria 292334
301 Ga0265327_10042551 3300031251 Bacteria 2437
302 Ga0265316_10043352 3300031344 Bacteria 3587
303 Ga0307513_10024144 3300031456 Bacteria 7079
304 Ga0307509_10000034 3300031507 Bacteria 193380
305 Ga0307509_10310343 3300031507 Bacteria 1320
306 Ga0307408_100029072 3300031548 Bacteria 3826
307 Ga0265313_10075898 3300031595 Bacteria 1537
308 Ga0307508_10000317 3300031616 Bacteria 58176
309 Ga0307514_10001251 3300031649 Bacteria 33354
310 Ga0265314_10000065 3300031711 Bacteria 158383
311 Ga0265314_10087721 3300031711 Bacteria 2034
312 Ga0265342_10099855 3300031712 Bacteria 1655
313 Ga0307516_10000001 3300031730 Bacteria 510338
314 Ga0307516_10000405 3300031730 Bacteria 56495
315 Ga0307405_10204646 3300031731 Bacteria 1436
316 Ga0307413_10085428 3300031824 Bacteria 2037
317 Ga0307413_10754999 3300031824 Bacteria 813
318 Ga0307412_10083948 3300031911 Bacteria 2210
319 Ga0307409_100288371 3300031995 Bacteria 1521
320 Ga0315911_1000005 3300033442 Bacteria 426255
321 Ga0373935_0015118 3300035692 Bacteria 4661
322 Ga0373937_0018626 3300036401 Bacteria 6203
323 Ga0310109_017351 3300036534 Bacteria 973
324 Ga0373925_0690309 3300037068 Bacteria 842
325 Ga0395899_0211793 3300037312 Bacteria 1346
326 Ga0395900_0013472 3300037418 Bacteria 8355
327 Ga0395900_0144077 3300037418 Bacteria 2438
328 Ga0395900_0625948 3300037418 Bacteria 1015
329 Ga0395901_0085564 3300038443 Bacteria 3296
330 Ga0395901_0221211 3300038443 Bacteria 1979
331 Ga0395901_1170714 3300038443 Bacteria 736
332 Ga0237819_01183 3300038705 Bacteria 7350
333 Ga0237816_00202 3300039145 Bacteria 4847
334 Ga0436365_0604521 3300039437 Bacteria 1010
335 Ga0436365_0743078 3300039437 Bacteria 30672
336 Ga0436365_1106902 3300039437 Bacteria 1086
337 Ga0436362_0543628 3300039453 Bacteria 2137
338 Ga0439461_0028876 3300041410 Bacteria 1145
339 Ga0451795_0975754 3300041456 Bacteria 802
340 Ga0451795_1434403 3300041456 Bacteria 1124
341 Ga0451800_1633068 3300041459 Bacteria 1017
342 Ga0451804_1057260 3300041463 Bacteria 657
343 Ga0439443_014595 3300042003 Bacteria 1185
344 Ga0450911_000005 3300042115 Bacteria 233469
345 Ga0450902_014459 3300042137 Bacteria 1277
346 Ga0439446_0046748 3300042156 Bacteria 1286
347 Ga0450908_000048 3300042184 Bacteria 24178
348 Ga0453684_0622467 3300044712 Bacteria 1181
349 Ga0466959_0012635 3300045049 Bacteria 6107
350 Ga0466967_1002745 3300045976 Bacteria 831
351 Ga0495617_000024 3300046452 Bacteria 174402
352 Ga0495617_000296 3300046452 Bacteria 28300
353 Ga0495617_024660 3300046452 Bacteria 2029
354 Ga0495617_140271 3300046452 Bacteria 772
355 Ga0495617_144857 3300046452 Bacteria 757
356 Ga0495627_000478 3300046453 Bacteria 33914
357 Ga0495592_0059295 3300046454 Bacteria 2819
358 Ga0495592_0088409 3300046454 Bacteria 2227
359 Ga0495603_0354853 3300046455 Bacteria 841
360 Ga0495590_0018331 3300046457 Bacteria 2506
361 Ga0495590_0029296 3300046457 Bacteria 1930
362 Ga0495629_0000027 3300046459 Bacteria 129244
363 Ga0495629_0000130 3300046459 Bacteria 65355
364 Ga0495629_0000281 3300046459 Bacteria 44035
365 Ga0495629_0041152 3300046459 Bacteria 3252
366 Ga0495638_0000128 3300046460 Bacteria 123567
367 Ga0495638_0000363 3300046460 Bacteria 56118
368 Ga0495638_0006293 3300046460 Bacteria 8657
369 Ga0495638_0006659 3300046460 Bacteria 8384
370 Ga0495638_0057822 3300046460 Bacteria 2404
371 Ga0495638_0078605 3300046460 Bacteria 2007
372 Ga0495638_0275069 3300046460 Bacteria 917
373 Ga0495641_0108463 3300046461 Bacteria 1239
374 Ga0495651_0007550 3300046462 Bacteria 8318
375 Ga0495653_0000449 3300046463 Bacteria 32095
376 Ga0495653_0000885 3300046463 Bacteria 23146
377 Ga0495653_0033105 3300046463 Bacteria 4097
378 Ga0495650_0000226 3300046471 Bacteria 115930
379 Ga0495650_0000470 3300046471 Bacteria 62114
380 Ga0495650_0001371 3300046471 Bacteria 24045
381 Ga0495650_0005382 3300046471 Bacteria 8328
382 Ga0495650_0006744 3300046471 Bacteria 7102
383 Ga0495650_0033401 3300046471 Bacteria 2290
384 Ga0495650_0159613 3300046471 Bacteria 805
385 Ga0495580_0003983 3300046472 Bacteria 12464
386 Ga0495580_0005607 3300046472 Bacteria 10338
387 Ga0495580_0005620 3300046472 Bacteria 10326
388 Ga0495580_0006044 3300046472 Bacteria 9911
389 Ga0495580_0007400 3300046472 Bacteria 8831
390 Ga0495580_0021463 3300046472 Bacteria 4764
391 Ga0495580_0027966 3300046472 Bacteria 4101
392 Ga0495580_0097802 3300046472 Bacteria 2041
393 Ga0495582_0032237 3300046473 Bacteria 2883
394 Ga0495605_0013142 3300046474 Bacteria 4574
395 Ga0495605_0044778 3300046474 Bacteria 2185
396 Ga0495664_0010704 3300046477 Bacteria 5152
397 Ga0495664_0067107 3300046477 Bacteria 2140
398 Ga0495584_0004592 3300046491 Bacteria 7400
399 Ga0495584_0165160 3300046491 Bacteria 1125
400 Ga0495584_0199762 3300046491 Bacteria 1016
401 Ga0495584_0393420 3300046491 Bacteria 704
402 Ga0495585_0000143 3300046492 Bacteria 78365
403 Ga0495585_0000360 3300046492 Bacteria 44156
404 Ga0495585_0003270 3300046492 Bacteria 11027
405 Ga0495585_0032133 3300046492 Bacteria 2975
406 Ga0495585_0064674 3300046492 Bacteria 2005
407 Ga0495585_0174619 3300046492 Bacteria 1108
408 Ga0495596_0104288 3300046500 Bacteria 1101
409 Ga0495596_0180383 3300046500 Bacteria 821
410 Ga0495607_0000083 3300046501 Bacteria 96690
411 Ga0495607_0000460 3300046501 Bacteria 40825
412 Ga0495607_0003621 3300046501 Bacteria 11730
413 Ga0495607_0045245 3300046501 Bacteria 2590
414 Ga0495607_0108152 3300046501 Bacteria 1478
415 Ga0495583_0001366 3300046506 Bacteria 25162
416 Ga0495583_0002817 3300046506 Bacteria 14221
417 Ga0495583_0002869 3300046506 Bacteria 14011
418 Ga0495583_0021304 3300046506 Bacteria 3338
419 Ga0495583_0034073 3300046506 Bacteria 2443
420 Ga0495583_0036880 3300046506 Bacteria 2321
421 Ga0495583_0065054 3300046506 Bacteria 1616
422 Ga0495583_0179260 3300046506 Bacteria 868
423 Ga0495606_0000066 3300046507 Bacteria 181028
424 Ga0495606_0000092 3300046507 Bacteria 152369
425 Ga0495606_0000136 3300046507 Bacteria 125611
426 Ga0495606_0001286 3300046507 Bacteria 34779
427 Ga0495606_0010585 3300046507 Bacteria 7634
428 Ga0495606_0023113 3300046507 Bacteria 4514
429 Ga0495606_0084167 3300046507 Bacteria 1970
430 Ga0495606_0112148 3300046507 Bacteria 1643
431 Ga0495606_0115834 3300046507 Bacteria 1610
432 Ga0495606_0343390 3300046507 Bacteria 794
433 Ga0495610_0000356 3300046512 Bacteria 47959
434 Ga0495610_0005518 3300046512 Bacteria 8963
435 Ga0495610_0214499 3300046512 Bacteria 780
436 Ga0495616_0000003 3300046513 Bacteria 290178
437 Ga0495616_0000018 3300046513 Bacteria 167281
438 Ga0495616_0025623 3300046513 Bacteria 3148
439 Ga0495616_0151260 3300046513 Bacteria 1050
440 Ga0495620_0000102 3300046515 Bacteria 68028
441 Ga0495620_0027224 3300046515 Bacteria 2678
442 Ga0495620_0038233 3300046515 Bacteria 2131
443 Ga0495620_0110997 3300046515 Bacteria 1087
444 Ga0495628_0007163 3300046516 Bacteria 9658
445 Ga0495628_0047361 3300046516 Bacteria 3411
446 Ga0495628_0052696 3300046516 Bacteria 3213
447 Ga0495628_0080520 3300046516 Bacteria 2531
448 Ga0495628_0110409 3300046516 Bacteria 2116
449 Ga0495631_0000022 3300046518 Bacteria 91377
450 Ga0495631_0000267 3300046518 Bacteria 36464
451 Ga0495631_0002903 3300046518 Bacteria 9494
452 Ga0495631_0173186 3300046518 Bacteria 925
453 Ga0495632_0000008 3300046519 Bacteria 294056
454 Ga0495632_0000042 3300046519 Bacteria 145186
455 Ga0495632_0002853 3300046519 Bacteria 12755
456 Ga0495632_0006266 3300046519 Bacteria 7688
457 Ga0495637_0008748 3300046520 Bacteria 4961
458 Ga0495637_0012500 3300046520 Bacteria 4059
459 Ga0495637_0044545 3300046520 Bacteria 1888
460 Ga0495637_0202655 3300046520 Bacteria 728
461 Ga0495643_0000005 3300046522 Bacteria 443135
462 Ga0495643_0000530 3300046522 Bacteria 47567
463 Ga0495643_0009416 3300046522 Bacteria 6073
464 Ga0495643_0019650 3300046522 Bacteria 3904
465 Ga0495643_0065152 3300046522 Bacteria 1924
466 Ga0495644_0014817 3300046523 Bacteria 2985
467 Ga0495648_0000146 3300046524 Bacteria 84443
468 Ga0495648_0000363 3300046524 Bacteria 50055
469 Ga0495648_0001155 3300046524 Bacteria 26690
470 Ga0495648_0001362 3300046524 Bacteria 24150
471 Ga0495648_0004160 3300046524 Bacteria 12442
472 Ga0495648_0012133 3300046524 Bacteria 6449
473 Ga0495648_0025432 3300046524 Bacteria 4008
474 Ga0495648_0052312 3300046524 Bacteria 2481
475 Ga0495648_0068302 3300046524 Bacteria 2074
476 Ga0495648_0081807 3300046524 Bacteria 1836
477 Ga0495648_0089274 3300046524 Bacteria 1730
478 Ga0495648_0100208 3300046524 Bacteria 1601
479 Ga0495663_0000015 3300046525 Bacteria 145185
480 Ga0495663_0001818 3300046525 Bacteria 6592
481 Ga0495666_0240105 3300046526 Bacteria 827
482 Ga0495642_0002091 3300046528 Bacteria 8263
483 Ga0495642_0054429 3300046528 Bacteria 1650
484 Ga0495665_0043904 3300046531 Bacteria 2376
485 Ga0495665_0229958 3300046531 Bacteria 957
486 Ga0495640_0192125 3300046533 Bacteria 1297
487 Ga0495586_0228330 3300046535 Bacteria 1059
488 Ga0495609_0013558 3300046538 Bacteria 3847
489 Ga0495609_0014939 3300046538 Bacteria 3642
490 Ga0495609_0027977 3300046538 Bacteria 2574
491 Ga0495609_0178062 3300046538 Bacteria 896
492 Ga0495597_0011589 3300046542 Bacteria 4271
493 Ga0495597_0091236 3300046542 Bacteria 1293
494 Ga0495645_0007813 3300046543 Bacteria 7439
495 Ga0495645_0303663 3300046543 Bacteria 1042
496 Ga0495622_0000811 3300046557 Bacteria 17289
497 Ga0495622_0218024 3300046557 Bacteria 846
498 Ga0495633_0000197 3300046558 Bacteria 76903
499 Ga0495633_0000222 3300046558 Bacteria 70418
500 Ga0495633_0000371 3300046558 Bacteria 48203
501 Ga0495633_0000842 3300046558 Bacteria 27022
502 Ga0495633_0067556 3300046558 Bacteria 1669
503 Ga0495633_0131657 3300046558 Bacteria 1157
504 Ga0495633_0249159 3300046558 Bacteria 811
505 Ga0495656_0391587 3300046615 Bacteria 726
506 Ga0495668_0000019 3300046616 Bacteria 416042
507 Ga0495668_0000056 3300046616 Bacteria 197862
508 Ga0495668_0000061 3300046616 Bacteria 192499
509 Ga0495668_0000066 3300046616 Bacteria 178533
510 Ga0495668_0020487 3300046616 Bacteria 3804
511 Ga0495668_0123686 3300046616 Bacteria 1415
512 Ga0495634_0090030 3300046642 Bacteria 1994
513 Ga0495634_0181821 3300046642 Bacteria 1316
514 Ga0495611_0000004 3300046648 Bacteria 308149
515 Ga0495611_0000113 3300046648 Bacteria 56814
516 Ga0495611_0011961 3300046648 Bacteria 3686
517 Ga0495611_0015996 3300046648 Bacteria 3207
518 Ga0495611_0155574 3300046648 Bacteria 1067
519 Ga0495625_0000024 3300046660 Bacteria 271126
520 Ga0495625_0000255 3300046660 Bacteria 82750
521 Ga0495625_0008595 3300046660 Bacteria 8690
522 Ga0495625_0009405 3300046660 Bacteria 8179
523 Ga0495625_0016404 3300046660 Bacteria 5832
524 Ga0495625_0264849 3300046660 Bacteria 1111
525 Ga0495625_0265681 3300046660 Bacteria 1109
526 Ga0495625_0273380 3300046660 Bacteria 1089
527 Ga0495659_0046350 3300046664 Bacteria 1569
528 Ga0495661_0023232 3300046665 Bacteria 4025
529 Ga0495661_0147719 3300046665 Bacteria 1272
530 Ga0495599_0175318 3300046678 Bacteria 1322
531 Ga0495646_0002861 3300046680 Bacteria 10686
532 Ga0495646_0006551 3300046680 Bacteria 7388
533 Ga0495646_0056805 3300046680 Bacteria 2345
534 Ga0495669_0000155 3300046684 Bacteria 43475
535 Ga0495613_0056868 3300046689 Bacteria 2873
536 Ga0495613_0077881 3300046689 Bacteria 2412
537 Ga0495613_0101505 3300046689 Bacteria 2078
538 Ga0495613_0774563 3300046689 Bacteria 627
539 Ga0495624_0004752 3300046690 Bacteria 9880
540 Ga0495624_0005955 3300046690 Bacteria 8714
541 Ga0495624_0006209 3300046690 Bacteria 8493
542 Ga0495624_0022978 3300046690 Bacteria 4115
543 Ga0495670_0001381 3300046691 Bacteria 11876
544 Ga0495670_0002072 3300046691 Bacteria 9885
545 Ga0495670_0040453 3300046691 Bacteria 2324
546 Ga0495670_0364507 3300046691 Bacteria 778
547 Ga0495671_0000007 3300046692 Bacteria 443069
548 Ga0495671_0001491 3300046692 Bacteria 15677
549 Ga0495671_0061148 3300046692 Bacteria 1858
550 Ga0495671_0065703 3300046692 Bacteria 1785
551 Ga0495671_0193287 3300046692 Bacteria 988
552 Ga0495649_0021687 3300046694 Bacteria 3598
553 Ga0495649_0085604 3300046694 Bacteria 1682
554 Ga0495649_0263956 3300046694 Bacteria 882
555 Ga0495589_0000367 3300046794 Bacteria 35022
556 Ga0495600_0005075 3300046809 Bacteria 7912
557 Ga0495660_0000052 3300046810 Bacteria 137821
558 Ga0495660_0000064 3300046810 Bacteria 124968
559 Ga0495660_0030727 3300046810 Bacteria 3025
560 Ga0495604_0488753 3300047317 Bacteria 800
561 Ga0495674_0001399 3300047319 Bacteria 23591
562 Ga0495674_0001405 3300047319 Bacteria 23564
563 Ga0495674_0005169 3300047319 Bacteria 12533
564 Ga0495674_0192671 3300047319 Bacteria 1693
565 Ga0495672_0001207 3300047320 Bacteria 26064
566 Ga0495672_0025394 3300047320 Bacteria 3793
567 Ga0495672_0078132 3300047320 Bacteria 1852
568 Ga0495672_0162524 3300047320 Bacteria 1146
569 Ga0495676_0053985 3300047321 Bacteria 3198
570 Ga0495676_0054767 3300047321 Bacteria 3168
571 Ga0495680_0315834 3300047322 Bacteria 1094
572 Ga0495683_0006619 3300047323 Bacteria 6318
573 Ga0495683_0012572 3300047323 Bacteria 4444
574 Ga0495687_000077 3300047443 Bacteria 148889
575 Ga0495687_000353 3300047443 Bacteria 58833
576 Ga0495687_112000 3300047443 Bacteria 1001
577 Ga0495675_0374154 3300047444 Bacteria 834
578 Ga0495679_000009 3300047446 Bacteria 343637
579 Ga0495679_000011 3300047446 Bacteria 324498
580 Ga0495679_000102 3300047446 Bacteria 76337
581 Ga0495679_012887 3300047446 Bacteria 3162
582 Ga0495673_0000028 3300047469 Bacteria 473418
583 Ga0495673_0000036 3300047469 Bacteria 311035
584 Ga0495673_0000101 3300047469 Bacteria 173409
585 Ga0495673_0003573 3300047469 Bacteria 10216
586 Ga0495673_0086782 3300047469 Bacteria 1285
587 Ga0495681_0000032 3300047470 Bacteria 127415
588 Ga0495681_0010146 3300047470 Bacteria 5727
589 Ga0495681_0033770 3300047470 Bacteria 2557
590 Ga0495681_0055878 3300047470 Bacteria 1839
591 Ga0495681_0175854 3300047470 Bacteria 882
592 Ga0495686_0000033 3300047472 Bacteria 342031
593 Ga0495686_0000180 3300047472 Bacteria 121204
594 Ga0495686_0000190 3300047472 Bacteria 115114
595 Ga0495686_0001592 3300047472 Bacteria 23973
596 Ga0495686_0002384 3300047472 Bacteria 17849
597 Ga0495686_0024922 3300047472 Bacteria 3925
598 Ga0495686_0070152 3300047472 Bacteria 2159
599 Ga0495686_0100699 3300047472 Bacteria 1743
600 Ga0495686_0155947 3300047472 Bacteria 1337
601 Ga0495686_0224032 3300047472 Bacteria 1068
602 Ga0495593_0004348 3300047673 Bacteria 8431
603 Ga0495593_0014869 3300047673 Bacteria 4421
604 Ga0495593_0223157 3300047673 Bacteria 945
605 Ga0495593_0373848 3300047673 Bacteria 712
606 Ga0495626_0004650 3300048091 Bacteria 8338
607 Ga0495626_0005244 3300048091 Bacteria 7667
608 Ga0495626_0030318 3300048091 Bacteria 2609
609 Ga0495626_0040568 3300048091 Bacteria 2198
610 Ga0496100_0056714 3300048903 Bacteria 2564
611 Ga0496100_0208709 3300048903 Bacteria 1427
612 Ga0496101_0000999 3300048904 Bacteria 16755
613 Ga0496101_0168706 3300048904 Bacteria 1681
614 Ga0496102_0000163 3300048905 Bacteria 89673
615 Ga0496102_0027920 3300048905 Bacteria 5042
616 Ga0496102_0126223 3300048905 Bacteria 2392
617 Ga0496102_0627485 3300048905 Bacteria 998
618 Ga0496102_0927401 3300048905 Bacteria 792
619 Ga0496103_0000052 3300048906 Bacteria 149437
620 Ga0496103_0205226 3300048906 Bacteria 1267
621 Ga0496104_0008489 3300048907 Bacteria 9135
622 Ga0496105_0001302 3300048908 Bacteria 17462
623 Ga0496105_0002897 3300048908 Bacteria 12589
624 Ga0496106_0474159 3300048909 Bacteria 1005
625 Ga0496107_0175449 3300048910 Bacteria 1591
626 Ga0496108_0203733 3300048911 Bacteria 1717
627 Ga0496109_0083486 3300048912 Bacteria 2946
628 Ga0496109_0206942 3300048912 Bacteria 1845
629 Ga0496110_0058192 3300048913 Bacteria 3404
630 Ga0496110_0145791 3300048913 Bacteria 2141
631 Ga0496110_0245520 3300048913 Bacteria 1629
632 Ga0496111_0002111 3300048914 Bacteria 11868
633 Ga0496111_0016400 3300048914 Bacteria 5103
634 Ga0496112_0000052 3300048915 Bacteria 81285
635 Ga0496112_0304667 3300048915 Bacteria 1538
636 Ga0496113_0028812 3300048916 Bacteria 3999
637 Ga0496113_0885374 3300048916 Bacteria 707
638 Ga0496114_0342325 3300048917 Bacteria 1322
639 Ga0496115_0000078 3300048918 Bacteria 89817
640 Ga0496115_0027713 3300048918 Bacteria 4434
641 Ga0496115_0283942 3300048918 Bacteria 1359
642 Ga0496115_0369101 3300048918 Bacteria 1168
643 Ga0496115_0436424 3300048918 Bacteria 1059
644 Ga0496115_0496133 3300048918 Bacteria 982
645 Ga0496115_0826663 3300048918 Bacteria 719
646 Ga0496116_0015207 3300048919 Bacteria 6095
647 Ga0496116_0081560 3300048919 Bacteria 2005
648 Ga0496116_0088333 3300048919 Bacteria 1894
649 Ga0496117_0000102 3300048920 Bacteria 189959
650 Ga0496117_0000141 3300048920 Bacteria 158041
651 Ga0496117_0012119 3300048920 Bacteria 7645
652 Ga0496117_0109260 3300048920 Bacteria 1727
653 Ga0496117_0207727 3300048920 Bacteria 1100
654 Ga0496118_0000038 3300048921 Bacteria 315464
655 Ga0496118_0000103 3300048921 Bacteria 158099
656 Ga0496118_0000696 3300048921 Bacteria 54619
657 Ga0496118_0005851 3300048921 Bacteria 13787
658 Ga0496118_0060180 3300048921 Bacteria 2822
659 Ga0496118_0188363 3300048921 Bacteria 1237
660 Ga0496118_0287098 3300048921 Bacteria 912
661 Ga0496119_0003348 3300048922 Bacteria 16702
662 Ga0496119_0009712 3300048922 Bacteria 8194
663 Ga0496119_0024539 3300048922 Bacteria 4238
664 Ga0496120_0030390 3300048923 Bacteria 3284
665 Ga0496120_0062358 3300048923 Bacteria 2077
666 Ga0496120_0108714 3300048923 Bacteria 1452
667 Ga0496121_0000156 3300048924 Bacteria 149376
668 Ga0496121_0000208 3300048924 Bacteria 129753
669 Ga0496121_0000782 3300048924 Bacteria 58365
670 Ga0496121_0001227 3300048924 Bacteria 44616
671 Ga0496121_0028584 3300048924 Bacteria 5187
672 Ga0496121_0057869 3300048924 Bacteria 3209
673 Ga0496121_0059804 3300048924 Bacteria 3139
674 Ga0496121_0066519 3300048924 Bacteria 2926
675 Ga0496121_0075697 3300048924 Bacteria 2688
676 Ga0496121_0232510 3300048924 Bacteria 1290
677 Ga0496121_0317860 3300048924 Bacteria 1049
678 Ga0496121_0402299 3300048924 Bacteria 896
679 Ga0496122_0002015 3300048925 Bacteria 30205
680 Ga0496122_0010032 3300048925 Bacteria 9853
681 Ga0496122_0011694 3300048925 Bacteria 8847
682 Ga0496122_0045690 3300048925 Bacteria 3401
683 Ga0496122_0051420 3300048925 Bacteria 3131
684 Ga0496123_0000539 3300048926 Bacteria 65166
685 Ga0496123_0004774 3300048926 Bacteria 14014
686 Ga0496123_0007053 3300048926 Bacteria 10693
687 Ga0496123_0022976 3300048926 Bacteria 4788
688 Ga0496124_0000041 3300048927 Bacteria 303887
689 Ga0496124_0019294 3300048927 Bacteria 6351
690 Ga0496124_0024928 3300048927 Bacteria 5427
691 Ga0496124_0075331 3300048927 Bacteria 2788
692 Ga0496124_0120736 3300048927 Bacteria 2095
693 Ga0496124_0249998 3300048927 Bacteria 1312
694 Ga0496124_0289547 3300048927 Bacteria 1189
695 Ga0496125_0000238 3300048928 Bacteria 113252
696 Ga0496125_0005247 3300048928 Bacteria 14519
697 Ga0496125_0078684 3300048928 Bacteria 2533
698 Ga0496125_0145693 3300048928 Bacteria 1637
699 Ga0496125_0480177 3300048928 Bacteria 704
700 Ga0496126_0000155 3300048929 Bacteria 158816
701 Ga0496126_0000817 3300048929 Bacteria 55573
702 Ga0496126_0054808 3300048929 Bacteria 3609
703 Ga0496126_0084486 3300048929 Bacteria 2800
704 Ga0496126_0094153 3300048929 Bacteria 2629
705 Ga0496126_0285009 3300048929 Bacteria 1367
706 Ga0495678_000067 3300049459 Bacteria 132540
707 Ga0495678_001527 3300049459 Bacteria 17887
708 Ga0495678_030533 3300049459 Bacteria 2254
709 Ga0495678_035460 3300049459 Bacteria 2045
710 Ga0495678_053007 3300049459 Bacteria 1559
711 Ga0495682_0009921 3300049460 Bacteria 3704
712 Ga0495682_0039341 3300049460 Bacteria 1736
713 Ga0495682_0102406 3300049460 Bacteria 1027
714 Ga0501335_001954 3300049551 Bacteria 1637
715 Ga0501033_0361177 3300049570 Bacteria 1016
716 Ga0501034_0008945 3300049571 Bacteria 10528
717 Ga0501034_0043506 3300049571 Bacteria 4545
718 Ga0501034_0074510 3300049571 Bacteria 3402
719 Ga0501034_0278855 3300049571 Bacteria 1611
720 Ga0501034_0667521 3300049571 Bacteria 940
721 Ga0501037_0015498 3300049573 Bacteria 5609
722 Ga0501039_0477245 3300049575 Bacteria 979
723 Ga0501043_0114352 3300049579 Bacteria 2119
724 Ga0501047_0157204 3300049581 Bacteria 2147
725 Ga0501047_0258557 3300049581 Bacteria 1589
726 Ga0501073_0676047 3300049589 Bacteria 712
727 Ga0501249_000057 3300049679 Bacteria 40985
728 Ga0501225_0005256 3300049705 Bacteria 3812
729 Ga0501225_0008501 3300049705 Bacteria 2944
730 Ga0501035_0012166 3300049822 Bacteria 7958
731 Ga0501035_0049902 3300049822 Bacteria 3751
732 Ga0501035_0653511 3300049822 Bacteria 852
733 Ga0501044_0000515 3300049823 Bacteria 47051
734 Ga0501044_0092841 3300049823 Bacteria 3044
735 Ga0501044_0208817 3300049823 Bacteria 1908
736 Ga0501044_0838402 3300049823 Bacteria 797
737 Ga0501204_007499 3300049850 Bacteria 1229
738 nmdc:mga00v17_11948_c1 3300050491 Bacteria 4781
739 nmdc:mga00v17_703184_c1 3300050491 Bacteria 648
740 nmdc:mga0yw44_266370_c1 3300050492 Bacteria 1143
741 nmdc:mga0k408_316310_c1 3300050493 Bacteria 932
742 nmdc:mga0k408_469216_c1 3300050493 Bacteria 747
743 nmdc:mga06z11_27_c1 3300050494 Bacteria 64010
744 nmdc:mga04h51_2074_c1 3300050495 Bacteria 4707
745 nmdc:mga07m45_45066_c1 3300050496 Bacteria 2476
746 nmdc:mga09592_67153_c1 3300050508 Bacteria 3040
747 Ga0495601_0192739 3300053077 Bacteria 1332
748 Ga0495601_0215168 3300053077 Bacteria 1255
749 Ga0500610_0000144 3300053079 Bacteria 21374
750 Ga0495595_0184311 3300053084 Bacteria 1036
751 Ga0495619_0277068 3300053085 Bacteria 1162
752 Ga0500578_0000005 3300053086 Bacteria 243789
753 Ga0500643_000012 3300053087 Bacteria 369839
754 Ga0500643_000199 3300053087 Bacteria 57141
755 Ga0500643_000466 3300053087 Bacteria 29832
756 Ga0500643_000848 3300053087 Bacteria 19517
757 Ga0500643_023732 3300053087 Bacteria 1957
758 Ga0500646_0017402 3300053090 Bacteria 1885
759 Ga0500647_0076062 3300053091 Bacteria 1611
760 Ga0500583_0136685 3300053092 Bacteria 1217
761 Ga0500651_0368218 3300053093 Bacteria 813
762 Ga0500641_0000152 3300053096 Bacteria 25722
763 Ga0500641_0020030 3300053096 Bacteria 2535
764 Ga0500555_000594 3300053103 Bacteria 14125
765 Ga0500562_001900 3300053108 Bacteria 5241
766 Ga0500562_036021 3300053108 Bacteria 1311
767 Ga0500562_044569 3300053108 Bacteria 1181
768 Ga0500594_0000079 3300053118 Bacteria 29754
769 Ga0500595_016627 3300053119 Bacteria 2735
770 Ga0500595_147439 3300053119 Bacteria 658
771 Ga0500608_000039 3300053122 Bacteria 59428
772 Ga0500608_000151 3300053122 Bacteria 28926
773 Ga0500608_000351 3300053122 Bacteria 17772
774 Ga0500608_000636 3300053122 Bacteria 12933
775 Ga0500642_0096758 3300053130 Bacteria 1369
776 Ga0500658_0002778 3300053134 Bacteria 6718
777 Ga0500559_0000190 3300053136 Bacteria 49263
778 Ga0500559_0001426 3300053136 Bacteria 13564
779 Ga0500559_0011010 3300053136 Bacteria 3872
780 Ga0500559_0014015 3300053136 Bacteria 3389
781 Ga0500559_0039778 3300053136 Bacteria 2046
782 Ga0500561_0010843 3300053137 Bacteria 1898
783 Ga0500564_018193 3300053138 Bacteria 3200
784 Ga0500568_0007024 3300053139 Bacteria 5569
785 Ga0500568_0015017 3300053139 Bacteria 3475
786 Ga0500573_0000271 3300053140 Bacteria 21909
787 Ga0500573_0061486 3300053140 Bacteria 2151
788 Ga0500573_0181186 3300053140 Bacteria 1132
789 Ga0500588_0184032 3300053146 Bacteria 769
790 Ga0500604_0106670 3300053151 Bacteria 927
791 Ga0500616_0044966 3300053153 Bacteria 2355
792 Ga0500619_000886 3300053154 Bacteria 5108
793 Ga0500622_0001545 3300053156 Bacteria 18217
794 Ga0500622_0002329 3300053156 Bacteria 13867
795 Ga0500622_0008683 3300053156 Bacteria 5669
796 Ga0500622_0024452 3300053156 Bacteria 3193
797 Ga0500622_0055833 3300053156 Bacteria 2022
798 Ga0500624_000053 3300053157 Bacteria 74086
799 Ga0500627_0091911 3300053158 Bacteria 1358
800 Ga0500633_0031530 3300053160 Bacteria 1714
801 Ga0500636_0003608 3300053177 Bacteria 8724
802 Ga0500637_0102461 3300053178 Bacteria 1660
803 Ga0500567_038725 3300053723 Bacteria 2230
804 Ga0500625_000002 3300053729 Bacteria 371909
805 Ga0500645_000001 3300053730 Bacteria 455558
806 Ga0500645_000566 3300053730 Bacteria 24221
807 Ga0500645_010918 3300053730 Bacteria 2984
808 Ga0500661_046605 3300055283 Bacteria 771
809 Ga0587084_003395 3300059477 Bacteria 1748
810 Ga0587088_004364 3300059508 Bacteria 1786
811 Ga0587090_003778 3300059510 Bacteria 1786
812 Ga0587094_002775 3300059513 Bacteria 1839
813 Ga0587128_005805 3300059630 Bacteria 1495
814 Ga0587069_005954 3300059642 Bacteria 1444
815 Ga0587078_002342 3300059646 Bacteria 1830
816 Ga0587079_005621 3300059647 Bacteria 1784
817 Ga0587102_000884 3300059649 Bacteria 1902
818 Ga0587096_00527 3300060247 Bacteria 1081
819 Ga0587071_006951 3300060344 Bacteria 1788
820 Ga0587071_038487 3300060344 Bacteria 950
821 Ga0587111_0006342 3300060346 Bacteria 1872
822 Ga0587111_0014016 3300060346 Bacteria 1443
823 Ga0587111_0015291 3300060346 Bacteria 1401
824 Ga0587111_0047376 3300060346 Bacteria 937
825 2512035364 2511231221 Bacteria 6846400
826 2585400558 2582581867 Bacteria 7184437
827 2585819880 2585427590 Bacteria 6824633
828 2616310858 2615840626 Bacteria 7921970
829 2830078984 2830075706 Bacteria 3855215
830 2842918434 2842914999 Bacteria 4419378
831 2885431589 2885429604 Bacteria 3642894
832 2928974838 2928972540 Bacteria 3058286
833 2939634858 2939631187 Bacteria 6118131
834 2977242118 2977240413 Bacteria 3191065
835 2989780942 2989776772 Bacteria 4843317
836 8045865643 8045864390 Bacteria 5043873
837 Ga0207694_10004368
838 JGI24741J21665_1004560
839 JGI24740J21852_10015017
840 JGI24740J21852_10058307
841 JGI24739J22299_10001701
842 JGI24737J22298_10006194
843 JGI24737J22298_10028777
844 JGI24735J21928_10005514
845 JGI24742J22300_10007013
846 JGI25159J45721_1001111
847 JGI25165J46597_1000095
848 JGI25165J46597_1033269
849 JGI25153J46596_10000070
850 Ga0055532_1008694
851 Ga0055525_1000203
852 Ga0055542_1000040
853 Ga0055542_1024935
854 Ga0055529_1000037
855 Ga0055529_1008275
856 Ga0055536_1010073
857 Ga0055536_1011254
858 Ga0055536_1011520
859 Ga0055530_10005838
860 Ga0055530_10009279
861 Ga0055530_10017340
862 Ga0055531_10008976
863 Ga0055543_1001755
864 Ga0065165_1000034
865 Ga0065165_1000201
866 Ga0065165_1019972
867 Ga0065704_10002132
868 Ga0065704_10103203
869 Ga0070658_10000493
870 Ga0070658_10214969
871 Ga0070683_100003434
872 Ga0070683_100129620
873 Ga0070670_100222087
874 Ga0070666_10012958
875 Ga0070680_100101269
876 Ga0070682_100557312
877 Ga0070660_100018126
878 Ga0070661_100007029
879 Ga0070661_100732717
880 Ga0070668_100029073
881 Ga0070668_100051660
882 Ga0070668_100146008
883 Ga0070669_100108785
884 Ga0070669_100792781
885 Ga0070675_100902593
886 Ga0070671_100077914
887 Ga0070671_100867727
888 Ga0070674_100094329
889 Ga0070673_100065542
890 Ga0070667_100000641
891 Ga0070667_100443740
892 Ga0070711_100518536
893 Ga0070663_100061428
894 Ga0070663_100150234
895 Ga0070678_100000151
896 Ga0070662_100107064
897 Ga0070681_10088271
898 Ga0070681_10531691
899 Ga0068867_100125191
900 Ga0070706_100167714
901 Ga0070679_100171386
902 Ga0070684_100019470
903 Ga0068853_100059993
904 Ga0068853_100486010
905 Ga0070665_100000023
906 Ga0070665_100070111
907 Ga0070665_100126039
908 Ga0070665_100136898
909 Ga0070665_100386040
910 Ga0068855_100000578
911 Ga0068855_100006609
912 Ga0068855_100212232
913 Ga0068855_100284476
914 Ga0068855_101195589
915 Ga0070664_100079939
916 Ga0068857_100507882
917 Ga0068854_100065040
918 Ga0068856_100005054
919 Ga0068856_100614898
920 Ga0068852_100028904
921 Ga0068859_100442449
922 Ga0068864_100043363
923 Ga0068861_100119692
924 Ga0068861_100241584
925 Ga0068851_10006331
926 Ga0068863_100000047
927 Ga0068858_100001609
928 Ga0068860_100000083
929 Ga0068860_100033785
930 Ga0068862_100031630
931 Ga0075365_10483784
932 Ga0075368_10004678
933 Ga0075363_100074975
934 Ga0075364_10062738
935 Ga0075367_10000432
936 Ga0075369_10184509
937 Ga0075369_10286418
938 Ga0075366_10057177
939 Ga0075366_10515073
940 Ga0097621_100308053
941 Ga0075370_10024908
942 Ga0068871_100424830
943 Ga0075431_100146462
944 Ga0075429_100766057
945 Ga0097620_100442457
946 Ga0079104_1000233
947 Ga0099794_10076257
948 Ga0105240_10001958
949 Ga0105240_10008326
950 Ga0105240_10339483
951 Ga0105240_11744777
952 Ga0105245_10002151
953 Ga0105247_10108411
954 Ga0105243_10000847
955 Ga0105243_10009064
956 Ga0105237_10042893
957 Ga0105237_10168162
958 Ga0105237_10473179
959 Ga0105237_10497327
960 Ga0105238_10006093
961 Ga0105238_10008522
962 Ga0105238_10028456
963 Ga0105238_10128901
964 Ga0105238_10301227
965 Ga0105238_10414726
966 Ga0105148_100126
967 Ga0105028_101109
968 Ga0105239_10033754
969 Ga0105239_10100056
970 Ga0105239_10819860
971 Ga0157373_10343162
972 Ga0157371_10000029
973 Ga0157371_10000149
974 Ga0157370_10000127
975 Ga0157370_10157576
976 Ga0157370_10494962
977 Ga0157369_10097084
978 Ga0157369_10979721
979 Ga0157374_10413154
980 Ga0157378_10107733
981 Ga0157378_10377941
982 Ga0157372_10021887
983 Ga0182008_10010811
984 Ga0182008_10081456
985 Ga0182008_10282673
986 Ga0182006_1000066
987 Ga0182006_1008015
988 Ga0182007_10026530
989 Ga0182007_10028669
990 Ga0182007_10039739
991 Ga0182005_1000045
992 Ga0182005_1015093
993 Ga0183365_10004
994 Ga0163161_10018355
995 Ga0163161_10175512
996 Ga0163161_10549019
997 Ga0206355_1722878
998 Ga0213876_10013112
999 Ga0209674_100408
1000 Ga0209672_105007
1001 Ga0209147_101509
1002 Ga0209563_100147
1003 Ga0209437_101033
1004 Ga0209437_102846
1005 Ga0209646_1019045
1006 Ga0209026_1017308
1007 Ga0209677_109799
1008 Ga0209148_1000011
1009 Ga0209148_1001708
1010 Ga0209233_1000052
1011 Ga0209233_1021386
1012 Ga0209233_1040117
1013 Ga0209455_1000006
1014 Ga0209455_1000528
1015 Ga0209455_1005748
1016 Ga0209130_1000016
1017 Ga0209676_1000031
1018 Ga0209676_1000057
1019 Ga0209676_1009299
1020 Ga0209564_1025690
1021 Ga0209758_1000023
1022 Ga0209050_1000135
1023 Ga0209050_1000522
1024 Ga0209050_1001148
1025 Ga0209256_1015077
1026 Ga0209256_1015450
1027 Ga0209051_1000720
1028 Ga0209051_1001452
1029 Ga0209051_1022249
1030 Ga0209257_1000050
1031 Ga0209257_1015126
1032 Ga0207656_10008808
1033 Ga0207710_10092745
1034 Ga0207688_10028488
1035 Ga0207680_10011782
1036 Ga0207647_10005180
1037 Ga0207647_10020030
1038 Ga0207699_10347450
1039 Ga0207645_10028085
1040 Ga0207645_10039222
1041 Ga0207705_10001210
1042 Ga0207684_10629550
1043 Ga0207707_10028648
1044 Ga0207695_10011982
1045 Ga0207695_10034335
1046 Ga0207695_10467702
1047 Ga0207695_10533118
1048 Ga0207671_10017854
1049 Ga0207671_10021399
1050 Ga0207671_10026997
1051 Ga0207671_10246904
1052 Ga0207663_10392401
1053 Ga0207660_10085410
1054 Ga0207657_10019604
1055 Ga0207649_10000710
1056 Ga0207649_10027081
1057 Ga0207649_10097031
1058 Ga0207649_10642154
1059 Ga0207652_10172685
1060 Ga0207681_10157779
1061 Ga0207694_10018654
1062 Ga0207694_10072771
1063 Ga0207694_10084123
1064 Ga0207694_10288462
1065 Ga0207694_10487408
1066 Ga0207650_10234968
1067 Ga0207687_10000798
1068 Ga0207706_10105523
1069 Ga0207706_10169919
1070 Ga0207709_10000039
1071 Ga0207669_10000117
1072 Ga0207669_10000382
1073 Ga0207711_10578814
1074 Ga0207661_10002953
1075 Ga0207679_10947931
1076 Ga0207667_10000002
1077 Ga0207667_10003995
1078 Ga0207667_10033611
1079 Ga0207651_10360248
1080 Ga0207668_10000459
1081 Ga0207668_10101088
1082 Ga0207668_10744655
1083 Ga0207640_10151241
1084 Ga0207658_10000539
1085 Ga0207658_10073092
1086 Ga0207703_10000847
1087 Ga0207639_10017056
1088 Ga0207639_10030241
1089 Ga0207639_10172214
1090 Ga0207639_10407957
1091 Ga0207678_10016640
1092 Ga0207678_10036071
1093 Ga0207678_10078493
1094 Ga0207702_10024157
1095 Ga0207702_10034995
1096 Ga0207641_10000079
1097 Ga0207648_10047537
1098 Ga0207676_10102002
1099 Ga0207674_10024940
1100 Ga0207674_10034505
1101 Ga0207683_10000496
1102 Ga0207683_10021185
1103 Ga0207698_10004357
1104 Ga0207698_10080544
1105 Ga0209281_1000076
1106 Ga0209179_1014034
1107 Ga0209813_10000193
1108 Ga0268266_10000002
1109 Ga0268266_10098802
1110 Ga0268266_10144375
1111 Ga0268266_10312702
1112 Ga0268266_10393901
1113 Ga0268265_10000441
1114 Ga0268264_10000055
1115 Ga0268264_10022045
1116 Ga0268264_11507938
1117 Ga0265334_10108569
1118 Ga0307517_10055671
1119 Ga0307515_10048081
1120 Ga0307515_10105375
1121 Ga0307515_10373205
1122 Ga0265338_10069689
1123 Ga0307511_10004068
1124 Ga0265330_10000281
1125 Ga0265332_10000008
1126 Ga0265320_10001142
1127 Ga0265320_10025201
1128 Ga0265325_10002464
1129 Ga0265325_10003681
1130 Ga0265325_10014671
1131 Ga0265340_10014774
1132 Ga0265340_10026996
1133 Ga0265340_10223790
1134 Ga0265339_10013193
1135 Ga0265331_10009489
1136 Ga0265327_10000039
1137 Ga0265327_10042551
1138 Ga0265316_10043352
1139 Ga0307513_10024144
1140 Ga0307509_10000034
1141 Ga0307509_10310343
1142 Ga0307408_100029072
1143 Ga0265313_10075898
1144 Ga0307508_10000317
1145 Ga0307514_10001251
1146 Ga0265314_10000065
1147 Ga0265314_10087721
1148 Ga0265342_10099855
1149 Ga0307516_10000001
1150 Ga0307516_10000405
1151 Ga0307405_10204646
1152 Ga0307413_10085428
1153 Ga0307413_10754999
1154 Ga0307412_10083948
1155 Ga0307409_100288371
1156 Ga0315911_1000005
1157 Ga0373935_0015118
1158 Ga0373937_0018626
1159 Ga0310109_017351
1160 Ga0373925_0690309
1161 Ga0395899_0211793
1162 Ga0395900_0013472
1163 Ga0395900_0144077
1164 Ga0395900_0625948
1165 Ga0395901_0085564
1166 Ga0395901_0221211
1167 Ga0395901_1170714
1168 Ga0237819_01183
1169 Ga0237816_00202
1170 Ga0436365_0604521
1171 Ga0436365_0743078
1172 Ga0436365_1106902
1173 Ga0436362_0543628
1174 Ga0439461_0028876
1175 Ga0451795_0975754
1176 Ga0451795_1434403
1177 Ga0451800_1633068
1178 Ga0451804_1057260
1179 Ga0439443_014595
1180 Ga0450911_000005
1181 Ga0450902_014459
1182 Ga0439446_0046748
1183 Ga0450908_000048
1184 Ga0453684_0622467
1185 Ga0466959_0012635
1186 Ga0466967_1002745
1187 Ga0495617_000024
1188 Ga0495617_000296
1189 Ga0495617_024660
1190 Ga0495617_140271
1191 Ga0495617_144857
1192 Ga0495627_000478
1193 Ga0495592_0059295
1194 Ga0495592_0088409
1195 Ga0495603_0354853
1196 Ga0495590_0018331
1197 Ga0495590_0029296
1198 Ga0495629_0000027
1199 Ga0495629_0000130
1200 Ga0495629_0000281
1201 Ga0495629_0041152
1202 Ga0495638_0000128
1203 Ga0495638_0000363
1204 Ga0495638_0006293
1205 Ga0495638_0006659
1206 Ga0495638_0057822
1207 Ga0495638_0078605
1208 Ga0495638_0275069
1209 Ga0495641_0108463
1210 Ga0495651_0007550
1211 Ga0495653_0000449
1212 Ga0495653_0000885
1213 Ga0495653_0033105
1214 Ga0495650_0000226
1215 Ga0495650_0000470
1216 Ga0495650_0001371
1217 Ga0495650_0005382
1218 Ga0495650_0006744
1219 Ga0495650_0033401
1220 Ga0495650_0159613
1221 Ga0495580_0003983
1222 Ga0495580_0005607
1223 Ga0495580_0005620
1224 Ga0495580_0006044
1225 Ga0495580_0007400
1226 Ga0495580_0021463
1227 Ga0495580_0027966
1228 Ga0495580_0097802
1229 Ga0495582_0032237
1230 Ga0495605_0013142
1231 Ga0495605_0044778
1232 Ga0495664_0010704
1233 Ga0495664_0067107
1234 Ga0495584_0004592
1235 Ga0495584_0165160
1236 Ga0495584_0199762
1237 Ga0495584_0393420
1238 Ga0495585_0000143
1239 Ga0495585_0000360
1240 Ga0495585_0003270
1241 Ga0495585_0032133
1242 Ga0495585_0064674
1243 Ga0495585_0174619
1244 Ga0495596_0104288
1245 Ga0495596_0180383
1246 Ga0495607_0000083
1247 Ga0495607_0000460
1248 Ga0495607_0003621
1249 Ga0495607_0045245
1250 Ga0495607_0108152
1251 Ga0495583_0001366
1252 Ga0495583_0002817
1253 Ga0495583_0002869
1254 Ga0495583_0021304
1255 Ga0495583_0034073
1256 Ga0495583_0036880
1257 Ga0495583_0065054
1258 Ga0495583_0179260
1259 Ga0495606_0000066
1260 Ga0495606_0000092
1261 Ga0495606_0000136
1262 Ga0495606_0001286
1263 Ga0495606_0010585
1264 Ga0495606_0023113
1265 Ga0495606_0084167
1266 Ga0495606_0112148
1267 Ga0495606_0115834
1268 Ga0495606_0343390
1269 Ga0495610_0000356
1270 Ga0495610_0005518
1271 Ga0495610_0214499
1272 Ga0495616_0000003
1273 Ga0495616_0000018
1274 Ga0495616_0025623
1275 Ga0495616_0151260
1276 Ga0495620_0000102
1277 Ga0495620_0027224
1278 Ga0495620_0038233
1279 Ga0495620_0110997
1280 Ga0495628_0007163
1281 Ga0495628_0047361
1282 Ga0495628_0052696
1283 Ga0495628_0080520
1284 Ga0495628_0110409
1285 Ga0495631_0000022
1286 Ga0495631_0000267
1287 Ga0495631_0002903
1288 Ga0495631_0173186
1289 Ga0495632_0000008
1290 Ga0495632_0000042
1291 Ga0495632_0002853
1292 Ga0495632_0006266
1293 Ga0495637_0008748
1294 Ga0495637_0012500
1295 Ga0495637_0044545
1296 Ga0495637_0202655
1297 Ga0495643_0000005
1298 Ga0495643_0000530
1299 Ga0495643_0009416
1300 Ga0495643_0019650
1301 Ga0495643_0065152
1302 Ga0495644_0014817
1303 Ga0495648_0000146
1304 Ga0495648_0000363
1305 Ga0495648_0001155
1306 Ga0495648_0001362
1307 Ga0495648_0004160
1308 Ga0495648_0012133
1309 Ga0495648_0025432
1310 Ga0495648_0052312
1311 Ga0495648_0068302
1312 Ga0495648_0081807
1313 Ga0495648_0089274
1314 Ga0495648_0100208
1315 Ga0495663_0000015
1316 Ga0495663_0001818
1317 Ga0495666_0240105
1318 Ga0495642_0002091
1319 Ga0495642_0054429
1320 Ga0495665_0043904
1321 Ga0495665_0229958
1322 Ga0495640_0192125
1323 Ga0495586_0228330
1324 Ga0495609_0013558
1325 Ga0495609_0014939
1326 Ga0495609_0027977
1327 Ga0495609_0178062
1328 Ga0495597_0011589
1329 Ga0495597_0091236
1330 Ga0495645_0007813
1331 Ga0495645_0303663
1332 Ga0495622_0000811
1333 Ga0495622_0218024
1334 Ga0495633_0000197
1335 Ga0495633_0000222
1336 Ga0495633_0000371
1337 Ga0495633_0000842
1338 Ga0495633_0067556
1339 Ga0495633_0131657
1340 Ga0495633_0249159
1341 Ga0495656_0391587
1342 Ga0495668_0000019
1343 Ga0495668_0000056
1344 Ga0495668_0000061
1345 Ga0495668_0000066
1346 Ga0495668_0020487
1347 Ga0495668_0123686
1348 Ga0495634_0090030
1349 Ga0495634_0181821
1350 Ga0495611_0000004
1351 Ga0495611_0000113
1352 Ga0495611_0011961
1353 Ga0495611_0015996
1354 Ga0495611_0155574
1355 Ga0495625_0000024
1356 Ga0495625_0000255
1357 Ga0495625_0008595
1358 Ga0495625_0009405
1359 Ga0495625_0016404
1360 Ga0495625_0264849
1361 Ga0495625_0265681
1362 Ga0495625_0273380
1363 Ga0495659_0046350
1364 Ga0495661_0023232
1365 Ga0495661_0147719
1366 Ga0495599_0175318
1367 Ga0495646_0002861
1368 Ga0495646_0006551
1369 Ga0495646_0056805
1370 Ga0495669_0000155
1371 Ga0495613_0056868
1372 Ga0495613_0077881
1373 Ga0495613_0101505
1374 Ga0495613_0774563
1375 Ga0495624_0004752
1376 Ga0495624_0005955
1377 Ga0495624_0006209
1378 Ga0495624_0022978
1379 Ga0495670_0001381
1380 Ga0495670_0002072
1381 Ga0495670_0040453
1382 Ga0495670_0364507
1383 Ga0495671_0000007
1384 Ga0495671_0001491
1385 Ga0495671_0061148
1386 Ga0495671_0065703
1387 Ga0495671_0193287
1388 Ga0495649_0021687
1389 Ga0495649_0085604
1390 Ga0495649_0263956
1391 Ga0495589_0000367
1392 Ga0495600_0005075
1393 Ga0495660_0000052
1394 Ga0495660_0000064
1395 Ga0495660_0030727
1396 Ga0495604_0488753
1397 Ga0495674_0001399
1398 Ga0495674_0001405
1399 Ga0495674_0005169
1400 Ga0495674_0192671
1401 Ga0495672_0001207
1402 Ga0495672_0025394
1403 Ga0495672_0078132
1404 Ga0495672_0162524
1405 Ga0495676_0053985
1406 Ga0495676_0054767
1407 Ga0495680_0315834
1408 Ga0495683_0006619
1409 Ga0495683_0012572
1410 Ga0495687_000077
1411 Ga0495687_000353
1412 Ga0495687_112000
1413 Ga0495675_0374154
1414 Ga0495679_000009
1415 Ga0495679_000011
1416 Ga0495679_000102
1417 Ga0495679_012887
1418 Ga0495673_0000028
1419 Ga0495673_0000036
1420 Ga0495673_0000101
1421 Ga0495673_0003573
1422 Ga0495673_0086782
1423 Ga0495681_0000032
1424 Ga0495681_0010146
1425 Ga0495681_0033770
1426 Ga0495681_0055878
1427 Ga0495681_0175854
1428 Ga0495686_0000033
1429 Ga0495686_0000180
1430 Ga0495686_0000190
1431 Ga0495686_0001592
1432 Ga0495686_0002384
1433 Ga0495686_0024922
1434 Ga0495686_0070152
1435 Ga0495686_0100699
1436 Ga0495686_0155947
1437 Ga0495686_0224032
1438 Ga0495593_0004348
1439 Ga0495593_0014869
1440 Ga0495593_0223157
1441 Ga0495593_0373848
1442 Ga0495626_0004650
1443 Ga0495626_0005244
1444 Ga0495626_0030318
1445 Ga0495626_0040568
1446 Ga0496100_0056714
1447 Ga0496100_0208709
1448 Ga0496101_0000999
1449 Ga0496101_0168706
1450 Ga0496102_0000163
1451 Ga0496102_0027920
1452 Ga0496102_0126223
1453 Ga0496102_0627485
1454 Ga0496102_0927401
1455 Ga0496103_0000052
1456 Ga0496103_0205226
1457 Ga0496104_0008489
1458 Ga0496105_0001302
1459 Ga0496105_0002897
1460 Ga0496106_0474159
1461 Ga0496107_0175449
1462 Ga0496108_0203733
1463 Ga0496109_0083486
1464 Ga0496109_0206942
1465 Ga0496110_0058192
1466 Ga0496110_0145791
1467 Ga0496110_0245520
1468 Ga0496111_0002111
1469 Ga0496111_0016400
1470 Ga0496112_0000052
1471 Ga0496112_0304667
1472 Ga0496113_0028812
1473 Ga0496113_0885374
1474 Ga0496114_0342325
1475 Ga0496115_0000078
1476 Ga0496115_0027713
1477 Ga0496115_0283942
1478 Ga0496115_0369101
1479 Ga0496115_0436424
1480 Ga0496115_0496133
1481 Ga0496115_0826663
1482 Ga0496116_0015207
1483 Ga0496116_0081560
1484 Ga0496116_0088333
1485 Ga0496117_0000102
1486 Ga0496117_0000141
1487 Ga0496117_0012119
1488 Ga0496117_0109260
1489 Ga0496117_0207727
1490 Ga0496118_0000038
1491 Ga0496118_0000103
1492 Ga0496118_0000696
1493 Ga0496118_0005851
1494 Ga0496118_0060180
1495 Ga0496118_0188363
1496 Ga0496118_0287098
1497 Ga0496119_0003348
1498 Ga0496119_0009712
1499 Ga0496119_0024539
1500 Ga0496120_0030390
1501 Ga0496120_0062358
1502 Ga0496120_0108714
1503 Ga0496121_0000156
1504 Ga0496121_0000208
1505 Ga0496121_0000782
1506 Ga0496121_0001227
1507 Ga0496121_0028584
1508 Ga0496121_0057869
1509 Ga0496121_0059804
1510 Ga0496121_0066519
1511 Ga0496121_0075697
1512 Ga0496121_0232510
1513 Ga0496121_0317860
1514 Ga0496121_0402299
1515 Ga0496122_0002015
1516 Ga0496122_0010032
1517 Ga0496122_0011694
1518 Ga0496122_0045690
1519 Ga0496122_0051420
1520 Ga0496123_0000539
1521 Ga0496123_0004774
1522 Ga0496123_0007053
1523 Ga0496123_0022976
1524 Ga0496124_0000041
1525 Ga0496124_0019294
1526 Ga0496124_0024928
1527 Ga0496124_0075331
1528 Ga0496124_0120736
1529 Ga0496124_0249998
1530 Ga0496124_0289547
1531 Ga0496125_0000238
1532 Ga0496125_0005247
1533 Ga0496125_0078684
1534 Ga0496125_0145693
1535 Ga0496125_0480177
1536 Ga0496126_0000155
1537 Ga0496126_0000817
1538 Ga0496126_0054808
1539 Ga0496126_0084486
1540 Ga0496126_0094153
1541 Ga0496126_0285009
1542 Ga0495678_000067
1543 Ga0495678_001527
1544 Ga0495678_030533
1545 Ga0495678_035460
1546 Ga0495678_053007
1547 Ga0495682_0009921
1548 Ga0495682_0039341
1549 Ga0495682_0102406
1550 Ga0501335_001954
1551 Ga0501033_0361177
1552 Ga0501034_0008945
1553 Ga0501034_0043506
1554 Ga0501034_0074510
1555 Ga0501034_0278855
1556 Ga0501034_0667521
1557 Ga0501037_0015498
1558 Ga0501039_0477245
1559 Ga0501043_0114352
1560 Ga0501047_0157204
1561 Ga0501047_0258557
1562 Ga0501073_0676047
1563 Ga0501249_000057
1564 Ga0501225_0005256
1565 Ga0501225_0008501
1566 Ga0501035_0012166
1567 Ga0501035_0049902
1568 Ga0501035_0653511
1569 Ga0501044_0000515
1570 Ga0501044_0092841
1571 Ga0501044_0208817
1572 Ga0501044_0838402
1573 Ga0501204_007499
1574 nmdc:mga00v17_11948_c1
1575 nmdc:mga00v17_703184_c1
1576 nmdc:mga0yw44_266370_c1
1577 nmdc:mga0k408_316310_c1
1578 nmdc:mga0k408_469216_c1
1579 nmdc:mga06z11_27_c1
1580 nmdc:mga04h51_2074_c1
1581 nmdc:mga07m45_45066_c1
1582 nmdc:mga09592_67153_c1
1583 Ga0495601_0192739
1584 Ga0495601_0215168
1585 Ga0500610_0000144
1586 Ga0495595_0184311
1587 Ga0495619_0277068
1588 Ga0500578_0000005
1589 Ga0500643_000012
1590 Ga0500643_000199
1591 Ga0500643_000466
1592 Ga0500643_000848
1593 Ga0500643_023732
1594 Ga0500646_0017402
1595 Ga0500647_0076062
1596 Ga0500583_0136685
1597 Ga0500651_0368218
1598 Ga0500641_0000152
1599 Ga0500641_0020030
1600 Ga0500555_000594
1601 Ga0500562_001900
1602 Ga0500562_036021
1603 Ga0500562_044569
1604 Ga0500594_0000079
1605 Ga0500595_016627
1606 Ga0500595_147439
1607 Ga0500608_000039
1608 Ga0500608_000151
1609 Ga0500608_000351
1610 Ga0500608_000636
1611 Ga0500642_0096758
1612 Ga0500658_0002778
1613 Ga0500559_0000190
1614 Ga0500559_0001426
1615 Ga0500559_0011010
1616 Ga0500559_0014015
1617 Ga0500559_0039778
1618 Ga0500561_0010843
1619 Ga0500564_018193
1620 Ga0500568_0007024
1621 Ga0500568_0015017
1622 Ga0500573_0000271
1623 Ga0500573_0061486
1624 Ga0500573_0181186
1625 Ga0500588_0184032
1626 Ga0500604_0106670
1627 Ga0500616_0044966
1628 Ga0500619_000886
1629 Ga0500622_0001545
1630 Ga0500622_0002329
1631 Ga0500622_0008683
1632 Ga0500622_0024452
1633 Ga0500622_0055833
1634 Ga0500624_000053
1635 Ga0500627_0091911
1636 Ga0500633_0031530
1637 Ga0500636_0003608
1638 Ga0500637_0102461
1639 Ga0500567_038725
1640 Ga0500625_000002
1641 Ga0500645_000001
1642 Ga0500645_000566
1643 Ga0500645_010918
1644 Ga0500661_046605
1645 Ga0587084_003395
1646 Ga0587088_004364
1647 Ga0587090_003778
1648 Ga0587094_002775
1649 Ga0587128_005805
1650 Ga0587069_005954
1651 Ga0587078_002342
1652 Ga0587079_005621
1653 Ga0587102_000884
1654 Ga0587096_00527
1655 Ga0587071_006951
1656 Ga0587071_038487
1657 Ga0587111_0006342
1658 Ga0587111_0014016
1659 Ga0587111_0015291
1660 Ga0587111_0047376
1661 2512035364
1662 2585400558
1663 2585819880
1664 2616310858
1665 2830078984
1666 2842918434
1667 2885431589
1668 2928974838
1669 2939634858
1670 2977242118
1671 2989780942
1672 8045865643

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00258

Flavodoxin_1

Flavodoxin

32

160

0.82

PF03358

FMN_red

NADPH-dependent FMN reductase

28

175

0.82

PF02525

Flavodoxin_2

Flavodoxin-like fold

28

171

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4la4-assembly1.cif.gz_B-2 crystal structure of native pnpb 0.9644 1 187
4laf-assembly1.cif.gz_C crystal structure of pnpb complex with fmn 0.9598 1 187
7q6n-assembly1.cif.gz_A structure of wrba from salmonella typhimurium bound to me0052 0.9558 1 186
4laf-assembly1.cif.gz_D crystal structure of pnpb complex with fmn 0.9533 2 188
4la4-assembly1.cif.gz_A crystal structure of native pnpb 0.953 1 187
ID Description Score Start End Superfamily
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.953 1 187 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9483 1 188 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9434 1 188 3.40.50.360
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9431 1 187 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.934 1 188 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2R7QAX1-F1-model_v4 deleted 0.9799 58 188
AF-A0A418NU94-F1-model_v4 NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) 0.9736 1 188 GO:0008753
GO:0010181
GO:0016020
GO:0050136
GO:0050660
GO:0050661
GO:0051287
AF-A0A7C1HH78-F1-model_v4 NAD(P)H:quinone oxidoreductase (EC 1.6.5.2) 0.9726 72 188 GO:0003955
GO:0010181
GO:0016020
AF-A0A2R7QAX1-F1-model_v4 deleted 0.9725 58 188
AF-F8XTR7-F1-model_v4 deleted 0.9724 53 188

Map