F482895
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 301 | 1672 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0002486|Ga0395905_0002486_17458_18954 |
| Length | 498 |
| Sequence | MTRALQSHWQLINAFQIRGTGIAGNASTVPSQERRKARRTLKGDKMSKFRKLLGTLYVQVLMAVTAGIALGMLYPQLGTEFKPLGDGFIKLIKMVFAPVIFATVVLGIAKLENMKDLGRIGLRALIYFEVMSTFALALGLLTVNLLAPGAGMNIDPHALDAKSIASYTAVAKHDSFTGFLLQMIPVSVVDALARNEILQILLFSILFGVALARMGKRAEPVVHFLDAFSHSMFVIVGMIMRIAPLAAFGAMAFTVGKYGFGSIASLAKLMGAMYLTCFLFVAVVLGAIARLSGFSLWKFLKYMREEIFTVLGTCSSESVLPQMIGKLERVGCSKSVVGLVVPSGLTFNPDGQCIYYTMAAIFIAQATNTPLSLADQLIVLSVLMLTSKGSAGVTGAGFITLAATLASLGKIPVEGMVLLLGVDRFMSEARSITNTIGNAVGTMAIARWVGAMDVKKVQAVLNGEAGEQNSLVDDDAAAGRHAVPAALIDAAGAGQRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 47 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 48 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 108 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 109 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 114 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 115 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 116 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 117 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 118 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 119 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 120 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 121 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 122 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 237 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 250 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 251 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 252 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 253 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 254 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 255 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 256 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 257 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 258 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 259 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 260 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 261 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 262 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 263 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 264 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 265 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 266 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 267 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 268 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 269 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 270 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 271 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 272 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 273 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 274 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 275 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 276 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 277 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 278 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 279 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 280 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 281 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 282 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 283 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 284 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 285 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 286 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 287 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 288 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 289 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 290 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 291 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 292 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 293 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 294 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 295 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 296 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 297 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 298 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 299 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 300 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 301 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.54 |
| Metatranscriptomes | 0 |
| Isolates | 6.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.74 |
| Nodule | 2.39 |
| Rhizoplane | 2.87 |
| Rhizosphere | 79.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0002486 | 3300037471 | Bacteria | 20390 |
| 2 | MRS2a_Contig_5159 | 2124908027 | Bacteria | 5101 |
| 3 | MRS2a_Contig_9283 | 2124908027 | Bacteria | 3194 |
| 4 | SwRhRL2b_contig_833017 | 2162886007 | Bacteria | 2240 |
| 5 | JGI25156J39149_1003941 | 3300002705 | Bacteria | 4692 |
| 6 | JGI25159J45721_1001342 | 3300002987 | Bacteria | 10334 |
| 7 | Ga0055542_1007504 | 3300003762 | Bacteria | 2210 |
| 8 | Ga0055526_1001553 | 3300003771 | Bacteria | 16245 |
| 9 | Ga0055537_1000681 | 3300003773 | Bacteria | 17864 |
| 10 | Ga0055524_1005422 | 3300003775 | Bacteria | 5697 |
| 11 | Ga0055536_1000182 | 3300003781 | Bacteria | 52228 |
| 12 | Ga0055534_1000217 | 3300003784 | Bacteria | 42503 |
| 13 | Ga0055528_1000042 | 3300003790 | Bacteria | 104874 |
| 14 | Ga0055530_10000448 | 3300003791 | Bacteria | 36611 |
| 15 | Ga0055530_10000530 | 3300003791 | Bacteria | 33133 |
| 16 | Ga0055540_1000122 | 3300003792 | Bacteria | 81293 |
| 17 | Ga0055540_1000268 | 3300003792 | Bacteria | 47109 |
| 18 | Ga0055531_10000146 | 3300003794 | Bacteria | 81289 |
| 19 | Ga0055531_10006153 | 3300003794 | Bacteria | 6867 |
| 20 | Ga0065165_1000003 | 3300005262 | Bacteria | 390701 |
| 21 | Ga0065714_10000224 | 3300005288 | Bacteria | 7203 |
| 22 | Ga0065714_10005580 | 3300005288 | Bacteria | 12212 |
| 23 | Ga0065714_10013504 | 3300005288 | Bacteria | 1685 |
| 24 | Ga0065714_10110444 | 3300005288 | Bacteria | 1474 |
| 25 | Ga0065704_10072267 | 3300005289 | Bacteria | 8826 |
| 26 | Ga0065704_10138532 | 3300005289 | Bacteria | 1543 |
| 27 | Ga0065704_10150087 | 3300005289 | Bacteria | 1436 |
| 28 | Ga0065712_10001997 | 3300005290 | Bacteria | 5746 |
| 29 | Ga0065715_10005821 | 3300005293 | Bacteria | 4025 |
| 30 | Ga0070670_100094055 | 3300005331 | Bacteria | 2578 |
| 31 | Ga0070677_10007750 | 3300005333 | Bacteria | 3596 |
| 32 | Ga0070661_100001945 | 3300005344 | Bacteria | 14298 |
| 33 | Ga0070659_100000661 | 3300005366 | Bacteria | 25049 |
| 34 | Ga0070711_100017338 | 3300005439 | Bacteria | 4583 |
| 35 | Ga0070678_100061527 | 3300005456 | Bacteria | 2768 |
| 36 | Ga0070707_100015628 | 3300005468 | Bacteria | 7123 |
| 37 | Ga0070698_100007295 | 3300005471 | Bacteria | 11969 |
| 38 | Ga0070699_100001621 | 3300005518 | Bacteria | 20514 |
| 39 | Ga0070699_100020221 | 3300005518 | Bacteria | 5740 |
| 40 | Ga0070697_100002273 | 3300005536 | Bacteria | 14750 |
| 41 | Ga0070672_100219094 | 3300005543 | Bacteria | 1596 |
| 42 | Ga0070665_100019759 | 3300005548 | Bacteria | 6761 |
| 43 | Ga0068855_100147412 | 3300005563 | Bacteria | 2678 |
| 44 | Ga0070664_100017134 | 3300005564 | Bacteria | 5948 |
| 45 | Ga0070702_100111858 | 3300005615 | Bacteria | 1694 |
| 46 | Ga0068866_10048037 | 3300005718 | Bacteria | 2155 |
| 47 | Ga0068862_100170975 | 3300005844 | Bacteria | 1945 |
| 48 | Ga0081455_10118157 | 3300005937 | Bacteria | 2094 |
| 49 | Ga0075363_100018233 | 3300006048 | Bacteria | 3493 |
| 50 | Ga0075364_10021278 | 3300006051 | Bacteria | 4086 |
| 51 | Ga0075432_10000482 | 3300006058 | Bacteria | 11887 |
| 52 | Ga0075432_10012718 | 3300006058 | Bacteria | 2858 |
| 53 | Ga0075432_10014249 | 3300006058 | Bacteria | 2707 |
| 54 | Ga0070712_100012323 | 3300006175 | Bacteria | 5433 |
| 55 | Ga0070712_100063180 | 3300006175 | Bacteria | 2620 |
| 56 | Ga0075362_10019042 | 3300006177 | Bacteria | 2850 |
| 57 | Ga0075362_10024797 | 3300006177 | Bacteria | 2547 |
| 58 | Ga0075370_10071870 | 3300006353 | Bacteria | 1980 |
| 59 | Ga0075433_10028589 | 3300006852 | Bacteria | 4741 |
| 60 | Ga0099823_1000050 | 3300006944 | Bacteria | 57425 |
| 61 | Ga0079104_1003077 | 3300006946 | Bacteria | 8135 |
| 62 | Ga0105251_10000038 | 3300009011 | Bacteria | 116060 |
| 63 | Ga0105251_10001289 | 3300009011 | Bacteria | 21676 |
| 64 | Ga0105251_10005569 | 3300009011 | Bacteria | 8193 |
| 65 | Ga0105251_10008986 | 3300009011 | Bacteria | 5961 |
| 66 | Ga0105251_10010858 | 3300009011 | Bacteria | 5245 |
| 67 | Ga0105251_10012159 | 3300009011 | Bacteria | 4884 |
| 68 | Ga0105251_10013841 | 3300009011 | Bacteria | 4489 |
| 69 | Ga0105251_10025412 | 3300009011 | Bacteria | 3030 |
| 70 | Ga0105251_10045898 | 3300009011 | Bacteria | 2105 |
| 71 | Ga0105244_10001385 | 3300009036 | Bacteria | 19690 |
| 72 | Ga0105244_10002330 | 3300009036 | Bacteria | 14435 |
| 73 | Ga0105244_10002532 | 3300009036 | Bacteria | 13729 |
| 74 | Ga0105244_10022447 | 3300009036 | Bacteria | 3474 |
| 75 | Ga0105250_10005563 | 3300009092 | Bacteria | 5634 |
| 76 | Ga0105250_10006860 | 3300009092 | Bacteria | 4940 |
| 77 | Ga0105250_10018807 | 3300009092 | Bacteria | 2795 |
| 78 | Ga0105240_10002844 | 3300009093 | Bacteria | 27365 |
| 79 | Ga0105247_10119196 | 3300009101 | Bacteria | 1708 |
| 80 | Ga0114129_10074287 | 3300009147 | Bacteria | 4735 |
| 81 | Ga0114129_10252369 | 3300009147 | Bacteria | 2367 |
| 82 | Ga0105243_10014635 | 3300009148 | Bacteria | 5935 |
| 83 | Ga0105248_10034171 | 3300009177 | Bacteria | 5684 |
| 84 | Ga0105237_10001202 | 3300009545 | Bacteria | 34641 |
| 85 | Ga0105238_10006297 | 3300009551 | Bacteria | 11797 |
| 86 | Ga0105249_10086282 | 3300009553 | Bacteria | 2927 |
| 87 | Ga0157345_1000146 | 3300012498 | Bacteria | 12442 |
| 88 | Ga0157371_10000595 | 3300013102 | Bacteria | 43057 |
| 89 | Ga0157370_10003919 | 3300013104 | Bacteria | 17337 |
| 90 | Ga0157370_10009259 | 3300013104 | Bacteria | 10553 |
| 91 | Ga0157370_10048224 | 3300013104 | Bacteria | 4080 |
| 92 | Ga0157370_10092657 | 3300013104 | Bacteria | 2836 |
| 93 | Ga0157369_10005429 | 3300013105 | Bacteria | 14823 |
| 94 | Ga0163162_10043981 | 3300013306 | Bacteria | 4472 |
| 95 | Ga0163162_10129821 | 3300013306 | Bacteria | 2628 |
| 96 | Ga0182008_10001181 | 3300014497 | Bacteria | 18007 |
| 97 | Ga0182008_10002772 | 3300014497 | Bacteria | 10863 |
| 98 | Ga0182008_10016194 | 3300014497 | Bacteria | 3879 |
| 99 | Ga0182006_1001476 | 3300015261 | Bacteria | 14155 |
| 100 | Ga0182006_1004144 | 3300015261 | Bacteria | 7194 |
| 101 | Ga0182007_10000492 | 3300015262 | Bacteria | 23618 |
| 102 | Ga0183361_10020 | 3300016635 | Bacteria | 128627 |
| 103 | Ga0163161_10000683 | 3300017792 | Bacteria | 27101 |
| 104 | Ga0163161_10001374 | 3300017792 | Bacteria | 18049 |
| 105 | Ga0163161_10007389 | 3300017792 | Bacteria | 7589 |
| 106 | Ga0163161_10212521 | 3300017792 | Bacteria | 1495 |
| 107 | Ga0209148_1000596 | 3300025254 | Bacteria | 32631 |
| 108 | Ga0209759_1000150 | 3300025256 | Bacteria | 120839 |
| 109 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 110 | Ga0209565_1006313 | 3300025263 | Bacteria | 3338 |
| 111 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 112 | Ga0209130_1000036 | 3300025284 | Bacteria | 284111 |
| 113 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 114 | Ga0209675_1003445 | 3300025291 | Bacteria | 7520 |
| 115 | Ga0209676_1000102 | 3300025292 | Bacteria | 227372 |
| 116 | Ga0209676_1001013 | 3300025292 | Bacteria | 32853 |
| 117 | Ga0209676_1004024 | 3300025292 | Bacteria | 8467 |
| 118 | Ga0209564_1000078 | 3300025295 | Bacteria | 275766 |
| 119 | Ga0209050_1000082 | 3300025298 | Bacteria | 266864 |
| 120 | Ga0209050_1000105 | 3300025298 | Bacteria | 227285 |
| 121 | Ga0209050_1000229 | 3300025298 | Bacteria | 123110 |
| 122 | Ga0209050_1021666 | 3300025298 | Bacteria | 2335 |
| 123 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 124 | Ga0209256_1000070 | 3300025299 | Bacteria | 245034 |
| 125 | Ga0207426_1011379 | 3300025302 | Bacteria | 3393 |
| 126 | Ga0209051_1000029 | 3300025303 | Bacteria | 403675 |
| 127 | Ga0209051_1000066 | 3300025303 | Bacteria | 227369 |
| 128 | Ga0209051_1005940 | 3300025303 | Bacteria | 7001 |
| 129 | Ga0209257_1000124 | 3300025304 | Bacteria | 218195 |
| 130 | Ga0209257_1000168 | 3300025304 | Bacteria | 171312 |
| 131 | Ga0207696_1002699 | 3300025711 | Bacteria | 8495 |
| 132 | Ga0207696_1002772 | 3300025711 | Bacteria | 8335 |
| 133 | Ga0207696_1006528 | 3300025711 | Bacteria | 4691 |
| 134 | Ga0207696_1013883 | 3300025711 | Bacteria | 2782 |
| 135 | Ga0207655_1000039 | 3300025728 | Bacteria | 341249 |
| 136 | Ga0207655_1000081 | 3300025728 | Bacteria | 214272 |
| 137 | Ga0207655_1000481 | 3300025728 | Bacteria | 51474 |
| 138 | Ga0207655_1010671 | 3300025728 | Bacteria | 5554 |
| 139 | Ga0207655_1011260 | 3300025728 | Bacteria | 5339 |
| 140 | Ga0207713_1000185 | 3300025735 | Bacteria | 88697 |
| 141 | Ga0207713_1005290 | 3300025735 | Bacteria | 8119 |
| 142 | Ga0207713_1007802 | 3300025735 | Bacteria | 6245 |
| 143 | Ga0207713_1008617 | 3300025735 | Bacteria | 5846 |
| 144 | Ga0207713_1010302 | 3300025735 | Bacteria | 5187 |
| 145 | Ga0207713_1011806 | 3300025735 | Bacteria | 4717 |
| 146 | Ga0207713_1016376 | 3300025735 | Bacteria | 3763 |
| 147 | Ga0207713_1018082 | 3300025735 | Bacteria | 3502 |
| 148 | Ga0207682_10012923 | 3300025893 | Bacteria | 3256 |
| 149 | Ga0207688_10074655 | 3300025901 | Bacteria | 1929 |
| 150 | Ga0207699_10128365 | 3300025906 | Bacteria | 1650 |
| 151 | Ga0207684_10052363 | 3300025910 | Bacteria | 3464 |
| 152 | Ga0207695_10005993 | 3300025913 | Bacteria | 15896 |
| 153 | Ga0207693_10016361 | 3300025915 | Bacteria | 5929 |
| 154 | Ga0207663_10014014 | 3300025916 | Bacteria | 4377 |
| 155 | Ga0207649_10000932 | 3300025920 | Bacteria | 18406 |
| 156 | Ga0207646_10018806 | 3300025922 | Bacteria | 6435 |
| 157 | Ga0207650_10073112 | 3300025925 | Bacteria | 2582 |
| 158 | Ga0207690_10059268 | 3300025932 | Bacteria | 2593 |
| 159 | Ga0207691_10227472 | 3300025940 | Bacteria | 1616 |
| 160 | Ga0207711_10023799 | 3300025941 | Bacteria | 5127 |
| 161 | Ga0207679_10000119 | 3300025945 | Bacteria | 63967 |
| 162 | Ga0207658_10103856 | 3300025986 | Bacteria | 2232 |
| 163 | Ga0207675_100179407 | 3300026118 | Bacteria | 2027 |
| 164 | Ga0207683_10026298 | 3300026121 | Bacteria | 5023 |
| 165 | Ga0207683_10079808 | 3300026121 | Bacteria | 2902 |
| 166 | Ga0209389_1000053 | 3300027296 | Bacteria | 108874 |
| 167 | Ga0207428_10002856 | 3300027907 | Bacteria | 17129 |
| 168 | Ga0207428_10028891 | 3300027907 | Bacteria | 4602 |
| 169 | Ga0207428_10059810 | 3300027907 | Bacteria | 3020 |
| 170 | Ga0268266_10028512 | 3300028379 | Bacteria | 4745 |
| 171 | Ga0265338_10000045 | 3300028800 | Bacteria | 223264 |
| 172 | Ga0268256_1013443 | 3300030500 | Bacteria | 2480 |
| 173 | Ga0307508_10000412 | 3300031616 | Bacteria | 50808 |
| 174 | Ga0307516_10001226 | 3300031730 | Bacteria | 35691 |
| 175 | Ga0373931_0097168 | 3300035691 | Bacteria | 1651 |
| 176 | Ga0395899_0013949 | 3300037312 | Bacteria | 6137 |
| 177 | Ga0395899_0030628 | 3300037312 | Bacteria | 4045 |
| 178 | Ga0395898_0318690 | 3300037466 | Bacteria | 1483 |
| 179 | Ga0395905_0001977 | 3300037471 | Bacteria | 23435 |
| 180 | Ga0395905_0004343 | 3300037471 | Bacteria | 14758 |
| 181 | Ga0395905_0004380 | 3300037471 | Bacteria | 14691 |
| 182 | Ga0395901_0009029 | 3300038443 | Bacteria | 10091 |
| 183 | Ga0439438_003482 | 3300041405 | Bacteria | 6357 |
| 184 | Ga0439466_0015762 | 3300041411 | Bacteria | 2743 |
| 185 | Ga0439432_004223 | 3300042006 | Bacteria | 5253 |
| 186 | Ga0439452_000908 | 3300042010 | Bacteria | 13513 |
| 187 | Ga0439456_001850 | 3300042013 | Bacteria | 4278 |
| 188 | Ga0439456_013454 | 3300042013 | Bacteria | 1703 |
| 189 | Ga0439463_026169 | 3300042016 | Bacteria | 1465 |
| 190 | Ga0450900_000321 | 3300042136 | Bacteria | 3484 |
| 191 | Ga0450902_000378 | 3300042137 | Bacteria | 5453 |
| 192 | Ga0450902_000931 | 3300042137 | Bacteria | 3836 |
| 193 | Ga0439460_0001234 | 3300042461 | Bacteria | 6023 |
| 194 | Ga0450901_000007 | 3300042533 | Bacteria | 23102 |
| 195 | Ga0466969_0004219 | 3300044656 | Bacteria | 7631 |
| 196 | Ga0466966_0009874 | 3300044684 | Bacteria | 6326 |
| 197 | Ga0466961_0000231 | 3300044693 | Bacteria | 37788 |
| 198 | Ga0466961_0012714 | 3300044693 | Bacteria | 5391 |
| 199 | Ga0453684_0005886 | 3300044712 | Bacteria | 23807 |
| 200 | Ga0466970_0010298 | 3300044765 | Bacteria | 4744 |
| 201 | Ga0466960_0098242 | 3300044901 | Bacteria | 1504 |
| 202 | Ga0466959_0009421 | 3300045049 | Bacteria | 6947 |
| 203 | Ga0466959_0068996 | 3300045049 | Bacteria | 2561 |
| 204 | Ga0495617_001657 | 3300046452 | Bacteria | 9580 |
| 205 | Ga0495617_002284 | 3300046452 | Bacteria | 7755 |
| 206 | Ga0495617_003726 | 3300046452 | Bacteria | 5669 |
| 207 | Ga0495617_004023 | 3300046452 | Bacteria | 5399 |
| 208 | Ga0495617_004409 | 3300046452 | Bacteria | 5127 |
| 209 | Ga0495627_001298 | 3300046453 | Bacteria | 15265 |
| 210 | Ga0495627_005153 | 3300046453 | Bacteria | 5324 |
| 211 | Ga0495627_005868 | 3300046453 | Bacteria | 4881 |
| 212 | Ga0495627_006284 | 3300046453 | Bacteria | 4666 |
| 213 | Ga0495592_0083473 | 3300046454 | Bacteria | 2306 |
| 214 | Ga0495603_0008656 | 3300046455 | Bacteria | 6150 |
| 215 | Ga0495590_0000487 | 3300046457 | Bacteria | 19558 |
| 216 | Ga0495590_0001793 | 3300046457 | Bacteria | 9110 |
| 217 | Ga0495590_0008744 | 3300046457 | Bacteria | 3853 |
| 218 | Ga0495590_0008821 | 3300046457 | Bacteria | 3834 |
| 219 | Ga0495590_0015723 | 3300046457 | Bacteria | 2741 |
| 220 | Ga0495590_0034868 | 3300046457 | Bacteria | 1757 |
| 221 | Ga0495590_0045555 | 3300046457 | Bacteria | 1530 |
| 222 | Ga0495591_000005 | 3300046458 | Bacteria | 394092 |
| 223 | Ga0495591_000221 | 3300046458 | Bacteria | 56635 |
| 224 | Ga0495591_000356 | 3300046458 | Bacteria | 40342 |
| 225 | Ga0495591_000364 | 3300046458 | Bacteria | 39254 |
| 226 | Ga0495591_000568 | 3300046458 | Bacteria | 28319 |
| 227 | Ga0495591_000818 | 3300046458 | Bacteria | 22045 |
| 228 | Ga0495591_000985 | 3300046458 | Bacteria | 19408 |
| 229 | Ga0495591_002493 | 3300046458 | Bacteria | 10195 |
| 230 | Ga0495591_005726 | 3300046458 | Bacteria | 5669 |
| 231 | Ga0495591_005888 | 3300046458 | Bacteria | 5554 |
| 232 | Ga0495591_015832 | 3300046458 | Bacteria | 2649 |
| 233 | Ga0495591_017651 | 3300046458 | Bacteria | 2443 |
| 234 | Ga0495629_0001063 | 3300046459 | Bacteria | 21933 |
| 235 | Ga0495629_0001722 | 3300046459 | Bacteria | 17166 |
| 236 | Ga0495629_0005730 | 3300046459 | Bacteria | 9270 |
| 237 | Ga0495629_0039433 | 3300046459 | Bacteria | 3324 |
| 238 | Ga0495638_0000196 | 3300046460 | Bacteria | 87444 |
| 239 | Ga0495638_0001031 | 3300046460 | Bacteria | 27599 |
| 240 | Ga0495638_0001507 | 3300046460 | Bacteria | 20972 |
| 241 | Ga0495638_0002819 | 3300046460 | Bacteria | 13920 |
| 242 | Ga0495638_0008159 | 3300046460 | Bacteria | 7444 |
| 243 | Ga0495638_0014124 | 3300046460 | Bacteria | 5407 |
| 244 | Ga0495638_0018656 | 3300046460 | Bacteria | 4603 |
| 245 | Ga0495638_0034915 | 3300046460 | Bacteria | 3208 |
| 246 | Ga0495638_0035531 | 3300046460 | Bacteria | 3176 |
| 247 | Ga0495638_0037093 | 3300046460 | Bacteria | 3102 |
| 248 | Ga0495638_0046896 | 3300046460 | Bacteria | 2712 |
| 249 | Ga0495638_0081062 | 3300046460 | Bacteria | 1971 |
| 250 | Ga0495651_0009049 | 3300046462 | Bacteria | 7643 |
| 251 | Ga0495653_0015156 | 3300046463 | Bacteria | 6284 |
| 252 | Ga0495653_0021637 | 3300046463 | Bacteria | 5208 |
| 253 | Ga0495653_0051176 | 3300046463 | Bacteria | 3172 |
| 254 | Ga0495653_0098141 | 3300046463 | Bacteria | 2127 |
| 255 | Ga0495650_0000405 | 3300046471 | Bacteria | 71148 |
| 256 | Ga0495650_0000651 | 3300046471 | Bacteria | 45752 |
| 257 | Ga0495650_0000896 | 3300046471 | Bacteria | 35106 |
| 258 | Ga0495650_0001556 | 3300046471 | Bacteria | 21654 |
| 259 | Ga0495650_0002566 | 3300046471 | Bacteria | 14389 |
| 260 | Ga0495650_0003886 | 3300046471 | Bacteria | 10568 |
| 261 | Ga0495650_0005305 | 3300046471 | Bacteria | 8430 |
| 262 | Ga0495650_0008407 | 3300046471 | Bacteria | 6027 |
| 263 | Ga0495650_0019440 | 3300046471 | Bacteria | 3342 |
| 264 | Ga0495650_0022629 | 3300046471 | Bacteria | 3010 |
| 265 | Ga0495580_0038208 | 3300046472 | Bacteria | 3440 |
| 266 | Ga0495580_0039398 | 3300046472 | Bacteria | 3380 |
| 267 | Ga0495580_0073178 | 3300046472 | Bacteria | 2392 |
| 268 | Ga0495580_0128255 | 3300046472 | Bacteria | 1760 |
| 269 | Ga0495582_0019023 | 3300046473 | Bacteria | 3758 |
| 270 | Ga0495582_0041633 | 3300046473 | Bacteria | 2531 |
| 271 | Ga0495582_0104327 | 3300046473 | Bacteria | 1589 |
| 272 | Ga0495605_0000009 | 3300046474 | Bacteria | 324622 |
| 273 | Ga0495605_0000242 | 3300046474 | Bacteria | 64936 |
| 274 | Ga0495605_0002640 | 3300046474 | Bacteria | 10984 |
| 275 | Ga0495605_0004181 | 3300046474 | Bacteria | 8506 |
| 276 | Ga0495605_0009781 | 3300046474 | Bacteria | 5384 |
| 277 | Ga0495605_0012353 | 3300046474 | Bacteria | 4740 |
| 278 | Ga0495605_0018138 | 3300046474 | Bacteria | 3778 |
| 279 | Ga0495605_0024864 | 3300046474 | Bacteria | 3128 |
| 280 | Ga0495605_0053899 | 3300046474 | Bacteria | 1949 |
| 281 | Ga0495605_0074193 | 3300046474 | Bacteria | 1601 |
| 282 | Ga0495639_0002382 | 3300046475 | Bacteria | 8216 |
| 283 | Ga0495639_0015986 | 3300046475 | Bacteria | 3255 |
| 284 | Ga0495639_0016835 | 3300046475 | Bacteria | 3176 |
| 285 | Ga0495662_0027025 | 3300046476 | Bacteria | 2772 |
| 286 | Ga0495664_0035304 | 3300046477 | Bacteria | 2943 |
| 287 | Ga0495664_0074624 | 3300046477 | Bacteria | 2029 |
| 288 | Ga0495584_0000018 | 3300046491 | Bacteria | 142382 |
| 289 | Ga0495584_0000230 | 3300046491 | Bacteria | 40309 |
| 290 | Ga0495584_0000346 | 3300046491 | Bacteria | 32084 |
| 291 | Ga0495584_0000574 | 3300046491 | Bacteria | 24787 |
| 292 | Ga0495584_0002952 | 3300046491 | Bacteria | 9464 |
| 293 | Ga0495584_0003172 | 3300046491 | Bacteria | 9136 |
| 294 | Ga0495584_0003406 | 3300046491 | Bacteria | 8769 |
| 295 | Ga0495584_0008312 | 3300046491 | Bacteria | 5375 |
| 296 | Ga0495584_0008924 | 3300046491 | Bacteria | 5181 |
| 297 | Ga0495584_0014998 | 3300046491 | Bacteria | 3949 |
| 298 | Ga0495584_0049309 | 3300046491 | Bacteria | 2121 |
| 299 | Ga0495584_0051852 | 3300046491 | Bacteria | 2065 |
| 300 | Ga0495585_0000030 | 3300046492 | Bacteria | 145184 |
| 301 | Ga0495585_0006562 | 3300046492 | Bacteria | 7197 |
| 302 | Ga0495585_0008245 | 3300046492 | Bacteria | 6325 |
| 303 | Ga0495585_0013595 | 3300046492 | Bacteria | 4757 |
| 304 | Ga0495585_0024490 | 3300046492 | Bacteria | 3460 |
| 305 | Ga0495585_0035091 | 3300046492 | Bacteria | 2837 |
| 306 | Ga0495585_0054148 | 3300046492 | Bacteria | 2219 |
| 307 | Ga0495594_0023090 | 3300046499 | Bacteria | 3331 |
| 308 | Ga0495596_0000034 | 3300046500 | Bacteria | 100596 |
| 309 | Ga0495596_0001312 | 3300046500 | Bacteria | 14347 |
| 310 | Ga0495596_0002906 | 3300046500 | Bacteria | 8911 |
| 311 | Ga0495596_0005478 | 3300046500 | Bacteria | 5988 |
| 312 | Ga0495596_0005591 | 3300046500 | Bacteria | 5908 |
| 313 | Ga0495596_0041988 | 3300046500 | Bacteria | 1803 |
| 314 | Ga0495607_0000148 | 3300046501 | Bacteria | 73830 |
| 315 | Ga0495607_0000645 | 3300046501 | Bacteria | 33901 |
| 316 | Ga0495607_0002176 | 3300046501 | Bacteria | 16288 |
| 317 | Ga0495607_0003536 | 3300046501 | Bacteria | 11899 |
| 318 | Ga0495607_0006633 | 3300046501 | Bacteria | 8113 |
| 319 | Ga0495607_0015242 | 3300046501 | Bacteria | 4984 |
| 320 | Ga0495607_0020415 | 3300046501 | Bacteria | 4188 |
| 321 | Ga0495607_0022609 | 3300046501 | Bacteria | 3945 |
| 322 | Ga0495607_0032604 | 3300046501 | Bacteria | 3178 |
| 323 | Ga0495607_0080040 | 3300046501 | Bacteria | 1798 |
| 324 | Ga0495607_0116086 | 3300046501 | Bacteria | 1412 |
| 325 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 326 | Ga0495583_0000334 | 3300046506 | Bacteria | 74547 |
| 327 | Ga0495583_0000369 | 3300046506 | Bacteria | 70121 |
| 328 | Ga0495583_0000958 | 3300046506 | Bacteria | 33509 |
| 329 | Ga0495583_0001173 | 3300046506 | Bacteria | 28282 |
| 330 | Ga0495583_0007444 | 3300046506 | Bacteria | 6875 |
| 331 | Ga0495583_0009625 | 3300046506 | Bacteria | 5750 |
| 332 | Ga0495583_0013623 | 3300046506 | Bacteria | 4524 |
| 333 | Ga0495583_0015874 | 3300046506 | Bacteria | 4074 |
| 334 | Ga0495583_0020992 | 3300046506 | Bacteria | 3366 |
| 335 | Ga0495583_0048724 | 3300046506 | Bacteria | 1943 |
| 336 | Ga0495606_0000122 | 3300046507 | Bacteria | 132071 |
| 337 | Ga0495606_0000124 | 3300046507 | Bacteria | 130164 |
| 338 | Ga0495606_0001186 | 3300046507 | Bacteria | 36728 |
| 339 | Ga0495606_0002367 | 3300046507 | Bacteria | 22139 |
| 340 | Ga0495606_0018588 | 3300046507 | Bacteria | 5203 |
| 341 | Ga0495606_0094014 | 3300046507 | Bacteria | 1838 |
| 342 | Ga0495608_0034669 | 3300046511 | Bacteria | 3406 |
| 343 | Ga0495610_0002583 | 3300046512 | Bacteria | 15025 |
| 344 | Ga0495610_0014736 | 3300046512 | Bacteria | 4578 |
| 345 | Ga0495610_0038534 | 3300046512 | Bacteria | 2425 |
| 346 | Ga0495610_0045098 | 3300046512 | Bacteria | 2183 |
| 347 | Ga0495610_0069333 | 3300046512 | Bacteria | 1650 |
| 348 | Ga0495616_0001384 | 3300046513 | Bacteria | 16893 |
| 349 | Ga0495616_0001474 | 3300046513 | Bacteria | 16340 |
| 350 | Ga0495616_0002376 | 3300046513 | Bacteria | 12532 |
| 351 | Ga0495616_0008814 | 3300046513 | Bacteria | 5937 |
| 352 | Ga0495616_0009920 | 3300046513 | Bacteria | 5536 |
| 353 | Ga0495616_0010474 | 3300046513 | Bacteria | 5365 |
| 354 | Ga0495616_0021334 | 3300046513 | Bacteria | 3508 |
| 355 | Ga0495618_0018744 | 3300046514 | Bacteria | 4251 |
| 356 | Ga0495618_0034508 | 3300046514 | Bacteria | 3172 |
| 357 | Ga0495620_0000030 | 3300046515 | Bacteria | 122177 |
| 358 | Ga0495620_0000527 | 3300046515 | Bacteria | 24615 |
| 359 | Ga0495620_0000725 | 3300046515 | Bacteria | 20298 |
| 360 | Ga0495620_0002042 | 3300046515 | Bacteria | 11762 |
| 361 | Ga0495620_0008765 | 3300046515 | Bacteria | 5412 |
| 362 | Ga0495620_0010293 | 3300046515 | Bacteria | 4936 |
| 363 | Ga0495620_0010690 | 3300046515 | Bacteria | 4830 |
| 364 | Ga0495620_0055655 | 3300046515 | Bacteria | 1666 |
| 365 | Ga0495628_0023537 | 3300046516 | Bacteria | 5054 |
| 366 | Ga0495628_0097688 | 3300046516 | Bacteria | 2268 |
| 367 | Ga0495630_0010670 | 3300046517 | Bacteria | 6632 |
| 368 | Ga0495630_0048456 | 3300046517 | Bacteria | 3179 |
| 369 | Ga0495630_0085990 | 3300046517 | Bacteria | 2374 |
| 370 | Ga0495631_0000763 | 3300046518 | Bacteria | 20676 |
| 371 | Ga0495631_0002793 | 3300046518 | Bacteria | 9685 |
| 372 | Ga0495631_0006880 | 3300046518 | Bacteria | 5834 |
| 373 | Ga0495631_0011977 | 3300046518 | Bacteria | 4251 |
| 374 | Ga0495631_0014186 | 3300046518 | Bacteria | 3851 |
| 375 | Ga0495631_0022168 | 3300046518 | Bacteria | 2953 |
| 376 | Ga0495631_0044904 | 3300046518 | Bacteria | 1946 |
| 377 | Ga0495632_0000142 | 3300046519 | Bacteria | 73780 |
| 378 | Ga0495632_0000553 | 3300046519 | Bacteria | 34975 |
| 379 | Ga0495632_0000809 | 3300046519 | Bacteria | 27722 |
| 380 | Ga0495632_0001230 | 3300046519 | Bacteria | 21724 |
| 381 | Ga0495632_0002313 | 3300046519 | Bacteria | 14664 |
| 382 | Ga0495632_0004154 | 3300046519 | Bacteria | 9930 |
| 383 | Ga0495632_0005290 | 3300046519 | Bacteria | 8573 |
| 384 | Ga0495632_0005882 | 3300046519 | Bacteria | 8008 |
| 385 | Ga0495632_0006402 | 3300046519 | Bacteria | 7580 |
| 386 | Ga0495632_0007114 | 3300046519 | Bacteria | 7081 |
| 387 | Ga0495632_0011608 | 3300046519 | Bacteria | 5130 |
| 388 | Ga0495632_0011646 | 3300046519 | Bacteria | 5123 |
| 389 | Ga0495632_0044904 | 3300046519 | Bacteria | 2203 |
| 390 | Ga0495637_0000082 | 3300046520 | Bacteria | 73771 |
| 391 | Ga0495637_0000334 | 3300046520 | Bacteria | 36438 |
| 392 | Ga0495637_0000967 | 3300046520 | Bacteria | 18308 |
| 393 | Ga0495637_0001362 | 3300046520 | Bacteria | 14682 |
| 394 | Ga0495637_0002662 | 3300046520 | Bacteria | 9768 |
| 395 | Ga0495637_0004015 | 3300046520 | Bacteria | 7679 |
| 396 | Ga0495637_0005403 | 3300046520 | Bacteria | 6518 |
| 397 | Ga0495637_0007126 | 3300046520 | Bacteria | 5564 |
| 398 | Ga0495637_0007448 | 3300046520 | Bacteria | 5421 |
| 399 | Ga0495637_0008292 | 3300046520 | Bacteria | 5109 |
| 400 | Ga0495637_0010552 | 3300046520 | Bacteria | 4463 |
| 401 | Ga0495643_0000295 | 3300046522 | Bacteria | 70296 |
| 402 | Ga0495643_0000574 | 3300046522 | Bacteria | 45173 |
| 403 | Ga0495643_0009625 | 3300046522 | Bacteria | 5990 |
| 404 | Ga0495643_0010114 | 3300046522 | Bacteria | 5818 |
| 405 | Ga0495643_0011455 | 3300046522 | Bacteria | 5401 |
| 406 | Ga0495643_0011628 | 3300046522 | Bacteria | 5350 |
| 407 | Ga0495643_0016225 | 3300046522 | Bacteria | 4379 |
| 408 | Ga0495643_0017382 | 3300046522 | Bacteria | 4204 |
| 409 | Ga0495643_0018980 | 3300046522 | Bacteria | 3982 |
| 410 | Ga0495643_0027151 | 3300046522 | Bacteria | 3221 |
| 411 | Ga0495643_0028702 | 3300046522 | Bacteria | 3116 |
| 412 | Ga0495643_0037596 | 3300046522 | Bacteria | 2654 |
| 413 | Ga0495644_0000105 | 3300046523 | Bacteria | 39842 |
| 414 | Ga0495644_0000159 | 3300046523 | Bacteria | 32152 |
| 415 | Ga0495644_0001768 | 3300046523 | Bacteria | 8722 |
| 416 | Ga0495648_0000471 | 3300046524 | Bacteria | 43369 |
| 417 | Ga0495648_0000636 | 3300046524 | Bacteria | 37436 |
| 418 | Ga0495648_0001090 | 3300046524 | Bacteria | 27610 |
| 419 | Ga0495648_0001478 | 3300046524 | Bacteria | 22985 |
| 420 | Ga0495648_0002828 | 3300046524 | Bacteria | 15615 |
| 421 | Ga0495648_0003509 | 3300046524 | Bacteria | 13748 |
| 422 | Ga0495648_0006024 | 3300046524 | Bacteria | 9958 |
| 423 | Ga0495648_0006475 | 3300046524 | Bacteria | 9553 |
| 424 | Ga0495648_0006601 | 3300046524 | Bacteria | 9425 |
| 425 | Ga0495648_0007357 | 3300046524 | Bacteria | 8820 |
| 426 | Ga0495648_0026233 | 3300046524 | Bacteria | 3926 |
| 427 | Ga0495648_0049319 | 3300046524 | Bacteria | 2582 |
| 428 | Ga0495648_0061811 | 3300046524 | Bacteria | 2222 |
| 429 | Ga0495663_0001421 | 3300046525 | Bacteria | 7556 |
| 430 | Ga0495663_0017455 | 3300046525 | Bacteria | 2037 |
| 431 | Ga0495666_0009568 | 3300046526 | Bacteria | 4844 |
| 432 | Ga0495666_0025571 | 3300046526 | Bacteria | 2915 |
| 433 | Ga0495666_0048747 | 3300046526 | Bacteria | 2039 |
| 434 | Ga0495642_0000082 | 3300046528 | Bacteria | 55424 |
| 435 | Ga0495642_0000233 | 3300046528 | Bacteria | 31690 |
| 436 | Ga0495642_0000832 | 3300046528 | Bacteria | 14774 |
| 437 | Ga0495642_0005143 | 3300046528 | Bacteria | 5031 |
| 438 | Ga0495642_0015391 | 3300046528 | Bacteria | 2973 |
| 439 | Ga0495642_0017534 | 3300046528 | Bacteria | 2797 |
| 440 | Ga0495642_0034700 | 3300046528 | Bacteria | 2033 |
| 441 | Ga0495654_0000088 | 3300046530 | Bacteria | 104763 |
| 442 | Ga0495654_0000769 | 3300046530 | Bacteria | 24760 |
| 443 | Ga0495654_0000851 | 3300046530 | Bacteria | 23130 |
| 444 | Ga0495654_0001220 | 3300046530 | Bacteria | 18224 |
| 445 | Ga0495654_0001409 | 3300046530 | Bacteria | 16659 |
| 446 | Ga0495654_0001496 | 3300046530 | Bacteria | 15980 |
| 447 | Ga0495654_0005676 | 3300046530 | Bacteria | 7201 |
| 448 | Ga0495654_0009184 | 3300046530 | Bacteria | 5421 |
| 449 | Ga0495654_0014621 | 3300046530 | Bacteria | 4174 |
| 450 | Ga0495654_0015750 | 3300046530 | Bacteria | 4011 |
| 451 | Ga0495654_0020301 | 3300046530 | Bacteria | 3464 |
| 452 | Ga0495665_0002139 | 3300046531 | Bacteria | 10688 |
| 453 | Ga0495665_0047004 | 3300046531 | Bacteria | 2290 |
| 454 | Ga0495640_0018531 | 3300046533 | Bacteria | 5157 |
| 455 | Ga0495586_0068473 | 3300046535 | Bacteria | 1936 |
| 456 | Ga0495587_0000190 | 3300046536 | Bacteria | 45240 |
| 457 | Ga0495587_0041010 | 3300046536 | Bacteria | 2763 |
| 458 | Ga0495587_0046575 | 3300046536 | Bacteria | 2573 |
| 459 | Ga0495609_0000043 | 3300046538 | Bacteria | 166590 |
| 460 | Ga0495609_0000152 | 3300046538 | Bacteria | 71861 |
| 461 | Ga0495609_0000316 | 3300046538 | Bacteria | 43165 |
| 462 | Ga0495609_0000740 | 3300046538 | Bacteria | 24818 |
| 463 | Ga0495609_0001746 | 3300046538 | Bacteria | 13981 |
| 464 | Ga0495609_0004110 | 3300046538 | Bacteria | 8096 |
| 465 | Ga0495609_0008782 | 3300046538 | Bacteria | 4919 |
| 466 | Ga0495609_0018956 | 3300046538 | Bacteria | 3187 |
| 467 | Ga0495609_0064868 | 3300046538 | Bacteria | 1610 |
| 468 | Ga0495621_0022590 | 3300046539 | Bacteria | 2086 |
| 469 | Ga0495597_0001542 | 3300046542 | Bacteria | 16341 |
| 470 | Ga0495597_0002076 | 3300046542 | Bacteria | 13362 |
| 471 | Ga0495597_0003234 | 3300046542 | Bacteria | 9679 |
| 472 | Ga0495597_0005419 | 3300046542 | Bacteria | 6752 |
| 473 | Ga0495597_0006725 | 3300046542 | Bacteria | 5919 |
| 474 | Ga0495597_0012474 | 3300046542 | Bacteria | 4100 |
| 475 | Ga0495597_0014329 | 3300046542 | Bacteria | 3777 |
| 476 | Ga0495597_0036759 | 3300046542 | Bacteria | 2203 |
| 477 | Ga0495645_0016307 | 3300046543 | Bacteria | 5302 |
| 478 | Ga0495645_0019538 | 3300046543 | Bacteria | 4877 |
| 479 | Ga0495622_0000196 | 3300046557 | Bacteria | 47964 |
| 480 | Ga0495622_0000882 | 3300046557 | Bacteria | 16339 |
| 481 | Ga0495622_0001128 | 3300046557 | Bacteria | 13945 |
| 482 | Ga0495622_0006570 | 3300046557 | Bacteria | 5391 |
| 483 | Ga0495622_0013426 | 3300046557 | Bacteria | 3799 |
| 484 | Ga0495622_0024866 | 3300046557 | Bacteria | 2796 |
| 485 | Ga0495633_0002810 | 3300046558 | Bacteria | 12039 |
| 486 | Ga0495633_0029262 | 3300046558 | Bacteria | 2680 |
| 487 | Ga0495633_0038664 | 3300046558 | Bacteria | 2278 |
| 488 | Ga0495656_0000270 | 3300046615 | Bacteria | 18372 |
| 489 | Ga0495656_0000938 | 3300046615 | Bacteria | 9435 |
| 490 | Ga0495656_0042289 | 3300046615 | Bacteria | 1907 |
| 491 | Ga0495668_0000046 | 3300046616 | Bacteria | 224203 |
| 492 | Ga0495668_0000776 | 3300046616 | Bacteria | 37248 |
| 493 | Ga0495668_0026391 | 3300046616 | Bacteria | 3296 |
| 494 | Ga0495668_0053048 | 3300046616 | Bacteria | 2243 |
| 495 | Ga0495634_0004177 | 3300046642 | Bacteria | 11403 |
| 496 | Ga0495634_0099202 | 3300046642 | Bacteria | 1883 |
| 497 | Ga0495611_0002459 | 3300046648 | Bacteria | 8459 |
| 498 | Ga0495611_0004180 | 3300046648 | Bacteria | 6282 |
| 499 | Ga0495611_0007504 | 3300046648 | Bacteria | 4629 |
| 500 | Ga0495611_0016560 | 3300046648 | Bacteria | 3151 |
| 501 | Ga0495625_0000101 | 3300046660 | Bacteria | 139139 |
| 502 | Ga0495625_0002402 | 3300046660 | Bacteria | 20301 |
| 503 | Ga0495625_0004203 | 3300046660 | Bacteria | 13721 |
| 504 | Ga0495625_0005071 | 3300046660 | Bacteria | 12192 |
| 505 | Ga0495625_0023330 | 3300046660 | Bacteria | 4727 |
| 506 | Ga0495625_0025412 | 3300046660 | Bacteria | 4493 |
| 507 | Ga0495625_0027971 | 3300046660 | Bacteria | 4233 |
| 508 | Ga0495625_0034675 | 3300046660 | Bacteria | 3723 |
| 509 | Ga0495625_0039537 | 3300046660 | Bacteria | 3443 |
| 510 | Ga0495625_0124826 | 3300046660 | Bacteria | 1748 |
| 511 | Ga0495635_0000142 | 3300046663 | Bacteria | 43626 |
| 512 | Ga0495635_0018404 | 3300046663 | Bacteria | 4875 |
| 513 | Ga0495659_0000002 | 3300046664 | Bacteria | 176698 |
| 514 | Ga0495659_0000631 | 3300046664 | Bacteria | 12813 |
| 515 | Ga0495659_0001053 | 3300046664 | Bacteria | 9632 |
| 516 | Ga0495659_0003361 | 3300046664 | Bacteria | 5127 |
| 517 | Ga0495661_0000024 | 3300046665 | Bacteria | 188844 |
| 518 | Ga0495661_0001088 | 3300046665 | Bacteria | 23860 |
| 519 | Ga0495661_0005288 | 3300046665 | Bacteria | 9176 |
| 520 | Ga0495661_0005623 | 3300046665 | Bacteria | 8893 |
| 521 | Ga0495661_0011271 | 3300046665 | Bacteria | 6068 |
| 522 | Ga0495661_0012444 | 3300046665 | Bacteria | 5744 |
| 523 | Ga0495661_0012690 | 3300046665 | Bacteria | 5687 |
| 524 | Ga0495661_0022767 | 3300046665 | Bacteria | 4073 |
| 525 | Ga0495661_0027126 | 3300046665 | Bacteria | 3678 |
| 526 | Ga0495661_0030785 | 3300046665 | Bacteria | 3414 |
| 527 | Ga0495661_0071194 | 3300046665 | Bacteria | 2032 |
| 528 | Ga0495588_0009372 | 3300046674 | Bacteria | 4523 |
| 529 | Ga0495588_0027584 | 3300046674 | Bacteria | 2838 |
| 530 | Ga0495588_0035263 | 3300046674 | Bacteria | 2534 |
| 531 | Ga0495588_0063760 | 3300046674 | Bacteria | 1911 |
| 532 | Ga0495588_0076377 | 3300046674 | Bacteria | 1746 |
| 533 | Ga0495599_0010719 | 3300046678 | Bacteria | 5613 |
| 534 | Ga0495623_0003295 | 3300046679 | Bacteria | 10663 |
| 535 | Ga0495623_0005249 | 3300046679 | Bacteria | 8494 |
| 536 | Ga0495646_0027993 | 3300046680 | Bacteria | 3532 |
| 537 | Ga0495646_0081796 | 3300046680 | Bacteria | 1880 |
| 538 | Ga0495669_0003122 | 3300046684 | Bacteria | 6815 |
| 539 | Ga0495669_0013821 | 3300046684 | Bacteria | 3446 |
| 540 | Ga0495669_0014277 | 3300046684 | Bacteria | 3397 |
| 541 | Ga0495669_0052350 | 3300046684 | Bacteria | 1834 |
| 542 | Ga0495613_0031426 | 3300046689 | Bacteria | 3944 |
| 543 | Ga0495613_0128361 | 3300046689 | Bacteria | 1816 |
| 544 | Ga0495624_0001964 | 3300046690 | Bacteria | 15647 |
| 545 | Ga0495624_0005770 | 3300046690 | Bacteria | 8869 |
| 546 | Ga0495624_0088120 | 3300046690 | Bacteria | 1916 |
| 547 | Ga0495670_0013957 | 3300046691 | Bacteria | 3951 |
| 548 | Ga0495670_0035319 | 3300046691 | Bacteria | 2491 |
| 549 | Ga0495670_0082544 | 3300046691 | Bacteria | 1639 |
| 550 | Ga0495671_0000320 | 3300046692 | Bacteria | 40570 |
| 551 | Ga0495671_0000382 | 3300046692 | Bacteria | 36493 |
| 552 | Ga0495671_0000685 | 3300046692 | Bacteria | 24518 |
| 553 | Ga0495671_0000709 | 3300046692 | Bacteria | 24153 |
| 554 | Ga0495671_0004586 | 3300046692 | Bacteria | 8223 |
| 555 | Ga0495671_0008151 | 3300046692 | Bacteria | 5911 |
| 556 | Ga0495671_0018981 | 3300046692 | Bacteria | 3641 |
| 557 | Ga0495671_0031071 | 3300046692 | Bacteria | 2731 |
| 558 | Ga0495671_0044785 | 3300046692 | Bacteria | 2217 |
| 559 | Ga0495671_0044883 | 3300046692 | Bacteria | 2214 |
| 560 | Ga0495671_0078271 | 3300046692 | Bacteria | 1621 |
| 561 | Ga0495649_0000070 | 3300046694 | Bacteria | 89578 |
| 562 | Ga0495649_0000109 | 3300046694 | Bacteria | 72797 |
| 563 | Ga0495649_0000154 | 3300046694 | Bacteria | 60553 |
| 564 | Ga0495649_0001866 | 3300046694 | Bacteria | 15420 |
| 565 | Ga0495649_0017726 | 3300046694 | Bacteria | 4015 |
| 566 | Ga0495649_0042263 | 3300046694 | Bacteria | 2490 |
| 567 | Ga0495649_0045070 | 3300046694 | Bacteria | 2406 |
| 568 | Ga0495649_0050734 | 3300046694 | Bacteria | 2250 |
| 569 | Ga0495649_0099301 | 3300046694 | Bacteria | 1548 |
| 570 | Ga0495589_0000544 | 3300046794 | Bacteria | 26230 |
| 571 | Ga0495589_0007180 | 3300046794 | Bacteria | 5834 |
| 572 | Ga0495589_0014021 | 3300046794 | Bacteria | 4132 |
| 573 | Ga0495589_0016374 | 3300046794 | Bacteria | 3811 |
| 574 | Ga0495589_0042562 | 3300046794 | Bacteria | 2263 |
| 575 | Ga0495600_0009629 | 3300046809 | Bacteria | 5972 |
| 576 | Ga0495600_0036526 | 3300046809 | Bacteria | 3193 |
| 577 | Ga0495660_0000439 | 3300046810 | Bacteria | 34751 |
| 578 | Ga0495660_0001321 | 3300046810 | Bacteria | 17107 |
| 579 | Ga0495660_0002216 | 3300046810 | Bacteria | 12514 |
| 580 | Ga0495660_0004536 | 3300046810 | Bacteria | 8392 |
| 581 | Ga0495660_0006045 | 3300046810 | Bacteria | 7188 |
| 582 | Ga0495660_0006734 | 3300046810 | Bacteria | 6783 |
| 583 | Ga0495660_0012857 | 3300046810 | Bacteria | 4854 |
| 584 | Ga0495660_0021199 | 3300046810 | Bacteria | 3722 |
| 585 | Ga0495660_0022681 | 3300046810 | Bacteria | 3582 |
| 586 | Ga0495660_0026140 | 3300046810 | Bacteria | 3311 |
| 587 | Ga0495660_0041343 | 3300046810 | Bacteria | 2553 |
| 588 | Ga0495660_0065211 | 3300046810 | Bacteria | 1944 |
| 589 | Ga0495581_0005793 | 3300047315 | Bacteria | 7163 |
| 590 | Ga0495581_0027914 | 3300047315 | Bacteria | 3274 |
| 591 | Ga0495581_0083295 | 3300047315 | Bacteria | 1852 |
| 592 | Ga0495636_0004096 | 3300047318 | Bacteria | 5702 |
| 593 | Ga0495674_0010514 | 3300047319 | Bacteria | 8758 |
| 594 | Ga0495674_0025381 | 3300047319 | Bacteria | 5434 |
| 595 | Ga0495674_0122549 | 3300047319 | Bacteria | 2195 |
| 596 | Ga0495674_0130906 | 3300047319 | Bacteria | 2113 |
| 597 | Ga0495672_0000019 | 3300047320 | Bacteria | 448153 |
| 598 | Ga0495672_0002352 | 3300047320 | Bacteria | 17472 |
| 599 | Ga0495672_0003138 | 3300047320 | Bacteria | 14382 |
| 600 | Ga0495672_0003442 | 3300047320 | Bacteria | 13546 |
| 601 | Ga0495672_0003897 | 3300047320 | Bacteria | 12520 |
| 602 | Ga0495672_0004223 | 3300047320 | Bacteria | 11879 |
| 603 | Ga0495672_0005450 | 3300047320 | Bacteria | 10092 |
| 604 | Ga0495672_0005476 | 3300047320 | Bacteria | 10063 |
| 605 | Ga0495672_0006544 | 3300047320 | Bacteria | 8981 |
| 606 | Ga0495672_0012133 | 3300047320 | Bacteria | 6031 |
| 607 | Ga0495676_0000071 | 3300047321 | Bacteria | 76592 |
| 608 | Ga0495676_0021777 | 3300047321 | Bacteria | 5590 |
| 609 | Ga0495676_0026082 | 3300047321 | Bacteria | 5035 |
| 610 | Ga0495676_0075195 | 3300047321 | Bacteria | 2584 |
| 611 | Ga0495680_0027706 | 3300047322 | Bacteria | 4650 |
| 612 | Ga0495680_0048836 | 3300047322 | Bacteria | 3320 |
| 613 | Ga0495680_0193925 | 3300047322 | Bacteria | 1460 |
| 614 | Ga0495683_0000022 | 3300047323 | Bacteria | 163268 |
| 615 | Ga0495683_0000567 | 3300047323 | Bacteria | 27911 |
| 616 | Ga0495683_0001855 | 3300047323 | Bacteria | 13261 |
| 617 | Ga0495683_0008036 | 3300047323 | Bacteria | 5663 |
| 618 | Ga0495683_0016340 | 3300047323 | Bacteria | 3855 |
| 619 | Ga0495683_0020129 | 3300047323 | Bacteria | 3443 |
| 620 | Ga0495687_003024 | 3300047443 | Bacteria | 12659 |
| 621 | Ga0495687_004710 | 3300047443 | Bacteria | 9045 |
| 622 | Ga0495687_008369 | 3300047443 | Bacteria | 5925 |
| 623 | Ga0495687_015375 | 3300047443 | Bacteria | 3896 |
| 624 | Ga0495687_022935 | 3300047443 | Bacteria | 2989 |
| 625 | Ga0495687_023190 | 3300047443 | Bacteria | 2968 |
| 626 | Ga0495675_0003662 | 3300047444 | Bacteria | 9287 |
| 627 | Ga0495675_0083742 | 3300047444 | Bacteria | 2007 |
| 628 | Ga0495677_0000486 | 3300047445 | Bacteria | 16837 |
| 629 | Ga0495677_0024984 | 3300047445 | Bacteria | 2167 |
| 630 | Ga0495679_000026 | 3300047446 | Bacteria | 196639 |
| 631 | Ga0495679_000245 | 3300047446 | Bacteria | 45040 |
| 632 | Ga0495679_001065 | 3300047446 | Bacteria | 16654 |
| 633 | Ga0495679_002264 | 3300047446 | Bacteria | 9936 |
| 634 | Ga0495679_002411 | 3300047446 | Bacteria | 9543 |
| 635 | Ga0495679_013512 | 3300047446 | Bacteria | 3061 |
| 636 | Ga0495679_022733 | 3300047446 | Bacteria | 2141 |
| 637 | Ga0495679_031362 | 3300047446 | Bacteria | 1715 |
| 638 | Ga0495685_005730 | 3300047447 | Bacteria | 4055 |
| 639 | Ga0495673_0000335 | 3300047469 | Bacteria | 60281 |
| 640 | Ga0495673_0000515 | 3300047469 | Bacteria | 40877 |
| 641 | Ga0495673_0000624 | 3300047469 | Bacteria | 34803 |
| 642 | Ga0495673_0001677 | 3300047469 | Bacteria | 17028 |
| 643 | Ga0495673_0001908 | 3300047469 | Bacteria | 15577 |
| 644 | Ga0495673_0002358 | 3300047469 | Bacteria | 13408 |
| 645 | Ga0495673_0002378 | 3300047469 | Bacteria | 13338 |
| 646 | Ga0495673_0002456 | 3300047469 | Bacteria | 13029 |
| 647 | Ga0495673_0007801 | 3300047469 | Bacteria | 6096 |
| 648 | Ga0495673_0010315 | 3300047469 | Bacteria | 5090 |
| 649 | Ga0495673_0012572 | 3300047469 | Bacteria | 4481 |
| 650 | Ga0495681_0000848 | 3300047470 | Bacteria | 23547 |
| 651 | Ga0495681_0001618 | 3300047470 | Bacteria | 16747 |
| 652 | Ga0495681_0004850 | 3300047470 | Bacteria | 9097 |
| 653 | Ga0495681_0007520 | 3300047470 | Bacteria | 6941 |
| 654 | Ga0495681_0008059 | 3300047470 | Bacteria | 6637 |
| 655 | Ga0495681_0009962 | 3300047470 | Bacteria | 5796 |
| 656 | Ga0495681_0016898 | 3300047470 | Bacteria | 4069 |
| 657 | Ga0495681_0030346 | 3300047470 | Bacteria | 2753 |
| 658 | Ga0495681_0033611 | 3300047470 | Bacteria | 2566 |
| 659 | Ga0495684_0112059 | 3300047471 | Bacteria | 2058 |
| 660 | Ga0495686_0000810 | 3300047472 | Bacteria | 40514 |
| 661 | Ga0495686_0000830 | 3300047472 | Bacteria | 39724 |
| 662 | Ga0495686_0001886 | 3300047472 | Bacteria | 20962 |
| 663 | Ga0495686_0002373 | 3300047472 | Bacteria | 17940 |
| 664 | Ga0495686_0002910 | 3300047472 | Bacteria | 15372 |
| 665 | Ga0495686_0014653 | 3300047472 | Bacteria | 5391 |
| 666 | Ga0495686_0050290 | 3300047472 | Bacteria | 2619 |
| 667 | Ga0495686_0080677 | 3300047472 | Bacteria | 1988 |
| 668 | Ga0495593_0000777 | 3300047673 | Bacteria | 18553 |
| 669 | Ga0495593_0007037 | 3300047673 | Bacteria | 6597 |
| 670 | Ga0495593_0012534 | 3300047673 | Bacteria | 4845 |
| 671 | Ga0495593_0034328 | 3300047673 | Bacteria | 2759 |
| 672 | Ga0495602_0058452 | 3300048088 | Bacteria | 3374 |
| 673 | Ga0495602_0074043 | 3300048088 | Bacteria | 2896 |
| 674 | Ga0495614_0014589 | 3300048089 | Bacteria | 3436 |
| 675 | Ga0495626_0000045 | 3300048091 | Bacteria | 164931 |
| 676 | Ga0495626_0000404 | 3300048091 | Bacteria | 44168 |
| 677 | Ga0495626_0000557 | 3300048091 | Bacteria | 36990 |
| 678 | Ga0495626_0001583 | 3300048091 | Bacteria | 17798 |
| 679 | Ga0495626_0001856 | 3300048091 | Bacteria | 15851 |
| 680 | Ga0495626_0007726 | 3300048091 | Bacteria | 5960 |
| 681 | Ga0495626_0007943 | 3300048091 | Bacteria | 5867 |
| 682 | Ga0495626_0008917 | 3300048091 | Bacteria | 5445 |
| 683 | Ga0495626_0014377 | 3300048091 | Bacteria | 4087 |
| 684 | Ga0495626_0040397 | 3300048091 | Bacteria | 2203 |
| 685 | Ga0496101_0002463 | 3300048904 | Bacteria | 11371 |
| 686 | Ga0496102_0004705 | 3300048905 | Bacteria | 11552 |
| 687 | Ga0496102_0034265 | 3300048905 | Bacteria | 4566 |
| 688 | Ga0496102_0196930 | 3300048905 | Bacteria | 1899 |
| 689 | Ga0496103_0003613 | 3300048906 | Bacteria | 9436 |
| 690 | Ga0496103_0025506 | 3300048906 | Bacteria | 3573 |
| 691 | Ga0496103_0050216 | 3300048906 | Bacteria | 2580 |
| 692 | Ga0496104_0104823 | 3300048907 | Bacteria | 2710 |
| 693 | Ga0496106_0000334 | 3300048909 | Bacteria | 33088 |
| 694 | Ga0496106_0005269 | 3300048909 | Bacteria | 9582 |
| 695 | Ga0496108_0095964 | 3300048911 | Bacteria | 2525 |
| 696 | Ga0496110_0000528 | 3300048913 | Bacteria | 25966 |
| 697 | Ga0496110_0004994 | 3300048913 | Bacteria | 10363 |
| 698 | Ga0496110_0030047 | 3300048913 | Bacteria | 4682 |
| 699 | Ga0496110_0043143 | 3300048913 | Bacteria | 3938 |
| 700 | Ga0496110_0112623 | 3300048913 | Bacteria | 2446 |
| 701 | Ga0496111_0011297 | 3300048914 | Bacteria | 6010 |
| 702 | Ga0496111_0026196 | 3300048914 | Bacteria | 4117 |
| 703 | Ga0496114_0243720 | 3300048917 | Bacteria | 1581 |
| 704 | Ga0496115_0042311 | 3300048918 | Bacteria | 3629 |
| 705 | Ga0496115_0112140 | 3300048918 | Bacteria | 2241 |
| 706 | Ga0496116_0002307 | 3300048919 | Bacteria | 20229 |
| 707 | Ga0496116_0017805 | 3300048919 | Bacteria | 5501 |
| 708 | Ga0496116_0024960 | 3300048919 | Bacteria | 4405 |
| 709 | Ga0496116_0060550 | 3300048919 | Bacteria | 2455 |
| 710 | Ga0496117_0003820 | 3300048920 | Bacteria | 17135 |
| 711 | Ga0496117_0006264 | 3300048920 | Bacteria | 12124 |
| 712 | Ga0496117_0006817 | 3300048920 | Bacteria | 11373 |
| 713 | Ga0496117_0022739 | 3300048920 | Bacteria | 5021 |
| 714 | Ga0496117_0024924 | 3300048920 | Bacteria | 4712 |
| 715 | Ga0496117_0028759 | 3300048920 | Bacteria | 4298 |
| 716 | Ga0496118_0000230 | 3300048921 | Bacteria | 98002 |
| 717 | Ga0496118_0000401 | 3300048921 | Bacteria | 73186 |
| 718 | Ga0496118_0006350 | 3300048921 | Bacteria | 13041 |
| 719 | Ga0496118_0018841 | 3300048921 | Bacteria | 6197 |
| 720 | Ga0496118_0026196 | 3300048921 | Bacteria | 4973 |
| 721 | Ga0496118_0030839 | 3300048921 | Bacteria | 4462 |
| 722 | Ga0496118_0050612 | 3300048921 | Bacteria | 3186 |
| 723 | Ga0496121_0001999 | 3300048924 | Bacteria | 32384 |
| 724 | Ga0496121_0003905 | 3300048924 | Bacteria | 20690 |
| 725 | Ga0496121_0004910 | 3300048924 | Bacteria | 17550 |
| 726 | Ga0496121_0011463 | 3300048924 | Bacteria | 9841 |
| 727 | Ga0496121_0017091 | 3300048924 | Bacteria | 7437 |
| 728 | Ga0496121_0030946 | 3300048924 | Bacteria | 4904 |
| 729 | Ga0496122_0001375 | 3300048925 | Bacteria | 39555 |
| 730 | Ga0496122_0002525 | 3300048925 | Bacteria | 25773 |
| 731 | Ga0496122_0004000 | 3300048925 | Bacteria | 18790 |
| 732 | Ga0496122_0006573 | 3300048925 | Bacteria | 13282 |
| 733 | Ga0496122_0011884 | 3300048925 | Bacteria | 8748 |
| 734 | Ga0496122_0093366 | 3300048925 | Bacteria | 2041 |
| 735 | Ga0496123_0000136 | 3300048926 | Bacteria | 152399 |
| 736 | Ga0496123_0001404 | 3300048926 | Bacteria | 33675 |
| 737 | Ga0496123_0002971 | 3300048926 | Bacteria | 19729 |
| 738 | Ga0496123_0030793 | 3300048926 | Bacteria | 3920 |
| 739 | Ga0496124_0000833 | 3300048927 | Bacteria | 50309 |
| 740 | Ga0496124_0001990 | 3300048927 | Bacteria | 27859 |
| 741 | Ga0496124_0004093 | 3300048927 | Bacteria | 17250 |
| 742 | Ga0496124_0004248 | 3300048927 | Bacteria | 16859 |
| 743 | Ga0496124_0005069 | 3300048927 | Bacteria | 15029 |
| 744 | Ga0496124_0010435 | 3300048927 | Bacteria | 9402 |
| 745 | Ga0496124_0017286 | 3300048927 | Bacteria | 6802 |
| 746 | Ga0496124_0020549 | 3300048927 | Bacteria | 6097 |
| 747 | Ga0496124_0023182 | 3300048927 | Bacteria | 5672 |
| 748 | Ga0496124_0059115 | 3300048927 | Bacteria | 3221 |
| 749 | Ga0496125_0000196 | 3300048928 | Bacteria | 129294 |
| 750 | Ga0496125_0009441 | 3300048928 | Bacteria | 10017 |
| 751 | Ga0496125_0018244 | 3300048928 | Bacteria | 6669 |
| 752 | Ga0496125_0021777 | 3300048928 | Bacteria | 5964 |
| 753 | Ga0496125_0041095 | 3300048928 | Bacteria | 3957 |
| 754 | Ga0496126_0000389 | 3300048929 | Bacteria | 90452 |
| 755 | Ga0496126_0004363 | 3300048929 | Bacteria | 16963 |
| 756 | Ga0496126_0055196 | 3300048929 | Bacteria | 3595 |
| 757 | Ga0495678_000377 | 3300049459 | Bacteria | 45250 |
| 758 | Ga0495678_000796 | 3300049459 | Bacteria | 28272 |
| 759 | Ga0495678_002564 | 3300049459 | Bacteria | 12171 |
| 760 | Ga0495678_003056 | 3300049459 | Bacteria | 10627 |
| 761 | Ga0495678_003232 | 3300049459 | Bacteria | 10216 |
| 762 | Ga0495678_007973 | 3300049459 | Bacteria | 5417 |
| 763 | Ga0495678_009748 | 3300049459 | Bacteria | 4719 |
| 764 | Ga0495678_020220 | 3300049459 | Bacteria | 2952 |
| 765 | Ga0495678_023239 | 3300049459 | Bacteria | 2699 |
| 766 | Ga0495682_0000254 | 3300049460 | Bacteria | 42240 |
| 767 | Ga0495682_0001072 | 3300049460 | Bacteria | 16087 |
| 768 | Ga0495682_0001744 | 3300049460 | Bacteria | 11018 |
| 769 | Ga0495682_0001966 | 3300049460 | Bacteria | 10169 |
| 770 | Ga0495682_0008401 | 3300049460 | Bacteria | 4065 |
| 771 | Ga0495682_0010297 | 3300049460 | Bacteria | 3624 |
| 772 | Ga0495682_0025336 | 3300049460 | Bacteria | 2208 |
| 773 | Ga0495682_0035028 | 3300049460 | Bacteria | 1850 |
| 774 | nmdc:mga03683_23668_c1 | 3300050489 | Bacteria | 2395 |
| 775 | nmdc:mga00v17_45122_c1 | 3300050491 | Bacteria | 2662 |
| 776 | nmdc:mga07m45_24184_c1 | 3300050496 | Bacteria | 3326 |
| 777 | nmdc:mga05p37_163394_c1 | 3300050507 | Bacteria | 2718 |
| 778 | nmdc:mga05p37_274862_c1 | 3300050507 | Bacteria | 2012 |
| 779 | nmdc:mga0n895_42228_c1 | 3300050512 | Bacteria | 4436 |
| 780 | nmdc:mga0a205_70917_c1 | 3300050515 | Bacteria | 3365 |
| 781 | Ga0500659_0003317 | 3300053135 | Bacteria | 9467 |
| 782 | Ga0500634_0006669 | 3300053161 | Bacteria | 5610 |
| 783 | 2510281473 | 2510065053 | Bacteria | 5005518 |
| 784 | 2510282296 | 2510065053 | Bacteria | 5005518 |
| 785 | 2510291519 | 2510065055 | Bacteria | 5037935 |
| 786 | 2510292358 | 2510065055 | Bacteria | 5037935 |
| 787 | 2510309621 | 2510065058 | Bacteria | 5005894 |
| 788 | 2510310444 | 2510065058 | Bacteria | 5005894 |
| 789 | 2511253422 | 2511231004 | Bacteria | 6669789 |
| 790 | 2511265102 | 2511231006 | Bacteria | 6794709 |
| 791 | 2511270382 | 2511231007 | Bacteria | 6306603 |
| 792 | 2511300773 | 2511231012 | Bacteria | 6738011 |
| 793 | 2511312450 | 2511231014 | Bacteria | 6462302 |
| 794 | 2511323346 | 2511231015 | Bacteria | 6598026 |
| 795 | 2511324026 | 2511231016 | Bacteria | 6704427 |
| 796 | 2511331219 | 2511231017 | Bacteria | 6503007 |
| 797 | 2511351051 | 2511231020 | Bacteria | 6115223 |
| 798 | 2511357718 | 2511231021 | Bacteria | 7302637 |
| 799 | 2511366315 | 2511231022 | Bacteria | 6719296 |
| 800 | 2511415758 | 2511231031 | Bacteria | 6558529 |
| 801 | 2512345958 | 2512047030 | Bacteria | 9031815 |
| 802 | 2515689307 | 2515154123 | Bacteria | 6387382 |
| 803 | 2516018686 | 2515154189 | Bacteria | 9629850 |
| 804 | 2601796037 | 2600255318 | Bacteria | 6383414 |
| 805 | 2606075111 | 2603880185 | Bacteria | 6379190 |
| 806 | 2606127974 | 2603880199 | Bacteria | 6377649 |
| 807 | 2643842649 | 2643221565 | Bacteria | 6216018 |
| 808 | 2643954539 | 2643221589 | Bacteria | 6250934 |
| 809 | 2644023348 | 2643221602 | Bacteria | 6249926 |
| 810 | 2644186690 | 2643221633 | Bacteria | 6733554 |
| 811 | 2644251868 | 2643221645 | Bacteria | 7207331 |
| 812 | 2715758525 | 2713897149 | Bacteria | 6506249 |
| 813 | 2738740422 | 2738541280 | Bacteria | 6630198 |
| 814 | 2738843325 | 2738541300 | Bacteria | 6675882 |
| 815 | 2739258069 | 2738543015 | Bacteria | 6750701 |
| 816 | 2739275602 | 2738543018 | Bacteria | 6718814 |
| 817 | 2739344646 | 2738543030 | Bacteria | 6719714 |
| 818 | 2746091204 | 2744054900 | Bacteria | 8399525 |
| 819 | 2746097637 | 2744054901 | Bacteria | 8397047 |
| 820 | 2765583728 | 2765235841 | Bacteria | 6137024 |
| 821 | 2792839418 | 2791355137 | Bacteria | 9654227 |
| 822 | 2842332291 | 2842324504 | Bacteria | 9364110 |
| 823 | 2842356538 | 2842348783 | Bacteria | 9002918 |
| 824 | 2842460872 | 2842454564 | Bacteria | 8730687 |
| 825 | 2842891848 | 2842888712 | Bacteria | 4279094 |
| 826 | 2878031990 | 2878029506 | Bacteria | 6418441 |
| 827 | 2883090214 | 2883087390 | Bacteria | 9532701 |
| 828 | 2885277960 | 2885270888 | Bacteria | 9831543 |
| 829 | 2904621610 | 2904615490 | Bacteria | 10047340 |
| 830 | 2908673453 | 2908669403 | Bacteria | 5740494 |
| 831 | 2931402856 | 2931396565 | Bacteria | 7251677 |
| 832 | 3007618413 | 3007614139 | Bacteria | 6053559 |
| 833 | 3007808845 | 3007803356 | Bacteria | 5931491 |
| 834 | 3007876614 | 3007872151 | Bacteria | 5268868 |
| 835 | 8054932562 | 8054929484 | Bacteria | 5599761 |
| 836 | 8056178801 | 8056177738 | Bacteria | 6748268 |
| 837 | Ga0395905_0002486 | |||
| 838 | MRS2a_Contig_5159 | |||
| 839 | MRS2a_Contig_9283 | |||
| 840 | SwRhRL2b_contig_833017 | |||
| 841 | JGI25156J39149_1003941 | |||
| 842 | JGI25159J45721_1001342 | |||
| 843 | Ga0055542_1007504 | |||
| 844 | Ga0055526_1001553 | |||
| 845 | Ga0055537_1000681 | |||
| 846 | Ga0055524_1005422 | |||
| 847 | Ga0055536_1000182 | |||
| 848 | Ga0055534_1000217 | |||
| 849 | Ga0055528_1000042 | |||
| 850 | Ga0055530_10000448 | |||
| 851 | Ga0055530_10000530 | |||
| 852 | Ga0055540_1000122 | |||
| 853 | Ga0055540_1000268 | |||
| 854 | Ga0055531_10000146 | |||
| 855 | Ga0055531_10006153 | |||
| 856 | Ga0065165_1000003 | |||
| 857 | Ga0065714_10000224 | |||
| 858 | Ga0065714_10005580 | |||
| 859 | Ga0065714_10013504 | |||
| 860 | Ga0065714_10110444 | |||
| 861 | Ga0065704_10072267 | |||
| 862 | Ga0065704_10138532 | |||
| 863 | Ga0065704_10150087 | |||
| 864 | Ga0065712_10001997 | |||
| 865 | Ga0065715_10005821 | |||
| 866 | Ga0070670_100094055 | |||
| 867 | Ga0070677_10007750 | |||
| 868 | Ga0070661_100001945 | |||
| 869 | Ga0070659_100000661 | |||
| 870 | Ga0070711_100017338 | |||
| 871 | Ga0070678_100061527 | |||
| 872 | Ga0070707_100015628 | |||
| 873 | Ga0070698_100007295 | |||
| 874 | Ga0070699_100001621 | |||
| 875 | Ga0070699_100020221 | |||
| 876 | Ga0070697_100002273 | |||
| 877 | Ga0070672_100219094 | |||
| 878 | Ga0070665_100019759 | |||
| 879 | Ga0068855_100147412 | |||
| 880 | Ga0070664_100017134 | |||
| 881 | Ga0070702_100111858 | |||
| 882 | Ga0068866_10048037 | |||
| 883 | Ga0068862_100170975 | |||
| 884 | Ga0081455_10118157 | |||
| 885 | Ga0075363_100018233 | |||
| 886 | Ga0075364_10021278 | |||
| 887 | Ga0075432_10000482 | |||
| 888 | Ga0075432_10012718 | |||
| 889 | Ga0075432_10014249 | |||
| 890 | Ga0070712_100012323 | |||
| 891 | Ga0070712_100063180 | |||
| 892 | Ga0075362_10019042 | |||
| 893 | Ga0075362_10024797 | |||
| 894 | Ga0075370_10071870 | |||
| 895 | Ga0075433_10028589 | |||
| 896 | Ga0099823_1000050 | |||
| 897 | Ga0079104_1003077 | |||
| 898 | Ga0105251_10000038 | |||
| 899 | Ga0105251_10001289 | |||
| 900 | Ga0105251_10005569 | |||
| 901 | Ga0105251_10008986 | |||
| 902 | Ga0105251_10010858 | |||
| 903 | Ga0105251_10012159 | |||
| 904 | Ga0105251_10013841 | |||
| 905 | Ga0105251_10025412 | |||
| 906 | Ga0105251_10045898 | |||
| 907 | Ga0105244_10001385 | |||
| 908 | Ga0105244_10002330 | |||
| 909 | Ga0105244_10002532 | |||
| 910 | Ga0105244_10022447 | |||
| 911 | Ga0105250_10005563 | |||
| 912 | Ga0105250_10006860 | |||
| 913 | Ga0105250_10018807 | |||
| 914 | Ga0105240_10002844 | |||
| 915 | Ga0105247_10119196 | |||
| 916 | Ga0114129_10074287 | |||
| 917 | Ga0114129_10252369 | |||
| 918 | Ga0105243_10014635 | |||
| 919 | Ga0105248_10034171 | |||
| 920 | Ga0105237_10001202 | |||
| 921 | Ga0105238_10006297 | |||
| 922 | Ga0105249_10086282 | |||
| 923 | Ga0157345_1000146 | |||
| 924 | Ga0157371_10000595 | |||
| 925 | Ga0157370_10003919 | |||
| 926 | Ga0157370_10009259 | |||
| 927 | Ga0157370_10048224 | |||
| 928 | Ga0157370_10092657 | |||
| 929 | Ga0157369_10005429 | |||
| 930 | Ga0163162_10043981 | |||
| 931 | Ga0163162_10129821 | |||
| 932 | Ga0182008_10001181 | |||
| 933 | Ga0182008_10002772 | |||
| 934 | Ga0182008_10016194 | |||
| 935 | Ga0182006_1001476 | |||
| 936 | Ga0182006_1004144 | |||
| 937 | Ga0182007_10000492 | |||
| 938 | Ga0183361_10020 | |||
| 939 | Ga0163161_10000683 | |||
| 940 | Ga0163161_10001374 | |||
| 941 | Ga0163161_10007389 | |||
| 942 | Ga0163161_10212521 | |||
| 943 | Ga0209148_1000596 | |||
| 944 | Ga0209759_1000150 | |||
| 945 | Ga0209565_1000018 | |||
| 946 | Ga0209565_1006313 | |||
| 947 | Ga0209673_1000006 | |||
| 948 | Ga0209130_1000036 | |||
| 949 | Ga0209675_1000005 | |||
| 950 | Ga0209675_1003445 | |||
| 951 | Ga0209676_1000102 | |||
| 952 | Ga0209676_1001013 | |||
| 953 | Ga0209676_1004024 | |||
| 954 | Ga0209564_1000078 | |||
| 955 | Ga0209050_1000082 | |||
| 956 | Ga0209050_1000105 | |||
| 957 | Ga0209050_1000229 | |||
| 958 | Ga0209050_1021666 | |||
| 959 | Ga0209256_1000049 | |||
| 960 | Ga0209256_1000070 | |||
| 961 | Ga0207426_1011379 | |||
| 962 | Ga0209051_1000029 | |||
| 963 | Ga0209051_1000066 | |||
| 964 | Ga0209051_1005940 | |||
| 965 | Ga0209257_1000124 | |||
| 966 | Ga0209257_1000168 | |||
| 967 | Ga0207696_1002699 | |||
| 968 | Ga0207696_1002772 | |||
| 969 | Ga0207696_1006528 | |||
| 970 | Ga0207696_1013883 | |||
| 971 | Ga0207655_1000039 | |||
| 972 | Ga0207655_1000081 | |||
| 973 | Ga0207655_1000481 | |||
| 974 | Ga0207655_1010671 | |||
| 975 | Ga0207655_1011260 | |||
| 976 | Ga0207713_1000185 | |||
| 977 | Ga0207713_1005290 | |||
| 978 | Ga0207713_1007802 | |||
| 979 | Ga0207713_1008617 | |||
| 980 | Ga0207713_1010302 | |||
| 981 | Ga0207713_1011806 | |||
| 982 | Ga0207713_1016376 | |||
| 983 | Ga0207713_1018082 | |||
| 984 | Ga0207682_10012923 | |||
| 985 | Ga0207688_10074655 | |||
| 986 | Ga0207699_10128365 | |||
| 987 | Ga0207684_10052363 | |||
| 988 | Ga0207695_10005993 | |||
| 989 | Ga0207693_10016361 | |||
| 990 | Ga0207663_10014014 | |||
| 991 | Ga0207649_10000932 | |||
| 992 | Ga0207646_10018806 | |||
| 993 | Ga0207650_10073112 | |||
| 994 | Ga0207690_10059268 | |||
| 995 | Ga0207691_10227472 | |||
| 996 | Ga0207711_10023799 | |||
| 997 | Ga0207679_10000119 | |||
| 998 | Ga0207658_10103856 | |||
| 999 | Ga0207675_100179407 | |||
| 1000 | Ga0207683_10026298 | |||
| 1001 | Ga0207683_10079808 | |||
| 1002 | Ga0209389_1000053 | |||
| 1003 | Ga0207428_10002856 | |||
| 1004 | Ga0207428_10028891 | |||
| 1005 | Ga0207428_10059810 | |||
| 1006 | Ga0268266_10028512 | |||
| 1007 | Ga0265338_10000045 | |||
| 1008 | Ga0268256_1013443 | |||
| 1009 | Ga0307508_10000412 | |||
| 1010 | Ga0307516_10001226 | |||
| 1011 | Ga0373931_0097168 | |||
| 1012 | Ga0395899_0013949 | |||
| 1013 | Ga0395899_0030628 | |||
| 1014 | Ga0395898_0318690 | |||
| 1015 | Ga0395905_0001977 | |||
| 1016 | Ga0395905_0004343 | |||
| 1017 | Ga0395905_0004380 | |||
| 1018 | Ga0395901_0009029 | |||
| 1019 | Ga0439438_003482 | |||
| 1020 | Ga0439466_0015762 | |||
| 1021 | Ga0439432_004223 | |||
| 1022 | Ga0439452_000908 | |||
| 1023 | Ga0439456_001850 | |||
| 1024 | Ga0439456_013454 | |||
| 1025 | Ga0439463_026169 | |||
| 1026 | Ga0450900_000321 | |||
| 1027 | Ga0450902_000378 | |||
| 1028 | Ga0450902_000931 | |||
| 1029 | Ga0439460_0001234 | |||
| 1030 | Ga0450901_000007 | |||
| 1031 | Ga0466969_0004219 | |||
| 1032 | Ga0466966_0009874 | |||
| 1033 | Ga0466961_0000231 | |||
| 1034 | Ga0466961_0012714 | |||
| 1035 | Ga0453684_0005886 | |||
| 1036 | Ga0466970_0010298 | |||
| 1037 | Ga0466960_0098242 | |||
| 1038 | Ga0466959_0009421 | |||
| 1039 | Ga0466959_0068996 | |||
| 1040 | Ga0495617_001657 | |||
| 1041 | Ga0495617_002284 | |||
| 1042 | Ga0495617_003726 | |||
| 1043 | Ga0495617_004023 | |||
| 1044 | Ga0495617_004409 | |||
| 1045 | Ga0495627_001298 | |||
| 1046 | Ga0495627_005153 | |||
| 1047 | Ga0495627_005868 | |||
| 1048 | Ga0495627_006284 | |||
| 1049 | Ga0495592_0083473 | |||
| 1050 | Ga0495603_0008656 | |||
| 1051 | Ga0495590_0000487 | |||
| 1052 | Ga0495590_0001793 | |||
| 1053 | Ga0495590_0008744 | |||
| 1054 | Ga0495590_0008821 | |||
| 1055 | Ga0495590_0015723 | |||
| 1056 | Ga0495590_0034868 | |||
| 1057 | Ga0495590_0045555 | |||
| 1058 | Ga0495591_000005 | |||
| 1059 | Ga0495591_000221 | |||
| 1060 | Ga0495591_000356 | |||
| 1061 | Ga0495591_000364 | |||
| 1062 | Ga0495591_000568 | |||
| 1063 | Ga0495591_000818 | |||
| 1064 | Ga0495591_000985 | |||
| 1065 | Ga0495591_002493 | |||
| 1066 | Ga0495591_005726 | |||
| 1067 | Ga0495591_005888 | |||
| 1068 | Ga0495591_015832 | |||
| 1069 | Ga0495591_017651 | |||
| 1070 | Ga0495629_0001063 | |||
| 1071 | Ga0495629_0001722 | |||
| 1072 | Ga0495629_0005730 | |||
| 1073 | Ga0495629_0039433 | |||
| 1074 | Ga0495638_0000196 | |||
| 1075 | Ga0495638_0001031 | |||
| 1076 | Ga0495638_0001507 | |||
| 1077 | Ga0495638_0002819 | |||
| 1078 | Ga0495638_0008159 | |||
| 1079 | Ga0495638_0014124 | |||
| 1080 | Ga0495638_0018656 | |||
| 1081 | Ga0495638_0034915 | |||
| 1082 | Ga0495638_0035531 | |||
| 1083 | Ga0495638_0037093 | |||
| 1084 | Ga0495638_0046896 | |||
| 1085 | Ga0495638_0081062 | |||
| 1086 | Ga0495651_0009049 | |||
| 1087 | Ga0495653_0015156 | |||
| 1088 | Ga0495653_0021637 | |||
| 1089 | Ga0495653_0051176 | |||
| 1090 | Ga0495653_0098141 | |||
| 1091 | Ga0495650_0000405 | |||
| 1092 | Ga0495650_0000651 | |||
| 1093 | Ga0495650_0000896 | |||
| 1094 | Ga0495650_0001556 | |||
| 1095 | Ga0495650_0002566 | |||
| 1096 | Ga0495650_0003886 | |||
| 1097 | Ga0495650_0005305 | |||
| 1098 | Ga0495650_0008407 | |||
| 1099 | Ga0495650_0019440 | |||
| 1100 | Ga0495650_0022629 | |||
| 1101 | Ga0495580_0038208 | |||
| 1102 | Ga0495580_0039398 | |||
| 1103 | Ga0495580_0073178 | |||
| 1104 | Ga0495580_0128255 | |||
| 1105 | Ga0495582_0019023 | |||
| 1106 | Ga0495582_0041633 | |||
| 1107 | Ga0495582_0104327 | |||
| 1108 | Ga0495605_0000009 | |||
| 1109 | Ga0495605_0000242 | |||
| 1110 | Ga0495605_0002640 | |||
| 1111 | Ga0495605_0004181 | |||
| 1112 | Ga0495605_0009781 | |||
| 1113 | Ga0495605_0012353 | |||
| 1114 | Ga0495605_0018138 | |||
| 1115 | Ga0495605_0024864 | |||
| 1116 | Ga0495605_0053899 | |||
| 1117 | Ga0495605_0074193 | |||
| 1118 | Ga0495639_0002382 | |||
| 1119 | Ga0495639_0015986 | |||
| 1120 | Ga0495639_0016835 | |||
| 1121 | Ga0495662_0027025 | |||
| 1122 | Ga0495664_0035304 | |||
| 1123 | Ga0495664_0074624 | |||
| 1124 | Ga0495584_0000018 | |||
| 1125 | Ga0495584_0000230 | |||
| 1126 | Ga0495584_0000346 | |||
| 1127 | Ga0495584_0000574 | |||
| 1128 | Ga0495584_0002952 | |||
| 1129 | Ga0495584_0003172 | |||
| 1130 | Ga0495584_0003406 | |||
| 1131 | Ga0495584_0008312 | |||
| 1132 | Ga0495584_0008924 | |||
| 1133 | Ga0495584_0014998 | |||
| 1134 | Ga0495584_0049309 | |||
| 1135 | Ga0495584_0051852 | |||
| 1136 | Ga0495585_0000030 | |||
| 1137 | Ga0495585_0006562 | |||
| 1138 | Ga0495585_0008245 | |||
| 1139 | Ga0495585_0013595 | |||
| 1140 | Ga0495585_0024490 | |||
| 1141 | Ga0495585_0035091 | |||
| 1142 | Ga0495585_0054148 | |||
| 1143 | Ga0495594_0023090 | |||
| 1144 | Ga0495596_0000034 | |||
| 1145 | Ga0495596_0001312 | |||
| 1146 | Ga0495596_0002906 | |||
| 1147 | Ga0495596_0005478 | |||
| 1148 | Ga0495596_0005591 | |||
| 1149 | Ga0495596_0041988 | |||
| 1150 | Ga0495607_0000148 | |||
| 1151 | Ga0495607_0000645 | |||
| 1152 | Ga0495607_0002176 | |||
| 1153 | Ga0495607_0003536 | |||
| 1154 | Ga0495607_0006633 | |||
| 1155 | Ga0495607_0015242 | |||
| 1156 | Ga0495607_0020415 | |||
| 1157 | Ga0495607_0022609 | |||
| 1158 | Ga0495607_0032604 | |||
| 1159 | Ga0495607_0080040 | |||
| 1160 | Ga0495607_0116086 | |||
| 1161 | Ga0495583_0000008 | |||
| 1162 | Ga0495583_0000334 | |||
| 1163 | Ga0495583_0000369 | |||
| 1164 | Ga0495583_0000958 | |||
| 1165 | Ga0495583_0001173 | |||
| 1166 | Ga0495583_0007444 | |||
| 1167 | Ga0495583_0009625 | |||
| 1168 | Ga0495583_0013623 | |||
| 1169 | Ga0495583_0015874 | |||
| 1170 | Ga0495583_0020992 | |||
| 1171 | Ga0495583_0048724 | |||
| 1172 | Ga0495606_0000122 | |||
| 1173 | Ga0495606_0000124 | |||
| 1174 | Ga0495606_0001186 | |||
| 1175 | Ga0495606_0002367 | |||
| 1176 | Ga0495606_0018588 | |||
| 1177 | Ga0495606_0094014 | |||
| 1178 | Ga0495608_0034669 | |||
| 1179 | Ga0495610_0002583 | |||
| 1180 | Ga0495610_0014736 | |||
| 1181 | Ga0495610_0038534 | |||
| 1182 | Ga0495610_0045098 | |||
| 1183 | Ga0495610_0069333 | |||
| 1184 | Ga0495616_0001384 | |||
| 1185 | Ga0495616_0001474 | |||
| 1186 | Ga0495616_0002376 | |||
| 1187 | Ga0495616_0008814 | |||
| 1188 | Ga0495616_0009920 | |||
| 1189 | Ga0495616_0010474 | |||
| 1190 | Ga0495616_0021334 | |||
| 1191 | Ga0495618_0018744 | |||
| 1192 | Ga0495618_0034508 | |||
| 1193 | Ga0495620_0000030 | |||
| 1194 | Ga0495620_0000527 | |||
| 1195 | Ga0495620_0000725 | |||
| 1196 | Ga0495620_0002042 | |||
| 1197 | Ga0495620_0008765 | |||
| 1198 | Ga0495620_0010293 | |||
| 1199 | Ga0495620_0010690 | |||
| 1200 | Ga0495620_0055655 | |||
| 1201 | Ga0495628_0023537 | |||
| 1202 | Ga0495628_0097688 | |||
| 1203 | Ga0495630_0010670 | |||
| 1204 | Ga0495630_0048456 | |||
| 1205 | Ga0495630_0085990 | |||
| 1206 | Ga0495631_0000763 | |||
| 1207 | Ga0495631_0002793 | |||
| 1208 | Ga0495631_0006880 | |||
| 1209 | Ga0495631_0011977 | |||
| 1210 | Ga0495631_0014186 | |||
| 1211 | Ga0495631_0022168 | |||
| 1212 | Ga0495631_0044904 | |||
| 1213 | Ga0495632_0000142 | |||
| 1214 | Ga0495632_0000553 | |||
| 1215 | Ga0495632_0000809 | |||
| 1216 | Ga0495632_0001230 | |||
| 1217 | Ga0495632_0002313 | |||
| 1218 | Ga0495632_0004154 | |||
| 1219 | Ga0495632_0005290 | |||
| 1220 | Ga0495632_0005882 | |||
| 1221 | Ga0495632_0006402 | |||
| 1222 | Ga0495632_0007114 | |||
| 1223 | Ga0495632_0011608 | |||
| 1224 | Ga0495632_0011646 | |||
| 1225 | Ga0495632_0044904 | |||
| 1226 | Ga0495637_0000082 | |||
| 1227 | Ga0495637_0000334 | |||
| 1228 | Ga0495637_0000967 | |||
| 1229 | Ga0495637_0001362 | |||
| 1230 | Ga0495637_0002662 | |||
| 1231 | Ga0495637_0004015 | |||
| 1232 | Ga0495637_0005403 | |||
| 1233 | Ga0495637_0007126 | |||
| 1234 | Ga0495637_0007448 | |||
| 1235 | Ga0495637_0008292 | |||
| 1236 | Ga0495637_0010552 | |||
| 1237 | Ga0495643_0000295 | |||
| 1238 | Ga0495643_0000574 | |||
| 1239 | Ga0495643_0009625 | |||
| 1240 | Ga0495643_0010114 | |||
| 1241 | Ga0495643_0011455 | |||
| 1242 | Ga0495643_0011628 | |||
| 1243 | Ga0495643_0016225 | |||
| 1244 | Ga0495643_0017382 | |||
| 1245 | Ga0495643_0018980 | |||
| 1246 | Ga0495643_0027151 | |||
| 1247 | Ga0495643_0028702 | |||
| 1248 | Ga0495643_0037596 | |||
| 1249 | Ga0495644_0000105 | |||
| 1250 | Ga0495644_0000159 | |||
| 1251 | Ga0495644_0001768 | |||
| 1252 | Ga0495648_0000471 | |||
| 1253 | Ga0495648_0000636 | |||
| 1254 | Ga0495648_0001090 | |||
| 1255 | Ga0495648_0001478 | |||
| 1256 | Ga0495648_0002828 | |||
| 1257 | Ga0495648_0003509 | |||
| 1258 | Ga0495648_0006024 | |||
| 1259 | Ga0495648_0006475 | |||
| 1260 | Ga0495648_0006601 | |||
| 1261 | Ga0495648_0007357 | |||
| 1262 | Ga0495648_0026233 | |||
| 1263 | Ga0495648_0049319 | |||
| 1264 | Ga0495648_0061811 | |||
| 1265 | Ga0495663_0001421 | |||
| 1266 | Ga0495663_0017455 | |||
| 1267 | Ga0495666_0009568 | |||
| 1268 | Ga0495666_0025571 | |||
| 1269 | Ga0495666_0048747 | |||
| 1270 | Ga0495642_0000082 | |||
| 1271 | Ga0495642_0000233 | |||
| 1272 | Ga0495642_0000832 | |||
| 1273 | Ga0495642_0005143 | |||
| 1274 | Ga0495642_0015391 | |||
| 1275 | Ga0495642_0017534 | |||
| 1276 | Ga0495642_0034700 | |||
| 1277 | Ga0495654_0000088 | |||
| 1278 | Ga0495654_0000769 | |||
| 1279 | Ga0495654_0000851 | |||
| 1280 | Ga0495654_0001220 | |||
| 1281 | Ga0495654_0001409 | |||
| 1282 | Ga0495654_0001496 | |||
| 1283 | Ga0495654_0005676 | |||
| 1284 | Ga0495654_0009184 | |||
| 1285 | Ga0495654_0014621 | |||
| 1286 | Ga0495654_0015750 | |||
| 1287 | Ga0495654_0020301 | |||
| 1288 | Ga0495665_0002139 | |||
| 1289 | Ga0495665_0047004 | |||
| 1290 | Ga0495640_0018531 | |||
| 1291 | Ga0495586_0068473 | |||
| 1292 | Ga0495587_0000190 | |||
| 1293 | Ga0495587_0041010 | |||
| 1294 | Ga0495587_0046575 | |||
| 1295 | Ga0495609_0000043 | |||
| 1296 | Ga0495609_0000152 | |||
| 1297 | Ga0495609_0000316 | |||
| 1298 | Ga0495609_0000740 | |||
| 1299 | Ga0495609_0001746 | |||
| 1300 | Ga0495609_0004110 | |||
| 1301 | Ga0495609_0008782 | |||
| 1302 | Ga0495609_0018956 | |||
| 1303 | Ga0495609_0064868 | |||
| 1304 | Ga0495621_0022590 | |||
| 1305 | Ga0495597_0001542 | |||
| 1306 | Ga0495597_0002076 | |||
| 1307 | Ga0495597_0003234 | |||
| 1308 | Ga0495597_0005419 | |||
| 1309 | Ga0495597_0006725 | |||
| 1310 | Ga0495597_0012474 | |||
| 1311 | Ga0495597_0014329 | |||
| 1312 | Ga0495597_0036759 | |||
| 1313 | Ga0495645_0016307 | |||
| 1314 | Ga0495645_0019538 | |||
| 1315 | Ga0495622_0000196 | |||
| 1316 | Ga0495622_0000882 | |||
| 1317 | Ga0495622_0001128 | |||
| 1318 | Ga0495622_0006570 | |||
| 1319 | Ga0495622_0013426 | |||
| 1320 | Ga0495622_0024866 | |||
| 1321 | Ga0495633_0002810 | |||
| 1322 | Ga0495633_0029262 | |||
| 1323 | Ga0495633_0038664 | |||
| 1324 | Ga0495656_0000270 | |||
| 1325 | Ga0495656_0000938 | |||
| 1326 | Ga0495656_0042289 | |||
| 1327 | Ga0495668_0000046 | |||
| 1328 | Ga0495668_0000776 | |||
| 1329 | Ga0495668_0026391 | |||
| 1330 | Ga0495668_0053048 | |||
| 1331 | Ga0495634_0004177 | |||
| 1332 | Ga0495634_0099202 | |||
| 1333 | Ga0495611_0002459 | |||
| 1334 | Ga0495611_0004180 | |||
| 1335 | Ga0495611_0007504 | |||
| 1336 | Ga0495611_0016560 | |||
| 1337 | Ga0495625_0000101 | |||
| 1338 | Ga0495625_0002402 | |||
| 1339 | Ga0495625_0004203 | |||
| 1340 | Ga0495625_0005071 | |||
| 1341 | Ga0495625_0023330 | |||
| 1342 | Ga0495625_0025412 | |||
| 1343 | Ga0495625_0027971 | |||
| 1344 | Ga0495625_0034675 | |||
| 1345 | Ga0495625_0039537 | |||
| 1346 | Ga0495625_0124826 | |||
| 1347 | Ga0495635_0000142 | |||
| 1348 | Ga0495635_0018404 | |||
| 1349 | Ga0495659_0000002 | |||
| 1350 | Ga0495659_0000631 | |||
| 1351 | Ga0495659_0001053 | |||
| 1352 | Ga0495659_0003361 | |||
| 1353 | Ga0495661_0000024 | |||
| 1354 | Ga0495661_0001088 | |||
| 1355 | Ga0495661_0005288 | |||
| 1356 | Ga0495661_0005623 | |||
| 1357 | Ga0495661_0011271 | |||
| 1358 | Ga0495661_0012444 | |||
| 1359 | Ga0495661_0012690 | |||
| 1360 | Ga0495661_0022767 | |||
| 1361 | Ga0495661_0027126 | |||
| 1362 | Ga0495661_0030785 | |||
| 1363 | Ga0495661_0071194 | |||
| 1364 | Ga0495588_0009372 | |||
| 1365 | Ga0495588_0027584 | |||
| 1366 | Ga0495588_0035263 | |||
| 1367 | Ga0495588_0063760 | |||
| 1368 | Ga0495588_0076377 | |||
| 1369 | Ga0495599_0010719 | |||
| 1370 | Ga0495623_0003295 | |||
| 1371 | Ga0495623_0005249 | |||
| 1372 | Ga0495646_0027993 | |||
| 1373 | Ga0495646_0081796 | |||
| 1374 | Ga0495669_0003122 | |||
| 1375 | Ga0495669_0013821 | |||
| 1376 | Ga0495669_0014277 | |||
| 1377 | Ga0495669_0052350 | |||
| 1378 | Ga0495613_0031426 | |||
| 1379 | Ga0495613_0128361 | |||
| 1380 | Ga0495624_0001964 | |||
| 1381 | Ga0495624_0005770 | |||
| 1382 | Ga0495624_0088120 | |||
| 1383 | Ga0495670_0013957 | |||
| 1384 | Ga0495670_0035319 | |||
| 1385 | Ga0495670_0082544 | |||
| 1386 | Ga0495671_0000320 | |||
| 1387 | Ga0495671_0000382 | |||
| 1388 | Ga0495671_0000685 | |||
| 1389 | Ga0495671_0000709 | |||
| 1390 | Ga0495671_0004586 | |||
| 1391 | Ga0495671_0008151 | |||
| 1392 | Ga0495671_0018981 | |||
| 1393 | Ga0495671_0031071 | |||
| 1394 | Ga0495671_0044785 | |||
| 1395 | Ga0495671_0044883 | |||
| 1396 | Ga0495671_0078271 | |||
| 1397 | Ga0495649_0000070 | |||
| 1398 | Ga0495649_0000109 | |||
| 1399 | Ga0495649_0000154 | |||
| 1400 | Ga0495649_0001866 | |||
| 1401 | Ga0495649_0017726 | |||
| 1402 | Ga0495649_0042263 | |||
| 1403 | Ga0495649_0045070 | |||
| 1404 | Ga0495649_0050734 | |||
| 1405 | Ga0495649_0099301 | |||
| 1406 | Ga0495589_0000544 | |||
| 1407 | Ga0495589_0007180 | |||
| 1408 | Ga0495589_0014021 | |||
| 1409 | Ga0495589_0016374 | |||
| 1410 | Ga0495589_0042562 | |||
| 1411 | Ga0495600_0009629 | |||
| 1412 | Ga0495600_0036526 | |||
| 1413 | Ga0495660_0000439 | |||
| 1414 | Ga0495660_0001321 | |||
| 1415 | Ga0495660_0002216 | |||
| 1416 | Ga0495660_0004536 | |||
| 1417 | Ga0495660_0006045 | |||
| 1418 | Ga0495660_0006734 | |||
| 1419 | Ga0495660_0012857 | |||
| 1420 | Ga0495660_0021199 | |||
| 1421 | Ga0495660_0022681 | |||
| 1422 | Ga0495660_0026140 | |||
| 1423 | Ga0495660_0041343 | |||
| 1424 | Ga0495660_0065211 | |||
| 1425 | Ga0495581_0005793 | |||
| 1426 | Ga0495581_0027914 | |||
| 1427 | Ga0495581_0083295 | |||
| 1428 | Ga0495636_0004096 | |||
| 1429 | Ga0495674_0010514 | |||
| 1430 | Ga0495674_0025381 | |||
| 1431 | Ga0495674_0122549 | |||
| 1432 | Ga0495674_0130906 | |||
| 1433 | Ga0495672_0000019 | |||
| 1434 | Ga0495672_0002352 | |||
| 1435 | Ga0495672_0003138 | |||
| 1436 | Ga0495672_0003442 | |||
| 1437 | Ga0495672_0003897 | |||
| 1438 | Ga0495672_0004223 | |||
| 1439 | Ga0495672_0005450 | |||
| 1440 | Ga0495672_0005476 | |||
| 1441 | Ga0495672_0006544 | |||
| 1442 | Ga0495672_0012133 | |||
| 1443 | Ga0495676_0000071 | |||
| 1444 | Ga0495676_0021777 | |||
| 1445 | Ga0495676_0026082 | |||
| 1446 | Ga0495676_0075195 | |||
| 1447 | Ga0495680_0027706 | |||
| 1448 | Ga0495680_0048836 | |||
| 1449 | Ga0495680_0193925 | |||
| 1450 | Ga0495683_0000022 | |||
| 1451 | Ga0495683_0000567 | |||
| 1452 | Ga0495683_0001855 | |||
| 1453 | Ga0495683_0008036 | |||
| 1454 | Ga0495683_0016340 | |||
| 1455 | Ga0495683_0020129 | |||
| 1456 | Ga0495687_003024 | |||
| 1457 | Ga0495687_004710 | |||
| 1458 | Ga0495687_008369 | |||
| 1459 | Ga0495687_015375 | |||
| 1460 | Ga0495687_022935 | |||
| 1461 | Ga0495687_023190 | |||
| 1462 | Ga0495675_0003662 | |||
| 1463 | Ga0495675_0083742 | |||
| 1464 | Ga0495677_0000486 | |||
| 1465 | Ga0495677_0024984 | |||
| 1466 | Ga0495679_000026 | |||
| 1467 | Ga0495679_000245 | |||
| 1468 | Ga0495679_001065 | |||
| 1469 | Ga0495679_002264 | |||
| 1470 | Ga0495679_002411 | |||
| 1471 | Ga0495679_013512 | |||
| 1472 | Ga0495679_022733 | |||
| 1473 | Ga0495679_031362 | |||
| 1474 | Ga0495685_005730 | |||
| 1475 | Ga0495673_0000335 | |||
| 1476 | Ga0495673_0000515 | |||
| 1477 | Ga0495673_0000624 | |||
| 1478 | Ga0495673_0001677 | |||
| 1479 | Ga0495673_0001908 | |||
| 1480 | Ga0495673_0002358 | |||
| 1481 | Ga0495673_0002378 | |||
| 1482 | Ga0495673_0002456 | |||
| 1483 | Ga0495673_0007801 | |||
| 1484 | Ga0495673_0010315 | |||
| 1485 | Ga0495673_0012572 | |||
| 1486 | Ga0495681_0000848 | |||
| 1487 | Ga0495681_0001618 | |||
| 1488 | Ga0495681_0004850 | |||
| 1489 | Ga0495681_0007520 | |||
| 1490 | Ga0495681_0008059 | |||
| 1491 | Ga0495681_0009962 | |||
| 1492 | Ga0495681_0016898 | |||
| 1493 | Ga0495681_0030346 | |||
| 1494 | Ga0495681_0033611 | |||
| 1495 | Ga0495684_0112059 | |||
| 1496 | Ga0495686_0000810 | |||
| 1497 | Ga0495686_0000830 | |||
| 1498 | Ga0495686_0001886 | |||
| 1499 | Ga0495686_0002373 | |||
| 1500 | Ga0495686_0002910 | |||
| 1501 | Ga0495686_0014653 | |||
| 1502 | Ga0495686_0050290 | |||
| 1503 | Ga0495686_0080677 | |||
| 1504 | Ga0495593_0000777 | |||
| 1505 | Ga0495593_0007037 | |||
| 1506 | Ga0495593_0012534 | |||
| 1507 | Ga0495593_0034328 | |||
| 1508 | Ga0495602_0058452 | |||
| 1509 | Ga0495602_0074043 | |||
| 1510 | Ga0495614_0014589 | |||
| 1511 | Ga0495626_0000045 | |||
| 1512 | Ga0495626_0000404 | |||
| 1513 | Ga0495626_0000557 | |||
| 1514 | Ga0495626_0001583 | |||
| 1515 | Ga0495626_0001856 | |||
| 1516 | Ga0495626_0007726 | |||
| 1517 | Ga0495626_0007943 | |||
| 1518 | Ga0495626_0008917 | |||
| 1519 | Ga0495626_0014377 | |||
| 1520 | Ga0495626_0040397 | |||
| 1521 | Ga0496101_0002463 | |||
| 1522 | Ga0496102_0004705 | |||
| 1523 | Ga0496102_0034265 | |||
| 1524 | Ga0496102_0196930 | |||
| 1525 | Ga0496103_0003613 | |||
| 1526 | Ga0496103_0025506 | |||
| 1527 | Ga0496103_0050216 | |||
| 1528 | Ga0496104_0104823 | |||
| 1529 | Ga0496106_0000334 | |||
| 1530 | Ga0496106_0005269 | |||
| 1531 | Ga0496108_0095964 | |||
| 1532 | Ga0496110_0000528 | |||
| 1533 | Ga0496110_0004994 | |||
| 1534 | Ga0496110_0030047 | |||
| 1535 | Ga0496110_0043143 | |||
| 1536 | Ga0496110_0112623 | |||
| 1537 | Ga0496111_0011297 | |||
| 1538 | Ga0496111_0026196 | |||
| 1539 | Ga0496114_0243720 | |||
| 1540 | Ga0496115_0042311 | |||
| 1541 | Ga0496115_0112140 | |||
| 1542 | Ga0496116_0002307 | |||
| 1543 | Ga0496116_0017805 | |||
| 1544 | Ga0496116_0024960 | |||
| 1545 | Ga0496116_0060550 | |||
| 1546 | Ga0496117_0003820 | |||
| 1547 | Ga0496117_0006264 | |||
| 1548 | Ga0496117_0006817 | |||
| 1549 | Ga0496117_0022739 | |||
| 1550 | Ga0496117_0024924 | |||
| 1551 | Ga0496117_0028759 | |||
| 1552 | Ga0496118_0000230 | |||
| 1553 | Ga0496118_0000401 | |||
| 1554 | Ga0496118_0006350 | |||
| 1555 | Ga0496118_0018841 | |||
| 1556 | Ga0496118_0026196 | |||
| 1557 | Ga0496118_0030839 | |||
| 1558 | Ga0496118_0050612 | |||
| 1559 | Ga0496121_0001999 | |||
| 1560 | Ga0496121_0003905 | |||
| 1561 | Ga0496121_0004910 | |||
| 1562 | Ga0496121_0011463 | |||
| 1563 | Ga0496121_0017091 | |||
| 1564 | Ga0496121_0030946 | |||
| 1565 | Ga0496122_0001375 | |||
| 1566 | Ga0496122_0002525 | |||
| 1567 | Ga0496122_0004000 | |||
| 1568 | Ga0496122_0006573 | |||
| 1569 | Ga0496122_0011884 | |||
| 1570 | Ga0496122_0093366 | |||
| 1571 | Ga0496123_0000136 | |||
| 1572 | Ga0496123_0001404 | |||
| 1573 | Ga0496123_0002971 | |||
| 1574 | Ga0496123_0030793 | |||
| 1575 | Ga0496124_0000833 | |||
| 1576 | Ga0496124_0001990 | |||
| 1577 | Ga0496124_0004093 | |||
| 1578 | Ga0496124_0004248 | |||
| 1579 | Ga0496124_0005069 | |||
| 1580 | Ga0496124_0010435 | |||
| 1581 | Ga0496124_0017286 | |||
| 1582 | Ga0496124_0020549 | |||
| 1583 | Ga0496124_0023182 | |||
| 1584 | Ga0496124_0059115 | |||
| 1585 | Ga0496125_0000196 | |||
| 1586 | Ga0496125_0009441 | |||
| 1587 | Ga0496125_0018244 | |||
| 1588 | Ga0496125_0021777 | |||
| 1589 | Ga0496125_0041095 | |||
| 1590 | Ga0496126_0000389 | |||
| 1591 | Ga0496126_0004363 | |||
| 1592 | Ga0496126_0055196 | |||
| 1593 | Ga0495678_000377 | |||
| 1594 | Ga0495678_000796 | |||
| 1595 | Ga0495678_002564 | |||
| 1596 | Ga0495678_003056 | |||
| 1597 | Ga0495678_003232 | |||
| 1598 | Ga0495678_007973 | |||
| 1599 | Ga0495678_009748 | |||
| 1600 | Ga0495678_020220 | |||
| 1601 | Ga0495678_023239 | |||
| 1602 | Ga0495682_0000254 | |||
| 1603 | Ga0495682_0001072 | |||
| 1604 | Ga0495682_0001744 | |||
| 1605 | Ga0495682_0001966 | |||
| 1606 | Ga0495682_0008401 | |||
| 1607 | Ga0495682_0010297 | |||
| 1608 | Ga0495682_0025336 | |||
| 1609 | Ga0495682_0035028 | |||
| 1610 | nmdc:mga03683_23668_c1 | |||
| 1611 | nmdc:mga00v17_45122_c1 | |||
| 1612 | nmdc:mga07m45_24184_c1 | |||
| 1613 | nmdc:mga05p37_163394_c1 | |||
| 1614 | nmdc:mga05p37_274862_c1 | |||
| 1615 | nmdc:mga0n895_42228_c1 | |||
| 1616 | nmdc:mga0a205_70917_c1 | |||
| 1617 | Ga0500659_0003317 | |||
| 1618 | Ga0500634_0006669 | |||
| 1619 | 2510281473 | |||
| 1620 | 2510282296 | |||
| 1621 | 2510291519 | |||
| 1622 | 2510292358 | |||
| 1623 | 2510309621 | |||
| 1624 | 2510310444 | |||
| 1625 | 2511253422 | |||
| 1626 | 2511265102 | |||
| 1627 | 2511270382 | |||
| 1628 | 2511300773 | |||
| 1629 | 2511312450 | |||
| 1630 | 2511323346 | |||
| 1631 | 2511324026 | |||
| 1632 | 2511331219 | |||
| 1633 | 2511351051 | |||
| 1634 | 2511357718 | |||
| 1635 | 2511366315 | |||
| 1636 | 2511415758 | |||
| 1637 | 2512345958 | |||
| 1638 | 2515689307 | |||
| 1639 | 2516018686 | |||
| 1640 | 2601796037 | |||
| 1641 | 2606075111 | |||
| 1642 | 2606127974 | |||
| 1643 | 2643842649 | |||
| 1644 | 2643954539 | |||
| 1645 | 2644023348 | |||
| 1646 | 2644186690 | |||
| 1647 | 2644251868 | |||
| 1648 | 2715758525 | |||
| 1649 | 2738740422 | |||
| 1650 | 2738843325 | |||
| 1651 | 2739258069 | |||
| 1652 | 2739275602 | |||
| 1653 | 2739344646 | |||
| 1654 | 2746091204 | |||
| 1655 | 2746097637 | |||
| 1656 | 2765583728 | |||
| 1657 | 2792839418 | |||
| 1658 | 2842332291 | |||
| 1659 | 2842356538 | |||
| 1660 | 2842460872 | |||
| 1661 | 2842891848 | |||
| 1662 | 2878031990 | |||
| 1663 | 2883090214 | |||
| 1664 | 2885277960 | |||
| 1665 | 2904621610 | |||
| 1666 | 2908673453 | |||
| 1667 | 2931402856 | |||
| 1668 | 3007618413 | |||
| 1669 | 3007808845 | |||
| 1670 | 3007876614 | |||
| 1671 | 8054932562 | |||
| 1672 | 8056178801 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rcp-assembly1.cif.gz_A | gltph mutant (s279e/d405n) in complex with aspartate and sodium ions | 0.8943 | 4 | 383 |
| 6uwf-assembly1.cif.gz_A | gltph in complex with l-aspartate and sodium ions in outward-facing state | 0.8913 | 4 | 383 |
| 6bat-assembly1.cif.gz_A | crystal structure of wild-type gltph in complex with l-aspartate | 0.8911 | 9 | 383 |
| 6bav-assembly1.cif.gz_B | crystal structure of gltph r397c in complex with s-benzyl-l-cysteine | 0.8773 | 4 | 383 |
| 6bmi-assembly1.cif.gz_B | crystal structure of gltph r397c in complex with l-serine | 0.8767 | 4 | 383 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9816 | 8 | 388 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9517 | 4 | 388 | 1.10.3860.10 |
| af_P21345_1_417_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9429 | 16 | 388 | 1.10.3860.10 |
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9152 | 8 | 388 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9037 | 4 | 388 | 1.10.3860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G5MPG5-F1-model_v4 | deleted | 0.9818 | 4 | 400 |
|
| AF-A0A2S6H2N5-F1-model_v4 | C4-dicarboxylate transport protein | 0.9817 | 8 | 396 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A4Y3J673-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9806 | 30 | 396 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A3N8LD07-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.9786 | 8 | 396 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A2N7X2R2-F1-model_v4 | Glutamate/aspartate:proton symporter GltP | 0.9784 | 6 | 398 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |