F482889

General Info

Members Datasets Scaffolds Average Seq Length
836 494 1672 293

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10000035|Ga0307517_1000003560
Length 338
Sequence MKGIILAGGTGTRLYPITTVVSKQLLPVFDKPMIYYPLATLMLAGIREILIISTPQDQPLFQRLLGDGSSLGLELSYATQAKARGLADAFIVGRKFVGKDDVALILGDNIFHGHGLSDLMSRAAMRSNEATVFGYVVNSPEQYGVVELDGRGRAISIEEKPSKPKSNVAVTGLYFYDNDVIDIAASLQPSARGELEITDVNRVYLERGDLFVEVLGRGFAWLDTGTHETLVEASHFVQILEQRQGLRIACIEEIALRLRYISLDHFHMLAQRAAKSSYGQYLLSVHHSFVSNSSKAGSESCDMMAPLFASQAARVSLAPSLSDISSTIPAPTLSTSTS

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
165 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
204 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
212 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
213 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
223 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
224 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
225 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
226 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
227 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
341 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
342 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
343 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
346 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
347 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
353 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
354 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
355 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
356 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
359 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
369 2511231008 Pseudomonas sp. GM21 Isolate Nodule
370 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
371 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
372 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
373 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
374 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
375 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
376 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
377 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
378 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
379 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
380 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
381 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
382 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
383 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
384 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
385 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
386 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
387 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
388 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
389 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
390 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
391 2751185917 Enterobacter sp. HK169 Isolate Unclassified
392 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
393 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
394 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
395 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
396 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
397 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
398 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
399 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
400 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
401 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
402 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
403 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
404 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
405 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
406 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
407 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
408 2849139964 Bacillus sp. R-71875 Isolate Unclassified
409 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
410 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
411 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
412 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
413 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
414 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
415 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
416 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
417 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
418 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
419 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
420 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
421 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
422 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
423 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
424 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
425 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
426 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
427 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
428 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
429 2904699407
430 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
431 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
432 2906610324
433 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
434 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
435 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
436 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
437 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
438 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
439 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
440 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
441 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
442 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
443 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
444 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
445 2922425934
446 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
447 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
448 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
449 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
450 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
451 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
452 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
453 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
454 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
455 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
456 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
457 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
458 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
459 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
460 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
461 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
462 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
463 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
464 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
465 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
466 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
467 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
468 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
469 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
470 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
471 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
472 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
473 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
474 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
475 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
476 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
477 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
478 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
479 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
480 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
481 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
482 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
483 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
484 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
485 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
486 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
487 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
488 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
489 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
490 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
491 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
492 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
493 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
494 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.55
Metatranscriptomes 0.84
Isolates 15.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 8.37
Nodule 7.18
Rhizoplane 5.98
Rhizosphere 66.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10000035 3300028786 Bacteria 172762
2 SwRhRL2b_contig_431541 2162886007 Bacteria 23712
3 LJQas_1000313 3300000549 Bacteria 8638
4 LJQas_1000428 3300000549 Bacteria 7004
5 JGI25153J46596_10000502 3300003215 Bacteria 24875
6 JGI25153J46596_10004212 3300003215 Bacteria 7795
7 rootL2_10137330 3300003322 Bacteria 3316
8 JGI25160J50197_1000344 3300003354 Bacteria 31105
9 JGI25160J50197_1004733 3300003354 Bacteria 5822
10 JGI25160J50197_1008646 3300003354 Bacteria 3861
11 Ga0055526_1018034 3300003771 Bacteria 2658
12 Ga0055543_1001128 3300004625 Bacteria 11446
13 Ga0065165_1000054 3300005262 Bacteria 187351
14 Ga0065165_1002041 3300005262 Bacteria 18738
15 Ga0065165_1004508 3300005262 Bacteria 8555
16 Ga0065165_1024806 3300005262 Bacteria 2007
17 Ga0065714_10021260 3300005288 Bacteria 1755
18 Ga0065704_10070449 3300005289 Bacteria 24379
19 Ga0065707_10082876 3300005295 Bacteria 11628
20 Ga0070658_10287331 3300005327 Bacteria 1401
21 Ga0070683_100019205 3300005329 Bacteria 6070
22 Ga0070683_100209810 3300005329 Bacteria 1850
23 Ga0070666_10086031 3300005335 Bacteria 2154
24 Ga0070682_100060944 3300005337 Bacteria 2387
25 Ga0068868_100137522 3300005338 Bacteria 2003
26 Ga0070660_100050701 3300005339 Bacteria 3194
27 Ga0070660_100152652 3300005339 Bacteria 1858
28 Ga0070660_100167111 3300005339 Bacteria 1775
29 Ga0070661_100015251 3300005344 Bacteria 5424
30 Ga0070668_100101282 3300005347 Bacteria 2283
31 Ga0070668_100148176 3300005347 Bacteria 1895
32 Ga0070668_100205306 3300005347 Bacteria 1619
33 Ga0070668_100287471 3300005347 Bacteria 1375
34 Ga0070669_100032156 3300005353 Bacteria 3790
35 Ga0070675_100259033 3300005354 Bacteria 1524
36 Ga0070675_100496291 3300005354 Bacteria 1099
37 Ga0070671_100211219 3300005355 Bacteria 1646
38 Ga0070671_100494467 3300005355 Bacteria 1052
39 Ga0070674_100098058 3300005356 Bacteria 2130
40 Ga0070673_100140182 3300005364 Bacteria 2039
41 Ga0070673_100390300 3300005364 Bacteria 1243
42 Ga0070659_100039289 3300005366 Bacteria 3694
43 Ga0070659_100073436 3300005366 Bacteria 2723
44 Ga0070667_100027985 3300005367 Bacteria 4690
45 Ga0070667_100029259 3300005367 Bacteria 4589
46 Ga0070714_100016833 3300005435 Bacteria 5913
47 Ga0070714_100358870 3300005435 Bacteria 1370
48 Ga0070713_100099432 3300005436 Bacteria 2517
49 Ga0070713_100155674 3300005436 Bacteria 2037
50 Ga0070710_10065829 3300005437 Bacteria 2076
51 Ga0070705_100085280 3300005440 Bacteria 1952
52 Ga0070705_100123621 3300005440 Bacteria 1675
53 Ga0070700_100000016 3300005441 Bacteria 147213
54 Ga0070694_100028742 3300005444 Bacteria 3620
55 Ga0070663_100085322 3300005455 Bacteria 2330
56 Ga0070678_100080939 3300005456 Bacteria 2461
57 Ga0070678_100460312 3300005456 Bacteria 1116
58 Ga0070679_100097641 3300005530 Bacteria 2925
59 Ga0068853_100007053 3300005539 Bacteria 8985
60 Ga0070672_100205158 3300005543 Bacteria 1649
61 Ga0070695_100115921 3300005545 Bacteria 1826
62 Ga0070696_100145516 3300005546 Bacteria 1735
63 Ga0070693_100100600 3300005547 Bacteria 1760
64 Ga0070693_100221020 3300005547 Bacteria 1241
65 Ga0070665_100016709 3300005548 Bacteria 7354
66 Ga0070665_100449742 3300005548 Bacteria 1298
67 Ga0070704_100222740 3300005549 Bacteria 1534
68 Ga0068855_100009183 3300005563 Bacteria 11941
69 Ga0068855_100096811 3300005563 Bacteria 3399
70 Ga0068855_100264546 3300005563 Bacteria 1915
71 Ga0068857_100127798 3300005577 Bacteria 2291
72 Ga0068854_100080249 3300005578 Bacteria 2407
73 Ga0068856_100091113 3300005614 Bacteria 3033
74 Ga0068856_100124021 3300005614 Bacteria 2585
75 Ga0070702_100015741 3300005615 Bacteria 3867
76 Ga0068852_100019657 3300005616 Bacteria 5351
77 Ga0068852_100038874 3300005616 Bacteria 4003
78 Ga0068852_100168992 3300005616 Bacteria 2048
79 Ga0068859_100471540 3300005617 Bacteria 1351
80 Ga0068864_100149334 3300005618 Bacteria 2115
81 Ga0068864_100188988 3300005618 Bacteria 1887
82 Ga0068866_10076377 3300005718 Bacteria 1786
83 Ga0068861_100240165 3300005719 Bacteria 1540
84 Ga0068851_10001626 3300005834 Bacteria 9856
85 Ga0068851_10025378 3300005834 Bacteria 2907
86 Ga0068870_10038027 3300005840 Bacteria 2483
87 Ga0068863_100017642 3300005841 Bacteria 6837
88 Ga0068863_100091260 3300005841 Bacteria 2889
89 Ga0068858_100444736 3300005842 Bacteria 1248
90 Ga0068860_100006638 3300005843 Bacteria 11619
91 Ga0068860_100256874 3300005843 Bacteria 1702
92 Ga0068860_100567825 3300005843 Bacteria 1138
93 Ga0068862_100060247 3300005844 Bacteria 3260
94 Ga0068862_100172395 3300005844 Bacteria 1938
95 Ga0081455_10064438 3300005937 Bacteria 3068
96 Ga0081540_1004075 3300005983 Bacteria 11312
97 Ga0081540_1012922 3300005983 Bacteria 5458
98 Ga0081540_1019967 3300005983 Bacteria 4048
99 Ga0081540_1024743 3300005983 Bacteria 3476
100 Ga0070717_10096889 3300006028 Bacteria 2499
101 Ga0070717_10137831 3300006028 Bacteria 2103
102 Ga0070717_10253942 3300006028 Bacteria 1554
103 Ga0075365_10000758 3300006038 Bacteria 13112
104 Ga0075365_10039057 3300006038 Bacteria 3089
105 Ga0075432_10008863 3300006058 Bacteria 3432
106 Ga0075432_10053983 3300006058 Bacteria 1422
107 Ga0070716_100084534 3300006173 Bacteria 1903
108 Ga0075367_10051748 3300006178 Bacteria 2429
109 Ga0075369_10002752 3300006186 Bacteria 6310
110 Ga0075369_10008001 3300006186 Bacteria 4050
111 Ga0097621_100203510 3300006237 Bacteria 1720
112 Ga0075370_10059787 3300006353 Bacteria 2170
113 Ga0068871_100183992 3300006358 Bacteria 1797
114 Ga0068871_100711108 3300006358 Bacteria 921
115 Ga0075428_100569201 3300006844 Bacteria 1211
116 Ga0075431_100269507 3300006847 Bacteria 1726
117 Ga0075433_10338652 3300006852 Bacteria 1330
118 Ga0075434_100061688 3300006871 Bacteria 3731
119 Ga0068865_100184839 3300006881 Bacteria 1607
120 Ga0097620_100471546 3300006931 Bacteria 1351
121 Ga0099824_1018455 3300006942 Bacteria 5724
122 Ga0075435_100161354 3300007076 Bacteria 1888
123 Ga0105251_10012385 3300009011 Bacteria 4825
124 Ga0105251_10045775 3300009011 Bacteria 2108
125 Ga0105244_10001709 3300009036 Bacteria 17337
126 Ga0105244_10019047 3300009036 Bacteria 3841
127 Ga0105244_10024666 3300009036 Bacteria 3279
128 Ga0105244_10128852 3300009036 Bacteria 1222
129 Ga0105250_10000032 3300009092 Bacteria 159642
130 Ga0105250_10000325 3300009092 Bacteria 36727
131 Ga0105250_10074592 3300009092 Bacteria 1372
132 Ga0105240_10000793 3300009093 Bacteria 57276
133 Ga0105240_10000882 3300009093 Bacteria 53905
134 Ga0105240_10067287 3300009093 Bacteria 4440
135 Ga0105240_10134481 3300009093 Bacteria 2962
136 Ga0111539_10022931 3300009094 Bacteria 7664
137 Ga0111539_10195233 3300009094 Bacteria 2361
138 Ga0111539_11033170 3300009094 Bacteria 955
139 Ga0105247_10328233 3300009101 Bacteria 1070
140 Ga0114129_10052715 3300009147 Bacteria 5709
141 Ga0114129_10086467 3300009147 Bacteria 4349
142 Ga0105243_10014716 3300009148 Bacteria 5918
143 Ga0105243_10014820 3300009148 Bacteria 5899
144 Ga0105243_10047630 3300009148 Bacteria 3376
145 Ga0105242_10000988 3300009176 Bacteria 22235
146 Ga0105242_10063793 3300009176 Bacteria 3034
147 Ga0105242_10159112 3300009176 Bacteria 1975
148 Ga0105248_10040375 3300009177 Bacteria 5230
149 Ga0105248_10065945 3300009177 Bacteria 4065
150 Ga0105248_10220185 3300009177 Bacteria 2137
151 Ga0105248_10239757 3300009177 Bacteria 2041
152 Ga0105237_10000153 3300009545 Bacteria 96552
153 Ga0105237_10005366 3300009545 Bacteria 14497
154 Ga0105237_10017760 3300009545 Bacteria 7376
155 Ga0105237_10312323 3300009545 Bacteria 1575
156 Ga0105238_10000004 3300009551 Bacteria 390514
157 Ga0105238_10006993 3300009551 Bacteria 11282
158 Ga0105238_10032169 3300009551 Bacteria 5338
159 Ga0105238_10076245 3300009551 Bacteria 3344
160 Ga0105238_10096288 3300009551 Bacteria 2946
161 Ga0105249_10142757 3300009553 Bacteria 2297
162 Ga0105249_10193096 3300009553 Bacteria 1988
163 Ga0105239_10021850 3300010375 Bacteria 7054
164 Ga0105239_10407256 3300010375 Bacteria 1539
165 Ga0105239_10523652 3300010375 Bacteria 1349
166 Ga0105246_10042715 3300011119 Bacteria 3071
167 Ga0105246_10099564 3300011119 Bacteria 2113
168 Ga0105246_10149623 3300011119 Bacteria 1765
169 Ga0105246_10180824 3300011119 Bacteria 1624
170 Ga0105246_10408763 3300011119 Bacteria 1129
171 Ga0157373_10374820 3300013100 Bacteria 1017
172 Ga0157371_10053550 3300013102 Bacteria 2865
173 Ga0157371_10082265 3300013102 Bacteria 2280
174 Ga0157370_10073595 3300013104 Bacteria 3224
175 Ga0157370_10145296 3300013104 Bacteria 2209
176 Ga0157370_10210979 3300013104 Bacteria 1800
177 Ga0157369_10284252 3300013105 Bacteria 1723
178 Ga0157374_10077895 3300013296 Bacteria 3139
179 Ga0157374_10093981 3300013296 Bacteria 2864
180 Ga0157378_10059697 3300013297 Bacteria 3403
181 Ga0163162_10115450 3300013306 Bacteria 2785
182 Ga0163162_10341159 3300013306 Bacteria 1631
183 Ga0157372_10100451 3300013307 Bacteria 3301
184 Ga0157372_10253465 3300013307 Bacteria 2043
185 Ga0157375_10220641 3300013308 Bacteria 2054
186 Ga0157375_10257244 3300013308 Bacteria 1907
187 Ga0163163_10009451 3300014325 Bacteria 8706
188 Ga0163163_10222323 3300014325 Bacteria 1937
189 Ga0163163_10490980 3300014325 Bacteria 1289
190 Ga0157380_10073722 3300014326 Bacteria 2769
191 Ga0157380_10507600 3300014326 Bacteria 1173
192 Ga0157379_10000004 3300014968 Bacteria 173351
193 Ga0157376_10089440 3300014969 Bacteria 2662
194 Ga0157376_10245586 3300014969 Bacteria 1669
195 Ga0157376_10391266 3300014969 Bacteria 1342
196 Ga0182006_1000572 3300015261 Bacteria 27217
197 Ga0163161_10125641 3300017792 Bacteria 1931
198 Ga0163161_10360097 3300017792 Bacteria 1158
199 Ga0213873_10000002 3300021358 Bacteria 1164195
200 Ga0213876_10000001 3300021384 Bacteria 1186326
201 Ga0209148_1000239 3300025254 Bacteria 87710
202 Ga0209233_1000600 3300025261 Bacteria 18662
203 Ga0209233_1001306 3300025261 Bacteria 9945
204 Ga0209233_1025181 3300025261 Bacteria 1476
205 Ga0209455_1002439 3300025272 Bacteria 7203
206 Ga0209564_1015835 3300025295 Bacteria 3044
207 Ga0209758_1000806 3300025297 Bacteria 44157
208 Ga0209758_1001068 3300025297 Bacteria 35664
209 Ga0209758_1018079 3300025297 Bacteria 3474
210 Ga0209758_1035507 3300025297 Bacteria 1964
211 Ga0209758_1061677 3300025297 Bacteria 1233
212 Ga0209256_1003643 3300025299 Bacteria 10552
213 Ga0209256_1029787 3300025299 Bacteria 1515
214 Ga0207426_1000375 3300025302 Bacteria 78261
215 Ga0207426_1000467 3300025302 Bacteria 62488
216 Ga0207426_1000527 3300025302 Bacteria 55514
217 Ga0207426_1015512 3300025302 Bacteria 2760
218 Ga0209051_1001715 3300025303 Bacteria 17497
219 Ga0209051_1007303 3300025303 Bacteria 6064
220 Ga0207697_10022679 3300025315 Bacteria 2571
221 Ga0207656_10011584 3300025321 Bacteria 3336
222 Ga0207696_1000198 3300025711 Bacteria 92750
223 Ga0207696_1000386 3300025711 Bacteria 42561
224 Ga0207655_1000733 3300025728 Bacteria 37019
225 Ga0207655_1003206 3300025728 Bacteria 12308
226 Ga0207655_1017212 3300025728 Bacteria 3907
227 Ga0207655_1029710 3300025728 Bacteria 2553
228 Ga0207710_10140486 3300025900 Bacteria 1166
229 Ga0207688_10115997 3300025901 Bacteria 1559
230 Ga0207680_10027568 3300025903 Bacteria 3165
231 Ga0207680_10028171 3300025903 Bacteria 3139
232 Ga0207680_10161871 3300025903 Bacteria 1501
233 Ga0207645_10027311 3300025907 Bacteria 3687
234 Ga0207654_10052793 3300025911 Bacteria 2344
235 Ga0207654_10115232 3300025911 Bacteria 1679
236 Ga0207707_10001050 3300025912 Bacteria 26502
237 Ga0207695_10000797 3300025913 Bacteria 59086
238 Ga0207695_10000830 3300025913 Bacteria 57286
239 Ga0207695_10001008 3300025913 Bacteria 49740
240 Ga0207695_10002445 3300025913 Bacteria 27456
241 Ga0207671_10001174 3300025914 Bacteria 31189
242 Ga0207671_10011775 3300025914 Bacteria 7082
243 Ga0207671_10030463 3300025914 Bacteria 4024
244 Ga0207671_10137330 3300025914 Bacteria 1881
245 Ga0207693_10002666 3300025915 Bacteria 15499
246 Ga0207662_10013430 3300025918 Bacteria 4582
247 Ga0207657_10043220 3300025919 Bacteria 3971
248 Ga0207657_10107777 3300025919 Bacteria 2304
249 Ga0207657_10282420 3300025919 Bacteria 1318
250 Ga0207649_10015204 3300025920 Bacteria 4323
251 Ga0207652_10004838 3300025921 Bacteria 10909
252 Ga0207681_10027831 3300025923 Bacteria 3659
253 Ga0207681_10175551 3300025923 Bacteria 1628
254 Ga0207694_10000021 3300025924 Bacteria 300246
255 Ga0207694_10041435 3300025924 Bacteria 3548
256 Ga0207694_10046291 3300025924 Bacteria 3362
257 Ga0207694_10180683 3300025924 Bacteria 1711
258 Ga0207650_10000202 3300025925 Bacteria 68952
259 Ga0207659_10450718 3300025926 Bacteria 1084
260 Ga0207700_10063470 3300025928 Bacteria 2809
261 Ga0207700_10119228 3300025928 Bacteria 2136
262 Ga0207700_10126608 3300025928 Bacteria 2079
263 Ga0207664_10083510 3300025929 Bacteria 2604
264 Ga0207664_10416411 3300025929 Bacteria 1196
265 Ga0207706_10225770 3300025933 Bacteria 1639
266 Ga0207686_10020400 3300025934 Bacteria 3786
267 Ga0207686_10048677 3300025934 Bacteria 2627
268 Ga0207686_10258963 3300025934 Bacteria 1274
269 Ga0207709_10018228 3300025935 Bacteria 3928
270 Ga0207665_10042604 3300025939 Bacteria 3034
271 Ga0207691_10001922 3300025940 Bacteria 20273
272 Ga0207691_10471127 3300025940 Bacteria 1068
273 Ga0207711_10027057 3300025941 Bacteria 4815
274 Ga0207711_10366058 3300025941 Bacteria 1336
275 Ga0207711_10539029 3300025941 Bacteria 1088
276 Ga0207689_10073517 3300025942 Bacteria 2808
277 Ga0207661_10279658 3300025944 Bacteria 1491
278 Ga0207667_10052624 3300025949 Bacteria 4287
279 Ga0207667_10277639 3300025949 Bacteria 1712
280 Ga0207668_10125623 3300025972 Bacteria 1950
281 Ga0207668_10205870 3300025972 Bacteria 1570
282 Ga0207658_10116657 3300025986 Bacteria 2121
283 Ga0207703_10177578 3300026035 Bacteria 1877
284 Ga0207639_10043105 3300026041 Bacteria 3386
285 Ga0207678_10121583 3300026067 Bacteria 2228
286 Ga0207708_10000005 3300026075 Bacteria 284735
287 Ga0207702_10119209 3300026078 Bacteria 2359
288 Ga0207641_10000412 3300026088 Bacteria 49926
289 Ga0207641_10064763 3300026088 Bacteria 3125
290 Ga0207676_10040599 3300026095 Bacteria 3567
291 Ga0207676_10231511 3300026095 Bacteria 1652
292 Ga0207674_10024355 3300026116 Bacteria 6470
293 Ga0207675_100158547 3300026118 Bacteria 2157
294 Ga0207683_10000852 3300026121 Bacteria 27982
295 Ga0207683_10130079 3300026121 Bacteria 2264
296 Ga0207683_10280099 3300026121 Bacteria 1524
297 Ga0209589_1000014 3300027357 Bacteria 227996
298 Ga0209489_100014 3300027361 Bacteria 227996
299 Ga0209700_100024 3300027363 Bacteria 227996
300 Ga0207428_10202160 3300027907 Bacteria 1495
301 Ga0268266_10027915 3300028379 Bacteria 4800
302 Ga0268266_10277060 3300028379 Bacteria 1559
303 Ga0268265_10319470 3300028380 Bacteria 1405
304 Ga0268264_10000689 3300028381 Bacteria 39297
305 Ga0268264_10117019 3300028381 Bacteria 2344
306 Ga0307517_10000100 3300028786 Bacteria 125762
307 Ga0307515_10013216 3300028794 Bacteria 15444
308 Ga0307515_10021109 3300028794 Bacteria 11563
309 Ga0307515_10103093 3300028794 Bacteria 3424
310 Ga0265320_10025982 3300031240 Bacteria 3072
311 Ga0265325_10000922 3300031241 Bacteria 21220
312 Ga0265340_10003444 3300031247 Bacteria 8928
313 Ga0265339_10007897 3300031249 Bacteria 6828
314 Ga0265316_10052652 3300031344 Bacteria 3192
315 Ga0307408_100010563 3300031548 Bacteria 6089
316 Ga0307408_100034220 3300031548 Bacteria 3557
317 Ga0307408_100043912 3300031548 Bacteria 3182
318 Ga0307408_100080643 3300031548 Bacteria 2431
319 Ga0307408_100090973 3300031548 Bacteria 2304
320 Ga0307408_100215937 3300031548 Bacteria 1562
321 Ga0307508_10010223 3300031616 Bacteria 8584
322 Ga0307508_10035220 3300031616 Bacteria 4512
323 Ga0307508_10201320 3300031616 Bacteria 1592
324 Ga0265314_10082348 3300031711 Bacteria 2117
325 Ga0265314_10108673 3300031711 Bacteria 1766
326 Ga0307405_10006319 3300031731 Bacteria 5817
327 Ga0307405_10027366 3300031731 Bacteria 3305
328 Ga0307405_10091519 3300031731 Bacteria 2015
329 Ga0307405_10095174 3300031731 Bacteria 1982
330 Ga0307405_10317371 3300031731 Bacteria 1189
331 Ga0316577_10014346 3300031733 Bacteria 4349
332 Ga0307413_10002237 3300031824 Bacteria 7803
333 Ga0307413_10013413 3300031824 Bacteria 4119
334 Ga0307413_10406443 3300031824 Bacteria 1068
335 Ga0307410_10000589 3300031852 Bacteria 14976
336 Ga0307410_10003037 3300031852 Bacteria 8297
337 Ga0307410_10074763 3300031852 Bacteria 2361
338 Ga0307407_10091485 3300031903 Bacteria 1865
339 Ga0307412_10001061 3300031911 Bacteria 15719
340 Ga0307412_10006661 3300031911 Bacteria 6548
341 Ga0307412_10041803 3300031911 Bacteria 2973
342 Ga0307412_10047393 3300031911 Bacteria 2823
343 Ga0307412_10059824 3300031911 Bacteria 2555
344 Ga0307412_10147085 3300031911 Bacteria 1733
345 Ga0307409_100241533 3300031995 Bacteria 1645
346 Ga0307409_100254933 3300031995 Bacteria 1606
347 Ga0307416_100005468 3300032002 Bacteria 7801
348 Ga0307416_100234091 3300032002 Bacteria 1773
349 Ga0307416_100283804 3300032002 Bacteria 1634
350 Ga0307416_100871623 3300032002 Bacteria 999
351 Ga0307416_101031055 3300032002 Bacteria 926
352 Ga0307414_10040700 3300032004 Bacteria 3141
353 Ga0307411_10004613 3300032005 Bacteria 6632
354 Ga0307510_10007284 3300033180 Bacteria 13179
355 Ga0307510_10064141 3300033180 Bacteria 3733
356 Ga0315911_1000002 3300033442 Bacteria 926833
357 Ga0373949_0025947 3300035090 Bacteria 1371
358 Ga0373931_0089515 3300035691 Bacteria 1712
359 Ga0373927_0107006 3300035695 Bacteria 1821
360 Ga0373937_0047334 3300036401 Bacteria 3935
361 Ga0373937_0198760 3300036401 Bacteria 1884
362 Ga0316582_0383352 3300036647 Bacteria 968
363 Ga0373925_0118157 3300037068 Bacteria 2056
364 Ga0373925_0224643 3300037068 Bacteria 1500
365 Ga0395899_0005680 3300037312 Bacteria 9687
366 Ga0395899_0010822 3300037312 Bacteria 6992
367 Ga0395900_0002292 3300037418 Bacteria 21261
368 Ga0395900_0010130 3300037418 Bacteria 9640
369 Ga0395900_0026944 3300037418 Bacteria 5883
370 Ga0395900_0068511 3300037418 Bacteria 3646
371 Ga0395900_0124116 3300037418 Bacteria 2648
372 Ga0395900_0175868 3300037418 Bacteria 2177
373 Ga0395900_0642842 3300037418 Bacteria 998
374 Ga0395898_0002013 3300037466 Bacteria 25494
375 Ga0395898_0006115 3300037466 Bacteria 12905
376 Ga0395898_0014129 3300037466 Bacteria 8207
377 Ga0395898_0083624 3300037466 Bacteria 3076
378 Ga0395898_0171930 3300037466 Bacteria 2071
379 Ga0395898_0173885 3300037466 Bacteria 2058
380 Ga0395905_0015639 3300037471 Bacteria 7209
381 Ga0395905_0026671 3300037471 Bacteria 5448
382 Ga0395905_0498624 3300037471 Bacteria 1118
383 Ga0436364_0681592 3300037853 Bacteria 2757
384 Ga0436364_0826744 3300037853 Bacteria 2070
385 Ga0436364_1461962 3300037853 Bacteria 1732
386 Ga0395901_0004737 3300038443 Bacteria 13731
387 Ga0395901_0036353 3300038443 Bacteria 5090
388 Ga0395901_0054286 3300038443 Bacteria 4164
389 Ga0395901_0168100 3300038443 Bacteria 2301
390 Ga0395901_0186833 3300038443 Bacteria 2173
391 Ga0395901_0705622 3300038443 Bacteria 1006
392 Ga0395901_0774068 3300038443 Bacteria 951
393 Ga0400490_14049 3300038726 Bacteria 7683
394 Ga0400489_04907 3300039093 Bacteria 9378
395 Ga0436365_0332720 3300039437 Bacteria 227622
396 Ga0436365_1326044 3300039437 Bacteria 3011
397 Ga0436360_1043296 3300039438 Bacteria 2210
398 Ga0436360_1309131 3300039438 Bacteria 7974
399 Ga0436361_0340447 3300039447 Bacteria 2519
400 Ga0436361_0614516 3300039447 Bacteria 1144
401 Ga0436361_0648521 3300039447 Bacteria 3766
402 Ga0436363_0411896 3300039450 Bacteria 1217
403 Ga0436362_0660519 3300039453 Bacteria 832172
404 Ga0439436_0000550 3300041404 Bacteria 9879
405 Ga0439436_0007527 3300041404 Bacteria 3351
406 Ga0439438_000449 3300041405 Bacteria 18620
407 Ga0439439_0000054 3300041406 Bacteria 14510
408 Ga0439447_027295 3300041407 Bacteria 1457
409 Ga0439461_0007338 3300041410 Bacteria 1949
410 Ga0439466_0001366 3300041411 Bacteria 9481
411 Ga0439466_0096429 3300041411 Bacteria 924
412 Ga0439433_0000004 3300041999 Bacteria 39895
413 Ga0439433_0000065 3300041999 Bacteria 13231
414 Ga0439433_0000455 3300041999 Bacteria 7539
415 Ga0439442_000001 3300042002 Bacteria 161142
416 Ga0439442_000592 3300042002 Bacteria 7838
417 Ga0439442_001300 3300042002 Bacteria 4962
418 Ga0439442_003782 3300042002 Bacteria 2996
419 Ga0439432_000310 3300042006 Bacteria 17587
420 Ga0439449_0000405 3300042007 Bacteria 15992
421 Ga0439449_0021569 3300042007 Bacteria 2411
422 Ga0439449_0034103 3300042007 Bacteria 1895
423 Ga0439449_0045071 3300042007 Bacteria 1635
424 Ga0439452_001352 3300042010 Bacteria 10189
425 Ga0439457_000956 3300042014 Bacteria 8682
426 Ga0439462_0000546 3300042015 Bacteria 7447
427 Ga0450919_006490 3300042121 Bacteria 1382
428 Ga0450920_000059 3300042122 Bacteria 14165
429 Ga0450920_000088 3300042122 Bacteria 12116
430 Ga0450907_000288 3300042146 Bacteria 17027
431 Ga0450907_000303 3300042146 Bacteria 16503
432 Ga0450908_007264 3300042184 Bacteria 2092
433 Ga0450909_005045 3300042185 Bacteria 1895
434 Ga0439434_0001912 3300042435 Bacteria 6043
435 Ga0439434_0007612 3300042435 Bacteria 3174
436 Ga0439434_0065692 3300042435 Bacteria 1138
437 Ga0450918_000190 3300042531 Bacteria 13717
438 Ga0450918_000276 3300042531 Bacteria 11660
439 Ga0451577_0115465 3300042876 Bacteria 2404
440 Ga0466961_0000031 3300044693 Bacteria 85869
441 Ga0466961_0144592 3300044693 Bacteria 1487
442 Ga0453684_0681262 3300044712 Bacteria 1119
443 Ga0466957_0148265 3300044842 Bacteria 1516
444 Ga0466959_0006857 3300045049 Bacteria 7942
445 Ga0466967_0455037 3300045976 Bacteria 1251
446 Ga0495629_0105839 3300046459 Bacteria 1962
447 Ga0495629_0146459 3300046459 Bacteria 1642
448 Ga0495651_0033707 3300046462 Bacteria 3994
449 Ga0495651_0133506 3300046462 Bacteria 1809
450 Ga0495651_0310705 3300046462 Bacteria 1054
451 Ga0495653_0100887 3300046463 Bacteria 2092
452 Ga0495653_0253518 3300046463 Bacteria 1167
453 Ga0495580_0007029 3300046472 Bacteria 9077
454 Ga0495582_0035328 3300046473 Bacteria 2749
455 Ga0495639_0001561 3300046475 Bacteria 10237
456 Ga0495664_0017458 3300046477 Bacteria 4103
457 Ga0495606_0133539 3300046507 Bacteria 1473
458 Ga0495610_0070992 3300046512 Bacteria 1625
459 Ga0495618_0052436 3300046514 Bacteria 2579
460 Ga0495648_0003275 3300046524 Bacteria 14331
461 Ga0495648_0038782 3300046524 Bacteria 3041
462 Ga0495648_0125354 3300046524 Bacteria 1374
463 Ga0495642_0058314 3300046528 Bacteria 1598
464 Ga0495654_0003598 3300046530 Bacteria 9433
465 Ga0495586_0001724 3300046535 Bacteria 11939
466 Ga0495609_0049608 3300046538 Bacteria 1873
467 Ga0495622_0045200 3300046557 Bacteria 2046
468 Ga0495633_0103906 3300046558 Bacteria 1318
469 Ga0495667_0012988 3300046559 Bacteria 5645
470 Ga0495667_0118475 3300046559 Bacteria 1710
471 Ga0495656_0006245 3300046615 Bacteria 4170
472 Ga0495611_0038951 3300046648 Bacteria 2116
473 Ga0495635_0014160 3300046663 Bacteria 5581
474 Ga0495635_0334997 3300046663 Bacteria 1011
475 Ga0495659_0094487 3300046664 Bacteria 1152
476 Ga0495588_0007529 3300046674 Bacteria 4959
477 Ga0495657_0022744 3300046675 Bacteria 4486
478 Ga0495657_0114570 3300046675 Bacteria 1704
479 Ga0495657_0144167 3300046675 Bacteria 1483
480 Ga0495624_0100078 3300046690 Bacteria 1785
481 Ga0495670_0019653 3300046691 Bacteria 3329
482 Ga0495670_0042156 3300046691 Bacteria 2277
483 Ga0495649_0159730 3300046694 Bacteria 1182
484 Ga0495600_0028073 3300046809 Bacteria 3640
485 Ga0495581_0001814 3300047315 Bacteria 11948
486 Ga0495581_0332188 3300047315 Bacteria 887
487 Ga0495604_0067253 3300047317 Bacteria 2723
488 Ga0495672_0042930 3300047320 Bacteria 2722
489 Ga0495676_0025479 3300047321 Bacteria 5107
490 Ga0495676_0116560 3300047321 Bacteria 1950
491 Ga0495687_067024 3300047443 Bacteria 1455
492 Ga0495686_0024664 3300047472 Bacteria 3948
493 Ga0495593_0043612 3300047673 Bacteria 2402
494 Ga0495593_0135443 3300047673 Bacteria 1249
495 Ga0495602_0114844 3300048088 Bacteria 2179
496 Ga0496100_0165962 3300048903 Bacteria 1586
497 Ga0496101_0088606 3300048904 Bacteria 2299
498 Ga0496101_0164366 3300048904 Bacteria 1703
499 Ga0496101_0246232 3300048904 Bacteria 1392
500 Ga0496102_0087221 3300048905 Bacteria 2883
501 Ga0496104_0001655 3300048907 Bacteria 19236
502 Ga0496104_0089347 3300048907 Bacteria 2943
503 Ga0496104_0103020 3300048907 Bacteria 2734
504 Ga0496104_0222781 3300048907 Bacteria 1798
505 Ga0496104_0233637 3300048907 Bacteria 1750
506 Ga0496104_0302389 3300048907 Bacteria 1512
507 Ga0496105_0005515 3300048908 Bacteria 9603
508 Ga0496105_0005541 3300048908 Bacteria 9584
509 Ga0496105_0006734 3300048908 Bacteria 8836
510 Ga0496105_0148645 3300048908 Bacteria 1926
511 Ga0496105_0173597 3300048908 Bacteria 1766
512 Ga0496106_0106773 3300048909 Bacteria 2177
513 Ga0496106_0260229 3300048909 Bacteria 1388
514 Ga0496106_0295160 3300048909 Bacteria 1299
515 Ga0496107_0160607 3300048910 Bacteria 1665
516 Ga0496108_0016877 3300048911 Bacteria 5967
517 Ga0496108_0098954 3300048911 Bacteria 2485
518 Ga0496108_0257780 3300048911 Bacteria 1517
519 Ga0496109_0000839 3300048912 Bacteria 25665
520 Ga0496109_0030558 3300048912 Bacteria 4828
521 Ga0496109_0188663 3300048912 Bacteria 1937
522 Ga0496110_0062499 3300048913 Bacteria 3288
523 Ga0496110_0163753 3300048913 Bacteria 2016
524 Ga0496110_0251492 3300048913 Bacteria 1608
525 Ga0496110_0280051 3300048913 Bacteria 1518
526 Ga0496111_0002183 3300048914 Bacteria 11720
527 Ga0496111_0250255 3300048914 Bacteria 1315
528 Ga0496112_0006565 3300048915 Bacteria 10236
529 Ga0496112_0008387 3300048915 Bacteria 9255
530 Ga0496112_0028066 3300048915 Bacteria 5430
531 Ga0496112_0132501 3300048915 Bacteria 2463
532 Ga0496112_0310113 3300048915 Bacteria 1523
533 Ga0496112_0489848 3300048915 Bacteria 1165
534 Ga0496112_0677012 3300048915 Bacteria 960
535 Ga0496113_0127257 3300048916 Bacteria 1996
536 Ga0496113_0330406 3300048916 Bacteria 1222
537 Ga0496114_0012738 3300048917 Bacteria 6735
538 Ga0496114_0152926 3300048917 Bacteria 2002
539 Ga0496114_0209195 3300048917 Bacteria 1711
540 Ga0496115_0008711 3300048918 Bacteria 7518
541 Ga0496115_0116043 3300048918 Bacteria 2202
542 Ga0496115_0215468 3300048918 Bacteria 1585
543 Ga0496115_0227311 3300048918 Bacteria 1539
544 Ga0496115_0413961 3300048918 Bacteria 1093
545 Ga0496117_0002279 3300048920 Bacteria 24781
546 Ga0496117_0009546 3300048920 Bacteria 9004
547 Ga0496118_0001768 3300048921 Bacteria 31276
548 Ga0496118_0029332 3300048921 Bacteria 4615
549 Ga0496118_0157744 3300048921 Bacteria 1409
550 Ga0496120_0015101 3300048923 Bacteria 5110
551 Ga0496120_0040477 3300048923 Bacteria 2738
552 Ga0496120_0057834 3300048923 Bacteria 2180
553 Ga0496121_0001894 3300048924 Bacteria 33517
554 Ga0496121_0051754 3300048924 Bacteria 3456
555 Ga0496121_0149050 3300048924 Bacteria 1724
556 Ga0496122_0116193 3300048925 Bacteria 1741
557 Ga0496122_0134845 3300048925 Bacteria 1559
558 Ga0496123_0140427 3300048926 Bacteria 1322
559 Ga0496124_0002163 3300048927 Bacteria 26352
560 Ga0496124_0082047 3300048927 Bacteria 2648
561 Ga0496124_0145976 3300048927 Bacteria 1861
562 Ga0496124_0229791 3300048927 Bacteria 1388
563 Ga0496125_0001616 3300048928 Bacteria 31818
564 Ga0496125_0006808 3300048928 Bacteria 12270
565 Ga0496125_0026490 3300048928 Bacteria 5280
566 Ga0496126_0002472 3300048929 Bacteria 24884
567 Ga0496126_0006015 3300048929 Bacteria 13627
568 Ga0496126_0029998 3300048929 Bacteria 5160
569 Ga0496126_0046400 3300048929 Bacteria 3985
570 Ga0496126_0049326 3300048929 Bacteria 3844
571 Ga0496126_0051188 3300048929 Bacteria 3760
572 Ga0496126_0080635 3300048929 Bacteria 2879
573 Ga0496126_0133829 3300048929 Bacteria 2140
574 Ga0496126_0182643 3300048929 Bacteria 1781
575 Ga0496126_0226543 3300048929 Bacteria 1568
576 Ga0496126_0361984 3300048929 Bacteria 1184
577 Ga0496126_0577606 3300048929 Bacteria 888
578 Ga0501031_0070033 3300049568 Bacteria 2284
579 Ga0501031_0080584 3300049568 Bacteria 2121
580 Ga0501032_0000942 3300049569 Bacteria 23547
581 Ga0501032_0032322 3300049569 Bacteria 3586
582 Ga0501032_0103963 3300049569 Bacteria 1881
583 Ga0501033_0000674 3300049570 Bacteria 31495
584 Ga0501034_0000016 3300049571 Bacteria 289751
585 Ga0501034_0188961 3300049571 Bacteria 2023
586 Ga0501034_0221677 3300049571 Bacteria 1843
587 Ga0501036_0183904 3300049572 Bacteria 1759
588 Ga0501036_0306332 3300049572 Bacteria 1328
589 Ga0501036_0501051 3300049572 Bacteria 1010
590 Ga0501036_0547516 3300049572 Bacteria 962
591 Ga0501037_0028995 3300049573 Bacteria 4088
592 Ga0501037_0085794 3300049573 Bacteria 2279
593 Ga0501037_0086799 3300049573 Bacteria 2264
594 Ga0501037_0320393 3300049573 Bacteria 1073
595 Ga0501038_0000734 3300049574 Bacteria 29279
596 Ga0501038_0001529 3300049574 Bacteria 21336
597 Ga0501038_0002689 3300049574 Bacteria 16566
598 Ga0501038_0007103 3300049574 Bacteria 10341
599 Ga0501038_0009897 3300049574 Bacteria 8728
600 Ga0501038_0071307 3300049574 Bacteria 2947
601 Ga0501039_0005049 3300049575 Bacteria 10005
602 Ga0501039_0048339 3300049575 Bacteria 3288
603 Ga0501039_0093328 3300049575 Bacteria 2345
604 Ga0501039_0116890 3300049575 Bacteria 2088
605 Ga0501040_0005957 3300049576 Bacteria 7885
606 Ga0501043_0002923 3300049579 Bacteria 14261
607 Ga0501043_0005412 3300049579 Bacteria 10317
608 Ga0501043_0009885 3300049579 Bacteria 7479
609 Ga0501043_0021212 3300049579 Bacteria 5092
610 Ga0501043_0068354 3300049579 Bacteria 2789
611 Ga0501043_0085405 3300049579 Bacteria 2480
612 Ga0501043_0090913 3300049579 Bacteria 2400
613 Ga0501043_0233365 3300049579 Bacteria 1420
614 Ga0501046_0015018 3300049580 Bacteria 6514
615 Ga0501046_0123177 3300049580 Bacteria 1971
616 Ga0501047_0125601 3300049581 Bacteria 2446
617 Ga0501047_0168088 3300049581 Bacteria 2063
618 Ga0501047_0220179 3300049581 Bacteria 1754
619 Ga0501067_0028783 3300049583 Bacteria 3079
620 Ga0501068_0095443 3300049584 Bacteria 1839
621 Ga0501068_0143952 3300049584 Bacteria 1495
622 Ga0501069_0150479 3300049585 Bacteria 1337
623 Ga0501070_0056862 3300049586 Bacteria 3243
624 Ga0501070_0124978 3300049586 Bacteria 2126
625 Ga0501070_0186148 3300049586 Bacteria 1708
626 Ga0501071_0397088 3300049587 Bacteria 1053
627 Ga0501073_0055431 3300049589 Bacteria 2774
628 Ga0501073_0314435 3300049589 Bacteria 1081
629 Ga0501074_0006081 3300049590 Bacteria 8717
630 Ga0501074_0177916 3300049590 Bacteria 1518
631 Ga0501076_0137759 3300049592 Bacteria 1982
632 Ga0501077_0045550 3300049593 Bacteria 2787
633 Ga0501080_0090592 3300049742 Bacteria 2841
634 Ga0501080_0382764 3300049742 Bacteria 1267
635 Ga0501241_001816 3300049758 Bacteria 4212
636 Ga0501035_0000923 3300049822 Bacteria 31113
637 Ga0501035_0001334 3300049822 Bacteria 25468
638 Ga0501035_0068669 3300049822 Bacteria 3142
639 Ga0501035_0084849 3300049822 Bacteria 2793
640 Ga0501035_0089026 3300049822 Bacteria 2719
641 Ga0501035_0189732 3300049822 Bacteria 1767
642 Ga0501044_0004565 3300049823 Bacteria 15488
643 Ga0501044_0009412 3300049823 Bacteria 10643
644 Ga0501044_0040327 3300049823 Bacteria 4866
645 Ga0501044_0046543 3300049823 Bacteria 4490
646 Ga0501044_0059545 3300049823 Bacteria 3912
647 Ga0501044_0563983 3300049823 Bacteria 1035
648 Ga0501045_0006283 3300049824 Bacteria 8214
649 nmdc:mga03683_91143_c1 3300050489 Bacteria 1329
650 nmdc:mga03n38_106558_c1 3300050490 Bacteria 1359
651 nmdc:mga00v17_77369_c1 3300050491 Bacteria 2071
652 nmdc:mga0yw44_21036_c1 3300050492 Bacteria 3633
653 nmdc:mga0yw44_2394_c1 3300050492 Bacteria 7979
654 nmdc:mga06z11_39335_c1 3300050494 Bacteria 2353
655 nmdc:mga07m45_15067_c1 3300050496 Bacteria 4129
656 nmdc:mga05p37_200732_c1 3300050507 Bacteria 2416
657 nmdc:mga05p37_61463_c1 3300050507 Bacteria 4624
658 nmdc:mga06r32_353259_c1 3300050510 Bacteria 1454
659 nmdc:mga08y16_366531_c1 3300050511 Bacteria 1478
660 nmdc:mga08y16_421001_c1 3300050511 Bacteria 1365
661 nmdc:mga0n895_324180_c1 3300050512 Bacteria 1561
662 nmdc:mga0sz30_3128_c1 3300050516 Bacteria 4552
663 nmdc:mga0sz30_5801_c1 3300050516 Bacteria 4548
664 nmdc:mga0sz30_72902_c1 3300050516 Bacteria 1480
665 Ga0495601_0036166 3300053077 Bacteria 3083
666 Ga0495601_0105267 3300053077 Bacteria 1824
667 Ga0495612_0008841 3300053078 Bacteria 4080
668 Ga0495612_0035130 3300053078 Bacteria 2031
669 Ga0500610_0076759 3300053079 Bacteria 1742
670 Ga0495595_0002902 3300053084 Bacteria 6760
671 Ga0495595_0043060 3300053084 Bacteria 2070
672 Ga0495619_0117982 3300053085 Bacteria 1818
673 Ga0500578_0079887 3300053086 Bacteria 2081
674 Ga0500643_000095 3300053087 Bacteria 92535
675 Ga0500583_0052936 3300053092 Bacteria 1890
676 Ga0500651_0035325 3300053093 Bacteria 3150
677 Ga0500641_0008907 3300053096 Bacteria 3597
678 Ga0500555_017169 3300053103 Bacteria 2086
679 Ga0500595_012476 3300053119 Bacteria 3286
680 Ga0500607_058153 3300053121 Bacteria 2035
681 Ga0500608_115434 3300053122 Bacteria 1225
682 Ga0500614_008701 3300053123 Bacteria 2155
683 Ga0500614_034190 3300053123 Bacteria 1260
684 Ga0500642_0010458 3300053130 Bacteria 3272
685 Ga0500559_0012469 3300053136 Bacteria 3612
686 Ga0500564_082438 3300053138 Bacteria 1440
687 Ga0500568_0023347 3300053139 Bacteria 2631
688 Ga0500573_0030414 3300053140 Bacteria 3116
689 Ga0500604_0061893 3300053151 Bacteria 1177
690 Ga0500619_004398 3300053154 Bacteria 3020
691 Ga0500627_0001129 3300053158 Bacteria 7306
692 Ga0500638_042127 3300053162 Bacteria 2217
693 Ga0500636_0000807 3300053177 Bacteria 16914
694 Ga0500567_134688 3300053723 Bacteria 959
695 Ga0500601_000088 3300053737 Bacteria 19062
696 Ga0501084_0178750 3300054114 Bacteria 1791
697 Ga0587084_010320 3300059477 Bacteria 1222
698 Ga0587070_015401 3300059491 Bacteria 1210
699 Ga0587073_0022347 3300059492 Bacteria 1227
700 Ga0587090_012339 3300059510 Bacteria 1218
701 Ga0587106_001284 3300059605 Bacteria 2173
702 Ga0587128_022202 3300059630 Bacteria 985
703 Ga0587079_018512 3300059647 Bacteria 1222
704 2508541012 2508501009 Bacteria 7784016
705 2511280734 2511231008 Bacteria 6624100
706 2511399978 2511231028 Bacteria 8046582
707 2513641537 2513237094 Bacteria 8789602
708 2513653891 2513237096 Bacteria 8722461
709 2513674563 2513237098 Bacteria 9902361
710 2513679857 2513237098 Bacteria 9902361
711 2513692964 2513237101 Bacteria 7952346
712 2513704000 2513237102 Bacteria 7703324
713 2513856325 2513237137 Bacteria 9558895
714 2513890118 2513237141 Bacteria 8496279
715 2513918231 2513237145 Bacteria 8979722
716 2514014923 2513237161 Bacteria 8871253
717 2517891539 2517572143 Bacteria 9484767
718 2524463711 2524023210 Bacteria 9029266
719 2524471089 2524023210 Bacteria 9029266
720 2524538696 2524023228 Bacteria 10118060
721 2528857566 2528768022 Bacteria 10457665
722 2617349927 2617270735 Bacteria 9163226
723 2681996400 2681812866 Bacteria 4552357
724 2691514560 2690315906 Bacteria 4517044
725 2728754874 2728368998 Bacteria 8720350
726 2738674403 2738541265 Bacteria 6594665
727 2738752796 2738541282 Bacteria 6593925
728 2738861837 2738541303 Bacteria 6591772
729 2753856736 2751185917 Bacteria 4551186
730 2775655114 2775506735 Bacteria 4556596
731 2784471651 2784132109 Bacteria 3141763
732 2793066902 2791355197 Bacteria 8420563
733 2807410759 2806310737 Bacteria 5751088
734 2807459100 2806310745 Bacteria 5742165
735 2808827658 2808606357 Bacteria 4466944
736 2808853013 2808606360 Bacteria 4404006
737 2808878483 2808606366 Bacteria 4415912
738 2808896996 2808606371 Bacteria 4251511
739 2808955699 2808606382 Bacteria 6841132
740 2812320577 2811994871 Bacteria 4497550
741 2838126685 2838122688 Bacteria 8803140
742 2840764458 2840764183 Bacteria 6358399
743 2841949136 2841941048 Bacteria 8688029
744 2841974096 2841966195 Bacteria 8673214
745 2842380087 2842377471 Bacteria 7140707
746 2849142129 2849139964 Bacteria 5613304
747 2857742076 2857740372 Bacteria 4782044
748 2857744596 2857740372 Bacteria 4782044
749 2874612288 2874604998 Bacteria 7834745
750 2874630716 2874628541 Bacteria 8630250
751 2885371648 2885366525 Bacteria 8326213
752 2885380394 2885374607 Bacteria 8927485
753 2885383463 2885383462 Bacteria 9473874
754 2885392600 2885383462 Bacteria 9473874
755 2885418387 2885409591 Bacteria 9235467
756 2889036563 2889033259 Bacteria 9099371
757 2891400055 2891395885 Bacteria 9251614
758 2893686893 2893684298 Bacteria 2897960
759 2894653177 2894652903 Bacteria 4587256
760 2903734205 2903727486 Bacteria 8281579
761 2903769341 2903768456 Bacteria 9749579
762 2903775564 2903768456 Bacteria 9749579
763 2904442152 2904439833 Bacteria 5931679
764 2904498188 2904497146 Bacteria 4731781
765 2904533442 2904530477 Bacteria 5876334
766 2904586394 2904584206 Bacteria 6028872
767 2904591793 2904589729 Bacteria 6113573
768 2904602048 2904601388 Bacteria 5884906
769 2904691354 2904690495 Bacteria 9412302
770 2904704754
771 2904777083 2904776348 Bacteria 4658726
772 2904777546 2904776348 Bacteria 4658726
773 2905929160 2905926851 Bacteria 4423176
774 2906616714
775 2906628655 2906626472 Bacteria 8826946
776 2906639828 2906635258 Bacteria 8601019
777 2906667042 2906660503 Bacteria 8595048
778 2908741882 2908739725 Bacteria 8628932
779 2908759534 2908756301 Bacteria 8864324
780 2908782334 2908775508 Bacteria 8092255
781 2910810086 2910809715 Bacteria 4982797
782 2919034919 2919034639 Bacteria 4763403
783 2919052206 2919051321 Bacteria 4210889
784 2919059740 2919059106 Bacteria 4991624
785 2919083608 2919079590 Bacteria 5946433
786 2919540382 2919538618 Bacteria 4677069
787 2922431256
788 2927833380 2927833300 Bacteria 4923934
789 2928099520 2928093941 Bacteria 5965005
790 2932428234 2932426870 Bacteria 4547726
791 2932798617 2932794094 Bacteria 7915132
792 2932806489 2932801729 Bacteria 7987968
793 2932824517 2932818245 Bacteria 9955613
794 2933421072 2933418574 Bacteria 4476724
795 2935633854 2935630451 Bacteria 8169952
796 2935684392 2935675223 Bacteria 9928132
797 2935804870 2935801545 Bacteria 9301974
798 2935888672 2935883170 Bacteria 7964738
799 2935964860 2935959822 Bacteria 7869783
800 2939598633 2939598168 Bacteria 4687164
801 2939648637 2939647034 Bacteria 4681660
802 2939675309 2939674588 Bacteria 4844420
803 2941510843 2941507105 Bacteria 8166816
804 2941518227 2941515067 Bacteria 8166720
805 2941526902 2941523033 Bacteria 8169134
806 2941536532 2941531003 Bacteria 7653939
807 2945921375 2945920336 Bacteria 4501603
808 2945942436 2945941187 Bacteria 4682474
809 2946038381 2946037020 Bacteria 4900426
810 2946062179 2946059875 Bacteria 4386623
811 2974306368 2974302888 Bacteria 4369871
812 2984582101 2984580707 Bacteria 3351387
813 2990046252 2990044586 Bacteria 6603797
814 3001120388 3001119090 Bacteria 3449530
815 3001890798 3001889506 Bacteria 2975194
816 3002142754 3002141150 Bacteria 5254435
817 3005481053 3005474847 Bacteria 9259049
818 3005485246 3005483717 Bacteria 7877331
819 3005601021 3005594810 Bacteria 8716512
820 3005723789 3005718088 Bacteria 8283608
821 8006929577 8006926726 Bacteria 6749210
822 8006939658 8006933436 Bacteria 10410654
823 8006979407 8006973647 Bacteria 10679141
824 8006997275 8006994254 Bacteria 8309700
825 8019565550 8019555841 Bacteria 9642137
826 8019575646 8019565922 Bacteria 9639779
827 8019580386 8019576017 Bacteria 10049540
828 8019588111 8019586578 Bacteria 10212056
829 8019615302 8019608314 Bacteria 10042931
830 8019647930 8019638758 Bacteria 9062356
831 8056125666 8056120720 Bacteria 5758328
832 8056135155 8056131705 Bacteria 6107031
833 8056676803 8056673599 Bacteria 7871253
834 8056685695 8056681323 Bacteria 8472857
835 8056693848 8056689827 Bacteria 6712655
836 8056973353 8056967851 Bacteria 9038162
837 Ga0307517_10000035
838 SwRhRL2b_contig_431541
839 LJQas_1000313
840 LJQas_1000428
841 JGI25153J46596_10000502
842 JGI25153J46596_10004212
843 rootL2_10137330
844 JGI25160J50197_1000344
845 JGI25160J50197_1004733
846 JGI25160J50197_1008646
847 Ga0055526_1018034
848 Ga0055543_1001128
849 Ga0065165_1000054
850 Ga0065165_1002041
851 Ga0065165_1004508
852 Ga0065165_1024806
853 Ga0065714_10021260
854 Ga0065704_10070449
855 Ga0065707_10082876
856 Ga0070658_10287331
857 Ga0070683_100019205
858 Ga0070683_100209810
859 Ga0070666_10086031
860 Ga0070682_100060944
861 Ga0068868_100137522
862 Ga0070660_100050701
863 Ga0070660_100152652
864 Ga0070660_100167111
865 Ga0070661_100015251
866 Ga0070668_100101282
867 Ga0070668_100148176
868 Ga0070668_100205306
869 Ga0070668_100287471
870 Ga0070669_100032156
871 Ga0070675_100259033
872 Ga0070675_100496291
873 Ga0070671_100211219
874 Ga0070671_100494467
875 Ga0070674_100098058
876 Ga0070673_100140182
877 Ga0070673_100390300
878 Ga0070659_100039289
879 Ga0070659_100073436
880 Ga0070667_100027985
881 Ga0070667_100029259
882 Ga0070714_100016833
883 Ga0070714_100358870
884 Ga0070713_100099432
885 Ga0070713_100155674
886 Ga0070710_10065829
887 Ga0070705_100085280
888 Ga0070705_100123621
889 Ga0070700_100000016
890 Ga0070694_100028742
891 Ga0070663_100085322
892 Ga0070678_100080939
893 Ga0070678_100460312
894 Ga0070679_100097641
895 Ga0068853_100007053
896 Ga0070672_100205158
897 Ga0070695_100115921
898 Ga0070696_100145516
899 Ga0070693_100100600
900 Ga0070693_100221020
901 Ga0070665_100016709
902 Ga0070665_100449742
903 Ga0070704_100222740
904 Ga0068855_100009183
905 Ga0068855_100096811
906 Ga0068855_100264546
907 Ga0068857_100127798
908 Ga0068854_100080249
909 Ga0068856_100091113
910 Ga0068856_100124021
911 Ga0070702_100015741
912 Ga0068852_100019657
913 Ga0068852_100038874
914 Ga0068852_100168992
915 Ga0068859_100471540
916 Ga0068864_100149334
917 Ga0068864_100188988
918 Ga0068866_10076377
919 Ga0068861_100240165
920 Ga0068851_10001626
921 Ga0068851_10025378
922 Ga0068870_10038027
923 Ga0068863_100017642
924 Ga0068863_100091260
925 Ga0068858_100444736
926 Ga0068860_100006638
927 Ga0068860_100256874
928 Ga0068860_100567825
929 Ga0068862_100060247
930 Ga0068862_100172395
931 Ga0081455_10064438
932 Ga0081540_1004075
933 Ga0081540_1012922
934 Ga0081540_1019967
935 Ga0081540_1024743
936 Ga0070717_10096889
937 Ga0070717_10137831
938 Ga0070717_10253942
939 Ga0075365_10000758
940 Ga0075365_10039057
941 Ga0075432_10008863
942 Ga0075432_10053983
943 Ga0070716_100084534
944 Ga0075367_10051748
945 Ga0075369_10002752
946 Ga0075369_10008001
947 Ga0097621_100203510
948 Ga0075370_10059787
949 Ga0068871_100183992
950 Ga0068871_100711108
951 Ga0075428_100569201
952 Ga0075431_100269507
953 Ga0075433_10338652
954 Ga0075434_100061688
955 Ga0068865_100184839
956 Ga0097620_100471546
957 Ga0099824_1018455
958 Ga0075435_100161354
959 Ga0105251_10012385
960 Ga0105251_10045775
961 Ga0105244_10001709
962 Ga0105244_10019047
963 Ga0105244_10024666
964 Ga0105244_10128852
965 Ga0105250_10000032
966 Ga0105250_10000325
967 Ga0105250_10074592
968 Ga0105240_10000793
969 Ga0105240_10000882
970 Ga0105240_10067287
971 Ga0105240_10134481
972 Ga0111539_10022931
973 Ga0111539_10195233
974 Ga0111539_11033170
975 Ga0105247_10328233
976 Ga0114129_10052715
977 Ga0114129_10086467
978 Ga0105243_10014716
979 Ga0105243_10014820
980 Ga0105243_10047630
981 Ga0105242_10000988
982 Ga0105242_10063793
983 Ga0105242_10159112
984 Ga0105248_10040375
985 Ga0105248_10065945
986 Ga0105248_10220185
987 Ga0105248_10239757
988 Ga0105237_10000153
989 Ga0105237_10005366
990 Ga0105237_10017760
991 Ga0105237_10312323
992 Ga0105238_10000004
993 Ga0105238_10006993
994 Ga0105238_10032169
995 Ga0105238_10076245
996 Ga0105238_10096288
997 Ga0105249_10142757
998 Ga0105249_10193096
999 Ga0105239_10021850
1000 Ga0105239_10407256
1001 Ga0105239_10523652
1002 Ga0105246_10042715
1003 Ga0105246_10099564
1004 Ga0105246_10149623
1005 Ga0105246_10180824
1006 Ga0105246_10408763
1007 Ga0157373_10374820
1008 Ga0157371_10053550
1009 Ga0157371_10082265
1010 Ga0157370_10073595
1011 Ga0157370_10145296
1012 Ga0157370_10210979
1013 Ga0157369_10284252
1014 Ga0157374_10077895
1015 Ga0157374_10093981
1016 Ga0157378_10059697
1017 Ga0163162_10115450
1018 Ga0163162_10341159
1019 Ga0157372_10100451
1020 Ga0157372_10253465
1021 Ga0157375_10220641
1022 Ga0157375_10257244
1023 Ga0163163_10009451
1024 Ga0163163_10222323
1025 Ga0163163_10490980
1026 Ga0157380_10073722
1027 Ga0157380_10507600
1028 Ga0157379_10000004
1029 Ga0157376_10089440
1030 Ga0157376_10245586
1031 Ga0157376_10391266
1032 Ga0182006_1000572
1033 Ga0163161_10125641
1034 Ga0163161_10360097
1035 Ga0213873_10000002
1036 Ga0213876_10000001
1037 Ga0209148_1000239
1038 Ga0209233_1000600
1039 Ga0209233_1001306
1040 Ga0209233_1025181
1041 Ga0209455_1002439
1042 Ga0209564_1015835
1043 Ga0209758_1000806
1044 Ga0209758_1001068
1045 Ga0209758_1018079
1046 Ga0209758_1035507
1047 Ga0209758_1061677
1048 Ga0209256_1003643
1049 Ga0209256_1029787
1050 Ga0207426_1000375
1051 Ga0207426_1000467
1052 Ga0207426_1000527
1053 Ga0207426_1015512
1054 Ga0209051_1001715
1055 Ga0209051_1007303
1056 Ga0207697_10022679
1057 Ga0207656_10011584
1058 Ga0207696_1000198
1059 Ga0207696_1000386
1060 Ga0207655_1000733
1061 Ga0207655_1003206
1062 Ga0207655_1017212
1063 Ga0207655_1029710
1064 Ga0207710_10140486
1065 Ga0207688_10115997
1066 Ga0207680_10027568
1067 Ga0207680_10028171
1068 Ga0207680_10161871
1069 Ga0207645_10027311
1070 Ga0207654_10052793
1071 Ga0207654_10115232
1072 Ga0207707_10001050
1073 Ga0207695_10000797
1074 Ga0207695_10000830
1075 Ga0207695_10001008
1076 Ga0207695_10002445
1077 Ga0207671_10001174
1078 Ga0207671_10011775
1079 Ga0207671_10030463
1080 Ga0207671_10137330
1081 Ga0207693_10002666
1082 Ga0207662_10013430
1083 Ga0207657_10043220
1084 Ga0207657_10107777
1085 Ga0207657_10282420
1086 Ga0207649_10015204
1087 Ga0207652_10004838
1088 Ga0207681_10027831
1089 Ga0207681_10175551
1090 Ga0207694_10000021
1091 Ga0207694_10041435
1092 Ga0207694_10046291
1093 Ga0207694_10180683
1094 Ga0207650_10000202
1095 Ga0207659_10450718
1096 Ga0207700_10063470
1097 Ga0207700_10119228
1098 Ga0207700_10126608
1099 Ga0207664_10083510
1100 Ga0207664_10416411
1101 Ga0207706_10225770
1102 Ga0207686_10020400
1103 Ga0207686_10048677
1104 Ga0207686_10258963
1105 Ga0207709_10018228
1106 Ga0207665_10042604
1107 Ga0207691_10001922
1108 Ga0207691_10471127
1109 Ga0207711_10027057
1110 Ga0207711_10366058
1111 Ga0207711_10539029
1112 Ga0207689_10073517
1113 Ga0207661_10279658
1114 Ga0207667_10052624
1115 Ga0207667_10277639
1116 Ga0207668_10125623
1117 Ga0207668_10205870
1118 Ga0207658_10116657
1119 Ga0207703_10177578
1120 Ga0207639_10043105
1121 Ga0207678_10121583
1122 Ga0207708_10000005
1123 Ga0207702_10119209
1124 Ga0207641_10000412
1125 Ga0207641_10064763
1126 Ga0207676_10040599
1127 Ga0207676_10231511
1128 Ga0207674_10024355
1129 Ga0207675_100158547
1130 Ga0207683_10000852
1131 Ga0207683_10130079
1132 Ga0207683_10280099
1133 Ga0209589_1000014
1134 Ga0209489_100014
1135 Ga0209700_100024
1136 Ga0207428_10202160
1137 Ga0268266_10027915
1138 Ga0268266_10277060
1139 Ga0268265_10319470
1140 Ga0268264_10000689
1141 Ga0268264_10117019
1142 Ga0307517_10000100
1143 Ga0307515_10013216
1144 Ga0307515_10021109
1145 Ga0307515_10103093
1146 Ga0265320_10025982
1147 Ga0265325_10000922
1148 Ga0265340_10003444
1149 Ga0265339_10007897
1150 Ga0265316_10052652
1151 Ga0307408_100010563
1152 Ga0307408_100034220
1153 Ga0307408_100043912
1154 Ga0307408_100080643
1155 Ga0307408_100090973
1156 Ga0307408_100215937
1157 Ga0307508_10010223
1158 Ga0307508_10035220
1159 Ga0307508_10201320
1160 Ga0265314_10082348
1161 Ga0265314_10108673
1162 Ga0307405_10006319
1163 Ga0307405_10027366
1164 Ga0307405_10091519
1165 Ga0307405_10095174
1166 Ga0307405_10317371
1167 Ga0316577_10014346
1168 Ga0307413_10002237
1169 Ga0307413_10013413
1170 Ga0307413_10406443
1171 Ga0307410_10000589
1172 Ga0307410_10003037
1173 Ga0307410_10074763
1174 Ga0307407_10091485
1175 Ga0307412_10001061
1176 Ga0307412_10006661
1177 Ga0307412_10041803
1178 Ga0307412_10047393
1179 Ga0307412_10059824
1180 Ga0307412_10147085
1181 Ga0307409_100241533
1182 Ga0307409_100254933
1183 Ga0307416_100005468
1184 Ga0307416_100234091
1185 Ga0307416_100283804
1186 Ga0307416_100871623
1187 Ga0307416_101031055
1188 Ga0307414_10040700
1189 Ga0307411_10004613
1190 Ga0307510_10007284
1191 Ga0307510_10064141
1192 Ga0315911_1000002
1193 Ga0373949_0025947
1194 Ga0373931_0089515
1195 Ga0373927_0107006
1196 Ga0373937_0047334
1197 Ga0373937_0198760
1198 Ga0316582_0383352
1199 Ga0373925_0118157
1200 Ga0373925_0224643
1201 Ga0395899_0005680
1202 Ga0395899_0010822
1203 Ga0395900_0002292
1204 Ga0395900_0010130
1205 Ga0395900_0026944
1206 Ga0395900_0068511
1207 Ga0395900_0124116
1208 Ga0395900_0175868
1209 Ga0395900_0642842
1210 Ga0395898_0002013
1211 Ga0395898_0006115
1212 Ga0395898_0014129
1213 Ga0395898_0083624
1214 Ga0395898_0171930
1215 Ga0395898_0173885
1216 Ga0395905_0015639
1217 Ga0395905_0026671
1218 Ga0395905_0498624
1219 Ga0436364_0681592
1220 Ga0436364_0826744
1221 Ga0436364_1461962
1222 Ga0395901_0004737
1223 Ga0395901_0036353
1224 Ga0395901_0054286
1225 Ga0395901_0168100
1226 Ga0395901_0186833
1227 Ga0395901_0705622
1228 Ga0395901_0774068
1229 Ga0400490_14049
1230 Ga0400489_04907
1231 Ga0436365_0332720
1232 Ga0436365_1326044
1233 Ga0436360_1043296
1234 Ga0436360_1309131
1235 Ga0436361_0340447
1236 Ga0436361_0614516
1237 Ga0436361_0648521
1238 Ga0436363_0411896
1239 Ga0436362_0660519
1240 Ga0439436_0000550
1241 Ga0439436_0007527
1242 Ga0439438_000449
1243 Ga0439439_0000054
1244 Ga0439447_027295
1245 Ga0439461_0007338
1246 Ga0439466_0001366
1247 Ga0439466_0096429
1248 Ga0439433_0000004
1249 Ga0439433_0000065
1250 Ga0439433_0000455
1251 Ga0439442_000001
1252 Ga0439442_000592
1253 Ga0439442_001300
1254 Ga0439442_003782
1255 Ga0439432_000310
1256 Ga0439449_0000405
1257 Ga0439449_0021569
1258 Ga0439449_0034103
1259 Ga0439449_0045071
1260 Ga0439452_001352
1261 Ga0439457_000956
1262 Ga0439462_0000546
1263 Ga0450919_006490
1264 Ga0450920_000059
1265 Ga0450920_000088
1266 Ga0450907_000288
1267 Ga0450907_000303
1268 Ga0450908_007264
1269 Ga0450909_005045
1270 Ga0439434_0001912
1271 Ga0439434_0007612
1272 Ga0439434_0065692
1273 Ga0450918_000190
1274 Ga0450918_000276
1275 Ga0451577_0115465
1276 Ga0466961_0000031
1277 Ga0466961_0144592
1278 Ga0453684_0681262
1279 Ga0466957_0148265
1280 Ga0466959_0006857
1281 Ga0466967_0455037
1282 Ga0495629_0105839
1283 Ga0495629_0146459
1284 Ga0495651_0033707
1285 Ga0495651_0133506
1286 Ga0495651_0310705
1287 Ga0495653_0100887
1288 Ga0495653_0253518
1289 Ga0495580_0007029
1290 Ga0495582_0035328
1291 Ga0495639_0001561
1292 Ga0495664_0017458
1293 Ga0495606_0133539
1294 Ga0495610_0070992
1295 Ga0495618_0052436
1296 Ga0495648_0003275
1297 Ga0495648_0038782
1298 Ga0495648_0125354
1299 Ga0495642_0058314
1300 Ga0495654_0003598
1301 Ga0495586_0001724
1302 Ga0495609_0049608
1303 Ga0495622_0045200
1304 Ga0495633_0103906
1305 Ga0495667_0012988
1306 Ga0495667_0118475
1307 Ga0495656_0006245
1308 Ga0495611_0038951
1309 Ga0495635_0014160
1310 Ga0495635_0334997
1311 Ga0495659_0094487
1312 Ga0495588_0007529
1313 Ga0495657_0022744
1314 Ga0495657_0114570
1315 Ga0495657_0144167
1316 Ga0495624_0100078
1317 Ga0495670_0019653
1318 Ga0495670_0042156
1319 Ga0495649_0159730
1320 Ga0495600_0028073
1321 Ga0495581_0001814
1322 Ga0495581_0332188
1323 Ga0495604_0067253
1324 Ga0495672_0042930
1325 Ga0495676_0025479
1326 Ga0495676_0116560
1327 Ga0495687_067024
1328 Ga0495686_0024664
1329 Ga0495593_0043612
1330 Ga0495593_0135443
1331 Ga0495602_0114844
1332 Ga0496100_0165962
1333 Ga0496101_0088606
1334 Ga0496101_0164366
1335 Ga0496101_0246232
1336 Ga0496102_0087221
1337 Ga0496104_0001655
1338 Ga0496104_0089347
1339 Ga0496104_0103020
1340 Ga0496104_0222781
1341 Ga0496104_0233637
1342 Ga0496104_0302389
1343 Ga0496105_0005515
1344 Ga0496105_0005541
1345 Ga0496105_0006734
1346 Ga0496105_0148645
1347 Ga0496105_0173597
1348 Ga0496106_0106773
1349 Ga0496106_0260229
1350 Ga0496106_0295160
1351 Ga0496107_0160607
1352 Ga0496108_0016877
1353 Ga0496108_0098954
1354 Ga0496108_0257780
1355 Ga0496109_0000839
1356 Ga0496109_0030558
1357 Ga0496109_0188663
1358 Ga0496110_0062499
1359 Ga0496110_0163753
1360 Ga0496110_0251492
1361 Ga0496110_0280051
1362 Ga0496111_0002183
1363 Ga0496111_0250255
1364 Ga0496112_0006565
1365 Ga0496112_0008387
1366 Ga0496112_0028066
1367 Ga0496112_0132501
1368 Ga0496112_0310113
1369 Ga0496112_0489848
1370 Ga0496112_0677012
1371 Ga0496113_0127257
1372 Ga0496113_0330406
1373 Ga0496114_0012738
1374 Ga0496114_0152926
1375 Ga0496114_0209195
1376 Ga0496115_0008711
1377 Ga0496115_0116043
1378 Ga0496115_0215468
1379 Ga0496115_0227311
1380 Ga0496115_0413961
1381 Ga0496117_0002279
1382 Ga0496117_0009546
1383 Ga0496118_0001768
1384 Ga0496118_0029332
1385 Ga0496118_0157744
1386 Ga0496120_0015101
1387 Ga0496120_0040477
1388 Ga0496120_0057834
1389 Ga0496121_0001894
1390 Ga0496121_0051754
1391 Ga0496121_0149050
1392 Ga0496122_0116193
1393 Ga0496122_0134845
1394 Ga0496123_0140427
1395 Ga0496124_0002163
1396 Ga0496124_0082047
1397 Ga0496124_0145976
1398 Ga0496124_0229791
1399 Ga0496125_0001616
1400 Ga0496125_0006808
1401 Ga0496125_0026490
1402 Ga0496126_0002472
1403 Ga0496126_0006015
1404 Ga0496126_0029998
1405 Ga0496126_0046400
1406 Ga0496126_0049326
1407 Ga0496126_0051188
1408 Ga0496126_0080635
1409 Ga0496126_0133829
1410 Ga0496126_0182643
1411 Ga0496126_0226543
1412 Ga0496126_0361984
1413 Ga0496126_0577606
1414 Ga0501031_0070033
1415 Ga0501031_0080584
1416 Ga0501032_0000942
1417 Ga0501032_0032322
1418 Ga0501032_0103963
1419 Ga0501033_0000674
1420 Ga0501034_0000016
1421 Ga0501034_0188961
1422 Ga0501034_0221677
1423 Ga0501036_0183904
1424 Ga0501036_0306332
1425 Ga0501036_0501051
1426 Ga0501036_0547516
1427 Ga0501037_0028995
1428 Ga0501037_0085794
1429 Ga0501037_0086799
1430 Ga0501037_0320393
1431 Ga0501038_0000734
1432 Ga0501038_0001529
1433 Ga0501038_0002689
1434 Ga0501038_0007103
1435 Ga0501038_0009897
1436 Ga0501038_0071307
1437 Ga0501039_0005049
1438 Ga0501039_0048339
1439 Ga0501039_0093328
1440 Ga0501039_0116890
1441 Ga0501040_0005957
1442 Ga0501043_0002923
1443 Ga0501043_0005412
1444 Ga0501043_0009885
1445 Ga0501043_0021212
1446 Ga0501043_0068354
1447 Ga0501043_0085405
1448 Ga0501043_0090913
1449 Ga0501043_0233365
1450 Ga0501046_0015018
1451 Ga0501046_0123177
1452 Ga0501047_0125601
1453 Ga0501047_0168088
1454 Ga0501047_0220179
1455 Ga0501067_0028783
1456 Ga0501068_0095443
1457 Ga0501068_0143952
1458 Ga0501069_0150479
1459 Ga0501070_0056862
1460 Ga0501070_0124978
1461 Ga0501070_0186148
1462 Ga0501071_0397088
1463 Ga0501073_0055431
1464 Ga0501073_0314435
1465 Ga0501074_0006081
1466 Ga0501074_0177916
1467 Ga0501076_0137759
1468 Ga0501077_0045550
1469 Ga0501080_0090592
1470 Ga0501080_0382764
1471 Ga0501241_001816
1472 Ga0501035_0000923
1473 Ga0501035_0001334
1474 Ga0501035_0068669
1475 Ga0501035_0084849
1476 Ga0501035_0089026
1477 Ga0501035_0189732
1478 Ga0501044_0004565
1479 Ga0501044_0009412
1480 Ga0501044_0040327
1481 Ga0501044_0046543
1482 Ga0501044_0059545
1483 Ga0501044_0563983
1484 Ga0501045_0006283
1485 nmdc:mga03683_91143_c1
1486 nmdc:mga03n38_106558_c1
1487 nmdc:mga00v17_77369_c1
1488 nmdc:mga0yw44_21036_c1
1489 nmdc:mga0yw44_2394_c1
1490 nmdc:mga06z11_39335_c1
1491 nmdc:mga07m45_15067_c1
1492 nmdc:mga05p37_200732_c1
1493 nmdc:mga05p37_61463_c1
1494 nmdc:mga06r32_353259_c1
1495 nmdc:mga08y16_366531_c1
1496 nmdc:mga08y16_421001_c1
1497 nmdc:mga0n895_324180_c1
1498 nmdc:mga0sz30_3128_c1
1499 nmdc:mga0sz30_5801_c1
1500 nmdc:mga0sz30_72902_c1
1501 Ga0495601_0036166
1502 Ga0495601_0105267
1503 Ga0495612_0008841
1504 Ga0495612_0035130
1505 Ga0500610_0076759
1506 Ga0495595_0002902
1507 Ga0495595_0043060
1508 Ga0495619_0117982
1509 Ga0500578_0079887
1510 Ga0500643_000095
1511 Ga0500583_0052936
1512 Ga0500651_0035325
1513 Ga0500641_0008907
1514 Ga0500555_017169
1515 Ga0500595_012476
1516 Ga0500607_058153
1517 Ga0500608_115434
1518 Ga0500614_008701
1519 Ga0500614_034190
1520 Ga0500642_0010458
1521 Ga0500559_0012469
1522 Ga0500564_082438
1523 Ga0500568_0023347
1524 Ga0500573_0030414
1525 Ga0500604_0061893
1526 Ga0500619_004398
1527 Ga0500627_0001129
1528 Ga0500638_042127
1529 Ga0500636_0000807
1530 Ga0500567_134688
1531 Ga0500601_000088
1532 Ga0501084_0178750
1533 Ga0587084_010320
1534 Ga0587070_015401
1535 Ga0587073_0022347
1536 Ga0587090_012339
1537 Ga0587106_001284
1538 Ga0587128_022202
1539 Ga0587079_018512
1540 2508541012
1541 2511280734
1542 2511399978
1543 2513641537
1544 2513653891
1545 2513674563
1546 2513679857
1547 2513692964
1548 2513704000
1549 2513856325
1550 2513890118
1551 2513918231
1552 2514014923
1553 2517891539
1554 2524463711
1555 2524471089
1556 2524538696
1557 2528857566
1558 2617349927
1559 2681996400
1560 2691514560
1561 2728754874
1562 2738674403
1563 2738752796
1564 2738861837
1565 2753856736
1566 2775655114
1567 2784471651
1568 2793066902
1569 2807410759
1570 2807459100
1571 2808827658
1572 2808853013
1573 2808878483
1574 2808896996
1575 2808955699
1576 2812320577
1577 2838126685
1578 2840764458
1579 2841949136
1580 2841974096
1581 2842380087
1582 2849142129
1583 2857742076
1584 2857744596
1585 2874612288
1586 2874630716
1587 2885371648
1588 2885380394
1589 2885383463
1590 2885392600
1591 2885418387
1592 2889036563
1593 2891400055
1594 2893686893
1595 2894653177
1596 2903734205
1597 2903769341
1598 2903775564
1599 2904442152
1600 2904498188
1601 2904533442
1602 2904586394
1603 2904591793
1604 2904602048
1605 2904691354
1606 2904704754
1607 2904777083
1608 2904777546
1609 2905929160
1610 2906616714
1611 2906628655
1612 2906639828
1613 2906667042
1614 2908741882
1615 2908759534
1616 2908782334
1617 2910810086
1618 2919034919
1619 2919052206
1620 2919059740
1621 2919083608
1622 2919540382
1623 2922431256
1624 2927833380
1625 2928099520
1626 2932428234
1627 2932798617
1628 2932806489
1629 2932824517
1630 2933421072
1631 2935633854
1632 2935684392
1633 2935804870
1634 2935888672
1635 2935964860
1636 2939598633
1637 2939648637
1638 2939675309
1639 2941510843
1640 2941518227
1641 2941526902
1642 2941536532
1643 2945921375
1644 2945942436
1645 2946038381
1646 2946062179
1647 2974306368
1648 2984582101
1649 2990046252
1650 3001120388
1651 3001890798
1652 3002142754
1653 3005481053
1654 3005485246
1655 3005601021
1656 3005723789
1657 8006929577
1658 8006939658
1659 8006979407
1660 8006997275
1661 8019565550
1662 8019575646
1663 8019580386
1664 8019588111
1665 8019615302
1666 8019647930
1667 8056125666
1668 8056135155
1669 8056676803
1670 8056685695
1671 8056693848
1672 8056973353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

239

0.98

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

149

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tqg-assembly1.cif.gz_D pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9938 1 289
1mp3-assembly1.cif.gz_A l89t variant of s. enterica rmla 0.9926 2 285
1iim-assembly1.cif.gz_A thymidylyltransferase complexed with ttp 0.9925 2 284
6tqg-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9922 2 289
6tqg-assembly1.cif.gz_B pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9921 2 289
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.991 2 289 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9742 2 289 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.966 1 238 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9199 1 238 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9088 1 223 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A5K1ISM2-F1-model_v4 Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) 1.006 1 80 GO:0008879
GO:0045226
AF-A0A351VA12-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.004 1 112 GO:0008879
GO:0045226
AF-K1TIU2-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.004 1 98 GO:0008879
GO:0045226
AF-A0A561DDF8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.003 1 138 GO:0008879
GO:0045226
AF-A0A3D6A514-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.003 2 102 GO:0008879
GO:0045226

Map