F482895

General Info

Members Datasets Scaffolds Average Seq Length
836 301 1672 438

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0002486|Ga0395905_0002486_17458_18954
Length 498
Sequence MTRALQSHWQLINAFQIRGTGIAGNASTVPSQERRKARRTLKGDKMSKFRKLLGTLYVQVLMAVTAGIALGMLYPQLGTEFKPLGDGFIKLIKMVFAPVIFATVVLGIAKLENMKDLGRIGLRALIYFEVMSTFALALGLLTVNLLAPGAGMNIDPHALDAKSIASYTAVAKHDSFTGFLLQMIPVSVVDALARNEILQILLFSILFGVALARMGKRAEPVVHFLDAFSHSMFVIVGMIMRIAPLAAFGAMAFTVGKYGFGSIASLAKLMGAMYLTCFLFVAVVLGAIARLSGFSLWKFLKYMREEIFTVLGTCSSESVLPQMIGKLERVGCSKSVVGLVVPSGLTFNPDGQCIYYTMAAIFIAQATNTPLSLADQLIVLSVLMLTSKGSAGVTGAGFITLAATLASLGKIPVEGMVLLLGVDRFMSEARSITNTIGNAVGTMAIARWVGAMDVKKVQAVLNGEAGEQNSLVDDDAAAGRHAVPAALIDAAGAGQRAA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
115 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
116 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
117 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
118 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
119 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
120 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
131 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
250 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
251 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
252 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
253 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
254 2511231004 Pseudomonas sp. GM102 Isolate Nodule
255 2511231006 Pseudomonas sp. GM17 Isolate Nodule
256 2511231007 Pseudomonas sp. GM18 Isolate Nodule
257 2511231012 Pseudomonas sp. GM33 Isolate Nodule
258 2511231014 Pseudomonas sp. GM48 Isolate Nodule
259 2511231015 Pseudomonas sp. GM49 Isolate Nodule
260 2511231016 Pseudomonas sp. GM50 Isolate Nodule
261 2511231017 Pseudomonas sp. GM55 Isolate Nodule
262 2511231020 Pseudomonas sp. GM74 Isolate Nodule
263 2511231021 Pseudomonas sp. GM78 Isolate Nodule
264 2511231022 Pseudomonas sp. GM79 Isolate Nodule
265 2511231031 Pseudomonas sp. GM16 Isolate Nodule
266 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
267 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
268 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
269 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
270 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
271 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
272 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
273 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
274 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
275 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
276 2643221645 Massilia sp. Root351 Isolate Unclassified
277 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
278 2738541280 Massilia sp. GV090 Isolate Unclassified
279 2738541300 Massilia sp. GV016 Isolate Unclassified
280 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
281 2738543018 Massilia sp. GV045 Isolate Unclassified
282 2738543030 Massilia sp. GV097 Isolate Unclassified
283 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
284 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
285 2765235841 Pseudomonas putida AA7 Isolate Unclassified
286 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
287 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
288 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
289 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
290 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
291 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
292 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
293 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
294 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
295 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
296 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
297 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
298 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
299 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
300 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
301 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.54
Metatranscriptomes 0
Isolates 6.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.74
Nodule 2.39
Rhizoplane 2.87
Rhizosphere 79.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0002486 3300037471 Bacteria 20390
2 MRS2a_Contig_5159 2124908027 Bacteria 5101
3 MRS2a_Contig_9283 2124908027 Bacteria 3194
4 SwRhRL2b_contig_833017 2162886007 Bacteria 2240
5 JGI25156J39149_1003941 3300002705 Bacteria 4692
6 JGI25159J45721_1001342 3300002987 Bacteria 10334
7 Ga0055542_1007504 3300003762 Bacteria 2210
8 Ga0055526_1001553 3300003771 Bacteria 16245
9 Ga0055537_1000681 3300003773 Bacteria 17864
10 Ga0055524_1005422 3300003775 Bacteria 5697
11 Ga0055536_1000182 3300003781 Bacteria 52228
12 Ga0055534_1000217 3300003784 Bacteria 42503
13 Ga0055528_1000042 3300003790 Bacteria 104874
14 Ga0055530_10000448 3300003791 Bacteria 36611
15 Ga0055530_10000530 3300003791 Bacteria 33133
16 Ga0055540_1000122 3300003792 Bacteria 81293
17 Ga0055540_1000268 3300003792 Bacteria 47109
18 Ga0055531_10000146 3300003794 Bacteria 81289
19 Ga0055531_10006153 3300003794 Bacteria 6867
20 Ga0065165_1000003 3300005262 Bacteria 390701
21 Ga0065714_10000224 3300005288 Bacteria 7203
22 Ga0065714_10005580 3300005288 Bacteria 12212
23 Ga0065714_10013504 3300005288 Bacteria 1685
24 Ga0065714_10110444 3300005288 Bacteria 1474
25 Ga0065704_10072267 3300005289 Bacteria 8826
26 Ga0065704_10138532 3300005289 Bacteria 1543
27 Ga0065704_10150087 3300005289 Bacteria 1436
28 Ga0065712_10001997 3300005290 Bacteria 5746
29 Ga0065715_10005821 3300005293 Bacteria 4025
30 Ga0070670_100094055 3300005331 Bacteria 2578
31 Ga0070677_10007750 3300005333 Bacteria 3596
32 Ga0070661_100001945 3300005344 Bacteria 14298
33 Ga0070659_100000661 3300005366 Bacteria 25049
34 Ga0070711_100017338 3300005439 Bacteria 4583
35 Ga0070678_100061527 3300005456 Bacteria 2768
36 Ga0070707_100015628 3300005468 Bacteria 7123
37 Ga0070698_100007295 3300005471 Bacteria 11969
38 Ga0070699_100001621 3300005518 Bacteria 20514
39 Ga0070699_100020221 3300005518 Bacteria 5740
40 Ga0070697_100002273 3300005536 Bacteria 14750
41 Ga0070672_100219094 3300005543 Bacteria 1596
42 Ga0070665_100019759 3300005548 Bacteria 6761
43 Ga0068855_100147412 3300005563 Bacteria 2678
44 Ga0070664_100017134 3300005564 Bacteria 5948
45 Ga0070702_100111858 3300005615 Bacteria 1694
46 Ga0068866_10048037 3300005718 Bacteria 2155
47 Ga0068862_100170975 3300005844 Bacteria 1945
48 Ga0081455_10118157 3300005937 Bacteria 2094
49 Ga0075363_100018233 3300006048 Bacteria 3493
50 Ga0075364_10021278 3300006051 Bacteria 4086
51 Ga0075432_10000482 3300006058 Bacteria 11887
52 Ga0075432_10012718 3300006058 Bacteria 2858
53 Ga0075432_10014249 3300006058 Bacteria 2707
54 Ga0070712_100012323 3300006175 Bacteria 5433
55 Ga0070712_100063180 3300006175 Bacteria 2620
56 Ga0075362_10019042 3300006177 Bacteria 2850
57 Ga0075362_10024797 3300006177 Bacteria 2547
58 Ga0075370_10071870 3300006353 Bacteria 1980
59 Ga0075433_10028589 3300006852 Bacteria 4741
60 Ga0099823_1000050 3300006944 Bacteria 57425
61 Ga0079104_1003077 3300006946 Bacteria 8135
62 Ga0105251_10000038 3300009011 Bacteria 116060
63 Ga0105251_10001289 3300009011 Bacteria 21676
64 Ga0105251_10005569 3300009011 Bacteria 8193
65 Ga0105251_10008986 3300009011 Bacteria 5961
66 Ga0105251_10010858 3300009011 Bacteria 5245
67 Ga0105251_10012159 3300009011 Bacteria 4884
68 Ga0105251_10013841 3300009011 Bacteria 4489
69 Ga0105251_10025412 3300009011 Bacteria 3030
70 Ga0105251_10045898 3300009011 Bacteria 2105
71 Ga0105244_10001385 3300009036 Bacteria 19690
72 Ga0105244_10002330 3300009036 Bacteria 14435
73 Ga0105244_10002532 3300009036 Bacteria 13729
74 Ga0105244_10022447 3300009036 Bacteria 3474
75 Ga0105250_10005563 3300009092 Bacteria 5634
76 Ga0105250_10006860 3300009092 Bacteria 4940
77 Ga0105250_10018807 3300009092 Bacteria 2795
78 Ga0105240_10002844 3300009093 Bacteria 27365
79 Ga0105247_10119196 3300009101 Bacteria 1708
80 Ga0114129_10074287 3300009147 Bacteria 4735
81 Ga0114129_10252369 3300009147 Bacteria 2367
82 Ga0105243_10014635 3300009148 Bacteria 5935
83 Ga0105248_10034171 3300009177 Bacteria 5684
84 Ga0105237_10001202 3300009545 Bacteria 34641
85 Ga0105238_10006297 3300009551 Bacteria 11797
86 Ga0105249_10086282 3300009553 Bacteria 2927
87 Ga0157345_1000146 3300012498 Bacteria 12442
88 Ga0157371_10000595 3300013102 Bacteria 43057
89 Ga0157370_10003919 3300013104 Bacteria 17337
90 Ga0157370_10009259 3300013104 Bacteria 10553
91 Ga0157370_10048224 3300013104 Bacteria 4080
92 Ga0157370_10092657 3300013104 Bacteria 2836
93 Ga0157369_10005429 3300013105 Bacteria 14823
94 Ga0163162_10043981 3300013306 Bacteria 4472
95 Ga0163162_10129821 3300013306 Bacteria 2628
96 Ga0182008_10001181 3300014497 Bacteria 18007
97 Ga0182008_10002772 3300014497 Bacteria 10863
98 Ga0182008_10016194 3300014497 Bacteria 3879
99 Ga0182006_1001476 3300015261 Bacteria 14155
100 Ga0182006_1004144 3300015261 Bacteria 7194
101 Ga0182007_10000492 3300015262 Bacteria 23618
102 Ga0183361_10020 3300016635 Bacteria 128627
103 Ga0163161_10000683 3300017792 Bacteria 27101
104 Ga0163161_10001374 3300017792 Bacteria 18049
105 Ga0163161_10007389 3300017792 Bacteria 7589
106 Ga0163161_10212521 3300017792 Bacteria 1495
107 Ga0209148_1000596 3300025254 Bacteria 32631
108 Ga0209759_1000150 3300025256 Bacteria 120839
109 Ga0209565_1000018 3300025263 Bacteria 460940
110 Ga0209565_1006313 3300025263 Bacteria 3338
111 Ga0209673_1000006 3300025273 Bacteria 650600
112 Ga0209130_1000036 3300025284 Bacteria 284111
113 Ga0209675_1000005 3300025291 Bacteria 849192
114 Ga0209675_1003445 3300025291 Bacteria 7520
115 Ga0209676_1000102 3300025292 Bacteria 227372
116 Ga0209676_1001013 3300025292 Bacteria 32853
117 Ga0209676_1004024 3300025292 Bacteria 8467
118 Ga0209564_1000078 3300025295 Bacteria 275766
119 Ga0209050_1000082 3300025298 Bacteria 266864
120 Ga0209050_1000105 3300025298 Bacteria 227285
121 Ga0209050_1000229 3300025298 Bacteria 123110
122 Ga0209050_1021666 3300025298 Bacteria 2335
123 Ga0209256_1000049 3300025299 Bacteria 310696
124 Ga0209256_1000070 3300025299 Bacteria 245034
125 Ga0207426_1011379 3300025302 Bacteria 3393
126 Ga0209051_1000029 3300025303 Bacteria 403675
127 Ga0209051_1000066 3300025303 Bacteria 227369
128 Ga0209051_1005940 3300025303 Bacteria 7001
129 Ga0209257_1000124 3300025304 Bacteria 218195
130 Ga0209257_1000168 3300025304 Bacteria 171312
131 Ga0207696_1002699 3300025711 Bacteria 8495
132 Ga0207696_1002772 3300025711 Bacteria 8335
133 Ga0207696_1006528 3300025711 Bacteria 4691
134 Ga0207696_1013883 3300025711 Bacteria 2782
135 Ga0207655_1000039 3300025728 Bacteria 341249
136 Ga0207655_1000081 3300025728 Bacteria 214272
137 Ga0207655_1000481 3300025728 Bacteria 51474
138 Ga0207655_1010671 3300025728 Bacteria 5554
139 Ga0207655_1011260 3300025728 Bacteria 5339
140 Ga0207713_1000185 3300025735 Bacteria 88697
141 Ga0207713_1005290 3300025735 Bacteria 8119
142 Ga0207713_1007802 3300025735 Bacteria 6245
143 Ga0207713_1008617 3300025735 Bacteria 5846
144 Ga0207713_1010302 3300025735 Bacteria 5187
145 Ga0207713_1011806 3300025735 Bacteria 4717
146 Ga0207713_1016376 3300025735 Bacteria 3763
147 Ga0207713_1018082 3300025735 Bacteria 3502
148 Ga0207682_10012923 3300025893 Bacteria 3256
149 Ga0207688_10074655 3300025901 Bacteria 1929
150 Ga0207699_10128365 3300025906 Bacteria 1650
151 Ga0207684_10052363 3300025910 Bacteria 3464
152 Ga0207695_10005993 3300025913 Bacteria 15896
153 Ga0207693_10016361 3300025915 Bacteria 5929
154 Ga0207663_10014014 3300025916 Bacteria 4377
155 Ga0207649_10000932 3300025920 Bacteria 18406
156 Ga0207646_10018806 3300025922 Bacteria 6435
157 Ga0207650_10073112 3300025925 Bacteria 2582
158 Ga0207690_10059268 3300025932 Bacteria 2593
159 Ga0207691_10227472 3300025940 Bacteria 1616
160 Ga0207711_10023799 3300025941 Bacteria 5127
161 Ga0207679_10000119 3300025945 Bacteria 63967
162 Ga0207658_10103856 3300025986 Bacteria 2232
163 Ga0207675_100179407 3300026118 Bacteria 2027
164 Ga0207683_10026298 3300026121 Bacteria 5023
165 Ga0207683_10079808 3300026121 Bacteria 2902
166 Ga0209389_1000053 3300027296 Bacteria 108874
167 Ga0207428_10002856 3300027907 Bacteria 17129
168 Ga0207428_10028891 3300027907 Bacteria 4602
169 Ga0207428_10059810 3300027907 Bacteria 3020
170 Ga0268266_10028512 3300028379 Bacteria 4745
171 Ga0265338_10000045 3300028800 Bacteria 223264
172 Ga0268256_1013443 3300030500 Bacteria 2480
173 Ga0307508_10000412 3300031616 Bacteria 50808
174 Ga0307516_10001226 3300031730 Bacteria 35691
175 Ga0373931_0097168 3300035691 Bacteria 1651
176 Ga0395899_0013949 3300037312 Bacteria 6137
177 Ga0395899_0030628 3300037312 Bacteria 4045
178 Ga0395898_0318690 3300037466 Bacteria 1483
179 Ga0395905_0001977 3300037471 Bacteria 23435
180 Ga0395905_0004343 3300037471 Bacteria 14758
181 Ga0395905_0004380 3300037471 Bacteria 14691
182 Ga0395901_0009029 3300038443 Bacteria 10091
183 Ga0439438_003482 3300041405 Bacteria 6357
184 Ga0439466_0015762 3300041411 Bacteria 2743
185 Ga0439432_004223 3300042006 Bacteria 5253
186 Ga0439452_000908 3300042010 Bacteria 13513
187 Ga0439456_001850 3300042013 Bacteria 4278
188 Ga0439456_013454 3300042013 Bacteria 1703
189 Ga0439463_026169 3300042016 Bacteria 1465
190 Ga0450900_000321 3300042136 Bacteria 3484
191 Ga0450902_000378 3300042137 Bacteria 5453
192 Ga0450902_000931 3300042137 Bacteria 3836
193 Ga0439460_0001234 3300042461 Bacteria 6023
194 Ga0450901_000007 3300042533 Bacteria 23102
195 Ga0466969_0004219 3300044656 Bacteria 7631
196 Ga0466966_0009874 3300044684 Bacteria 6326
197 Ga0466961_0000231 3300044693 Bacteria 37788
198 Ga0466961_0012714 3300044693 Bacteria 5391
199 Ga0453684_0005886 3300044712 Bacteria 23807
200 Ga0466970_0010298 3300044765 Bacteria 4744
201 Ga0466960_0098242 3300044901 Bacteria 1504
202 Ga0466959_0009421 3300045049 Bacteria 6947
203 Ga0466959_0068996 3300045049 Bacteria 2561
204 Ga0495617_001657 3300046452 Bacteria 9580
205 Ga0495617_002284 3300046452 Bacteria 7755
206 Ga0495617_003726 3300046452 Bacteria 5669
207 Ga0495617_004023 3300046452 Bacteria 5399
208 Ga0495617_004409 3300046452 Bacteria 5127
209 Ga0495627_001298 3300046453 Bacteria 15265
210 Ga0495627_005153 3300046453 Bacteria 5324
211 Ga0495627_005868 3300046453 Bacteria 4881
212 Ga0495627_006284 3300046453 Bacteria 4666
213 Ga0495592_0083473 3300046454 Bacteria 2306
214 Ga0495603_0008656 3300046455 Bacteria 6150
215 Ga0495590_0000487 3300046457 Bacteria 19558
216 Ga0495590_0001793 3300046457 Bacteria 9110
217 Ga0495590_0008744 3300046457 Bacteria 3853
218 Ga0495590_0008821 3300046457 Bacteria 3834
219 Ga0495590_0015723 3300046457 Bacteria 2741
220 Ga0495590_0034868 3300046457 Bacteria 1757
221 Ga0495590_0045555 3300046457 Bacteria 1530
222 Ga0495591_000005 3300046458 Bacteria 394092
223 Ga0495591_000221 3300046458 Bacteria 56635
224 Ga0495591_000356 3300046458 Bacteria 40342
225 Ga0495591_000364 3300046458 Bacteria 39254
226 Ga0495591_000568 3300046458 Bacteria 28319
227 Ga0495591_000818 3300046458 Bacteria 22045
228 Ga0495591_000985 3300046458 Bacteria 19408
229 Ga0495591_002493 3300046458 Bacteria 10195
230 Ga0495591_005726 3300046458 Bacteria 5669
231 Ga0495591_005888 3300046458 Bacteria 5554
232 Ga0495591_015832 3300046458 Bacteria 2649
233 Ga0495591_017651 3300046458 Bacteria 2443
234 Ga0495629_0001063 3300046459 Bacteria 21933
235 Ga0495629_0001722 3300046459 Bacteria 17166
236 Ga0495629_0005730 3300046459 Bacteria 9270
237 Ga0495629_0039433 3300046459 Bacteria 3324
238 Ga0495638_0000196 3300046460 Bacteria 87444
239 Ga0495638_0001031 3300046460 Bacteria 27599
240 Ga0495638_0001507 3300046460 Bacteria 20972
241 Ga0495638_0002819 3300046460 Bacteria 13920
242 Ga0495638_0008159 3300046460 Bacteria 7444
243 Ga0495638_0014124 3300046460 Bacteria 5407
244 Ga0495638_0018656 3300046460 Bacteria 4603
245 Ga0495638_0034915 3300046460 Bacteria 3208
246 Ga0495638_0035531 3300046460 Bacteria 3176
247 Ga0495638_0037093 3300046460 Bacteria 3102
248 Ga0495638_0046896 3300046460 Bacteria 2712
249 Ga0495638_0081062 3300046460 Bacteria 1971
250 Ga0495651_0009049 3300046462 Bacteria 7643
251 Ga0495653_0015156 3300046463 Bacteria 6284
252 Ga0495653_0021637 3300046463 Bacteria 5208
253 Ga0495653_0051176 3300046463 Bacteria 3172
254 Ga0495653_0098141 3300046463 Bacteria 2127
255 Ga0495650_0000405 3300046471 Bacteria 71148
256 Ga0495650_0000651 3300046471 Bacteria 45752
257 Ga0495650_0000896 3300046471 Bacteria 35106
258 Ga0495650_0001556 3300046471 Bacteria 21654
259 Ga0495650_0002566 3300046471 Bacteria 14389
260 Ga0495650_0003886 3300046471 Bacteria 10568
261 Ga0495650_0005305 3300046471 Bacteria 8430
262 Ga0495650_0008407 3300046471 Bacteria 6027
263 Ga0495650_0019440 3300046471 Bacteria 3342
264 Ga0495650_0022629 3300046471 Bacteria 3010
265 Ga0495580_0038208 3300046472 Bacteria 3440
266 Ga0495580_0039398 3300046472 Bacteria 3380
267 Ga0495580_0073178 3300046472 Bacteria 2392
268 Ga0495580_0128255 3300046472 Bacteria 1760
269 Ga0495582_0019023 3300046473 Bacteria 3758
270 Ga0495582_0041633 3300046473 Bacteria 2531
271 Ga0495582_0104327 3300046473 Bacteria 1589
272 Ga0495605_0000009 3300046474 Bacteria 324622
273 Ga0495605_0000242 3300046474 Bacteria 64936
274 Ga0495605_0002640 3300046474 Bacteria 10984
275 Ga0495605_0004181 3300046474 Bacteria 8506
276 Ga0495605_0009781 3300046474 Bacteria 5384
277 Ga0495605_0012353 3300046474 Bacteria 4740
278 Ga0495605_0018138 3300046474 Bacteria 3778
279 Ga0495605_0024864 3300046474 Bacteria 3128
280 Ga0495605_0053899 3300046474 Bacteria 1949
281 Ga0495605_0074193 3300046474 Bacteria 1601
282 Ga0495639_0002382 3300046475 Bacteria 8216
283 Ga0495639_0015986 3300046475 Bacteria 3255
284 Ga0495639_0016835 3300046475 Bacteria 3176
285 Ga0495662_0027025 3300046476 Bacteria 2772
286 Ga0495664_0035304 3300046477 Bacteria 2943
287 Ga0495664_0074624 3300046477 Bacteria 2029
288 Ga0495584_0000018 3300046491 Bacteria 142382
289 Ga0495584_0000230 3300046491 Bacteria 40309
290 Ga0495584_0000346 3300046491 Bacteria 32084
291 Ga0495584_0000574 3300046491 Bacteria 24787
292 Ga0495584_0002952 3300046491 Bacteria 9464
293 Ga0495584_0003172 3300046491 Bacteria 9136
294 Ga0495584_0003406 3300046491 Bacteria 8769
295 Ga0495584_0008312 3300046491 Bacteria 5375
296 Ga0495584_0008924 3300046491 Bacteria 5181
297 Ga0495584_0014998 3300046491 Bacteria 3949
298 Ga0495584_0049309 3300046491 Bacteria 2121
299 Ga0495584_0051852 3300046491 Bacteria 2065
300 Ga0495585_0000030 3300046492 Bacteria 145184
301 Ga0495585_0006562 3300046492 Bacteria 7197
302 Ga0495585_0008245 3300046492 Bacteria 6325
303 Ga0495585_0013595 3300046492 Bacteria 4757
304 Ga0495585_0024490 3300046492 Bacteria 3460
305 Ga0495585_0035091 3300046492 Bacteria 2837
306 Ga0495585_0054148 3300046492 Bacteria 2219
307 Ga0495594_0023090 3300046499 Bacteria 3331
308 Ga0495596_0000034 3300046500 Bacteria 100596
309 Ga0495596_0001312 3300046500 Bacteria 14347
310 Ga0495596_0002906 3300046500 Bacteria 8911
311 Ga0495596_0005478 3300046500 Bacteria 5988
312 Ga0495596_0005591 3300046500 Bacteria 5908
313 Ga0495596_0041988 3300046500 Bacteria 1803
314 Ga0495607_0000148 3300046501 Bacteria 73830
315 Ga0495607_0000645 3300046501 Bacteria 33901
316 Ga0495607_0002176 3300046501 Bacteria 16288
317 Ga0495607_0003536 3300046501 Bacteria 11899
318 Ga0495607_0006633 3300046501 Bacteria 8113
319 Ga0495607_0015242 3300046501 Bacteria 4984
320 Ga0495607_0020415 3300046501 Bacteria 4188
321 Ga0495607_0022609 3300046501 Bacteria 3945
322 Ga0495607_0032604 3300046501 Bacteria 3178
323 Ga0495607_0080040 3300046501 Bacteria 1798
324 Ga0495607_0116086 3300046501 Bacteria 1412
325 Ga0495583_0000008 3300046506 Bacteria 411092
326 Ga0495583_0000334 3300046506 Bacteria 74547
327 Ga0495583_0000369 3300046506 Bacteria 70121
328 Ga0495583_0000958 3300046506 Bacteria 33509
329 Ga0495583_0001173 3300046506 Bacteria 28282
330 Ga0495583_0007444 3300046506 Bacteria 6875
331 Ga0495583_0009625 3300046506 Bacteria 5750
332 Ga0495583_0013623 3300046506 Bacteria 4524
333 Ga0495583_0015874 3300046506 Bacteria 4074
334 Ga0495583_0020992 3300046506 Bacteria 3366
335 Ga0495583_0048724 3300046506 Bacteria 1943
336 Ga0495606_0000122 3300046507 Bacteria 132071
337 Ga0495606_0000124 3300046507 Bacteria 130164
338 Ga0495606_0001186 3300046507 Bacteria 36728
339 Ga0495606_0002367 3300046507 Bacteria 22139
340 Ga0495606_0018588 3300046507 Bacteria 5203
341 Ga0495606_0094014 3300046507 Bacteria 1838
342 Ga0495608_0034669 3300046511 Bacteria 3406
343 Ga0495610_0002583 3300046512 Bacteria 15025
344 Ga0495610_0014736 3300046512 Bacteria 4578
345 Ga0495610_0038534 3300046512 Bacteria 2425
346 Ga0495610_0045098 3300046512 Bacteria 2183
347 Ga0495610_0069333 3300046512 Bacteria 1650
348 Ga0495616_0001384 3300046513 Bacteria 16893
349 Ga0495616_0001474 3300046513 Bacteria 16340
350 Ga0495616_0002376 3300046513 Bacteria 12532
351 Ga0495616_0008814 3300046513 Bacteria 5937
352 Ga0495616_0009920 3300046513 Bacteria 5536
353 Ga0495616_0010474 3300046513 Bacteria 5365
354 Ga0495616_0021334 3300046513 Bacteria 3508
355 Ga0495618_0018744 3300046514 Bacteria 4251
356 Ga0495618_0034508 3300046514 Bacteria 3172
357 Ga0495620_0000030 3300046515 Bacteria 122177
358 Ga0495620_0000527 3300046515 Bacteria 24615
359 Ga0495620_0000725 3300046515 Bacteria 20298
360 Ga0495620_0002042 3300046515 Bacteria 11762
361 Ga0495620_0008765 3300046515 Bacteria 5412
362 Ga0495620_0010293 3300046515 Bacteria 4936
363 Ga0495620_0010690 3300046515 Bacteria 4830
364 Ga0495620_0055655 3300046515 Bacteria 1666
365 Ga0495628_0023537 3300046516 Bacteria 5054
366 Ga0495628_0097688 3300046516 Bacteria 2268
367 Ga0495630_0010670 3300046517 Bacteria 6632
368 Ga0495630_0048456 3300046517 Bacteria 3179
369 Ga0495630_0085990 3300046517 Bacteria 2374
370 Ga0495631_0000763 3300046518 Bacteria 20676
371 Ga0495631_0002793 3300046518 Bacteria 9685
372 Ga0495631_0006880 3300046518 Bacteria 5834
373 Ga0495631_0011977 3300046518 Bacteria 4251
374 Ga0495631_0014186 3300046518 Bacteria 3851
375 Ga0495631_0022168 3300046518 Bacteria 2953
376 Ga0495631_0044904 3300046518 Bacteria 1946
377 Ga0495632_0000142 3300046519 Bacteria 73780
378 Ga0495632_0000553 3300046519 Bacteria 34975
379 Ga0495632_0000809 3300046519 Bacteria 27722
380 Ga0495632_0001230 3300046519 Bacteria 21724
381 Ga0495632_0002313 3300046519 Bacteria 14664
382 Ga0495632_0004154 3300046519 Bacteria 9930
383 Ga0495632_0005290 3300046519 Bacteria 8573
384 Ga0495632_0005882 3300046519 Bacteria 8008
385 Ga0495632_0006402 3300046519 Bacteria 7580
386 Ga0495632_0007114 3300046519 Bacteria 7081
387 Ga0495632_0011608 3300046519 Bacteria 5130
388 Ga0495632_0011646 3300046519 Bacteria 5123
389 Ga0495632_0044904 3300046519 Bacteria 2203
390 Ga0495637_0000082 3300046520 Bacteria 73771
391 Ga0495637_0000334 3300046520 Bacteria 36438
392 Ga0495637_0000967 3300046520 Bacteria 18308
393 Ga0495637_0001362 3300046520 Bacteria 14682
394 Ga0495637_0002662 3300046520 Bacteria 9768
395 Ga0495637_0004015 3300046520 Bacteria 7679
396 Ga0495637_0005403 3300046520 Bacteria 6518
397 Ga0495637_0007126 3300046520 Bacteria 5564
398 Ga0495637_0007448 3300046520 Bacteria 5421
399 Ga0495637_0008292 3300046520 Bacteria 5109
400 Ga0495637_0010552 3300046520 Bacteria 4463
401 Ga0495643_0000295 3300046522 Bacteria 70296
402 Ga0495643_0000574 3300046522 Bacteria 45173
403 Ga0495643_0009625 3300046522 Bacteria 5990
404 Ga0495643_0010114 3300046522 Bacteria 5818
405 Ga0495643_0011455 3300046522 Bacteria 5401
406 Ga0495643_0011628 3300046522 Bacteria 5350
407 Ga0495643_0016225 3300046522 Bacteria 4379
408 Ga0495643_0017382 3300046522 Bacteria 4204
409 Ga0495643_0018980 3300046522 Bacteria 3982
410 Ga0495643_0027151 3300046522 Bacteria 3221
411 Ga0495643_0028702 3300046522 Bacteria 3116
412 Ga0495643_0037596 3300046522 Bacteria 2654
413 Ga0495644_0000105 3300046523 Bacteria 39842
414 Ga0495644_0000159 3300046523 Bacteria 32152
415 Ga0495644_0001768 3300046523 Bacteria 8722
416 Ga0495648_0000471 3300046524 Bacteria 43369
417 Ga0495648_0000636 3300046524 Bacteria 37436
418 Ga0495648_0001090 3300046524 Bacteria 27610
419 Ga0495648_0001478 3300046524 Bacteria 22985
420 Ga0495648_0002828 3300046524 Bacteria 15615
421 Ga0495648_0003509 3300046524 Bacteria 13748
422 Ga0495648_0006024 3300046524 Bacteria 9958
423 Ga0495648_0006475 3300046524 Bacteria 9553
424 Ga0495648_0006601 3300046524 Bacteria 9425
425 Ga0495648_0007357 3300046524 Bacteria 8820
426 Ga0495648_0026233 3300046524 Bacteria 3926
427 Ga0495648_0049319 3300046524 Bacteria 2582
428 Ga0495648_0061811 3300046524 Bacteria 2222
429 Ga0495663_0001421 3300046525 Bacteria 7556
430 Ga0495663_0017455 3300046525 Bacteria 2037
431 Ga0495666_0009568 3300046526 Bacteria 4844
432 Ga0495666_0025571 3300046526 Bacteria 2915
433 Ga0495666_0048747 3300046526 Bacteria 2039
434 Ga0495642_0000082 3300046528 Bacteria 55424
435 Ga0495642_0000233 3300046528 Bacteria 31690
436 Ga0495642_0000832 3300046528 Bacteria 14774
437 Ga0495642_0005143 3300046528 Bacteria 5031
438 Ga0495642_0015391 3300046528 Bacteria 2973
439 Ga0495642_0017534 3300046528 Bacteria 2797
440 Ga0495642_0034700 3300046528 Bacteria 2033
441 Ga0495654_0000088 3300046530 Bacteria 104763
442 Ga0495654_0000769 3300046530 Bacteria 24760
443 Ga0495654_0000851 3300046530 Bacteria 23130
444 Ga0495654_0001220 3300046530 Bacteria 18224
445 Ga0495654_0001409 3300046530 Bacteria 16659
446 Ga0495654_0001496 3300046530 Bacteria 15980
447 Ga0495654_0005676 3300046530 Bacteria 7201
448 Ga0495654_0009184 3300046530 Bacteria 5421
449 Ga0495654_0014621 3300046530 Bacteria 4174
450 Ga0495654_0015750 3300046530 Bacteria 4011
451 Ga0495654_0020301 3300046530 Bacteria 3464
452 Ga0495665_0002139 3300046531 Bacteria 10688
453 Ga0495665_0047004 3300046531 Bacteria 2290
454 Ga0495640_0018531 3300046533 Bacteria 5157
455 Ga0495586_0068473 3300046535 Bacteria 1936
456 Ga0495587_0000190 3300046536 Bacteria 45240
457 Ga0495587_0041010 3300046536 Bacteria 2763
458 Ga0495587_0046575 3300046536 Bacteria 2573
459 Ga0495609_0000043 3300046538 Bacteria 166590
460 Ga0495609_0000152 3300046538 Bacteria 71861
461 Ga0495609_0000316 3300046538 Bacteria 43165
462 Ga0495609_0000740 3300046538 Bacteria 24818
463 Ga0495609_0001746 3300046538 Bacteria 13981
464 Ga0495609_0004110 3300046538 Bacteria 8096
465 Ga0495609_0008782 3300046538 Bacteria 4919
466 Ga0495609_0018956 3300046538 Bacteria 3187
467 Ga0495609_0064868 3300046538 Bacteria 1610
468 Ga0495621_0022590 3300046539 Bacteria 2086
469 Ga0495597_0001542 3300046542 Bacteria 16341
470 Ga0495597_0002076 3300046542 Bacteria 13362
471 Ga0495597_0003234 3300046542 Bacteria 9679
472 Ga0495597_0005419 3300046542 Bacteria 6752
473 Ga0495597_0006725 3300046542 Bacteria 5919
474 Ga0495597_0012474 3300046542 Bacteria 4100
475 Ga0495597_0014329 3300046542 Bacteria 3777
476 Ga0495597_0036759 3300046542 Bacteria 2203
477 Ga0495645_0016307 3300046543 Bacteria 5302
478 Ga0495645_0019538 3300046543 Bacteria 4877
479 Ga0495622_0000196 3300046557 Bacteria 47964
480 Ga0495622_0000882 3300046557 Bacteria 16339
481 Ga0495622_0001128 3300046557 Bacteria 13945
482 Ga0495622_0006570 3300046557 Bacteria 5391
483 Ga0495622_0013426 3300046557 Bacteria 3799
484 Ga0495622_0024866 3300046557 Bacteria 2796
485 Ga0495633_0002810 3300046558 Bacteria 12039
486 Ga0495633_0029262 3300046558 Bacteria 2680
487 Ga0495633_0038664 3300046558 Bacteria 2278
488 Ga0495656_0000270 3300046615 Bacteria 18372
489 Ga0495656_0000938 3300046615 Bacteria 9435
490 Ga0495656_0042289 3300046615 Bacteria 1907
491 Ga0495668_0000046 3300046616 Bacteria 224203
492 Ga0495668_0000776 3300046616 Bacteria 37248
493 Ga0495668_0026391 3300046616 Bacteria 3296
494 Ga0495668_0053048 3300046616 Bacteria 2243
495 Ga0495634_0004177 3300046642 Bacteria 11403
496 Ga0495634_0099202 3300046642 Bacteria 1883
497 Ga0495611_0002459 3300046648 Bacteria 8459
498 Ga0495611_0004180 3300046648 Bacteria 6282
499 Ga0495611_0007504 3300046648 Bacteria 4629
500 Ga0495611_0016560 3300046648 Bacteria 3151
501 Ga0495625_0000101 3300046660 Bacteria 139139
502 Ga0495625_0002402 3300046660 Bacteria 20301
503 Ga0495625_0004203 3300046660 Bacteria 13721
504 Ga0495625_0005071 3300046660 Bacteria 12192
505 Ga0495625_0023330 3300046660 Bacteria 4727
506 Ga0495625_0025412 3300046660 Bacteria 4493
507 Ga0495625_0027971 3300046660 Bacteria 4233
508 Ga0495625_0034675 3300046660 Bacteria 3723
509 Ga0495625_0039537 3300046660 Bacteria 3443
510 Ga0495625_0124826 3300046660 Bacteria 1748
511 Ga0495635_0000142 3300046663 Bacteria 43626
512 Ga0495635_0018404 3300046663 Bacteria 4875
513 Ga0495659_0000002 3300046664 Bacteria 176698
514 Ga0495659_0000631 3300046664 Bacteria 12813
515 Ga0495659_0001053 3300046664 Bacteria 9632
516 Ga0495659_0003361 3300046664 Bacteria 5127
517 Ga0495661_0000024 3300046665 Bacteria 188844
518 Ga0495661_0001088 3300046665 Bacteria 23860
519 Ga0495661_0005288 3300046665 Bacteria 9176
520 Ga0495661_0005623 3300046665 Bacteria 8893
521 Ga0495661_0011271 3300046665 Bacteria 6068
522 Ga0495661_0012444 3300046665 Bacteria 5744
523 Ga0495661_0012690 3300046665 Bacteria 5687
524 Ga0495661_0022767 3300046665 Bacteria 4073
525 Ga0495661_0027126 3300046665 Bacteria 3678
526 Ga0495661_0030785 3300046665 Bacteria 3414
527 Ga0495661_0071194 3300046665 Bacteria 2032
528 Ga0495588_0009372 3300046674 Bacteria 4523
529 Ga0495588_0027584 3300046674 Bacteria 2838
530 Ga0495588_0035263 3300046674 Bacteria 2534
531 Ga0495588_0063760 3300046674 Bacteria 1911
532 Ga0495588_0076377 3300046674 Bacteria 1746
533 Ga0495599_0010719 3300046678 Bacteria 5613
534 Ga0495623_0003295 3300046679 Bacteria 10663
535 Ga0495623_0005249 3300046679 Bacteria 8494
536 Ga0495646_0027993 3300046680 Bacteria 3532
537 Ga0495646_0081796 3300046680 Bacteria 1880
538 Ga0495669_0003122 3300046684 Bacteria 6815
539 Ga0495669_0013821 3300046684 Bacteria 3446
540 Ga0495669_0014277 3300046684 Bacteria 3397
541 Ga0495669_0052350 3300046684 Bacteria 1834
542 Ga0495613_0031426 3300046689 Bacteria 3944
543 Ga0495613_0128361 3300046689 Bacteria 1816
544 Ga0495624_0001964 3300046690 Bacteria 15647
545 Ga0495624_0005770 3300046690 Bacteria 8869
546 Ga0495624_0088120 3300046690 Bacteria 1916
547 Ga0495670_0013957 3300046691 Bacteria 3951
548 Ga0495670_0035319 3300046691 Bacteria 2491
549 Ga0495670_0082544 3300046691 Bacteria 1639
550 Ga0495671_0000320 3300046692 Bacteria 40570
551 Ga0495671_0000382 3300046692 Bacteria 36493
552 Ga0495671_0000685 3300046692 Bacteria 24518
553 Ga0495671_0000709 3300046692 Bacteria 24153
554 Ga0495671_0004586 3300046692 Bacteria 8223
555 Ga0495671_0008151 3300046692 Bacteria 5911
556 Ga0495671_0018981 3300046692 Bacteria 3641
557 Ga0495671_0031071 3300046692 Bacteria 2731
558 Ga0495671_0044785 3300046692 Bacteria 2217
559 Ga0495671_0044883 3300046692 Bacteria 2214
560 Ga0495671_0078271 3300046692 Bacteria 1621
561 Ga0495649_0000070 3300046694 Bacteria 89578
562 Ga0495649_0000109 3300046694 Bacteria 72797
563 Ga0495649_0000154 3300046694 Bacteria 60553
564 Ga0495649_0001866 3300046694 Bacteria 15420
565 Ga0495649_0017726 3300046694 Bacteria 4015
566 Ga0495649_0042263 3300046694 Bacteria 2490
567 Ga0495649_0045070 3300046694 Bacteria 2406
568 Ga0495649_0050734 3300046694 Bacteria 2250
569 Ga0495649_0099301 3300046694 Bacteria 1548
570 Ga0495589_0000544 3300046794 Bacteria 26230
571 Ga0495589_0007180 3300046794 Bacteria 5834
572 Ga0495589_0014021 3300046794 Bacteria 4132
573 Ga0495589_0016374 3300046794 Bacteria 3811
574 Ga0495589_0042562 3300046794 Bacteria 2263
575 Ga0495600_0009629 3300046809 Bacteria 5972
576 Ga0495600_0036526 3300046809 Bacteria 3193
577 Ga0495660_0000439 3300046810 Bacteria 34751
578 Ga0495660_0001321 3300046810 Bacteria 17107
579 Ga0495660_0002216 3300046810 Bacteria 12514
580 Ga0495660_0004536 3300046810 Bacteria 8392
581 Ga0495660_0006045 3300046810 Bacteria 7188
582 Ga0495660_0006734 3300046810 Bacteria 6783
583 Ga0495660_0012857 3300046810 Bacteria 4854
584 Ga0495660_0021199 3300046810 Bacteria 3722
585 Ga0495660_0022681 3300046810 Bacteria 3582
586 Ga0495660_0026140 3300046810 Bacteria 3311
587 Ga0495660_0041343 3300046810 Bacteria 2553
588 Ga0495660_0065211 3300046810 Bacteria 1944
589 Ga0495581_0005793 3300047315 Bacteria 7163
590 Ga0495581_0027914 3300047315 Bacteria 3274
591 Ga0495581_0083295 3300047315 Bacteria 1852
592 Ga0495636_0004096 3300047318 Bacteria 5702
593 Ga0495674_0010514 3300047319 Bacteria 8758
594 Ga0495674_0025381 3300047319 Bacteria 5434
595 Ga0495674_0122549 3300047319 Bacteria 2195
596 Ga0495674_0130906 3300047319 Bacteria 2113
597 Ga0495672_0000019 3300047320 Bacteria 448153
598 Ga0495672_0002352 3300047320 Bacteria 17472
599 Ga0495672_0003138 3300047320 Bacteria 14382
600 Ga0495672_0003442 3300047320 Bacteria 13546
601 Ga0495672_0003897 3300047320 Bacteria 12520
602 Ga0495672_0004223 3300047320 Bacteria 11879
603 Ga0495672_0005450 3300047320 Bacteria 10092
604 Ga0495672_0005476 3300047320 Bacteria 10063
605 Ga0495672_0006544 3300047320 Bacteria 8981
606 Ga0495672_0012133 3300047320 Bacteria 6031
607 Ga0495676_0000071 3300047321 Bacteria 76592
608 Ga0495676_0021777 3300047321 Bacteria 5590
609 Ga0495676_0026082 3300047321 Bacteria 5035
610 Ga0495676_0075195 3300047321 Bacteria 2584
611 Ga0495680_0027706 3300047322 Bacteria 4650
612 Ga0495680_0048836 3300047322 Bacteria 3320
613 Ga0495680_0193925 3300047322 Bacteria 1460
614 Ga0495683_0000022 3300047323 Bacteria 163268
615 Ga0495683_0000567 3300047323 Bacteria 27911
616 Ga0495683_0001855 3300047323 Bacteria 13261
617 Ga0495683_0008036 3300047323 Bacteria 5663
618 Ga0495683_0016340 3300047323 Bacteria 3855
619 Ga0495683_0020129 3300047323 Bacteria 3443
620 Ga0495687_003024 3300047443 Bacteria 12659
621 Ga0495687_004710 3300047443 Bacteria 9045
622 Ga0495687_008369 3300047443 Bacteria 5925
623 Ga0495687_015375 3300047443 Bacteria 3896
624 Ga0495687_022935 3300047443 Bacteria 2989
625 Ga0495687_023190 3300047443 Bacteria 2968
626 Ga0495675_0003662 3300047444 Bacteria 9287
627 Ga0495675_0083742 3300047444 Bacteria 2007
628 Ga0495677_0000486 3300047445 Bacteria 16837
629 Ga0495677_0024984 3300047445 Bacteria 2167
630 Ga0495679_000026 3300047446 Bacteria 196639
631 Ga0495679_000245 3300047446 Bacteria 45040
632 Ga0495679_001065 3300047446 Bacteria 16654
633 Ga0495679_002264 3300047446 Bacteria 9936
634 Ga0495679_002411 3300047446 Bacteria 9543
635 Ga0495679_013512 3300047446 Bacteria 3061
636 Ga0495679_022733 3300047446 Bacteria 2141
637 Ga0495679_031362 3300047446 Bacteria 1715
638 Ga0495685_005730 3300047447 Bacteria 4055
639 Ga0495673_0000335 3300047469 Bacteria 60281
640 Ga0495673_0000515 3300047469 Bacteria 40877
641 Ga0495673_0000624 3300047469 Bacteria 34803
642 Ga0495673_0001677 3300047469 Bacteria 17028
643 Ga0495673_0001908 3300047469 Bacteria 15577
644 Ga0495673_0002358 3300047469 Bacteria 13408
645 Ga0495673_0002378 3300047469 Bacteria 13338
646 Ga0495673_0002456 3300047469 Bacteria 13029
647 Ga0495673_0007801 3300047469 Bacteria 6096
648 Ga0495673_0010315 3300047469 Bacteria 5090
649 Ga0495673_0012572 3300047469 Bacteria 4481
650 Ga0495681_0000848 3300047470 Bacteria 23547
651 Ga0495681_0001618 3300047470 Bacteria 16747
652 Ga0495681_0004850 3300047470 Bacteria 9097
653 Ga0495681_0007520 3300047470 Bacteria 6941
654 Ga0495681_0008059 3300047470 Bacteria 6637
655 Ga0495681_0009962 3300047470 Bacteria 5796
656 Ga0495681_0016898 3300047470 Bacteria 4069
657 Ga0495681_0030346 3300047470 Bacteria 2753
658 Ga0495681_0033611 3300047470 Bacteria 2566
659 Ga0495684_0112059 3300047471 Bacteria 2058
660 Ga0495686_0000810 3300047472 Bacteria 40514
661 Ga0495686_0000830 3300047472 Bacteria 39724
662 Ga0495686_0001886 3300047472 Bacteria 20962
663 Ga0495686_0002373 3300047472 Bacteria 17940
664 Ga0495686_0002910 3300047472 Bacteria 15372
665 Ga0495686_0014653 3300047472 Bacteria 5391
666 Ga0495686_0050290 3300047472 Bacteria 2619
667 Ga0495686_0080677 3300047472 Bacteria 1988
668 Ga0495593_0000777 3300047673 Bacteria 18553
669 Ga0495593_0007037 3300047673 Bacteria 6597
670 Ga0495593_0012534 3300047673 Bacteria 4845
671 Ga0495593_0034328 3300047673 Bacteria 2759
672 Ga0495602_0058452 3300048088 Bacteria 3374
673 Ga0495602_0074043 3300048088 Bacteria 2896
674 Ga0495614_0014589 3300048089 Bacteria 3436
675 Ga0495626_0000045 3300048091 Bacteria 164931
676 Ga0495626_0000404 3300048091 Bacteria 44168
677 Ga0495626_0000557 3300048091 Bacteria 36990
678 Ga0495626_0001583 3300048091 Bacteria 17798
679 Ga0495626_0001856 3300048091 Bacteria 15851
680 Ga0495626_0007726 3300048091 Bacteria 5960
681 Ga0495626_0007943 3300048091 Bacteria 5867
682 Ga0495626_0008917 3300048091 Bacteria 5445
683 Ga0495626_0014377 3300048091 Bacteria 4087
684 Ga0495626_0040397 3300048091 Bacteria 2203
685 Ga0496101_0002463 3300048904 Bacteria 11371
686 Ga0496102_0004705 3300048905 Bacteria 11552
687 Ga0496102_0034265 3300048905 Bacteria 4566
688 Ga0496102_0196930 3300048905 Bacteria 1899
689 Ga0496103_0003613 3300048906 Bacteria 9436
690 Ga0496103_0025506 3300048906 Bacteria 3573
691 Ga0496103_0050216 3300048906 Bacteria 2580
692 Ga0496104_0104823 3300048907 Bacteria 2710
693 Ga0496106_0000334 3300048909 Bacteria 33088
694 Ga0496106_0005269 3300048909 Bacteria 9582
695 Ga0496108_0095964 3300048911 Bacteria 2525
696 Ga0496110_0000528 3300048913 Bacteria 25966
697 Ga0496110_0004994 3300048913 Bacteria 10363
698 Ga0496110_0030047 3300048913 Bacteria 4682
699 Ga0496110_0043143 3300048913 Bacteria 3938
700 Ga0496110_0112623 3300048913 Bacteria 2446
701 Ga0496111_0011297 3300048914 Bacteria 6010
702 Ga0496111_0026196 3300048914 Bacteria 4117
703 Ga0496114_0243720 3300048917 Bacteria 1581
704 Ga0496115_0042311 3300048918 Bacteria 3629
705 Ga0496115_0112140 3300048918 Bacteria 2241
706 Ga0496116_0002307 3300048919 Bacteria 20229
707 Ga0496116_0017805 3300048919 Bacteria 5501
708 Ga0496116_0024960 3300048919 Bacteria 4405
709 Ga0496116_0060550 3300048919 Bacteria 2455
710 Ga0496117_0003820 3300048920 Bacteria 17135
711 Ga0496117_0006264 3300048920 Bacteria 12124
712 Ga0496117_0006817 3300048920 Bacteria 11373
713 Ga0496117_0022739 3300048920 Bacteria 5021
714 Ga0496117_0024924 3300048920 Bacteria 4712
715 Ga0496117_0028759 3300048920 Bacteria 4298
716 Ga0496118_0000230 3300048921 Bacteria 98002
717 Ga0496118_0000401 3300048921 Bacteria 73186
718 Ga0496118_0006350 3300048921 Bacteria 13041
719 Ga0496118_0018841 3300048921 Bacteria 6197
720 Ga0496118_0026196 3300048921 Bacteria 4973
721 Ga0496118_0030839 3300048921 Bacteria 4462
722 Ga0496118_0050612 3300048921 Bacteria 3186
723 Ga0496121_0001999 3300048924 Bacteria 32384
724 Ga0496121_0003905 3300048924 Bacteria 20690
725 Ga0496121_0004910 3300048924 Bacteria 17550
726 Ga0496121_0011463 3300048924 Bacteria 9841
727 Ga0496121_0017091 3300048924 Bacteria 7437
728 Ga0496121_0030946 3300048924 Bacteria 4904
729 Ga0496122_0001375 3300048925 Bacteria 39555
730 Ga0496122_0002525 3300048925 Bacteria 25773
731 Ga0496122_0004000 3300048925 Bacteria 18790
732 Ga0496122_0006573 3300048925 Bacteria 13282
733 Ga0496122_0011884 3300048925 Bacteria 8748
734 Ga0496122_0093366 3300048925 Bacteria 2041
735 Ga0496123_0000136 3300048926 Bacteria 152399
736 Ga0496123_0001404 3300048926 Bacteria 33675
737 Ga0496123_0002971 3300048926 Bacteria 19729
738 Ga0496123_0030793 3300048926 Bacteria 3920
739 Ga0496124_0000833 3300048927 Bacteria 50309
740 Ga0496124_0001990 3300048927 Bacteria 27859
741 Ga0496124_0004093 3300048927 Bacteria 17250
742 Ga0496124_0004248 3300048927 Bacteria 16859
743 Ga0496124_0005069 3300048927 Bacteria 15029
744 Ga0496124_0010435 3300048927 Bacteria 9402
745 Ga0496124_0017286 3300048927 Bacteria 6802
746 Ga0496124_0020549 3300048927 Bacteria 6097
747 Ga0496124_0023182 3300048927 Bacteria 5672
748 Ga0496124_0059115 3300048927 Bacteria 3221
749 Ga0496125_0000196 3300048928 Bacteria 129294
750 Ga0496125_0009441 3300048928 Bacteria 10017
751 Ga0496125_0018244 3300048928 Bacteria 6669
752 Ga0496125_0021777 3300048928 Bacteria 5964
753 Ga0496125_0041095 3300048928 Bacteria 3957
754 Ga0496126_0000389 3300048929 Bacteria 90452
755 Ga0496126_0004363 3300048929 Bacteria 16963
756 Ga0496126_0055196 3300048929 Bacteria 3595
757 Ga0495678_000377 3300049459 Bacteria 45250
758 Ga0495678_000796 3300049459 Bacteria 28272
759 Ga0495678_002564 3300049459 Bacteria 12171
760 Ga0495678_003056 3300049459 Bacteria 10627
761 Ga0495678_003232 3300049459 Bacteria 10216
762 Ga0495678_007973 3300049459 Bacteria 5417
763 Ga0495678_009748 3300049459 Bacteria 4719
764 Ga0495678_020220 3300049459 Bacteria 2952
765 Ga0495678_023239 3300049459 Bacteria 2699
766 Ga0495682_0000254 3300049460 Bacteria 42240
767 Ga0495682_0001072 3300049460 Bacteria 16087
768 Ga0495682_0001744 3300049460 Bacteria 11018
769 Ga0495682_0001966 3300049460 Bacteria 10169
770 Ga0495682_0008401 3300049460 Bacteria 4065
771 Ga0495682_0010297 3300049460 Bacteria 3624
772 Ga0495682_0025336 3300049460 Bacteria 2208
773 Ga0495682_0035028 3300049460 Bacteria 1850
774 nmdc:mga03683_23668_c1 3300050489 Bacteria 2395
775 nmdc:mga00v17_45122_c1 3300050491 Bacteria 2662
776 nmdc:mga07m45_24184_c1 3300050496 Bacteria 3326
777 nmdc:mga05p37_163394_c1 3300050507 Bacteria 2718
778 nmdc:mga05p37_274862_c1 3300050507 Bacteria 2012
779 nmdc:mga0n895_42228_c1 3300050512 Bacteria 4436
780 nmdc:mga0a205_70917_c1 3300050515 Bacteria 3365
781 Ga0500659_0003317 3300053135 Bacteria 9467
782 Ga0500634_0006669 3300053161 Bacteria 5610
783 2510281473 2510065053 Bacteria 5005518
784 2510282296 2510065053 Bacteria 5005518
785 2510291519 2510065055 Bacteria 5037935
786 2510292358 2510065055 Bacteria 5037935
787 2510309621 2510065058 Bacteria 5005894
788 2510310444 2510065058 Bacteria 5005894
789 2511253422 2511231004 Bacteria 6669789
790 2511265102 2511231006 Bacteria 6794709
791 2511270382 2511231007 Bacteria 6306603
792 2511300773 2511231012 Bacteria 6738011
793 2511312450 2511231014 Bacteria 6462302
794 2511323346 2511231015 Bacteria 6598026
795 2511324026 2511231016 Bacteria 6704427
796 2511331219 2511231017 Bacteria 6503007
797 2511351051 2511231020 Bacteria 6115223
798 2511357718 2511231021 Bacteria 7302637
799 2511366315 2511231022 Bacteria 6719296
800 2511415758 2511231031 Bacteria 6558529
801 2512345958 2512047030 Bacteria 9031815
802 2515689307 2515154123 Bacteria 6387382
803 2516018686 2515154189 Bacteria 9629850
804 2601796037 2600255318 Bacteria 6383414
805 2606075111 2603880185 Bacteria 6379190
806 2606127974 2603880199 Bacteria 6377649
807 2643842649 2643221565 Bacteria 6216018
808 2643954539 2643221589 Bacteria 6250934
809 2644023348 2643221602 Bacteria 6249926
810 2644186690 2643221633 Bacteria 6733554
811 2644251868 2643221645 Bacteria 7207331
812 2715758525 2713897149 Bacteria 6506249
813 2738740422 2738541280 Bacteria 6630198
814 2738843325 2738541300 Bacteria 6675882
815 2739258069 2738543015 Bacteria 6750701
816 2739275602 2738543018 Bacteria 6718814
817 2739344646 2738543030 Bacteria 6719714
818 2746091204 2744054900 Bacteria 8399525
819 2746097637 2744054901 Bacteria 8397047
820 2765583728 2765235841 Bacteria 6137024
821 2792839418 2791355137 Bacteria 9654227
822 2842332291 2842324504 Bacteria 9364110
823 2842356538 2842348783 Bacteria 9002918
824 2842460872 2842454564 Bacteria 8730687
825 2842891848 2842888712 Bacteria 4279094
826 2878031990 2878029506 Bacteria 6418441
827 2883090214 2883087390 Bacteria 9532701
828 2885277960 2885270888 Bacteria 9831543
829 2904621610 2904615490 Bacteria 10047340
830 2908673453 2908669403 Bacteria 5740494
831 2931402856 2931396565 Bacteria 7251677
832 3007618413 3007614139 Bacteria 6053559
833 3007808845 3007803356 Bacteria 5931491
834 3007876614 3007872151 Bacteria 5268868
835 8054932562 8054929484 Bacteria 5599761
836 8056178801 8056177738 Bacteria 6748268
837 Ga0395905_0002486
838 MRS2a_Contig_5159
839 MRS2a_Contig_9283
840 SwRhRL2b_contig_833017
841 JGI25156J39149_1003941
842 JGI25159J45721_1001342
843 Ga0055542_1007504
844 Ga0055526_1001553
845 Ga0055537_1000681
846 Ga0055524_1005422
847 Ga0055536_1000182
848 Ga0055534_1000217
849 Ga0055528_1000042
850 Ga0055530_10000448
851 Ga0055530_10000530
852 Ga0055540_1000122
853 Ga0055540_1000268
854 Ga0055531_10000146
855 Ga0055531_10006153
856 Ga0065165_1000003
857 Ga0065714_10000224
858 Ga0065714_10005580
859 Ga0065714_10013504
860 Ga0065714_10110444
861 Ga0065704_10072267
862 Ga0065704_10138532
863 Ga0065704_10150087
864 Ga0065712_10001997
865 Ga0065715_10005821
866 Ga0070670_100094055
867 Ga0070677_10007750
868 Ga0070661_100001945
869 Ga0070659_100000661
870 Ga0070711_100017338
871 Ga0070678_100061527
872 Ga0070707_100015628
873 Ga0070698_100007295
874 Ga0070699_100001621
875 Ga0070699_100020221
876 Ga0070697_100002273
877 Ga0070672_100219094
878 Ga0070665_100019759
879 Ga0068855_100147412
880 Ga0070664_100017134
881 Ga0070702_100111858
882 Ga0068866_10048037
883 Ga0068862_100170975
884 Ga0081455_10118157
885 Ga0075363_100018233
886 Ga0075364_10021278
887 Ga0075432_10000482
888 Ga0075432_10012718
889 Ga0075432_10014249
890 Ga0070712_100012323
891 Ga0070712_100063180
892 Ga0075362_10019042
893 Ga0075362_10024797
894 Ga0075370_10071870
895 Ga0075433_10028589
896 Ga0099823_1000050
897 Ga0079104_1003077
898 Ga0105251_10000038
899 Ga0105251_10001289
900 Ga0105251_10005569
901 Ga0105251_10008986
902 Ga0105251_10010858
903 Ga0105251_10012159
904 Ga0105251_10013841
905 Ga0105251_10025412
906 Ga0105251_10045898
907 Ga0105244_10001385
908 Ga0105244_10002330
909 Ga0105244_10002532
910 Ga0105244_10022447
911 Ga0105250_10005563
912 Ga0105250_10006860
913 Ga0105250_10018807
914 Ga0105240_10002844
915 Ga0105247_10119196
916 Ga0114129_10074287
917 Ga0114129_10252369
918 Ga0105243_10014635
919 Ga0105248_10034171
920 Ga0105237_10001202
921 Ga0105238_10006297
922 Ga0105249_10086282
923 Ga0157345_1000146
924 Ga0157371_10000595
925 Ga0157370_10003919
926 Ga0157370_10009259
927 Ga0157370_10048224
928 Ga0157370_10092657
929 Ga0157369_10005429
930 Ga0163162_10043981
931 Ga0163162_10129821
932 Ga0182008_10001181
933 Ga0182008_10002772
934 Ga0182008_10016194
935 Ga0182006_1001476
936 Ga0182006_1004144
937 Ga0182007_10000492
938 Ga0183361_10020
939 Ga0163161_10000683
940 Ga0163161_10001374
941 Ga0163161_10007389
942 Ga0163161_10212521
943 Ga0209148_1000596
944 Ga0209759_1000150
945 Ga0209565_1000018
946 Ga0209565_1006313
947 Ga0209673_1000006
948 Ga0209130_1000036
949 Ga0209675_1000005
950 Ga0209675_1003445
951 Ga0209676_1000102
952 Ga0209676_1001013
953 Ga0209676_1004024
954 Ga0209564_1000078
955 Ga0209050_1000082
956 Ga0209050_1000105
957 Ga0209050_1000229
958 Ga0209050_1021666
959 Ga0209256_1000049
960 Ga0209256_1000070
961 Ga0207426_1011379
962 Ga0209051_1000029
963 Ga0209051_1000066
964 Ga0209051_1005940
965 Ga0209257_1000124
966 Ga0209257_1000168
967 Ga0207696_1002699
968 Ga0207696_1002772
969 Ga0207696_1006528
970 Ga0207696_1013883
971 Ga0207655_1000039
972 Ga0207655_1000081
973 Ga0207655_1000481
974 Ga0207655_1010671
975 Ga0207655_1011260
976 Ga0207713_1000185
977 Ga0207713_1005290
978 Ga0207713_1007802
979 Ga0207713_1008617
980 Ga0207713_1010302
981 Ga0207713_1011806
982 Ga0207713_1016376
983 Ga0207713_1018082
984 Ga0207682_10012923
985 Ga0207688_10074655
986 Ga0207699_10128365
987 Ga0207684_10052363
988 Ga0207695_10005993
989 Ga0207693_10016361
990 Ga0207663_10014014
991 Ga0207649_10000932
992 Ga0207646_10018806
993 Ga0207650_10073112
994 Ga0207690_10059268
995 Ga0207691_10227472
996 Ga0207711_10023799
997 Ga0207679_10000119
998 Ga0207658_10103856
999 Ga0207675_100179407
1000 Ga0207683_10026298
1001 Ga0207683_10079808
1002 Ga0209389_1000053
1003 Ga0207428_10002856
1004 Ga0207428_10028891
1005 Ga0207428_10059810
1006 Ga0268266_10028512
1007 Ga0265338_10000045
1008 Ga0268256_1013443
1009 Ga0307508_10000412
1010 Ga0307516_10001226
1011 Ga0373931_0097168
1012 Ga0395899_0013949
1013 Ga0395899_0030628
1014 Ga0395898_0318690
1015 Ga0395905_0001977
1016 Ga0395905_0004343
1017 Ga0395905_0004380
1018 Ga0395901_0009029
1019 Ga0439438_003482
1020 Ga0439466_0015762
1021 Ga0439432_004223
1022 Ga0439452_000908
1023 Ga0439456_001850
1024 Ga0439456_013454
1025 Ga0439463_026169
1026 Ga0450900_000321
1027 Ga0450902_000378
1028 Ga0450902_000931
1029 Ga0439460_0001234
1030 Ga0450901_000007
1031 Ga0466969_0004219
1032 Ga0466966_0009874
1033 Ga0466961_0000231
1034 Ga0466961_0012714
1035 Ga0453684_0005886
1036 Ga0466970_0010298
1037 Ga0466960_0098242
1038 Ga0466959_0009421
1039 Ga0466959_0068996
1040 Ga0495617_001657
1041 Ga0495617_002284
1042 Ga0495617_003726
1043 Ga0495617_004023
1044 Ga0495617_004409
1045 Ga0495627_001298
1046 Ga0495627_005153
1047 Ga0495627_005868
1048 Ga0495627_006284
1049 Ga0495592_0083473
1050 Ga0495603_0008656
1051 Ga0495590_0000487
1052 Ga0495590_0001793
1053 Ga0495590_0008744
1054 Ga0495590_0008821
1055 Ga0495590_0015723
1056 Ga0495590_0034868
1057 Ga0495590_0045555
1058 Ga0495591_000005
1059 Ga0495591_000221
1060 Ga0495591_000356
1061 Ga0495591_000364
1062 Ga0495591_000568
1063 Ga0495591_000818
1064 Ga0495591_000985
1065 Ga0495591_002493
1066 Ga0495591_005726
1067 Ga0495591_005888
1068 Ga0495591_015832
1069 Ga0495591_017651
1070 Ga0495629_0001063
1071 Ga0495629_0001722
1072 Ga0495629_0005730
1073 Ga0495629_0039433
1074 Ga0495638_0000196
1075 Ga0495638_0001031
1076 Ga0495638_0001507
1077 Ga0495638_0002819
1078 Ga0495638_0008159
1079 Ga0495638_0014124
1080 Ga0495638_0018656
1081 Ga0495638_0034915
1082 Ga0495638_0035531
1083 Ga0495638_0037093
1084 Ga0495638_0046896
1085 Ga0495638_0081062
1086 Ga0495651_0009049
1087 Ga0495653_0015156
1088 Ga0495653_0021637
1089 Ga0495653_0051176
1090 Ga0495653_0098141
1091 Ga0495650_0000405
1092 Ga0495650_0000651
1093 Ga0495650_0000896
1094 Ga0495650_0001556
1095 Ga0495650_0002566
1096 Ga0495650_0003886
1097 Ga0495650_0005305
1098 Ga0495650_0008407
1099 Ga0495650_0019440
1100 Ga0495650_0022629
1101 Ga0495580_0038208
1102 Ga0495580_0039398
1103 Ga0495580_0073178
1104 Ga0495580_0128255
1105 Ga0495582_0019023
1106 Ga0495582_0041633
1107 Ga0495582_0104327
1108 Ga0495605_0000009
1109 Ga0495605_0000242
1110 Ga0495605_0002640
1111 Ga0495605_0004181
1112 Ga0495605_0009781
1113 Ga0495605_0012353
1114 Ga0495605_0018138
1115 Ga0495605_0024864
1116 Ga0495605_0053899
1117 Ga0495605_0074193
1118 Ga0495639_0002382
1119 Ga0495639_0015986
1120 Ga0495639_0016835
1121 Ga0495662_0027025
1122 Ga0495664_0035304
1123 Ga0495664_0074624
1124 Ga0495584_0000018
1125 Ga0495584_0000230
1126 Ga0495584_0000346
1127 Ga0495584_0000574
1128 Ga0495584_0002952
1129 Ga0495584_0003172
1130 Ga0495584_0003406
1131 Ga0495584_0008312
1132 Ga0495584_0008924
1133 Ga0495584_0014998
1134 Ga0495584_0049309
1135 Ga0495584_0051852
1136 Ga0495585_0000030
1137 Ga0495585_0006562
1138 Ga0495585_0008245
1139 Ga0495585_0013595
1140 Ga0495585_0024490
1141 Ga0495585_0035091
1142 Ga0495585_0054148
1143 Ga0495594_0023090
1144 Ga0495596_0000034
1145 Ga0495596_0001312
1146 Ga0495596_0002906
1147 Ga0495596_0005478
1148 Ga0495596_0005591
1149 Ga0495596_0041988
1150 Ga0495607_0000148
1151 Ga0495607_0000645
1152 Ga0495607_0002176
1153 Ga0495607_0003536
1154 Ga0495607_0006633
1155 Ga0495607_0015242
1156 Ga0495607_0020415
1157 Ga0495607_0022609
1158 Ga0495607_0032604
1159 Ga0495607_0080040
1160 Ga0495607_0116086
1161 Ga0495583_0000008
1162 Ga0495583_0000334
1163 Ga0495583_0000369
1164 Ga0495583_0000958
1165 Ga0495583_0001173
1166 Ga0495583_0007444
1167 Ga0495583_0009625
1168 Ga0495583_0013623
1169 Ga0495583_0015874
1170 Ga0495583_0020992
1171 Ga0495583_0048724
1172 Ga0495606_0000122
1173 Ga0495606_0000124
1174 Ga0495606_0001186
1175 Ga0495606_0002367
1176 Ga0495606_0018588
1177 Ga0495606_0094014
1178 Ga0495608_0034669
1179 Ga0495610_0002583
1180 Ga0495610_0014736
1181 Ga0495610_0038534
1182 Ga0495610_0045098
1183 Ga0495610_0069333
1184 Ga0495616_0001384
1185 Ga0495616_0001474
1186 Ga0495616_0002376
1187 Ga0495616_0008814
1188 Ga0495616_0009920
1189 Ga0495616_0010474
1190 Ga0495616_0021334
1191 Ga0495618_0018744
1192 Ga0495618_0034508
1193 Ga0495620_0000030
1194 Ga0495620_0000527
1195 Ga0495620_0000725
1196 Ga0495620_0002042
1197 Ga0495620_0008765
1198 Ga0495620_0010293
1199 Ga0495620_0010690
1200 Ga0495620_0055655
1201 Ga0495628_0023537
1202 Ga0495628_0097688
1203 Ga0495630_0010670
1204 Ga0495630_0048456
1205 Ga0495630_0085990
1206 Ga0495631_0000763
1207 Ga0495631_0002793
1208 Ga0495631_0006880
1209 Ga0495631_0011977
1210 Ga0495631_0014186
1211 Ga0495631_0022168
1212 Ga0495631_0044904
1213 Ga0495632_0000142
1214 Ga0495632_0000553
1215 Ga0495632_0000809
1216 Ga0495632_0001230
1217 Ga0495632_0002313
1218 Ga0495632_0004154
1219 Ga0495632_0005290
1220 Ga0495632_0005882
1221 Ga0495632_0006402
1222 Ga0495632_0007114
1223 Ga0495632_0011608
1224 Ga0495632_0011646
1225 Ga0495632_0044904
1226 Ga0495637_0000082
1227 Ga0495637_0000334
1228 Ga0495637_0000967
1229 Ga0495637_0001362
1230 Ga0495637_0002662
1231 Ga0495637_0004015
1232 Ga0495637_0005403
1233 Ga0495637_0007126
1234 Ga0495637_0007448
1235 Ga0495637_0008292
1236 Ga0495637_0010552
1237 Ga0495643_0000295
1238 Ga0495643_0000574
1239 Ga0495643_0009625
1240 Ga0495643_0010114
1241 Ga0495643_0011455
1242 Ga0495643_0011628
1243 Ga0495643_0016225
1244 Ga0495643_0017382
1245 Ga0495643_0018980
1246 Ga0495643_0027151
1247 Ga0495643_0028702
1248 Ga0495643_0037596
1249 Ga0495644_0000105
1250 Ga0495644_0000159
1251 Ga0495644_0001768
1252 Ga0495648_0000471
1253 Ga0495648_0000636
1254 Ga0495648_0001090
1255 Ga0495648_0001478
1256 Ga0495648_0002828
1257 Ga0495648_0003509
1258 Ga0495648_0006024
1259 Ga0495648_0006475
1260 Ga0495648_0006601
1261 Ga0495648_0007357
1262 Ga0495648_0026233
1263 Ga0495648_0049319
1264 Ga0495648_0061811
1265 Ga0495663_0001421
1266 Ga0495663_0017455
1267 Ga0495666_0009568
1268 Ga0495666_0025571
1269 Ga0495666_0048747
1270 Ga0495642_0000082
1271 Ga0495642_0000233
1272 Ga0495642_0000832
1273 Ga0495642_0005143
1274 Ga0495642_0015391
1275 Ga0495642_0017534
1276 Ga0495642_0034700
1277 Ga0495654_0000088
1278 Ga0495654_0000769
1279 Ga0495654_0000851
1280 Ga0495654_0001220
1281 Ga0495654_0001409
1282 Ga0495654_0001496
1283 Ga0495654_0005676
1284 Ga0495654_0009184
1285 Ga0495654_0014621
1286 Ga0495654_0015750
1287 Ga0495654_0020301
1288 Ga0495665_0002139
1289 Ga0495665_0047004
1290 Ga0495640_0018531
1291 Ga0495586_0068473
1292 Ga0495587_0000190
1293 Ga0495587_0041010
1294 Ga0495587_0046575
1295 Ga0495609_0000043
1296 Ga0495609_0000152
1297 Ga0495609_0000316
1298 Ga0495609_0000740
1299 Ga0495609_0001746
1300 Ga0495609_0004110
1301 Ga0495609_0008782
1302 Ga0495609_0018956
1303 Ga0495609_0064868
1304 Ga0495621_0022590
1305 Ga0495597_0001542
1306 Ga0495597_0002076
1307 Ga0495597_0003234
1308 Ga0495597_0005419
1309 Ga0495597_0006725
1310 Ga0495597_0012474
1311 Ga0495597_0014329
1312 Ga0495597_0036759
1313 Ga0495645_0016307
1314 Ga0495645_0019538
1315 Ga0495622_0000196
1316 Ga0495622_0000882
1317 Ga0495622_0001128
1318 Ga0495622_0006570
1319 Ga0495622_0013426
1320 Ga0495622_0024866
1321 Ga0495633_0002810
1322 Ga0495633_0029262
1323 Ga0495633_0038664
1324 Ga0495656_0000270
1325 Ga0495656_0000938
1326 Ga0495656_0042289
1327 Ga0495668_0000046
1328 Ga0495668_0000776
1329 Ga0495668_0026391
1330 Ga0495668_0053048
1331 Ga0495634_0004177
1332 Ga0495634_0099202
1333 Ga0495611_0002459
1334 Ga0495611_0004180
1335 Ga0495611_0007504
1336 Ga0495611_0016560
1337 Ga0495625_0000101
1338 Ga0495625_0002402
1339 Ga0495625_0004203
1340 Ga0495625_0005071
1341 Ga0495625_0023330
1342 Ga0495625_0025412
1343 Ga0495625_0027971
1344 Ga0495625_0034675
1345 Ga0495625_0039537
1346 Ga0495625_0124826
1347 Ga0495635_0000142
1348 Ga0495635_0018404
1349 Ga0495659_0000002
1350 Ga0495659_0000631
1351 Ga0495659_0001053
1352 Ga0495659_0003361
1353 Ga0495661_0000024
1354 Ga0495661_0001088
1355 Ga0495661_0005288
1356 Ga0495661_0005623
1357 Ga0495661_0011271
1358 Ga0495661_0012444
1359 Ga0495661_0012690
1360 Ga0495661_0022767
1361 Ga0495661_0027126
1362 Ga0495661_0030785
1363 Ga0495661_0071194
1364 Ga0495588_0009372
1365 Ga0495588_0027584
1366 Ga0495588_0035263
1367 Ga0495588_0063760
1368 Ga0495588_0076377
1369 Ga0495599_0010719
1370 Ga0495623_0003295
1371 Ga0495623_0005249
1372 Ga0495646_0027993
1373 Ga0495646_0081796
1374 Ga0495669_0003122
1375 Ga0495669_0013821
1376 Ga0495669_0014277
1377 Ga0495669_0052350
1378 Ga0495613_0031426
1379 Ga0495613_0128361
1380 Ga0495624_0001964
1381 Ga0495624_0005770
1382 Ga0495624_0088120
1383 Ga0495670_0013957
1384 Ga0495670_0035319
1385 Ga0495670_0082544
1386 Ga0495671_0000320
1387 Ga0495671_0000382
1388 Ga0495671_0000685
1389 Ga0495671_0000709
1390 Ga0495671_0004586
1391 Ga0495671_0008151
1392 Ga0495671_0018981
1393 Ga0495671_0031071
1394 Ga0495671_0044785
1395 Ga0495671_0044883
1396 Ga0495671_0078271
1397 Ga0495649_0000070
1398 Ga0495649_0000109
1399 Ga0495649_0000154
1400 Ga0495649_0001866
1401 Ga0495649_0017726
1402 Ga0495649_0042263
1403 Ga0495649_0045070
1404 Ga0495649_0050734
1405 Ga0495649_0099301
1406 Ga0495589_0000544
1407 Ga0495589_0007180
1408 Ga0495589_0014021
1409 Ga0495589_0016374
1410 Ga0495589_0042562
1411 Ga0495600_0009629
1412 Ga0495600_0036526
1413 Ga0495660_0000439
1414 Ga0495660_0001321
1415 Ga0495660_0002216
1416 Ga0495660_0004536
1417 Ga0495660_0006045
1418 Ga0495660_0006734
1419 Ga0495660_0012857
1420 Ga0495660_0021199
1421 Ga0495660_0022681
1422 Ga0495660_0026140
1423 Ga0495660_0041343
1424 Ga0495660_0065211
1425 Ga0495581_0005793
1426 Ga0495581_0027914
1427 Ga0495581_0083295
1428 Ga0495636_0004096
1429 Ga0495674_0010514
1430 Ga0495674_0025381
1431 Ga0495674_0122549
1432 Ga0495674_0130906
1433 Ga0495672_0000019
1434 Ga0495672_0002352
1435 Ga0495672_0003138
1436 Ga0495672_0003442
1437 Ga0495672_0003897
1438 Ga0495672_0004223
1439 Ga0495672_0005450
1440 Ga0495672_0005476
1441 Ga0495672_0006544
1442 Ga0495672_0012133
1443 Ga0495676_0000071
1444 Ga0495676_0021777
1445 Ga0495676_0026082
1446 Ga0495676_0075195
1447 Ga0495680_0027706
1448 Ga0495680_0048836
1449 Ga0495680_0193925
1450 Ga0495683_0000022
1451 Ga0495683_0000567
1452 Ga0495683_0001855
1453 Ga0495683_0008036
1454 Ga0495683_0016340
1455 Ga0495683_0020129
1456 Ga0495687_003024
1457 Ga0495687_004710
1458 Ga0495687_008369
1459 Ga0495687_015375
1460 Ga0495687_022935
1461 Ga0495687_023190
1462 Ga0495675_0003662
1463 Ga0495675_0083742
1464 Ga0495677_0000486
1465 Ga0495677_0024984
1466 Ga0495679_000026
1467 Ga0495679_000245
1468 Ga0495679_001065
1469 Ga0495679_002264
1470 Ga0495679_002411
1471 Ga0495679_013512
1472 Ga0495679_022733
1473 Ga0495679_031362
1474 Ga0495685_005730
1475 Ga0495673_0000335
1476 Ga0495673_0000515
1477 Ga0495673_0000624
1478 Ga0495673_0001677
1479 Ga0495673_0001908
1480 Ga0495673_0002358
1481 Ga0495673_0002378
1482 Ga0495673_0002456
1483 Ga0495673_0007801
1484 Ga0495673_0010315
1485 Ga0495673_0012572
1486 Ga0495681_0000848
1487 Ga0495681_0001618
1488 Ga0495681_0004850
1489 Ga0495681_0007520
1490 Ga0495681_0008059
1491 Ga0495681_0009962
1492 Ga0495681_0016898
1493 Ga0495681_0030346
1494 Ga0495681_0033611
1495 Ga0495684_0112059
1496 Ga0495686_0000810
1497 Ga0495686_0000830
1498 Ga0495686_0001886
1499 Ga0495686_0002373
1500 Ga0495686_0002910
1501 Ga0495686_0014653
1502 Ga0495686_0050290
1503 Ga0495686_0080677
1504 Ga0495593_0000777
1505 Ga0495593_0007037
1506 Ga0495593_0012534
1507 Ga0495593_0034328
1508 Ga0495602_0058452
1509 Ga0495602_0074043
1510 Ga0495614_0014589
1511 Ga0495626_0000045
1512 Ga0495626_0000404
1513 Ga0495626_0000557
1514 Ga0495626_0001583
1515 Ga0495626_0001856
1516 Ga0495626_0007726
1517 Ga0495626_0007943
1518 Ga0495626_0008917
1519 Ga0495626_0014377
1520 Ga0495626_0040397
1521 Ga0496101_0002463
1522 Ga0496102_0004705
1523 Ga0496102_0034265
1524 Ga0496102_0196930
1525 Ga0496103_0003613
1526 Ga0496103_0025506
1527 Ga0496103_0050216
1528 Ga0496104_0104823
1529 Ga0496106_0000334
1530 Ga0496106_0005269
1531 Ga0496108_0095964
1532 Ga0496110_0000528
1533 Ga0496110_0004994
1534 Ga0496110_0030047
1535 Ga0496110_0043143
1536 Ga0496110_0112623
1537 Ga0496111_0011297
1538 Ga0496111_0026196
1539 Ga0496114_0243720
1540 Ga0496115_0042311
1541 Ga0496115_0112140
1542 Ga0496116_0002307
1543 Ga0496116_0017805
1544 Ga0496116_0024960
1545 Ga0496116_0060550
1546 Ga0496117_0003820
1547 Ga0496117_0006264
1548 Ga0496117_0006817
1549 Ga0496117_0022739
1550 Ga0496117_0024924
1551 Ga0496117_0028759
1552 Ga0496118_0000230
1553 Ga0496118_0000401
1554 Ga0496118_0006350
1555 Ga0496118_0018841
1556 Ga0496118_0026196
1557 Ga0496118_0030839
1558 Ga0496118_0050612
1559 Ga0496121_0001999
1560 Ga0496121_0003905
1561 Ga0496121_0004910
1562 Ga0496121_0011463
1563 Ga0496121_0017091
1564 Ga0496121_0030946
1565 Ga0496122_0001375
1566 Ga0496122_0002525
1567 Ga0496122_0004000
1568 Ga0496122_0006573
1569 Ga0496122_0011884
1570 Ga0496122_0093366
1571 Ga0496123_0000136
1572 Ga0496123_0001404
1573 Ga0496123_0002971
1574 Ga0496123_0030793
1575 Ga0496124_0000833
1576 Ga0496124_0001990
1577 Ga0496124_0004093
1578 Ga0496124_0004248
1579 Ga0496124_0005069
1580 Ga0496124_0010435
1581 Ga0496124_0017286
1582 Ga0496124_0020549
1583 Ga0496124_0023182
1584 Ga0496124_0059115
1585 Ga0496125_0000196
1586 Ga0496125_0009441
1587 Ga0496125_0018244
1588 Ga0496125_0021777
1589 Ga0496125_0041095
1590 Ga0496126_0000389
1591 Ga0496126_0004363
1592 Ga0496126_0055196
1593 Ga0495678_000377
1594 Ga0495678_000796
1595 Ga0495678_002564
1596 Ga0495678_003056
1597 Ga0495678_003232
1598 Ga0495678_007973
1599 Ga0495678_009748
1600 Ga0495678_020220
1601 Ga0495678_023239
1602 Ga0495682_0000254
1603 Ga0495682_0001072
1604 Ga0495682_0001744
1605 Ga0495682_0001966
1606 Ga0495682_0008401
1607 Ga0495682_0010297
1608 Ga0495682_0025336
1609 Ga0495682_0035028
1610 nmdc:mga03683_23668_c1
1611 nmdc:mga00v17_45122_c1
1612 nmdc:mga07m45_24184_c1
1613 nmdc:mga05p37_163394_c1
1614 nmdc:mga05p37_274862_c1
1615 nmdc:mga0n895_42228_c1
1616 nmdc:mga0a205_70917_c1
1617 Ga0500659_0003317
1618 Ga0500634_0006669
1619 2510281473
1620 2510282296
1621 2510291519
1622 2510292358
1623 2510309621
1624 2510310444
1625 2511253422
1626 2511265102
1627 2511270382
1628 2511300773
1629 2511312450
1630 2511323346
1631 2511324026
1632 2511331219
1633 2511351051
1634 2511357718
1635 2511366315
1636 2511415758
1637 2512345958
1638 2515689307
1639 2516018686
1640 2601796037
1641 2606075111
1642 2606127974
1643 2643842649
1644 2643954539
1645 2644023348
1646 2644186690
1647 2644251868
1648 2715758525
1649 2738740422
1650 2738843325
1651 2739258069
1652 2739275602
1653 2739344646
1654 2746091204
1655 2746097637
1656 2765583728
1657 2792839418
1658 2842332291
1659 2842356538
1660 2842460872
1661 2842891848
1662 2878031990
1663 2883090214
1664 2885277960
1665 2904621610
1666 2908673453
1667 2931402856
1668 3007618413
1669 3007808845
1670 3007876614
1671 8054932562
1672 8056178801

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

56

448

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rcp-assembly1.cif.gz_A gltph mutant (s279e/d405n) in complex with aspartate and sodium ions 0.8943 4 383
6uwf-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in outward-facing state 0.8913 4 383
6bat-assembly1.cif.gz_A crystal structure of wild-type gltph in complex with l-aspartate 0.8911 9 383
6bav-assembly1.cif.gz_B crystal structure of gltph r397c in complex with s-benzyl-l-cysteine 0.8773 4 383
6bmi-assembly1.cif.gz_B crystal structure of gltph r397c in complex with l-serine 0.8767 4 383
ID Description Score Start End Superfamily
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9816 8 388 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9517 4 388 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9429 16 388 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9152 8 388 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9037 4 388 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A1G5MPG5-F1-model_v4 deleted 0.9818 4 400
AF-A0A2S6H2N5-F1-model_v4 C4-dicarboxylate transport protein 0.9817 8 396 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A4Y3J673-F1-model_v4 C4-dicarboxylate ABC transporter 0.9806 30 396 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A3N8LD07-F1-model_v4 C4-dicarboxylate transporter DctA 0.9786 8 396 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A2N7X2R2-F1-model_v4 Glutamate/aspartate:proton symporter GltP 0.9784 6 398 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778

Map