F482900
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 369 | 798 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0112879|Ga0466967_0112879_175_942 |
| Length | 255 |
| Sequence | MSSSPLFGHSLPSHNTRRYYLYVRQHSGIGVLDKAVGVLHTIAESPCGLAELCERTGLPRATAYRLAAALEVHRLLARDDEGRWRLGPAVTELAARVNDPLLAASAAVLPALRETTGESVQLYRREGTSRVCVAALEPAAGLRDTVPVGARLPMTAGSGAKVLLAYADAATQKAVLPTAKFSDRALAEVRRRGWAQSVAEREPGVASVSAPVRDHRGVVIAAISVSGPVDRIGRRPGARWAADLLSAADALARRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 6 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 7 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 8 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 9 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 10 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 13 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 14 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 15 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 16 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 17 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 18 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 19 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 20 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 21 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 22 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 23 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 24 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 25 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 26 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 27 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 28 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 29 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 30 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 31 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 32 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 33 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 34 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 35 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 36 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 37 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 38 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 39 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 40 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 41 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 42 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 43 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 44 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 160 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 226 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 237 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 238 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 251 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 252 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 253 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 261 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 361 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 369 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.33 |
| Metatranscriptomes | 0.12 |
| Isolates | 4.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 11.36 |
| Nodule | 0.12 |
| Rhizoplane | 10.65 |
| Rhizosphere | 68.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1010674 | 3300002073 | Bacteria | 1046 |
| 2 | JGI24738J21930_10007479 | 3300002075 | Bacteria | 2519 |
| 3 | JGI24738J21930_10008857 | 3300002075 | Bacteria | 2279 |
| 4 | JGI24749J21850_1005080 | 3300002076 | Bacteria | 1845 |
| 5 | JGI24744J21845_10000383 | 3300002077 | Bacteria | 7570 |
| 6 | JGI24742J22300_10000643 | 3300002244 | Bacteria | 5256 |
| 7 | JGI24751J29686_10006298 | 3300002459 | Bacteria | 2417 |
| 8 | JGI25406J46586_10004772 | 3300003203 | Bacteria | 6305 |
| 9 | Ga0055540_1004388 | 3300003792 | Bacteria | 6387 |
| 10 | Ga0055540_1009880 | 3300003792 | Bacteria | 3235 |
| 11 | Ga0055540_1031021 | 3300003792 | Bacteria | 1233 |
| 12 | Ga0070676_10119906 | 3300005328 | Bacteria | 1650 |
| 13 | Ga0070683_100048295 | 3300005329 | Bacteria | 3935 |
| 14 | Ga0070683_100834515 | 3300005329 | Bacteria | 884 |
| 15 | Ga0070690_100001859 | 3300005330 | Bacteria | 11199 |
| 16 | Ga0070690_100301823 | 3300005330 | Bacteria | 1149 |
| 17 | Ga0068869_100058333 | 3300005334 | Bacteria | 2822 |
| 18 | Ga0070666_10034987 | 3300005335 | Bacteria | 3329 |
| 19 | Ga0070666_10639683 | 3300005335 | Bacteria | 778 |
| 20 | Ga0070682_100070143 | 3300005337 | Bacteria | 2239 |
| 21 | Ga0070682_100071726 | 3300005337 | Bacteria | 2218 |
| 22 | Ga0070682_100135754 | 3300005337 | Bacteria | 1671 |
| 23 | Ga0070682_100154163 | 3300005337 | Bacteria | 1580 |
| 24 | Ga0068868_100001302 | 3300005338 | Bacteria | 17195 |
| 25 | Ga0068868_100100301 | 3300005338 | Bacteria | 2343 |
| 26 | Ga0068868_100258935 | 3300005338 | Bacteria | 1466 |
| 27 | Ga0068868_100574735 | 3300005338 | Bacteria | 996 |
| 28 | Ga0068868_101317228 | 3300005338 | Bacteria | 671 |
| 29 | Ga0070660_100080398 | 3300005339 | Bacteria | 2558 |
| 30 | Ga0070660_100360781 | 3300005339 | Bacteria | 1198 |
| 31 | Ga0070689_100038951 | 3300005340 | Bacteria | 3638 |
| 32 | Ga0070689_100143319 | 3300005340 | Bacteria | 1923 |
| 33 | Ga0070691_10000684 | 3300005341 | Bacteria | 13222 |
| 34 | Ga0070668_100001456 | 3300005347 | Bacteria | 17104 |
| 35 | Ga0070668_100020142 | 3300005347 | Bacteria | 5030 |
| 36 | Ga0070668_100084942 | 3300005347 | Bacteria | 2487 |
| 37 | Ga0070668_100203841 | 3300005347 | Bacteria | 1624 |
| 38 | Ga0070668_100505409 | 3300005347 | Bacteria | 1047 |
| 39 | Ga0070671_100000475 | 3300005355 | Bacteria | 27987 |
| 40 | Ga0070671_100002781 | 3300005355 | Bacteria | 13594 |
| 41 | Ga0070671_100159640 | 3300005355 | Bacteria | 1906 |
| 42 | Ga0070671_100276527 | 3300005355 | Bacteria | 1428 |
| 43 | Ga0070671_100314598 | 3300005355 | Bacteria | 1334 |
| 44 | Ga0070674_100001031 | 3300005356 | Bacteria | 14566 |
| 45 | Ga0070674_100004224 | 3300005356 | Bacteria | 8162 |
| 46 | Ga0070674_100117148 | 3300005356 | Bacteria | 1966 |
| 47 | Ga0070674_100729462 | 3300005356 | Bacteria | 850 |
| 48 | Ga0070674_100819082 | 3300005356 | Bacteria | 805 |
| 49 | Ga0070673_100078206 | 3300005364 | Bacteria | 2676 |
| 50 | Ga0070673_100425795 | 3300005364 | Bacteria | 1191 |
| 51 | Ga0070688_100078052 | 3300005365 | Bacteria | 2135 |
| 52 | Ga0070688_100364093 | 3300005365 | Bacteria | 1062 |
| 53 | Ga0070659_100141002 | 3300005366 | Bacteria | 1962 |
| 54 | Ga0070659_100153312 | 3300005366 | Bacteria | 1881 |
| 55 | Ga0070659_100203915 | 3300005366 | Bacteria | 1628 |
| 56 | Ga0070667_100000063 | 3300005367 | Bacteria | 138777 |
| 57 | Ga0070667_100000620 | 3300005367 | Bacteria | 34660 |
| 58 | Ga0070667_100020470 | 3300005367 | Bacteria | 5492 |
| 59 | Ga0070667_100022417 | 3300005367 | Bacteria | 5237 |
| 60 | Ga0070667_100413775 | 3300005367 | Bacteria | 1228 |
| 61 | Ga0070667_101042934 | 3300005367 | Bacteria | 763 |
| 62 | Ga0070709_10049623 | 3300005434 | Bacteria | 2625 |
| 63 | Ga0070714_100067806 | 3300005435 | Bacteria | 3077 |
| 64 | Ga0070714_100074821 | 3300005435 | Bacteria | 2937 |
| 65 | Ga0070713_100930373 | 3300005436 | Bacteria | 837 |
| 66 | Ga0070710_10006956 | 3300005437 | Bacteria | 5455 |
| 67 | Ga0070710_10007817 | 3300005437 | Bacteria | 5190 |
| 68 | Ga0070701_10017749 | 3300005438 | Bacteria | 3332 |
| 69 | Ga0070711_100000327 | 3300005439 | Bacteria | 24630 |
| 70 | Ga0070711_100001579 | 3300005439 | Bacteria | 12539 |
| 71 | Ga0070711_100177825 | 3300005439 | Bacteria | 1627 |
| 72 | Ga0070705_100502506 | 3300005440 | Bacteria | 921 |
| 73 | Ga0070700_100015828 | 3300005441 | Bacteria | 4286 |
| 74 | Ga0070694_100007834 | 3300005444 | Bacteria | 6519 |
| 75 | Ga0070708_100291628 | 3300005445 | Bacteria | 1536 |
| 76 | Ga0070663_100000066 | 3300005455 | Bacteria | 45121 |
| 77 | Ga0070663_100070529 | 3300005455 | Bacteria | 2541 |
| 78 | Ga0070663_100124548 | 3300005455 | Bacteria | 1951 |
| 79 | Ga0070663_100169897 | 3300005455 | Bacteria | 1685 |
| 80 | Ga0070663_100217488 | 3300005455 | Bacteria | 1499 |
| 81 | Ga0070663_100554816 | 3300005455 | Bacteria | 961 |
| 82 | Ga0070678_100000105 | 3300005456 | Bacteria | 32409 |
| 83 | Ga0070662_100372063 | 3300005457 | Bacteria | 1174 |
| 84 | Ga0068867_100000723 | 3300005459 | Bacteria | 22069 |
| 85 | Ga0068867_100058057 | 3300005459 | Bacteria | 2867 |
| 86 | Ga0070685_10311718 | 3300005466 | Bacteria | 1064 |
| 87 | Ga0070706_100010948 | 3300005467 | Bacteria | 8421 |
| 88 | Ga0070706_100488150 | 3300005467 | Bacteria | 1146 |
| 89 | Ga0070707_100007178 | 3300005468 | Bacteria | 10334 |
| 90 | Ga0070699_100164102 | 3300005518 | Bacteria | 1967 |
| 91 | Ga0070679_100208611 | 3300005530 | Bacteria | 1918 |
| 92 | Ga0070684_100379510 | 3300005535 | Bacteria | 1302 |
| 93 | Ga0070684_100505720 | 3300005535 | Bacteria | 1119 |
| 94 | Ga0070697_100548269 | 3300005536 | Bacteria | 1014 |
| 95 | Ga0068853_100070499 | 3300005539 | Bacteria | 3042 |
| 96 | Ga0068853_100110933 | 3300005539 | Bacteria | 2437 |
| 97 | Ga0070672_100036537 | 3300005543 | Bacteria | 3743 |
| 98 | Ga0070686_100117297 | 3300005544 | Bacteria | 1823 |
| 99 | Ga0070695_100007265 | 3300005545 | Bacteria | 6567 |
| 100 | Ga0070696_100001184 | 3300005546 | Bacteria | 16907 |
| 101 | Ga0070696_100040911 | 3300005546 | Bacteria | 3201 |
| 102 | Ga0070693_100067491 | 3300005547 | Bacteria | 2097 |
| 103 | Ga0070665_100004232 | 3300005548 | Bacteria | 15101 |
| 104 | Ga0070665_100005202 | 3300005548 | Bacteria | 13459 |
| 105 | Ga0070665_100006023 | 3300005548 | Bacteria | 12392 |
| 106 | Ga0070665_100077582 | 3300005548 | Bacteria | 3328 |
| 107 | Ga0070665_100705310 | 3300005548 | Bacteria | 1022 |
| 108 | Ga0070704_100000016 | 3300005549 | Bacteria | 57860 |
| 109 | Ga0068855_100084004 | 3300005563 | Bacteria | 3687 |
| 110 | Ga0068855_100790300 | 3300005563 | Bacteria | 1009 |
| 111 | Ga0068854_100674914 | 3300005578 | Bacteria | 889 |
| 112 | Ga0070702_100001709 | 3300005615 | Bacteria | 9119 |
| 113 | Ga0070702_100046624 | 3300005615 | Bacteria | 2457 |
| 114 | Ga0070702_100668495 | 3300005615 | Bacteria | 788 |
| 115 | Ga0068852_100566152 | 3300005616 | Bacteria | 1138 |
| 116 | Ga0068859_100000777 | 3300005617 | Bacteria | 32236 |
| 117 | Ga0068859_100000989 | 3300005617 | Bacteria | 29085 |
| 118 | Ga0068859_100074723 | 3300005617 | Bacteria | 3428 |
| 119 | Ga0068859_100776883 | 3300005617 | Bacteria | 1046 |
| 120 | Ga0068864_100225883 | 3300005618 | Bacteria | 1729 |
| 121 | Ga0068864_100265520 | 3300005618 | Bacteria | 1598 |
| 122 | Ga0068864_100723658 | 3300005618 | Bacteria | 974 |
| 123 | Ga0068864_100806984 | 3300005618 | Bacteria | 923 |
| 124 | Ga0068866_10000152 | 3300005718 | Bacteria | 31563 |
| 125 | Ga0068861_100000157 | 3300005719 | Bacteria | 35512 |
| 126 | Ga0068861_100118728 | 3300005719 | Bacteria | 2131 |
| 127 | Ga0068861_100337227 | 3300005719 | Bacteria | 1318 |
| 128 | Ga0068861_100509858 | 3300005719 | Bacteria | 1089 |
| 129 | Ga0068851_10229086 | 3300005834 | Bacteria | 1047 |
| 130 | Ga0068870_10480157 | 3300005840 | Bacteria | 825 |
| 131 | Ga0068863_100000159 | 3300005841 | Bacteria | 71831 |
| 132 | Ga0068863_100003604 | 3300005841 | Bacteria | 15290 |
| 133 | Ga0068863_100028488 | 3300005841 | Bacteria | 5334 |
| 134 | Ga0068863_100202456 | 3300005841 | Bacteria | 1910 |
| 135 | Ga0068858_100000002 | 3300005842 | Bacteria | 351633 |
| 136 | Ga0068858_100498310 | 3300005842 | Bacteria | 1176 |
| 137 | Ga0068858_100955628 | 3300005842 | Bacteria | 839 |
| 138 | Ga0068860_100000065 | 3300005843 | Bacteria | 186634 |
| 139 | Ga0068860_100000663 | 3300005843 | Bacteria | 39893 |
| 140 | Ga0068860_100050567 | 3300005843 | Bacteria | 3956 |
| 141 | Ga0068862_100000028 | 3300005844 | Bacteria | 184197 |
| 142 | Ga0068862_100010168 | 3300005844 | Bacteria | 7765 |
| 143 | Ga0081455_10000995 | 3300005937 | Bacteria | 35927 |
| 144 | Ga0081455_10230781 | 3300005937 | Bacteria | 1366 |
| 145 | Ga0081539_10001153 | 3300005985 | Bacteria | 47882 |
| 146 | Ga0070717_10179490 | 3300006028 | Bacteria | 1845 |
| 147 | Ga0075365_10019826 | 3300006038 | Bacteria | 4159 |
| 148 | Ga0075365_10097555 | 3300006038 | Bacteria | 2009 |
| 149 | Ga0075365_10287685 | 3300006038 | Bacteria | 1156 |
| 150 | Ga0075368_10050173 | 3300006042 | Bacteria | 1657 |
| 151 | Ga0075363_100020572 | 3300006048 | Bacteria | 3311 |
| 152 | Ga0075363_100031359 | 3300006048 | Bacteria | 2756 |
| 153 | Ga0075363_100053055 | 3300006048 | Bacteria | 2166 |
| 154 | Ga0075363_100112079 | 3300006048 | Bacteria | 1517 |
| 155 | Ga0075363_100120597 | 3300006048 | Bacteria | 1464 |
| 156 | Ga0075363_100272669 | 3300006048 | Bacteria | 977 |
| 157 | Ga0075363_100300311 | 3300006048 | Bacteria | 932 |
| 158 | Ga0075364_10003349 | 3300006051 | Bacteria | 9092 |
| 159 | Ga0075364_10017435 | 3300006051 | Bacteria | 4486 |
| 160 | Ga0075364_10036950 | 3300006051 | Bacteria | 3160 |
| 161 | Ga0075364_10040932 | 3300006051 | Bacteria | 3006 |
| 162 | Ga0075364_10337657 | 3300006051 | Bacteria | 1027 |
| 163 | Ga0070715_10027904 | 3300006163 | Bacteria | 2259 |
| 164 | Ga0070715_10028363 | 3300006163 | Bacteria | 2244 |
| 165 | Ga0070716_100012209 | 3300006173 | Bacteria | 4348 |
| 166 | Ga0070716_100023074 | 3300006173 | Bacteria | 3295 |
| 167 | Ga0070712_100000926 | 3300006175 | Bacteria | 17635 |
| 168 | Ga0070712_100019484 | 3300006175 | Bacteria | 4426 |
| 169 | Ga0075362_10182328 | 3300006177 | Bacteria | 1018 |
| 170 | Ga0075367_10127659 | 3300006178 | Bacteria | 1570 |
| 171 | Ga0075367_10162130 | 3300006178 | Bacteria | 1391 |
| 172 | Ga0075367_10400855 | 3300006178 | Bacteria | 868 |
| 173 | Ga0075369_10003004 | 3300006186 | Bacteria | 6100 |
| 174 | Ga0075369_10006451 | 3300006186 | Bacteria | 4436 |
| 175 | Ga0075369_10008548 | 3300006186 | Bacteria | 3943 |
| 176 | Ga0075369_10016201 | 3300006186 | Bacteria | 3003 |
| 177 | Ga0075369_10022484 | 3300006186 | Bacteria | 2601 |
| 178 | Ga0075369_10023619 | 3300006186 | Bacteria | 2543 |
| 179 | Ga0075369_10093774 | 3300006186 | Bacteria | 1341 |
| 180 | Ga0075369_10294186 | 3300006186 | Bacteria | 758 |
| 181 | Ga0075366_10085861 | 3300006195 | Bacteria | 1883 |
| 182 | Ga0097621_100077048 | 3300006237 | Bacteria | 2767 |
| 183 | Ga0075370_10001708 | 3300006353 | Bacteria | 9755 |
| 184 | Ga0075370_10001851 | 3300006353 | Bacteria | 9478 |
| 185 | Ga0075370_10026581 | 3300006353 | Bacteria | 3206 |
| 186 | Ga0075370_10090992 | 3300006353 | Bacteria | 1760 |
| 187 | Ga0075370_10117182 | 3300006353 | Bacteria | 1549 |
| 188 | Ga0075370_10133429 | 3300006353 | Bacteria | 1449 |
| 189 | Ga0075370_10200994 | 3300006353 | Bacteria | 1175 |
| 190 | Ga0068871_100119613 | 3300006358 | Bacteria | 2224 |
| 191 | Ga0075428_100006335 | 3300006844 | Bacteria | 13164 |
| 192 | Ga0075430_100083231 | 3300006846 | Bacteria | 2680 |
| 193 | Ga0075431_100180299 | 3300006847 | Bacteria | 2168 |
| 194 | Ga0075429_100269907 | 3300006880 | Bacteria | 1490 |
| 195 | Ga0097620_100000777 | 3300006931 | Bacteria | 32236 |
| 196 | Ga0097620_100000989 | 3300006931 | Bacteria | 29085 |
| 197 | Ga0097620_100074725 | 3300006931 | Bacteria | 3428 |
| 198 | Ga0097620_100776732 | 3300006931 | Bacteria | 1046 |
| 199 | Ga0075435_100646585 | 3300007076 | Bacteria | 918 |
| 200 | Ga0105250_10170395 | 3300009092 | Bacteria | 911 |
| 201 | Ga0105240_10196936 | 3300009093 | Bacteria | 2364 |
| 202 | Ga0111539_10191321 | 3300009094 | Bacteria | 2388 |
| 203 | Ga0111539_10573693 | 3300009094 | Bacteria | 1314 |
| 204 | Ga0111539_10761220 | 3300009094 | Bacteria | 1127 |
| 205 | Ga0105245_10000172 | 3300009098 | Bacteria | 61572 |
| 206 | Ga0105245_10033743 | 3300009098 | Bacteria | 4536 |
| 207 | Ga0105245_10042813 | 3300009098 | Bacteria | 4039 |
| 208 | Ga0105245_10056993 | 3300009098 | Bacteria | 3513 |
| 209 | Ga0105247_10000009 | 3300009101 | Bacteria | 385991 |
| 210 | Ga0105247_10000451 | 3300009101 | Bacteria | 34877 |
| 211 | Ga0105247_10050375 | 3300009101 | Bacteria | 2562 |
| 212 | Ga0105247_10639092 | 3300009101 | Bacteria | 794 |
| 213 | Ga0114129_10045686 | 3300009147 | Bacteria | 6155 |
| 214 | Ga0105243_10001407 | 3300009148 | Bacteria | 21285 |
| 215 | Ga0105243_10001852 | 3300009148 | Bacteria | 18054 |
| 216 | Ga0105243_10055548 | 3300009148 | Bacteria | 3147 |
| 217 | Ga0105241_10097080 | 3300009174 | Bacteria | 2335 |
| 218 | Ga0105241_10324085 | 3300009174 | Bacteria | 1329 |
| 219 | Ga0105242_10000281 | 3300009176 | Bacteria | 40643 |
| 220 | Ga0105242_10646999 | 3300009176 | Bacteria | 1027 |
| 221 | Ga0105248_10000186 | 3300009177 | Bacteria | 72427 |
| 222 | Ga0105248_10000943 | 3300009177 | Bacteria | 32364 |
| 223 | Ga0105248_10001346 | 3300009177 | Bacteria | 27382 |
| 224 | Ga0105248_10506794 | 3300009177 | Bacteria | 1361 |
| 225 | Ga0105248_10547064 | 3300009177 | Bacteria | 1306 |
| 226 | Ga0105237_10009360 | 3300009545 | Bacteria | 10493 |
| 227 | Ga0105237_10091927 | 3300009545 | Bacteria | 3024 |
| 228 | Ga0105237_10609182 | 3300009545 | Bacteria | 1099 |
| 229 | Ga0105238_10646028 | 3300009551 | Bacteria | 1068 |
| 230 | Ga0105249_10000011 | 3300009553 | Bacteria | 292812 |
| 231 | Ga0105249_10000291 | 3300009553 | Bacteria | 51476 |
| 232 | Ga0105249_10185635 | 3300009553 | Bacteria | 2026 |
| 233 | Ga0105249_10260659 | 3300009553 | Bacteria | 1722 |
| 234 | Ga0105249_11087294 | 3300009553 | Bacteria | 870 |
| 235 | Ga0105239_10004844 | 3300010375 | Bacteria | 15921 |
| 236 | Ga0105239_10013169 | 3300010375 | Bacteria | 9190 |
| 237 | Ga0105239_10226287 | 3300010375 | Bacteria | 2098 |
| 238 | Ga0105246_10117483 | 3300011119 | Bacteria | 1965 |
| 239 | Ga0157371_10195262 | 3300013102 | Bacteria | 1450 |
| 240 | Ga0157374_10058502 | 3300013296 | Bacteria | 3602 |
| 241 | Ga0157378_10000282 | 3300013297 | Bacteria | 49400 |
| 242 | Ga0157378_10081410 | 3300013297 | Bacteria | 2926 |
| 243 | Ga0163162_10001346 | 3300013306 | Bacteria | 22877 |
| 244 | Ga0163162_10136421 | 3300013306 | Bacteria | 2564 |
| 245 | Ga0163162_10830724 | 3300013306 | Bacteria | 1040 |
| 246 | Ga0163162_11413958 | 3300013306 | Bacteria | 791 |
| 247 | Ga0157372_10008436 | 3300013307 | Bacteria | 10939 |
| 248 | Ga0157372_10248274 | 3300013307 | Bacteria | 2065 |
| 249 | Ga0157375_10000443 | 3300013308 | Bacteria | 37561 |
| 250 | Ga0157375_10097647 | 3300013308 | Bacteria | 3012 |
| 251 | Ga0163163_10012382 | 3300014325 | Bacteria | 7770 |
| 252 | Ga0163163_10079654 | 3300014325 | Bacteria | 3274 |
| 253 | Ga0163163_10110618 | 3300014325 | Bacteria | 2776 |
| 254 | Ga0163163_10631623 | 3300014325 | Bacteria | 1134 |
| 255 | Ga0157380_10035286 | 3300014326 | Bacteria | 3862 |
| 256 | Ga0157380_10267553 | 3300014326 | Bacteria | 1556 |
| 257 | Ga0157380_10294098 | 3300014326 | Bacteria | 1493 |
| 258 | Ga0157377_10166689 | 3300014745 | Bacteria | 1374 |
| 259 | Ga0157379_10000007 | 3300014968 | Bacteria | 142402 |
| 260 | Ga0157379_10008216 | 3300014968 | Bacteria | 9062 |
| 261 | Ga0157379_10053821 | 3300014968 | Bacteria | 3596 |
| 262 | Ga0157379_10090968 | 3300014968 | Bacteria | 2737 |
| 263 | Ga0163161_10001593 | 3300017792 | Bacteria | 16741 |
| 264 | Ga0163161_10111328 | 3300017792 | Bacteria | 2047 |
| 265 | Ga0206353_10744464 | 3300020082 | Bacteria | 3067 |
| 266 | Ga0213873_10000052 | 3300021358 | Bacteria | 25748 |
| 267 | Ga0213876_10006606 | 3300021384 | Bacteria | 6325 |
| 268 | Ga0213876_10015198 | 3300021384 | Bacteria | 4077 |
| 269 | Ga0213876_10017728 | 3300021384 | Bacteria | 3757 |
| 270 | Ga0213876_10075210 | 3300021384 | Bacteria | 1784 |
| 271 | Ga0213875_10000073 | 3300021388 | Bacteria | 119027 |
| 272 | Ga0213875_10086117 | 3300021388 | Bacteria | 1465 |
| 273 | Ga0213875_10145422 | 3300021388 | Bacteria | 1110 |
| 274 | Ga0209673_1021887 | 3300025273 | Bacteria | 2222 |
| 275 | Ga0209673_1044854 | 3300025273 | Bacteria | 1221 |
| 276 | Ga0209051_1000075 | 3300025303 | Bacteria | 205011 |
| 277 | Ga0209051_1000448 | 3300025303 | Bacteria | 54644 |
| 278 | Ga0209051_1002630 | 3300025303 | Bacteria | 12609 |
| 279 | Ga0209051_1009355 | 3300025303 | Bacteria | 5062 |
| 280 | Ga0207653_10030501 | 3300025885 | Bacteria | 1740 |
| 281 | Ga0207682_10015450 | 3300025893 | Bacteria | 2972 |
| 282 | Ga0207692_10002256 | 3300025898 | Bacteria | 7387 |
| 283 | Ga0207692_10019524 | 3300025898 | Bacteria | 3065 |
| 284 | Ga0207642_10000264 | 3300025899 | Bacteria | 15769 |
| 285 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 286 | Ga0207710_10000721 | 3300025900 | Bacteria | 18358 |
| 287 | Ga0207710_10044460 | 3300025900 | Bacteria | 1978 |
| 288 | Ga0207688_10000335 | 3300025901 | Bacteria | 21839 |
| 289 | Ga0207688_10002023 | 3300025901 | Bacteria | 10880 |
| 290 | Ga0207688_10070823 | 3300025901 | Bacteria | 1978 |
| 291 | Ga0207647_10058151 | 3300025904 | Bacteria | 2368 |
| 292 | Ga0207685_10081337 | 3300025905 | Bacteria | 1341 |
| 293 | Ga0207645_10036766 | 3300025907 | Bacteria | 3145 |
| 294 | Ga0207645_10161229 | 3300025907 | Bacteria | 1467 |
| 295 | Ga0207645_10469005 | 3300025907 | Bacteria | 851 |
| 296 | Ga0207695_10288454 | 3300025913 | Bacteria | 1534 |
| 297 | Ga0207695_10484227 | 3300025913 | Bacteria | 1119 |
| 298 | Ga0207671_10013939 | 3300025914 | Bacteria | 6380 |
| 299 | Ga0207671_10034188 | 3300025914 | Bacteria | 3778 |
| 300 | Ga0207693_10000049 | 3300025915 | Bacteria | 100347 |
| 301 | Ga0207693_10000258 | 3300025915 | Bacteria | 48916 |
| 302 | Ga0207663_10000314 | 3300025916 | Bacteria | 21124 |
| 303 | Ga0207663_10549649 | 3300025916 | Bacteria | 902 |
| 304 | Ga0207660_10494423 | 3300025917 | Bacteria | 992 |
| 305 | Ga0207657_10033008 | 3300025919 | Bacteria | 4670 |
| 306 | Ga0207657_10155359 | 3300025919 | Bacteria | 1861 |
| 307 | Ga0207649_10431184 | 3300025920 | Bacteria | 992 |
| 308 | Ga0207652_10215678 | 3300025921 | Bacteria | 1729 |
| 309 | Ga0207646_10085464 | 3300025922 | Bacteria | 2822 |
| 310 | Ga0207681_10003263 | 3300025923 | Bacteria | 10159 |
| 311 | Ga0207681_10009825 | 3300025923 | Bacteria | 5851 |
| 312 | Ga0207694_10203101 | 3300025924 | Bacteria | 1613 |
| 313 | Ga0207687_10000153 | 3300025927 | Bacteria | 46342 |
| 314 | Ga0207687_10019107 | 3300025927 | Bacteria | 4536 |
| 315 | Ga0207687_10027888 | 3300025927 | Bacteria | 3791 |
| 316 | Ga0207687_10264634 | 3300025927 | Bacteria | 1372 |
| 317 | Ga0207687_10356026 | 3300025927 | Bacteria | 1194 |
| 318 | Ga0207700_10189724 | 3300025928 | Bacteria | 1727 |
| 319 | Ga0207700_10506138 | 3300025928 | Bacteria | 1069 |
| 320 | Ga0207700_10757072 | 3300025928 | Bacteria | 868 |
| 321 | Ga0207700_10916487 | 3300025928 | Bacteria | 784 |
| 322 | Ga0207664_10002749 | 3300025929 | Bacteria | 11679 |
| 323 | Ga0207664_10019234 | 3300025929 | Bacteria | 5044 |
| 324 | Ga0207664_10029135 | 3300025929 | Bacteria | 4203 |
| 325 | Ga0207644_10000326 | 3300025931 | Bacteria | 30930 |
| 326 | Ga0207644_10005846 | 3300025931 | Bacteria | 8016 |
| 327 | Ga0207690_10079943 | 3300025932 | Bacteria | 2280 |
| 328 | Ga0207690_10199324 | 3300025932 | Bacteria | 1519 |
| 329 | Ga0207690_10283766 | 3300025932 | Bacteria | 1290 |
| 330 | Ga0207706_10010210 | 3300025933 | Bacteria | 8588 |
| 331 | Ga0207686_10000624 | 3300025934 | Bacteria | 22005 |
| 332 | Ga0207686_10024748 | 3300025934 | Bacteria | 3483 |
| 333 | Ga0207709_10004736 | 3300025935 | Bacteria | 7811 |
| 334 | Ga0207709_10010027 | 3300025935 | Bacteria | 5220 |
| 335 | Ga0207709_10293488 | 3300025935 | Bacteria | 1206 |
| 336 | Ga0207670_10092663 | 3300025936 | Bacteria | 2139 |
| 337 | Ga0207670_10433655 | 3300025936 | Bacteria | 1057 |
| 338 | Ga0207669_10000277 | 3300025937 | Bacteria | 23524 |
| 339 | Ga0207669_10570369 | 3300025937 | Bacteria | 916 |
| 340 | Ga0207704_10000115 | 3300025938 | Bacteria | 44598 |
| 341 | Ga0207665_10003528 | 3300025939 | Bacteria | 10446 |
| 342 | Ga0207665_10011384 | 3300025939 | Bacteria | 5842 |
| 343 | Ga0207691_10293704 | 3300025940 | Bacteria | 1397 |
| 344 | Ga0207711_10000373 | 3300025941 | Bacteria | 47596 |
| 345 | Ga0207711_10002761 | 3300025941 | Bacteria | 15466 |
| 346 | Ga0207689_10049054 | 3300025942 | Bacteria | 3484 |
| 347 | Ga0207689_10239736 | 3300025942 | Bacteria | 1499 |
| 348 | Ga0207661_10041993 | 3300025944 | Bacteria | 3604 |
| 349 | Ga0207661_10244336 | 3300025944 | Bacteria | 1594 |
| 350 | Ga0207667_10176496 | 3300025949 | Bacteria | 2195 |
| 351 | Ga0207651_10038678 | 3300025960 | Bacteria | 3138 |
| 352 | Ga0207712_10000020 | 3300025961 | Bacteria | 292796 |
| 353 | Ga0207712_10005489 | 3300025961 | Bacteria | 7999 |
| 354 | Ga0207712_10017769 | 3300025961 | Bacteria | 4624 |
| 355 | Ga0207668_10007226 | 3300025972 | Bacteria | 6594 |
| 356 | Ga0207668_10018400 | 3300025972 | Bacteria | 4395 |
| 357 | Ga0207668_10106013 | 3300025972 | Bacteria | 2099 |
| 358 | Ga0207668_10115661 | 3300025972 | Bacteria | 2021 |
| 359 | Ga0207640_10037694 | 3300025981 | Bacteria | 3044 |
| 360 | Ga0207640_10056847 | 3300025981 | Bacteria | 2571 |
| 361 | Ga0207658_10000573 | 3300025986 | Bacteria | 33277 |
| 362 | Ga0207658_10004216 | 3300025986 | Bacteria | 10014 |
| 363 | Ga0207658_10165273 | 3300025986 | Bacteria | 1817 |
| 364 | Ga0207658_10201582 | 3300025986 | Bacteria | 1661 |
| 365 | Ga0207658_10254972 | 3300025986 | Bacteria | 1492 |
| 366 | Ga0207677_10003884 | 3300026023 | Bacteria | 7954 |
| 367 | Ga0207677_10337820 | 3300026023 | Bacteria | 1257 |
| 368 | Ga0207703_10000001 | 3300026035 | Bacteria | 822925 |
| 369 | Ga0207703_10031288 | 3300026035 | Bacteria | 4206 |
| 370 | Ga0207703_10138530 | 3300026035 | Bacteria | 2109 |
| 371 | Ga0207703_10258490 | 3300026035 | Bacteria | 1573 |
| 372 | Ga0207703_10603536 | 3300026035 | Bacteria | 1038 |
| 373 | Ga0207639_10021972 | 3300026041 | Bacteria | 4591 |
| 374 | Ga0207639_10214938 | 3300026041 | Bacteria | 1657 |
| 375 | Ga0207639_10879006 | 3300026041 | Bacteria | 837 |
| 376 | Ga0207678_10000511 | 3300026067 | Bacteria | 35188 |
| 377 | Ga0207678_10025446 | 3300026067 | Bacteria | 5165 |
| 378 | Ga0207678_10091782 | 3300026067 | Bacteria | 2596 |
| 379 | Ga0207678_10107629 | 3300026067 | Bacteria | 2378 |
| 380 | Ga0207678_10188382 | 3300026067 | Bacteria | 1763 |
| 381 | Ga0207678_10273717 | 3300026067 | Bacteria | 1448 |
| 382 | Ga0207678_10524397 | 3300026067 | Bacteria | 1034 |
| 383 | Ga0207708_10003058 | 3300026075 | Bacteria | 12327 |
| 384 | Ga0207708_10419609 | 3300026075 | Bacteria | 1109 |
| 385 | Ga0207641_10000156 | 3300026088 | Bacteria | 97171 |
| 386 | Ga0207641_10005483 | 3300026088 | Bacteria | 10821 |
| 387 | Ga0207641_10089971 | 3300026088 | Bacteria | 2683 |
| 388 | Ga0207641_10461165 | 3300026088 | Bacteria | 1229 |
| 389 | Ga0207648_10001288 | 3300026089 | Bacteria | 27969 |
| 390 | Ga0207648_10004514 | 3300026089 | Bacteria | 14272 |
| 391 | Ga0207676_10115741 | 3300026095 | Bacteria | 2252 |
| 392 | Ga0207676_10192849 | 3300026095 | Bacteria | 1794 |
| 393 | Ga0207676_11043320 | 3300026095 | Bacteria | 807 |
| 394 | Ga0207674_10399885 | 3300026116 | Bacteria | 1328 |
| 395 | Ga0207675_100000220 | 3300026118 | Bacteria | 53425 |
| 396 | Ga0207675_100048224 | 3300026118 | Bacteria | 3976 |
| 397 | Ga0207675_100087933 | 3300026118 | Bacteria | 2919 |
| 398 | Ga0207675_100584398 | 3300026118 | Bacteria | 1119 |
| 399 | Ga0207683_10000184 | 3300026121 | Bacteria | 53332 |
| 400 | Ga0207683_10087921 | 3300026121 | Bacteria | 2764 |
| 401 | Ga0207683_10094962 | 3300026121 | Bacteria | 2658 |
| 402 | Ga0207698_10538334 | 3300026142 | Bacteria | 1142 |
| 403 | Ga0209813_10041598 | 3300027866 | Bacteria | 1401 |
| 404 | Ga0207428_10156746 | 3300027907 | Bacteria | 1731 |
| 405 | Ga0268266_10001619 | 3300028379 | Bacteria | 26252 |
| 406 | Ga0268266_10005268 | 3300028379 | Bacteria | 12145 |
| 407 | Ga0268266_10038405 | 3300028379 | Bacteria | 4076 |
| 408 | Ga0268266_10059265 | 3300028379 | Bacteria | 3298 |
| 409 | Ga0268266_10232488 | 3300028379 | Bacteria | 1698 |
| 410 | Ga0268266_10492503 | 3300028379 | Bacteria | 1170 |
| 411 | Ga0268266_10731830 | 3300028379 | Bacteria | 954 |
| 412 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 413 | Ga0268265_11104616 | 3300028380 | Bacteria | 787 |
| 414 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 415 | Ga0268264_10000925 | 3300028381 | Bacteria | 30466 |
| 416 | Ga0268264_10040710 | 3300028381 | Bacteria | 3840 |
| 417 | Ga0307515_10036541 | 3300028794 | Bacteria | 7942 |
| 418 | Ga0307515_10071931 | 3300028794 | Bacteria | 4677 |
| 419 | Ga0307511_10107688 | 3300030521 | Bacteria | 1793 |
| 420 | Ga0307512_10031225 | 3300030522 | Bacteria | 4617 |
| 421 | Ga0307512_10049847 | 3300030522 | Bacteria | 3371 |
| 422 | Ga0265327_10000408 | 3300031251 | Bacteria | 79100 |
| 423 | Ga0265327_10002762 | 3300031251 | Bacteria | 17817 |
| 424 | Ga0265327_10047167 | 3300031251 | Bacteria | 2275 |
| 425 | Ga0265327_10047549 | 3300031251 | Bacteria | 2262 |
| 426 | Ga0316579_10108499 | 3300031691 | Bacteria | 1332 |
| 427 | Ga0316578_10165914 | 3300031728 | Bacteria | 1331 |
| 428 | Ga0307405_10099125 | 3300031731 | Bacteria | 1950 |
| 429 | Ga0307405_10171799 | 3300031731 | Bacteria | 1547 |
| 430 | Ga0307405_10189306 | 3300031731 | Bacteria | 1485 |
| 431 | Ga0307405_10356381 | 3300031731 | Bacteria | 1130 |
| 432 | Ga0307405_10549989 | 3300031731 | Bacteria | 934 |
| 433 | Ga0307413_10001347 | 3300031824 | Bacteria | 9195 |
| 434 | Ga0307413_10513638 | 3300031824 | Bacteria | 965 |
| 435 | Ga0307518_10002521 | 3300031838 | Bacteria | 13370 |
| 436 | Ga0307410_10054188 | 3300031852 | Bacteria | 2718 |
| 437 | Ga0307410_10086914 | 3300031852 | Bacteria | 2210 |
| 438 | Ga0307410_10190445 | 3300031852 | Bacteria | 1559 |
| 439 | Ga0307410_10778350 | 3300031852 | Bacteria | 812 |
| 440 | Ga0307406_10209805 | 3300031901 | Bacteria | 1440 |
| 441 | Ga0307406_10657555 | 3300031901 | Bacteria | 870 |
| 442 | Ga0307412_10522565 | 3300031911 | Bacteria | 992 |
| 443 | Ga0307409_100518395 | 3300031995 | Bacteria | 1164 |
| 444 | Ga0307416_100600064 | 3300032002 | Bacteria | 1181 |
| 445 | Ga0307415_100030468 | 3300032126 | Bacteria | 3464 |
| 446 | Ga0307507_10104243 | 3300033179 | Bacteria | 2354 |
| 447 | Ga0307510_10022713 | 3300033180 | Bacteria | 7278 |
| 448 | Ga0373929_0018691 | 3300035085 | Bacteria | 1380 |
| 449 | Ga0373949_0058147 | 3300035090 | Bacteria | 989 |
| 450 | Ga0373952_0051827 | 3300035092 | Bacteria | 981 |
| 451 | Ga0373932_0105633 | 3300035112 | Bacteria | 922 |
| 452 | Ga0373942_0097815 | 3300035207 | Bacteria | 893 |
| 453 | Ga0373935_0052563 | 3300035692 | Bacteria | 2590 |
| 454 | Ga0373927_0059608 | 3300035695 | Bacteria | 2469 |
| 455 | Ga0373927_0413729 | 3300035695 | Bacteria | 890 |
| 456 | Ga0316584_0054882 | 3300036712 | Bacteria | 2983 |
| 457 | Ga0436364_0225372 | 3300037853 | Bacteria | 2916 |
| 458 | Ga0436364_0755754 | 3300037853 | Bacteria | 3146 |
| 459 | Ga0436364_1296457 | 3300037853 | Bacteria | 11314 |
| 460 | Ga0436365_0201441 | 3300039437 | Bacteria | 25491 |
| 461 | Ga0436365_0585474 | 3300039437 | Bacteria | 22245 |
| 462 | Ga0436365_1307586 | 3300039437 | Bacteria | 971 |
| 463 | Ga0436365_1920746 | 3300039437 | Bacteria | 19751 |
| 464 | Ga0436361_0978287 | 3300039447 | Bacteria | 1213 |
| 465 | Ga0436363_1156841 | 3300039450 | Bacteria | 1847 |
| 466 | Ga0436363_1714028 | 3300039450 | Bacteria | 5323 |
| 467 | Ga0439461_0002218 | 3300041410 | Bacteria | 3084 |
| 468 | Ga0439461_0009967 | 3300041410 | Bacteria | 1734 |
| 469 | Ga0439466_0001603 | 3300041411 | Bacteria | 8829 |
| 470 | Ga0439466_0042342 | 3300041411 | Bacteria | 1516 |
| 471 | Ga0439466_0069642 | 3300041411 | Bacteria | 1122 |
| 472 | Ga0439465_0001837 | 3300041413 | Bacteria | 6947 |
| 473 | Ga0439465_0003484 | 3300041413 | Bacteria | 5133 |
| 474 | Ga0439465_0005400 | 3300041413 | Bacteria | 4077 |
| 475 | Ga0439465_0029375 | 3300041413 | Bacteria | 1746 |
| 476 | Ga0451797_1047338 | 3300041453 | Bacteria | 1115 |
| 477 | Ga0451795_0769305 | 3300041456 | Bacteria | 1242 |
| 478 | Ga0451853_0599558 | 3300041512 | Bacteria | 1086 |
| 479 | Ga0439442_002097 | 3300042002 | Bacteria | 3916 |
| 480 | Ga0439445_0001633 | 3300042004 | Bacteria | 4903 |
| 481 | Ga0439448_0023867 | 3300042005 | Bacteria | 1910 |
| 482 | Ga0439448_0060793 | 3300042005 | Bacteria | 1249 |
| 483 | Ga0439434_0036660 | 3300042435 | Bacteria | 1500 |
| 484 | Ga0439459_0023874 | 3300042438 | Bacteria | 1195 |
| 485 | Ga0466969_0038497 | 3300044656 | Bacteria | 2406 |
| 486 | Ga0466969_0054733 | 3300044656 | Bacteria | 1954 |
| 487 | Ga0466969_0078646 | 3300044656 | Bacteria | 1577 |
| 488 | Ga0466969_0119862 | 3300044656 | Bacteria | 1226 |
| 489 | Ga0466972_0001186 | 3300044658 | Bacteria | 12519 |
| 490 | Ga0466972_0004495 | 3300044658 | Bacteria | 6979 |
| 491 | Ga0466972_0014460 | 3300044658 | Bacteria | 3952 |
| 492 | Ga0466965_0001067 | 3300044683 | Bacteria | 10644 |
| 493 | Ga0466965_0007511 | 3300044683 | Bacteria | 5009 |
| 494 | Ga0466965_0029509 | 3300044683 | Bacteria | 2669 |
| 495 | Ga0466965_0053638 | 3300044683 | Bacteria | 2004 |
| 496 | Ga0466965_0249729 | 3300044683 | Bacteria | 951 |
| 497 | Ga0466965_0452939 | 3300044683 | Bacteria | 715 |
| 498 | Ga0466966_0010547 | 3300044684 | Bacteria | 6141 |
| 499 | Ga0466966_0037675 | 3300044684 | Bacteria | 3117 |
| 500 | Ga0466966_0315301 | 3300044684 | Bacteria | 940 |
| 501 | Ga0466961_0003735 | 3300044693 | Bacteria | 9512 |
| 502 | Ga0466961_0013068 | 3300044693 | Bacteria | 5312 |
| 503 | Ga0466961_0018566 | 3300044693 | Bacteria | 4476 |
| 504 | Ga0466961_0051284 | 3300044693 | Bacteria | 2636 |
| 505 | Ga0466963_0008470 | 3300044694 | Bacteria | 6163 |
| 506 | Ga0466963_0022414 | 3300044694 | Bacteria | 4000 |
| 507 | Ga0466963_0041493 | 3300044694 | Bacteria | 3019 |
| 508 | Ga0466963_0054645 | 3300044694 | Bacteria | 2655 |
| 509 | Ga0466963_0067096 | 3300044694 | Bacteria | 2407 |
| 510 | Ga0466963_0315608 | 3300044694 | Bacteria | 1100 |
| 511 | Ga0466963_0441929 | 3300044694 | Bacteria | 918 |
| 512 | Ga0466963_0469026 | 3300044694 | Bacteria | 888 |
| 513 | Ga0466971_0017842 | 3300044719 | Bacteria | 3144 |
| 514 | Ga0466971_0106608 | 3300044719 | Bacteria | 1291 |
| 515 | Ga0466968_0001388 | 3300044735 | Bacteria | 8653 |
| 516 | Ga0466968_0005428 | 3300044735 | Bacteria | 4772 |
| 517 | Ga0466968_0075741 | 3300044735 | Bacteria | 1471 |
| 518 | Ga0466968_0169814 | 3300044735 | Bacteria | 1010 |
| 519 | Ga0466968_0222426 | 3300044735 | Bacteria | 889 |
| 520 | Ga0466970_0016086 | 3300044765 | Bacteria | 3853 |
| 521 | Ga0466970_0044015 | 3300044765 | Bacteria | 2377 |
| 522 | Ga0466970_0165190 | 3300044765 | Bacteria | 1225 |
| 523 | Ga0466957_0002569 | 3300044842 | Bacteria | 9770 |
| 524 | Ga0466957_0080532 | 3300044842 | Bacteria | 2027 |
| 525 | Ga0466957_0166457 | 3300044842 | Bacteria | 1434 |
| 526 | Ga0466957_0179267 | 3300044842 | Bacteria | 1383 |
| 527 | Ga0466957_0257020 | 3300044842 | Bacteria | 1163 |
| 528 | Ga0466957_0403629 | 3300044842 | Bacteria | 935 |
| 529 | Ga0466960_0000108 | 3300044901 | Bacteria | 27686 |
| 530 | Ga0466960_0020121 | 3300044901 | Bacteria | 2952 |
| 531 | Ga0466960_0041695 | 3300044901 | Bacteria | 2175 |
| 532 | Ga0466960_0391397 | 3300044901 | Bacteria | 799 |
| 533 | Ga0466959_0001743 | 3300045049 | Bacteria | 13537 |
| 534 | Ga0466959_0021813 | 3300045049 | Bacteria | 4727 |
| 535 | Ga0466959_0068186 | 3300045049 | Bacteria | 2578 |
| 536 | Ga0466959_0097330 | 3300045049 | Bacteria | 2109 |
| 537 | Ga0466958_0000249 | 3300045836 | Bacteria | 20765 |
| 538 | Ga0466958_0015421 | 3300045836 | Bacteria | 4380 |
| 539 | Ga0466958_0032807 | 3300045836 | Bacteria | 3091 |
| 540 | Ga0466958_0062578 | 3300045836 | Bacteria | 2269 |
| 541 | Ga0466958_0125469 | 3300045836 | Bacteria | 1609 |
| 542 | Ga0466958_0139279 | 3300045836 | Bacteria | 1527 |
| 543 | Ga0466967_0004216 | 3300045976 | Bacteria | 9641 |
| 544 | Ga0466967_0017156 | 3300045976 | Bacteria | 5737 |
| 545 | Ga0466967_0025921 | 3300045976 | Bacteria | 4844 |
| 546 | Ga0466967_0033247 | 3300045976 | Bacteria | 4363 |
| 547 | Ga0466967_0034434 | 3300045976 | Bacteria | 4299 |
| 548 | Ga0466967_0068031 | 3300045976 | Bacteria | 3179 |
| 549 | Ga0466967_0068924 | 3300045976 | Bacteria | 3160 |
| 550 | Ga0466967_0112879 | 3300045976 | Bacteria | 2499 |
| 551 | Ga0466967_0225616 | 3300045976 | Bacteria | 1782 |
| 552 | Ga0466967_0283884 | 3300045976 | Bacteria | 1589 |
| 553 | Ga0466967_0607720 | 3300045976 | Bacteria | 1080 |
| 554 | Ga0466967_0752309 | 3300045976 | Bacteria | 967 |
| 555 | Ga0466967_1001020 | 3300045976 | Bacteria | 832 |
| 556 | Ga0495603_0014689 | 3300046455 | Bacteria | 4734 |
| 557 | Ga0495629_0048770 | 3300046459 | Bacteria | 2969 |
| 558 | Ga0495638_0001617 | 3300046460 | Bacteria | 20096 |
| 559 | Ga0495638_0017392 | 3300046460 | Bacteria | 4795 |
| 560 | Ga0495641_0020272 | 3300046461 | Bacteria | 3376 |
| 561 | Ga0495580_0514200 | 3300046472 | Bacteria | 798 |
| 562 | Ga0495639_0050203 | 3300046475 | Bacteria | 1894 |
| 563 | Ga0495594_0060339 | 3300046499 | Bacteria | 2098 |
| 564 | Ga0495606_0053870 | 3300046507 | Bacteria | 2608 |
| 565 | Ga0495620_0136916 | 3300046515 | Bacteria | 959 |
| 566 | Ga0495648_0002598 | 3300046524 | Bacteria | 16514 |
| 567 | Ga0495665_0024144 | 3300046531 | Bacteria | 3266 |
| 568 | Ga0495640_0093888 | 3300046533 | Bacteria | 1977 |
| 569 | Ga0495668_0037545 | 3300046616 | Bacteria | 2710 |
| 570 | Ga0495634_0188608 | 3300046642 | Bacteria | 1287 |
| 571 | Ga0495658_0007185 | 3300046683 | Bacteria | 5500 |
| 572 | Ga0495613_0577951 | 3300046689 | Bacteria | 749 |
| 573 | Ga0495624_0026430 | 3300046690 | Bacteria | 3804 |
| 574 | Ga0495649_0098020 | 3300046694 | Bacteria | 1559 |
| 575 | Ga0495581_0007818 | 3300047315 | Bacteria | 6192 |
| 576 | Ga0495604_0153294 | 3300047317 | Bacteria | 1635 |
| 577 | Ga0495604_0516147 | 3300047317 | Bacteria | 774 |
| 578 | Ga0495672_0015022 | 3300047320 | Bacteria | 5273 |
| 579 | Ga0495672_0084143 | 3300047320 | Bacteria | 1765 |
| 580 | Ga0495672_0087759 | 3300047320 | Bacteria | 1717 |
| 581 | Ga0495672_0131013 | 3300047320 | Bacteria | 1319 |
| 582 | Ga0495672_0136274 | 3300047320 | Bacteria | 1287 |
| 583 | Ga0495676_0034773 | 3300047321 | Bacteria | 4224 |
| 584 | Ga0495680_0175478 | 3300047322 | Bacteria | 1550 |
| 585 | Ga0495673_0000355 | 3300047469 | Bacteria | 57060 |
| 586 | Ga0495686_0021284 | 3300047472 | Bacteria | 4309 |
| 587 | Ga0495686_0144366 | 3300047472 | Bacteria | 1402 |
| 588 | Ga0495593_0013302 | 3300047673 | Bacteria | 4697 |
| 589 | Ga0496100_0000009 | 3300048903 | Bacteria | 225785 |
| 590 | Ga0496100_0003439 | 3300048903 | Bacteria | 8257 |
| 591 | Ga0496100_0021910 | 3300048903 | Bacteria | 3857 |
| 592 | Ga0496100_0104331 | 3300048903 | Bacteria | 1958 |
| 593 | Ga0496100_0221613 | 3300048903 | Bacteria | 1388 |
| 594 | Ga0496101_0000018 | 3300048904 | Bacteria | 236102 |
| 595 | Ga0496101_0000114 | 3300048904 | Bacteria | 79796 |
| 596 | Ga0496101_0002057 | 3300048904 | Bacteria | 12242 |
| 597 | Ga0496101_0003076 | 3300048904 | Bacteria | 10312 |
| 598 | Ga0496101_0004515 | 3300048904 | Bacteria | 8781 |
| 599 | Ga0496101_0076723 | 3300048904 | Bacteria | 2462 |
| 600 | Ga0496101_0297761 | 3300048904 | Bacteria | 1263 |
| 601 | Ga0496102_0000014 | 3300048905 | Bacteria | 310241 |
| 602 | Ga0496102_0000820 | 3300048905 | Bacteria | 30171 |
| 603 | Ga0496102_0003481 | 3300048905 | Bacteria | 13347 |
| 604 | Ga0496102_0003652 | 3300048905 | Bacteria | 13015 |
| 605 | Ga0496102_0076420 | 3300048905 | Bacteria | 3080 |
| 606 | Ga0496102_0142346 | 3300048905 | Bacteria | 2249 |
| 607 | Ga0496102_0237016 | 3300048905 | Bacteria | 1720 |
| 608 | Ga0496102_0268001 | 3300048905 | Bacteria | 1610 |
| 609 | Ga0496102_0339862 | 3300048905 | Bacteria | 1414 |
| 610 | Ga0496102_0382583 | 3300048905 | Bacteria | 1324 |
| 611 | Ga0496102_0420470 | 3300048905 | Bacteria | 1255 |
| 612 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 613 | Ga0496103_0000473 | 3300048906 | Bacteria | 33859 |
| 614 | Ga0496103_0000662 | 3300048906 | Bacteria | 25938 |
| 615 | Ga0496103_0001547 | 3300048906 | Bacteria | 15288 |
| 616 | Ga0496103_0038046 | 3300048906 | Bacteria | 2950 |
| 617 | Ga0496103_0042581 | 3300048906 | Bacteria | 2795 |
| 618 | Ga0496103_0307240 | 3300048906 | Bacteria | 1020 |
| 619 | Ga0496104_0000285 | 3300048907 | Bacteria | 44731 |
| 620 | Ga0496104_0008789 | 3300048907 | Bacteria | 8979 |
| 621 | Ga0496104_0203954 | 3300048907 | Bacteria | 1889 |
| 622 | Ga0496104_0280541 | 3300048907 | Bacteria | 1579 |
| 623 | Ga0496105_0040584 | 3300048908 | Bacteria | 3837 |
| 624 | Ga0496105_0199445 | 3300048908 | Bacteria | 1634 |
| 625 | Ga0496105_0219740 | 3300048908 | Bacteria | 1547 |
| 626 | Ga0496106_0003083 | 3300048909 | Bacteria | 12434 |
| 627 | Ga0496106_0005366 | 3300048909 | Bacteria | 9485 |
| 628 | Ga0496106_0026975 | 3300048909 | Bacteria | 4277 |
| 629 | Ga0496106_0027196 | 3300048909 | Bacteria | 4260 |
| 630 | Ga0496106_0071625 | 3300048909 | Bacteria | 2650 |
| 631 | Ga0496107_0000152 | 3300048910 | Bacteria | 35028 |
| 632 | Ga0496107_0000303 | 3300048910 | Bacteria | 26324 |
| 633 | Ga0496107_0000364 | 3300048910 | Bacteria | 24565 |
| 634 | Ga0496108_0000520 | 3300048911 | Bacteria | 30186 |
| 635 | Ga0496108_0005587 | 3300048911 | Bacteria | 10174 |
| 636 | Ga0496108_0022252 | 3300048911 | Bacteria | 5213 |
| 637 | Ga0496108_0048364 | 3300048911 | Bacteria | 3556 |
| 638 | Ga0496108_0848020 | 3300048911 | Bacteria | 786 |
| 639 | Ga0496109_0000214 | 3300048912 | Bacteria | 56898 |
| 640 | Ga0496109_0002624 | 3300048912 | Bacteria | 15074 |
| 641 | Ga0496109_0017274 | 3300048912 | Bacteria | 6320 |
| 642 | Ga0496109_0051609 | 3300048912 | Bacteria | 3746 |
| 643 | Ga0496109_0222005 | 3300048912 | Bacteria | 1777 |
| 644 | Ga0496109_0297274 | 3300048912 | Bacteria | 1522 |
| 645 | Ga0496109_0490464 | 3300048912 | Bacteria | 1160 |
| 646 | Ga0496109_0623128 | 3300048912 | Bacteria | 1015 |
| 647 | Ga0496110_0015406 | 3300048913 | Bacteria | 6361 |
| 648 | Ga0496110_0024790 | 3300048913 | Bacteria | 5117 |
| 649 | Ga0496110_0030141 | 3300048913 | Bacteria | 4675 |
| 650 | Ga0496110_0096592 | 3300048913 | Bacteria | 2648 |
| 651 | Ga0496110_0831443 | 3300048913 | Bacteria | 828 |
| 652 | Ga0496111_0005039 | 3300048914 | Bacteria | 8403 |
| 653 | Ga0496111_0028064 | 3300048914 | Bacteria | 3987 |
| 654 | Ga0496111_0492783 | 3300048914 | Bacteria | 902 |
| 655 | Ga0496112_0001718 | 3300048915 | Bacteria | 17115 |
| 656 | Ga0496112_0034180 | 3300048915 | Bacteria | 4947 |
| 657 | Ga0496112_0059613 | 3300048915 | Bacteria | 3761 |
| 658 | Ga0496112_0064234 | 3300048915 | Bacteria | 3622 |
| 659 | Ga0496112_0114959 | 3300048915 | Bacteria | 2661 |
| 660 | Ga0496112_0287583 | 3300048915 | Bacteria | 1590 |
| 661 | Ga0496113_0047080 | 3300048916 | Bacteria | 3204 |
| 662 | Ga0496113_0049429 | 3300048916 | Bacteria | 3131 |
| 663 | Ga0496113_0137406 | 3300048916 | Bacteria | 1921 |
| 664 | Ga0496114_0000108 | 3300048917 | Bacteria | 59737 |
| 665 | Ga0496114_0000136 | 3300048917 | Bacteria | 53108 |
| 666 | Ga0496114_0000166 | 3300048917 | Bacteria | 47004 |
| 667 | Ga0496114_0080888 | 3300048917 | Bacteria | 2744 |
| 668 | Ga0496114_0116485 | 3300048917 | Bacteria | 2294 |
| 669 | Ga0496114_0127030 | 3300048917 | Bacteria | 2199 |
| 670 | Ga0496114_0161578 | 3300048917 | Bacteria | 1948 |
| 671 | Ga0496114_0400059 | 3300048917 | Bacteria | 1216 |
| 672 | Ga0496115_0000620 | 3300048918 | Bacteria | 26937 |
| 673 | Ga0496115_0002574 | 3300048918 | Bacteria | 13020 |
| 674 | Ga0496115_0303140 | 3300048918 | Bacteria | 1309 |
| 675 | Ga0496115_0406384 | 3300048918 | Bacteria | 1104 |
| 676 | Ga0496116_0000428 | 3300048919 | Bacteria | 59070 |
| 677 | Ga0496116_0010448 | 3300048919 | Bacteria | 7775 |
| 678 | Ga0496116_0064942 | 3300048919 | Bacteria | 2343 |
| 679 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 680 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 681 | Ga0496118_0000292 | 3300048921 | Bacteria | 87325 |
| 682 | Ga0496118_0004368 | 3300048921 | Bacteria | 16812 |
| 683 | Ga0496119_0001080 | 3300048922 | Bacteria | 34426 |
| 684 | Ga0496119_0001862 | 3300048922 | Bacteria | 24358 |
| 685 | Ga0496119_0028396 | 3300048922 | Bacteria | 3817 |
| 686 | Ga0496120_0001263 | 3300048923 | Bacteria | 31791 |
| 687 | Ga0496120_0003934 | 3300048923 | Bacteria | 12949 |
| 688 | Ga0496120_0031778 | 3300048923 | Bacteria | 3192 |
| 689 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 690 | Ga0496121_0000032 | 3300048924 | Bacteria | 378997 |
| 691 | Ga0496121_0004517 | 3300048924 | Bacteria | 18633 |
| 692 | Ga0496122_0000164 | 3300048925 | Bacteria | 158055 |
| 693 | Ga0496123_0006609 | 3300048926 | Bacteria | 11199 |
| 694 | Ga0496123_0012134 | 3300048926 | Bacteria | 7380 |
| 695 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 696 | Ga0496124_0109899 | 3300048927 | Bacteria | 2220 |
| 697 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 698 | Ga0496125_0071017 | 3300048928 | Bacteria | 2722 |
| 699 | Ga0496125_0119758 | 3300048928 | Bacteria | 1881 |
| 700 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 701 | Ga0496126_0000067 | 3300048929 | Bacteria | 249091 |
| 702 | Ga0496126_0001990 | 3300048929 | Bacteria | 28976 |
| 703 | Ga0496126_0002459 | 3300048929 | Bacteria | 24976 |
| 704 | Ga0496126_0006797 | 3300048929 | Bacteria | 12687 |
| 705 | Ga0496126_0071181 | 3300048929 | Bacteria | 3096 |
| 706 | Ga0496126_0670904 | 3300048929 | Bacteria | 809 |
| 707 | Ga0501032_0015981 | 3300049569 | Bacteria | 5283 |
| 708 | Ga0501032_0264703 | 3300049569 | Bacteria | 1114 |
| 709 | Ga0501033_0006709 | 3300049570 | Bacteria | 8992 |
| 710 | Ga0501033_0039642 | 3300049570 | Bacteria | 3519 |
| 711 | Ga0501034_0006051 | 3300049571 | Bacteria | 13067 |
| 712 | Ga0501034_0011109 | 3300049571 | Bacteria | 9348 |
| 713 | Ga0501034_0074634 | 3300049571 | Bacteria | 3399 |
| 714 | Ga0501036_0016634 | 3300049572 | Bacteria | 6141 |
| 715 | Ga0501036_0044342 | 3300049572 | Bacteria | 3767 |
| 716 | Ga0501037_0000584 | 3300049573 | Bacteria | 28691 |
| 717 | Ga0501037_0003783 | 3300049573 | Bacteria | 10981 |
| 718 | Ga0501038_0003008 | 3300049574 | Bacteria | 15716 |
| 719 | Ga0501039_0002202 | 3300049575 | Bacteria | 14422 |
| 720 | Ga0501043_0001037 | 3300049579 | Bacteria | 24401 |
| 721 | Ga0501043_0077857 | 3300049579 | Bacteria | 2605 |
| 722 | Ga0501046_0001804 | 3300049580 | Bacteria | 20417 |
| 723 | Ga0501047_0000372 | 3300049581 | Bacteria | 50660 |
| 724 | Ga0501047_0433643 | 3300049581 | Bacteria | 1145 |
| 725 | Ga0501048_0031651 | 3300049582 | Bacteria | 3826 |
| 726 | Ga0501069_0036857 | 3300049585 | Bacteria | 2698 |
| 727 | Ga0501069_0235466 | 3300049585 | Bacteria | 1066 |
| 728 | Ga0501070_0000578 | 3300049586 | Bacteria | 33378 |
| 729 | Ga0501070_0002976 | 3300049586 | Bacteria | 14755 |
| 730 | Ga0501070_0039346 | 3300049586 | Bacteria | 3945 |
| 731 | Ga0501070_0098697 | 3300049586 | Bacteria | 2416 |
| 732 | Ga0501073_0024898 | 3300049589 | Bacteria | 4295 |
| 733 | Ga0501073_0032431 | 3300049589 | Bacteria | 3724 |
| 734 | Ga0501080_0042237 | 3300049742 | Bacteria | 4247 |
| 735 | Ga0501080_0753878 | 3300049742 | Bacteria | 856 |
| 736 | Ga0501035_0001032 | 3300049822 | Bacteria | 29280 |
| 737 | Ga0501035_0436679 | 3300049822 | Bacteria | 1085 |
| 738 | Ga0501044_0006896 | 3300049823 | Bacteria | 12507 |
| 739 | Ga0501044_0008550 | 3300049823 | Bacteria | 11218 |
| 740 | Ga0501044_0014604 | 3300049823 | Bacteria | 8469 |
| 741 | Ga0501045_0264326 | 3300049824 | Bacteria | 1281 |
| 742 | nmdc:mga03683_213621_c1 | 3300050489 | Bacteria | 888 |
| 743 | nmdc:mga03683_32675_c1 | 3300050489 | Bacteria | 2095 |
| 744 | nmdc:mga03n38_138016_c1 | 3300050490 | Bacteria | 1215 |
| 745 | nmdc:mga03n38_25694_c1 | 3300050490 | Bacteria | 2423 |
| 746 | nmdc:mga03n38_3325_c1 | 3300050490 | Bacteria | 5147 |
| 747 | nmdc:mga03n38_40989_c1 | 3300050490 | Bacteria | 2015 |
| 748 | nmdc:mga03n38_61400_c1 | 3300050490 | Bacteria | 1712 |
| 749 | nmdc:mga00v17_147632_c1 | 3300050491 | Bacteria | 1510 |
| 750 | nmdc:mga00v17_1649_c1 | 3300050491 | Bacteria | 11309 |
| 751 | nmdc:mga00v17_227478_c1 | 3300050491 | Bacteria | 1208 |
| 752 | nmdc:mga00v17_4701_c1 | 3300050491 | Bacteria | 7132 |
| 753 | nmdc:mga00v17_50762_c1 | 3300050491 | Bacteria | 2522 |
| 754 | nmdc:mga00v17_98783_c1 | 3300050491 | Bacteria | 1207 |
| 755 | nmdc:mga0yw44_15444_c1 | 3300050492 | Bacteria | 4091 |
| 756 | nmdc:mga0yw44_204468_c1 | 3300050492 | Bacteria | 1305 |
| 757 | nmdc:mga0yw44_27434_c1 | 3300050492 | Bacteria | 1823 |
| 758 | nmdc:mga0yw44_2876_c1 | 3300050492 | Bacteria | 7479 |
| 759 | nmdc:mga0yw44_6915_c1 | 3300050492 | Bacteria | 5528 |
| 760 | nmdc:mga06z11_112694_c1 | 3300050494 | Bacteria | 1508 |
| 761 | nmdc:mga06z11_226856_c1 | 3300050494 | Bacteria | 1093 |
| 762 | nmdc:mga06z11_5162_c1 | 3300050494 | Bacteria | 5212 |
| 763 | nmdc:mga04h51_49795_c1 | 3300050495 | Bacteria | 1401 |
| 764 | nmdc:mga07m45_11903_c1 | 3300050496 | Bacteria | 4583 |
| 765 | nmdc:mga07m45_149346_c1 | 3300050496 | Bacteria | 1355 |
| 766 | nmdc:mga07m45_17140_c1 | 3300050496 | Bacteria | 3885 |
| 767 | nmdc:mga07m45_42124_c1 | 3300050496 | Bacteria | 2559 |
| 768 | nmdc:mga07m45_54510_c1 | 3300050496 | Bacteria | 1577 |
| 769 | nmdc:mga05p37_26882_c1 | 3300050507 | Bacteria | 7001 |
| 770 | nmdc:mga09592_331376_c1 | 3300050508 | Bacteria | 1318 |
| 771 | nmdc:mga0qj67_520316_c1 | 3300050509 | Bacteria | 956 |
| 772 | nmdc:mga06r32_66396_c1 | 3300050510 | Bacteria | 3481 |
| 773 | nmdc:mga08y16_187794_c1 | 3300050511 | Bacteria | 2144 |
| 774 | nmdc:mga08y16_543028_c1 | 3300050511 | Bacteria | 1177 |
| 775 | nmdc:mga0sz30_164225_c1 | 3300050516 | Bacteria | 984 |
| 776 | nmdc:mga0sz30_18492_c1 | 3300050516 | Bacteria | 2357 |
| 777 | nmdc:mga0sz30_199038_c1 | 3300050516 | Bacteria | 889 |
| 778 | nmdc:mga0sz30_3091_c1 | 3300050516 | Bacteria | 5964 |
| 779 | nmdc:mga0sz30_41704_c1 | 3300050516 | Bacteria | 1930 |
| 780 | nmdc:mga0sz30_56390_c1 | 3300050516 | Bacteria | 1673 |
| 781 | nmdc:mga0sz30_68233_c1 | 3300050516 | Bacteria | 1527 |
| 782 | nmdc:mga0sz30_8902_c1 | 3300050516 | Bacteria | 3805 |
| 783 | Ga0500610_0026618 | 3300053079 | Bacteria | 2896 |
| 784 | Ga0500635_0000695 | 3300053080 | Bacteria | 8518 |
| 785 | Ga0500643_011430 | 3300053087 | Bacteria | 3240 |
| 786 | Ga0500643_017752 | 3300053087 | Bacteria | 2376 |
| 787 | Ga0500650_0207813 | 3300053098 | Bacteria | 890 |
| 788 | Ga0500556_0005325 | 3300053104 | Bacteria | 3637 |
| 789 | Ga0500642_0039883 | 3300053130 | Bacteria | 2022 |
| 790 | Ga0500652_000535 | 3300053131 | Bacteria | 13353 |
| 791 | Ga0500577_0008155 | 3300053142 | Bacteria | 2971 |
| 792 | Ga0500616_0007708 | 3300053153 | Bacteria | 6796 |
| 793 | Ga0500616_0092688 | 3300053153 | Bacteria | 1493 |
| 794 | Ga0500616_0206215 | 3300053153 | Bacteria | 867 |
| 795 | Ga0500645_000075 | 3300053730 | Bacteria | 78736 |
| 796 | Ga0500645_018737 | 3300053730 | Bacteria | 2158 |
| 797 | Ga0466962_0028329 | 3300061719 | Bacteria | 2684 |
| 798 | Ga0466962_0241866 | 3300061719 | Bacteria | 886 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_101317228 | Ga0068868_1013172281 | 181 |
| 2 | 3300005468 | Ga0070707_100007178 | Ga0070707_1000071789 | 188 |
| 3 | 3300025922 | Ga0207646_10085464 | Ga0207646_100854643 | 188 |
| 4 | 3300005445 | Ga0070708_100291628 | Ga0070708_1002916282 | 196 |
| 5 | 3300005518 | Ga0070699_100164102 | Ga0070699_1001641022 | 196 |
| 6 | 3300044694 | Ga0466963_0008470 | Ga0466963_0008470_4303_5028 | 198 |
| 7 | 3300048907 | Ga0496104_0203954 | Ga0496104_0203954_619_1332 | 198 |
| 8 | 3300048911 | Ga0496108_0022252 | Ga0496108_0022252_1420_2133 | 198 |
| 9 | 3300048913 | Ga0496110_0030141 | Ga0496110_0030141_3236_3949 | 198 |
| 10 | 3300048907 | Ga0496104_0280541 | Ga0496104_0280541_77_790 | 200 |
| 11 | 3300048917 | Ga0496114_0116485 | Ga0496114_0116485_26_739 | 200 |
| 12 | 3300046515 | Ga0495620_0136916 | Ga0495620_0136916_328_942 | 204 |
| 13 | 3300047320 | Ga0495672_0084143 | Ga0495672_0084143_94_708 | 204 |
| 14 | 3300048911 | Ga0496108_0848020 | Ga0496108_0848020_19_633 | 204 |
| 15 | 3300048914 | Ga0496111_0492783 | Ga0496111_0492783_16_630 | 204 |
| 16 | 3300005467 | Ga0070706_100010948 | Ga0070706_1000109485 | 207 |
| 17 | 3300005536 | Ga0070697_100548269 | Ga0070697_1005482692 | 207 |
| 18 | 3300009098 | Ga0105245_10033743 | Ga0105245_100337432 | 207 |
| 19 | 3300025927 | Ga0207687_10019107 | Ga0207687_100191072 | 207 |
| 20 | 3300044694 | Ga0466963_0067096 | Ga0466963_0067096_366_989 | 207 |
| 21 | 3300045049 | Ga0466959_0068186 | Ga0466959_0068186_342_1025 | 209 |
| 22 | 3300061719 | Ga0466962_0241866 | Ga0466962_0241866_153_836 | 209 |
| 23 | 3300013102 | Ga0157371_10195262 | Ga0157371_101952622 | 212 |
| 24 | 3300014325 | Ga0163163_10631623 | Ga0163163_106316231 | 212 |
| 25 | 3300044656 | Ga0466969_0119862 | Ga0466969_0119862_282_989 | 214 |
| 26 | 3300044693 | Ga0466961_0003735 | Ga0466961_0003735_6656_7363 | 214 |
| 27 | 3300053153 | Ga0500616_0206215 | Ga0500616_0206215_20_685 | 214 |
| 28 | iso_pu_bacteria | 2558860280 | 2559429534 | 214 |
| 29 | iso_pu_bacteria | 2582580736 | 2583150348 | 214 |
| 30 | iso_pu_bacteria | 2791354901 | 2791910618 | 216 |
| 31 | iso_pu_bacteria | 2795385470 | 2795783599 | 216 |
| 32 | iso_pu_bacteria | 2795385472 | 2795794489 | 216 |
| 33 | iso_pu_bacteria | 2956939328 | 2956939378 | 216 |
| 34 | iso_pu_bacteria | 3001119090 | 3001122171 | 216 |
| 35 | 3300005355 | Ga0070671_100000475 | Ga0070671_10000047520 | 217 |
| 36 | 3300005548 | Ga0070665_100005202 | Ga0070665_10000520214 | 217 |
| 37 | 3300005841 | Ga0068863_100028488 | Ga0068863_1000284882 | 217 |
| 38 | 3300025931 | Ga0207644_10000326 | Ga0207644_1000032620 | 217 |
| 39 | 3300025972 | Ga0207668_10115661 | Ga0207668_101156612 | 217 |
| 40 | 3300026088 | Ga0207641_10089971 | Ga0207641_100899712 | 217 |
| 41 | 3300028379 | Ga0268266_10038405 | Ga0268266_100384052 | 217 |
| 42 | 3300031731 | Ga0307405_10189306 | Ga0307405_101893063 | 217 |
| 43 | 3300005347 | Ga0070668_100001456 | Ga0070668_1000014564 | 218 |
| 44 | 3300009094 | Ga0111539_10761220 | Ga0111539_107612202 | 218 |
| 45 | 3300031838 | Ga0307518_10002521 | Ga0307518_100025212 | 218 |
| 46 | 3300039437 | Ga0436365_1307586 | Ga0436365_1307586_207_863 | 218 |
| 47 | 3300046531 | Ga0495665_0024144 | Ga0495665_0024144_532_1188 | 218 |
| 48 | 3300021358 | Ga0213873_10000052 | Ga0213873_1000005216 | 219 |
| 49 | 3300021388 | Ga0213875_10000073 | Ga0213875_1000007375 | 219 |
| 50 | 3300003203 | JGI25406J46586_10004772 | JGI25406J46586_100047723 | 220 |
| 51 | 3300005329 | Ga0070683_100048295 | Ga0070683_1000482955 | 220 |
| 52 | 3300005337 | Ga0070682_100070143 | Ga0070682_1000701431 | 220 |
| 53 | 3300005338 | Ga0068868_100574735 | Ga0068868_1005747351 | 220 |
| 54 | 3300005366 | Ga0070659_100203915 | Ga0070659_1002039151 | 220 |
| 55 | 3300005455 | Ga0070663_100000066 | Ga0070663_10000006631 | 220 |
| 56 | 3300005455 | Ga0070663_100217488 | Ga0070663_1002174882 | 220 |
| 57 | 3300005455 | Ga0070663_100554816 | Ga0070663_1005548161 | 220 |
| 58 | 3300005535 | Ga0070684_100505720 | Ga0070684_1005057201 | 220 |
| 59 | 3300005578 | Ga0068854_100674914 | Ga0068854_1006749141 | 220 |
| 60 | 3300005617 | Ga0068859_100074723 | Ga0068859_1000747232 | 220 |
| 61 | 3300005617 | Ga0068859_100776883 | Ga0068859_1007768831 | 220 |
| 62 | 3300005618 | Ga0068864_100265520 | Ga0068864_1002655202 | 220 |
| 63 | 3300005719 | Ga0068861_100337227 | Ga0068861_1003372272 | 220 |
| 64 | 3300005834 | Ga0068851_10229086 | Ga0068851_102290861 | 220 |
| 65 | 3300005842 | Ga0068858_100498310 | Ga0068858_1004983102 | 220 |
| 66 | 3300005843 | Ga0068860_100050567 | Ga0068860_1000505672 | 220 |
| 67 | 3300005985 | Ga0081539_10001153 | Ga0081539_1000115340 | 220 |
| 68 | 3300006358 | Ga0068871_100119613 | Ga0068871_1001196132 | 220 |
| 69 | 3300006880 | Ga0075429_100269907 | Ga0075429_1002699072 | 220 |
| 70 | 3300006931 | Ga0097620_100074725 | Ga0097620_1000747252 | 220 |
| 71 | 3300006931 | Ga0097620_100776732 | Ga0097620_1007767321 | 220 |
| 72 | 3300013307 | Ga0157372_10248274 | Ga0157372_102482742 | 220 |
| 73 | 3300017792 | Ga0163161_10111328 | Ga0163161_101113282 | 220 |
| 74 | 3300021384 | Ga0213876_10015198 | Ga0213876_100151983 | 220 |
| 75 | 3300025900 | Ga0207710_10044460 | Ga0207710_100444604 | 220 |
| 76 | 3300025901 | Ga0207688_10002023 | Ga0207688_1000202311 | 220 |
| 77 | 3300025907 | Ga0207645_10161229 | Ga0207645_101612292 | 220 |
| 78 | 3300025907 | Ga0207645_10469005 | Ga0207645_104690051 | 220 |
| 79 | 3300025924 | Ga0207694_10203101 | Ga0207694_102031012 | 220 |
| 80 | 3300025927 | Ga0207687_10356026 | Ga0207687_103560262 | 220 |
| 81 | 3300025928 | Ga0207700_10757072 | Ga0207700_107570722 | 220 |
| 82 | 3300025929 | Ga0207664_10002749 | Ga0207664_100027495 | 220 |
| 83 | 3300025929 | Ga0207664_10029135 | Ga0207664_100291355 | 220 |
| 84 | 3300025932 | Ga0207690_10199324 | Ga0207690_101993241 | 220 |
| 85 | 3300025936 | Ga0207670_10092663 | Ga0207670_100926632 | 220 |
| 86 | 3300025942 | Ga0207689_10049054 | Ga0207689_100490542 | 220 |
| 87 | 3300025944 | Ga0207661_10041993 | Ga0207661_100419934 | 220 |
| 88 | 3300025960 | Ga0207651_10038678 | Ga0207651_100386783 | 220 |
| 89 | 3300025986 | Ga0207658_10165273 | Ga0207658_101652732 | 220 |
| 90 | 3300026023 | Ga0207677_10337820 | Ga0207677_103378202 | 220 |
| 91 | 3300026035 | Ga0207703_10258490 | Ga0207703_102584902 | 220 |
| 92 | 3300026067 | Ga0207678_10000511 | Ga0207678_1000051125 | 220 |
| 93 | 3300026067 | Ga0207678_10025446 | Ga0207678_100254461 | 220 |
| 94 | 3300026067 | Ga0207678_10273717 | Ga0207678_102737171 | 220 |
| 95 | 3300026067 | Ga0207678_10524397 | Ga0207678_105243972 | 220 |
| 96 | 3300026075 | Ga0207708_10419609 | Ga0207708_104196092 | 220 |
| 97 | 3300026088 | Ga0207641_10461165 | Ga0207641_104611652 | 220 |
| 98 | 3300026118 | Ga0207675_100087933 | Ga0207675_1000879332 | 220 |
| 99 | 3300026118 | Ga0207675_100584398 | Ga0207675_1005843981 | 220 |
| 100 | 3300028379 | Ga0268266_10059265 | Ga0268266_100592652 | 220 |
| 101 | 3300028381 | Ga0268264_10040710 | Ga0268264_100407102 | 220 |
| 102 | 3300028794 | Ga0307515_10036541 | Ga0307515_100365417 | 220 |
| 103 | 3300028794 | Ga0307515_10071931 | Ga0307515_100719311 | 220 |
| 104 | 3300030521 | Ga0307511_10107688 | Ga0307511_101076882 | 220 |
| 105 | 3300030522 | Ga0307512_10031225 | Ga0307512_100312252 | 220 |
| 106 | 3300030522 | Ga0307512_10049847 | Ga0307512_100498474 | 220 |
| 107 | 3300031731 | Ga0307405_10356381 | Ga0307405_103563812 | 220 |
| 108 | 3300031824 | Ga0307413_10001347 | Ga0307413_100013475 | 220 |
| 109 | 3300031824 | Ga0307413_10513638 | Ga0307413_105136381 | 220 |
| 110 | 3300033179 | Ga0307507_10104243 | Ga0307507_101042431 | 220 |
| 111 | 3300033180 | Ga0307510_10022713 | Ga0307510_100227134 | 220 |
| 112 | 3300044656 | Ga0466969_0054733 | Ga0466969_0054733_226_888 | 220 |
| 113 | 3300044658 | Ga0466972_0001186 | Ga0466972_0001186_9910_10572 | 220 |
| 114 | 3300044683 | Ga0466965_0249729 | Ga0466965_0249729_110_772 | 220 |
| 115 | 3300044683 | Ga0466965_0452939 | Ga0466965_0452939_13_675 | 220 |
| 116 | 3300044735 | Ga0466968_0222426 | Ga0466968_0222426_59_721 | 220 |
| 117 | 3300044765 | Ga0466970_0044015 | Ga0466970_0044015_1142_1804 | 220 |
| 118 | 3300044901 | Ga0466960_0020121 | Ga0466960_0020121_1514_2176 | 220 |
| 119 | 3300045976 | Ga0466967_0225616 | Ga0466967_0225616_430_1092 | 220 |
| 120 | 3300048929 | Ga0496126_0670904 | Ga0496126_0670904_12_674 | 220 |
| 121 | 3300049580 | Ga0501046_0001804 | Ga0501046_0001804_14624_15286 | 220 |
| 122 | 3300050508 | nmdc:mga09592_331376_c1 | nmdc:mga09592_331376_c1_139_801 | 220 |
| 123 | 3300053098 | Ga0500650_0207813 | Ga0500650_0207813_113_775 | 220 |
| 124 | 3300053142 | Ga0500577_0008155 | Ga0500577_0008155_1368_2030 | 220 |
| 125 | iso_pu_bacteria | 2751185734 | 2753070669 | 221 |
| 126 | 3300005937 | Ga0081455_10000995 | Ga0081455_1000099535 | 223 |
| 127 | 3300048905 | Ga0496102_0268001 | Ga0496102_0268001_116_802 | 224 |
| 128 | 3300049586 | Ga0501070_0039346 | Ga0501070_0039346_2070_2744 | 224 |
| 129 | 3300049742 | Ga0501080_0042237 | Ga0501080_0042237_305_979 | 224 |
| 130 | 3300005455 | Ga0070663_100124548 | Ga0070663_1001245484 | 225 |
| 131 | 3300005618 | Ga0068864_100723658 | Ga0068864_1007236582 | 225 |
| 132 | 3300005719 | Ga0068861_100118728 | Ga0068861_1001187284 | 225 |
| 133 | 3300005840 | Ga0068870_10480157 | Ga0068870_104801571 | 225 |
| 134 | 3300005842 | Ga0068858_100000002 | Ga0068858_100000002233 | 225 |
| 135 | 3300005842 | Ga0068858_100955628 | Ga0068858_1009556281 | 225 |
| 136 | 3300006038 | Ga0075365_10019826 | Ga0075365_100198266 | 225 |
| 137 | 3300009092 | Ga0105250_10170395 | Ga0105250_101703951 | 225 |
| 138 | 3300009094 | Ga0111539_10573693 | Ga0111539_105736931 | 225 |
| 139 | 3300009101 | Ga0105247_10050375 | Ga0105247_100503753 | 225 |
| 140 | 3300009148 | Ga0105243_10001852 | Ga0105243_1000185216 | 225 |
| 141 | 3300009177 | Ga0105248_10000943 | Ga0105248_1000094328 | 225 |
| 142 | 3300009177 | Ga0105248_10547064 | Ga0105248_105470644 | 225 |
| 143 | 3300009553 | Ga0105249_10260659 | Ga0105249_102606592 | 225 |
| 144 | 3300011119 | Ga0105246_10117483 | Ga0105246_101174832 | 225 |
| 145 | 3300013306 | Ga0163162_10136421 | Ga0163162_101364212 | 225 |
| 146 | 3300014325 | Ga0163163_10012382 | Ga0163163_100123826 | 225 |
| 147 | 3300014325 | Ga0163163_10079654 | Ga0163163_100796544 | 225 |
| 148 | 3300014745 | Ga0157377_10166689 | Ga0157377_101666891 | 225 |
| 149 | 3300014968 | Ga0157379_10000007 | Ga0157379_1000000784 | 225 |
| 150 | 3300014968 | Ga0157379_10053821 | Ga0157379_100538212 | 225 |
| 151 | 3300020082 | Ga0206353_10744464 | Ga0206353_107444644 | 225 |
| 152 | 3300025901 | Ga0207688_10070823 | Ga0207688_100708232 | 225 |
| 153 | 3300025927 | Ga0207687_10027888 | Ga0207687_100278882 | 225 |
| 154 | 3300025932 | Ga0207690_10079943 | Ga0207690_100799433 | 225 |
| 155 | 3300025941 | Ga0207711_10002761 | Ga0207711_100027612 | 225 |
| 156 | 3300025981 | Ga0207640_10056847 | Ga0207640_100568472 | 225 |
| 157 | 3300026035 | Ga0207703_10000001 | Ga0207703_10000001476 | 225 |
| 158 | 3300026035 | Ga0207703_10603536 | Ga0207703_106035361 | 225 |
| 159 | 3300026118 | Ga0207675_100048224 | Ga0207675_1000482243 | 225 |
| 160 | 3300026121 | Ga0207683_10094962 | Ga0207683_100949622 | 225 |
| 161 | 3300027907 | Ga0207428_10156746 | Ga0207428_101567463 | 225 |
| 162 | 3300028379 | Ga0268266_10492503 | Ga0268266_104925032 | 225 |
| 163 | 3300044694 | Ga0466963_0041493 | Ga0466963_0041493_2250_2936 | 225 |
| 164 | 3300044842 | Ga0466957_0179267 | Ga0466957_0179267_656_1342 | 225 |
| 165 | 3300048904 | Ga0496101_0076723 | Ga0496101_0076723_400_1077 | 225 |
| 166 | 3300048905 | Ga0496102_0420470 | Ga0496102_0420470_345_1022 | 225 |
| 167 | 3300048906 | Ga0496103_0307240 | Ga0496103_0307240_34_711 | 225 |
| 168 | 3300048908 | Ga0496105_0199445 | Ga0496105_0199445_80_757 | 225 |
| 169 | 3300048909 | Ga0496106_0071625 | Ga0496106_0071625_1613_2290 | 225 |
| 170 | 3300048911 | Ga0496108_0000520 | Ga0496108_0000520_9216_9893 | 225 |
| 171 | 3300048912 | Ga0496109_0002624 | Ga0496109_0002624_9768_10445 | 225 |
| 172 | 3300048913 | Ga0496110_0096592 | Ga0496110_0096592_1284_1961 | 225 |
| 173 | 3300048915 | Ga0496112_0059613 | Ga0496112_0059613_220_897 | 225 |
| 174 | 3300048916 | Ga0496113_0047080 | Ga0496113_0047080_2315_2992 | 225 |
| 175 | 3300050511 | nmdc:mga08y16_543028_c1 | nmdc:mga08y16_543028_c1_349_1026 | 225 |
| 176 | 3300031901 | Ga0307406_10209805 | Ga0307406_102098051 | 228 |
| 177 | iso_pu_bacteria | 2565956761 | 2566993123 | 229 |
| 178 | iso_pu_bacteria | 2643221687 | 2644486506 | 229 |
| 179 | iso_pu_bacteria | 2643221715 | 2644634930 | 229 |
| 180 | iso_pu_bacteria | 2738541264 | 2738667508 | 229 |
| 181 | iso_pu_bacteria | 2738541274 | 2738706029 | 229 |
| 182 | iso_pu_bacteria | 2738541308 | 2738889914 | 229 |
| 183 | iso_pu_bacteria | 2738541356 | 2739146578 | 229 |
| 184 | iso_pu_bacteria | 2738543028 | 2739333071 | 229 |
| 185 | iso_pu_bacteria | 2738543034 | 2739362242 | 229 |
| 186 | iso_pu_bacteria | 2744054611 | 2744954294 | 229 |
| 187 | iso_pu_bacteria | 2842134933 | 2842138523 | 229 |
| 188 | iso_pu_bacteria | 2902792274 | 2902798344 | 229 |
| 189 | iso_pu_bacteria | 2902799365 | 2902801788 | 229 |
| 190 | iso_pu_bacteria | 2902810491 | 2902817015 | 229 |
| 191 | iso_pu_bacteria | 2902837492 | 2902840077 | 229 |
| 192 | iso_pu_bacteria | 2904535858 | 2904538883 | 229 |
| 193 | iso_pu_bacteria | 2922554459 | 2922556819 | 229 |
| 194 | iso_pu_bacteria | 2928142448 | 2928142555 | 229 |
| 195 | iso_pu_bacteria | 2929212328 | 2929214760 | 229 |
| 196 | iso_pu_bacteria | 2939582691 | 2939586652 | 229 |
| 197 | iso_pu_bacteria | 2974315732 | 2974317184 | 229 |
| 198 | iso_pu_bacteria | 2984523437 | 2984525390 | 229 |
| 199 | iso_pu_bacteria | 2738543011 | 2739239707 | 230 |
| 200 | iso_pu_bacteria | 2889300758 | 2889300916 | 230 |
| 201 | iso_pu_bacteria | 2939743619 | 2939744430 | 230 |
| 202 | iso_pu_bacteria | 2904765812 | 2904770151 | 231 |
| 203 | iso_pu_bacteria | 2904770941 | 2904770999 | 231 |
| 204 | iso_pu_bacteria | 2908811453 | 2908815042 | 231 |
| 205 | iso_pu_bacteria | 2919420072 | 2919424473 | 231 |
| 206 | iso_pu_bacteria | 2919432681 | 2919436866 | 231 |
| 207 | 3300002073 | JGI24745J21846_1010674 | JGI24745J21846_10106742 | 233 |
| 208 | 3300002075 | JGI24738J21930_10007479 | JGI24738J21930_100074793 | 233 |
| 209 | 3300002075 | JGI24738J21930_10008857 | JGI24738J21930_100088571 | 233 |
| 210 | 3300002076 | JGI24749J21850_1005080 | JGI24749J21850_10050801 | 233 |
| 211 | 3300002077 | JGI24744J21845_10000383 | JGI24744J21845_100003836 | 233 |
| 212 | 3300002244 | JGI24742J22300_10000643 | JGI24742J22300_100006434 | 233 |
| 213 | 3300002459 | JGI24751J29686_10006298 | JGI24751J29686_100062984 | 233 |
| 214 | 3300003792 | Ga0055540_1004388 | Ga0055540_10043883 | 233 |
| 215 | 3300003792 | Ga0055540_1009880 | Ga0055540_10098803 | 233 |
| 216 | 3300003792 | Ga0055540_1031021 | Ga0055540_10310212 | 233 |
| 217 | 3300005328 | Ga0070676_10119906 | Ga0070676_101199063 | 233 |
| 218 | 3300005329 | Ga0070683_100834515 | Ga0070683_1008345151 | 233 |
| 219 | 3300005330 | Ga0070690_100001859 | Ga0070690_1000018594 | 233 |
| 220 | 3300005330 | Ga0070690_100301823 | Ga0070690_1003018231 | 233 |
| 221 | 3300005334 | Ga0068869_100058333 | Ga0068869_1000583332 | 233 |
| 222 | 3300005335 | Ga0070666_10034987 | Ga0070666_100349872 | 233 |
| 223 | 3300005335 | Ga0070666_10639683 | Ga0070666_106396831 | 233 |
| 224 | 3300005337 | Ga0070682_100071726 | Ga0070682_1000717262 | 233 |
| 225 | 3300005337 | Ga0070682_100135754 | Ga0070682_1001357542 | 233 |
| 226 | 3300005337 | Ga0070682_100154163 | Ga0070682_1001541633 | 233 |
| 227 | 3300005338 | Ga0068868_100001302 | Ga0068868_10000130210 | 233 |
| 228 | 3300005338 | Ga0068868_100100301 | Ga0068868_1001003012 | 233 |
| 229 | 3300005338 | Ga0068868_100258935 | Ga0068868_1002589352 | 233 |
| 230 | 3300005339 | Ga0070660_100080398 | Ga0070660_1000803984 | 233 |
| 231 | 3300005339 | Ga0070660_100360781 | Ga0070660_1003607812 | 233 |
| 232 | 3300005340 | Ga0070689_100038951 | Ga0070689_1000389512 | 233 |
| 233 | 3300005340 | Ga0070689_100143319 | Ga0070689_1001433191 | 233 |
| 234 | 3300005341 | Ga0070691_10000684 | Ga0070691_1000068411 | 233 |
| 235 | 3300005347 | Ga0070668_100020142 | Ga0070668_1000201424 | 233 |
| 236 | 3300005347 | Ga0070668_100084942 | Ga0070668_1000849424 | 233 |
| 237 | 3300005347 | Ga0070668_100203841 | Ga0070668_1002038411 | 233 |
| 238 | 3300005347 | Ga0070668_100505409 | Ga0070668_1005054092 | 233 |
| 239 | 3300005355 | Ga0070671_100002781 | Ga0070671_1000027817 | 233 |
| 240 | 3300005355 | Ga0070671_100159640 | Ga0070671_1001596401 | 233 |
| 241 | 3300005355 | Ga0070671_100276527 | Ga0070671_1002765272 | 233 |
| 242 | 3300005355 | Ga0070671_100314598 | Ga0070671_1003145982 | 233 |
| 243 | 3300005356 | Ga0070674_100001031 | Ga0070674_10000103115 | 233 |
| 244 | 3300005356 | Ga0070674_100004224 | Ga0070674_1000042246 | 233 |
| 245 | 3300005356 | Ga0070674_100117148 | Ga0070674_1001171482 | 233 |
| 246 | 3300005356 | Ga0070674_100729462 | Ga0070674_1007294621 | 233 |
| 247 | 3300005356 | Ga0070674_100819082 | Ga0070674_1008190821 | 233 |
| 248 | 3300005364 | Ga0070673_100078206 | Ga0070673_1000782062 | 233 |
| 249 | 3300005364 | Ga0070673_100425795 | Ga0070673_1004257952 | 233 |
| 250 | 3300005365 | Ga0070688_100078052 | Ga0070688_1000780523 | 233 |
| 251 | 3300005365 | Ga0070688_100364093 | Ga0070688_1003640932 | 233 |
| 252 | 3300005366 | Ga0070659_100141002 | Ga0070659_1001410022 | 233 |
| 253 | 3300005366 | Ga0070659_100153312 | Ga0070659_1001533122 | 233 |
| 254 | 3300005367 | Ga0070667_100000063 | Ga0070667_10000006367 | 233 |
| 255 | 3300005367 | Ga0070667_100000620 | Ga0070667_1000006202 | 233 |
| 256 | 3300005367 | Ga0070667_100020470 | Ga0070667_1000204706 | 233 |
| 257 | 3300005367 | Ga0070667_100022417 | Ga0070667_1000224175 | 233 |
| 258 | 3300005367 | Ga0070667_100413775 | Ga0070667_1004137752 | 233 |
| 259 | 3300005367 | Ga0070667_101042934 | Ga0070667_1010429341 | 233 |
| 260 | 3300005434 | Ga0070709_10049623 | Ga0070709_100496231 | 233 |
| 261 | 3300005435 | Ga0070714_100067806 | Ga0070714_1000678065 | 233 |
| 262 | 3300005435 | Ga0070714_100074821 | Ga0070714_1000748214 | 233 |
| 263 | 3300005436 | Ga0070713_100930373 | Ga0070713_1009303731 | 233 |
| 264 | 3300005437 | Ga0070710_10006956 | Ga0070710_100069562 | 233 |
| 265 | 3300005437 | Ga0070710_10007817 | Ga0070710_100078172 | 233 |
| 266 | 3300005438 | Ga0070701_10017749 | Ga0070701_100177494 | 233 |
| 267 | 3300005439 | Ga0070711_100000327 | Ga0070711_10000032727 | 233 |
| 268 | 3300005439 | Ga0070711_100001579 | Ga0070711_10000157915 | 233 |
| 269 | 3300005439 | Ga0070711_100177825 | Ga0070711_1001778252 | 233 |
| 270 | 3300005440 | Ga0070705_100502506 | Ga0070705_1005025062 | 233 |
| 271 | 3300005441 | Ga0070700_100015828 | Ga0070700_1000158282 | 233 |
| 272 | 3300005444 | Ga0070694_100007834 | Ga0070694_1000078347 | 233 |
| 273 | 3300005455 | Ga0070663_100070529 | Ga0070663_1000705293 | 233 |
| 274 | 3300005455 | Ga0070663_100169897 | Ga0070663_1001698973 | 233 |
| 275 | 3300005456 | Ga0070678_100000105 | Ga0070678_10000010515 | 233 |
| 276 | 3300005457 | Ga0070662_100372063 | Ga0070662_1003720632 | 233 |
| 277 | 3300005459 | Ga0068867_100000723 | Ga0068867_10000072322 | 233 |
| 278 | 3300005459 | Ga0068867_100058057 | Ga0068867_1000580572 | 233 |
| 279 | 3300005466 | Ga0070685_10311718 | Ga0070685_103117183 | 233 |
| 280 | 3300005467 | Ga0070706_100488150 | Ga0070706_1004881502 | 233 |
| 281 | 3300005530 | Ga0070679_100208611 | Ga0070679_1002086111 | 233 |
| 282 | 3300005535 | Ga0070684_100379510 | Ga0070684_1003795102 | 233 |
| 283 | 3300005539 | Ga0068853_100070499 | Ga0068853_1000704994 | 233 |
| 284 | 3300005539 | Ga0068853_100110933 | Ga0068853_1001109334 | 233 |
| 285 | 3300005543 | Ga0070672_100036537 | Ga0070672_1000365372 | 233 |
| 286 | 3300005544 | Ga0070686_100117297 | Ga0070686_1001172972 | 233 |
| 287 | 3300005545 | Ga0070695_100007265 | Ga0070695_1000072652 | 233 |
| 288 | 3300005546 | Ga0070696_100001184 | Ga0070696_1000011844 | 233 |
| 289 | 3300005546 | Ga0070696_100040911 | Ga0070696_1000409112 | 233 |
| 290 | 3300005547 | Ga0070693_100067491 | Ga0070693_1000674911 | 233 |
| 291 | 3300005548 | Ga0070665_100004232 | Ga0070665_1000042328 | 233 |
| 292 | 3300005548 | Ga0070665_100006023 | Ga0070665_1000060232 | 233 |
| 293 | 3300005548 | Ga0070665_100077582 | Ga0070665_1000775823 | 233 |
| 294 | 3300005548 | Ga0070665_100705310 | Ga0070665_1007053102 | 233 |
| 295 | 3300005549 | Ga0070704_100000016 | Ga0070704_10000001619 | 233 |
| 296 | 3300005563 | Ga0068855_100084004 | Ga0068855_1000840042 | 233 |
| 297 | 3300005563 | Ga0068855_100790300 | Ga0068855_1007903003 | 233 |
| 298 | 3300005615 | Ga0070702_100001709 | Ga0070702_10000170912 | 233 |
| 299 | 3300005615 | Ga0070702_100046624 | Ga0070702_1000466243 | 233 |
| 300 | 3300005615 | Ga0070702_100668495 | Ga0070702_1006684951 | 233 |
| 301 | 3300005616 | Ga0068852_100566152 | Ga0068852_1005661521 | 233 |
| 302 | 3300005617 | Ga0068859_100000777 | Ga0068859_10000077714 | 233 |
| 303 | 3300005617 | Ga0068859_100000989 | Ga0068859_1000009897 | 233 |
| 304 | 3300005618 | Ga0068864_100225883 | Ga0068864_1002258832 | 233 |
| 305 | 3300005618 | Ga0068864_100806984 | Ga0068864_1008069842 | 233 |
| 306 | 3300005718 | Ga0068866_10000152 | Ga0068866_1000015226 | 233 |
| 307 | 3300005719 | Ga0068861_100000157 | Ga0068861_10000015710 | 233 |
| 308 | 3300005719 | Ga0068861_100509858 | Ga0068861_1005098581 | 233 |
| 309 | 3300005841 | Ga0068863_100000159 | Ga0068863_10000015912 | 233 |
| 310 | 3300005841 | Ga0068863_100003604 | Ga0068863_10000360412 | 233 |
| 311 | 3300005841 | Ga0068863_100202456 | Ga0068863_1002024562 | 233 |
| 312 | 3300005843 | Ga0068860_100000065 | Ga0068860_10000006566 | 233 |
| 313 | 3300005843 | Ga0068860_100000663 | Ga0068860_10000066329 | 233 |
| 314 | 3300005844 | Ga0068862_100000028 | Ga0068862_10000002890 | 233 |
| 315 | 3300005844 | Ga0068862_100010168 | Ga0068862_10001016812 | 233 |
| 316 | 3300005937 | Ga0081455_10230781 | Ga0081455_102307812 | 233 |
| 317 | 3300006028 | Ga0070717_10179490 | Ga0070717_101794903 | 233 |
| 318 | 3300006038 | Ga0075365_10097555 | Ga0075365_100975554 | 233 |
| 319 | 3300006038 | Ga0075365_10287685 | Ga0075365_102876852 | 233 |
| 320 | 3300006042 | Ga0075368_10050173 | Ga0075368_100501732 | 233 |
| 321 | 3300006048 | Ga0075363_100020572 | Ga0075363_1000205724 | 233 |
| 322 | 3300006048 | Ga0075363_100031359 | Ga0075363_1000313592 | 233 |
| 323 | 3300006048 | Ga0075363_100053055 | Ga0075363_1000530552 | 233 |
| 324 | 3300006048 | Ga0075363_100112079 | Ga0075363_1001120792 | 233 |
| 325 | 3300006048 | Ga0075363_100120597 | Ga0075363_1001205972 | 233 |
| 326 | 3300006048 | Ga0075363_100272669 | Ga0075363_1002726692 | 233 |
| 327 | 3300006048 | Ga0075363_100300311 | Ga0075363_1003003111 | 233 |
| 328 | 3300006051 | Ga0075364_10003349 | Ga0075364_100033498 | 233 |
| 329 | 3300006051 | Ga0075364_10017435 | Ga0075364_100174355 | 233 |
| 330 | 3300006051 | Ga0075364_10036950 | Ga0075364_100369503 | 233 |
| 331 | 3300006051 | Ga0075364_10040932 | Ga0075364_100409324 | 233 |
| 332 | 3300006051 | Ga0075364_10337657 | Ga0075364_103376571 | 233 |
| 333 | 3300006163 | Ga0070715_10027904 | Ga0070715_100279044 | 233 |
| 334 | 3300006163 | Ga0070715_10028363 | Ga0070715_100283632 | 233 |
| 335 | 3300006173 | Ga0070716_100012209 | Ga0070716_1000122095 | 233 |
| 336 | 3300006173 | Ga0070716_100023074 | Ga0070716_1000230744 | 233 |
| 337 | 3300006175 | Ga0070712_100000926 | Ga0070712_10000092619 | 233 |
| 338 | 3300006175 | Ga0070712_100019484 | Ga0070712_1000194842 | 233 |
| 339 | 3300006177 | Ga0075362_10182328 | Ga0075362_101823281 | 233 |
| 340 | 3300006178 | Ga0075367_10127659 | Ga0075367_101276594 | 233 |
| 341 | 3300006178 | Ga0075367_10162130 | Ga0075367_101621302 | 233 |
| 342 | 3300006178 | Ga0075367_10400855 | Ga0075367_104008552 | 233 |
| 343 | 3300006186 | Ga0075369_10003004 | Ga0075369_100030041 | 233 |
| 344 | 3300006186 | Ga0075369_10006451 | Ga0075369_100064514 | 233 |
| 345 | 3300006186 | Ga0075369_10008548 | Ga0075369_100085481 | 233 |
| 346 | 3300006186 | Ga0075369_10016201 | Ga0075369_100162012 | 233 |
| 347 | 3300006186 | Ga0075369_10022484 | Ga0075369_100224844 | 233 |
| 348 | 3300006186 | Ga0075369_10023619 | Ga0075369_100236193 | 233 |
| 349 | 3300006186 | Ga0075369_10093774 | Ga0075369_100937742 | 233 |
| 350 | 3300006186 | Ga0075369_10294186 | Ga0075369_102941861 | 233 |
| 351 | 3300006195 | Ga0075366_10085861 | Ga0075366_100858613 | 233 |
| 352 | 3300006237 | Ga0097621_100077048 | Ga0097621_1000770482 | 233 |
| 353 | 3300006353 | Ga0075370_10001708 | Ga0075370_100017089 | 233 |
| 354 | 3300006353 | Ga0075370_10001851 | Ga0075370_100018516 | 233 |
| 355 | 3300006353 | Ga0075370_10026581 | Ga0075370_100265812 | 233 |
| 356 | 3300006353 | Ga0075370_10090992 | Ga0075370_100909921 | 233 |
| 357 | 3300006353 | Ga0075370_10117182 | Ga0075370_101171822 | 233 |
| 358 | 3300006353 | Ga0075370_10133429 | Ga0075370_101334291 | 233 |
| 359 | 3300006353 | Ga0075370_10200994 | Ga0075370_102009942 | 233 |
| 360 | 3300006844 | Ga0075428_100006335 | Ga0075428_10000633516 | 233 |
| 361 | 3300006846 | Ga0075430_100083231 | Ga0075430_1000832313 | 233 |
| 362 | 3300006847 | Ga0075431_100180299 | Ga0075431_1001802992 | 233 |
| 363 | 3300006931 | Ga0097620_100000777 | Ga0097620_10000077714 | 233 |
| 364 | 3300006931 | Ga0097620_100000989 | Ga0097620_10000098928 | 233 |
| 365 | 3300007076 | Ga0075435_100646585 | Ga0075435_1006465851 | 233 |
| 366 | 3300009093 | Ga0105240_10196936 | Ga0105240_101969362 | 233 |
| 367 | 3300009094 | Ga0111539_10191321 | Ga0111539_101913213 | 233 |
| 368 | 3300009098 | Ga0105245_10000172 | Ga0105245_1000017236 | 233 |
| 369 | 3300009098 | Ga0105245_10042813 | Ga0105245_100428132 | 233 |
| 370 | 3300009098 | Ga0105245_10056993 | Ga0105245_100569934 | 233 |
| 371 | 3300009101 | Ga0105247_10000009 | Ga0105247_1000000928 | 233 |
| 372 | 3300009101 | Ga0105247_10000451 | Ga0105247_1000045122 | 233 |
| 373 | 3300009101 | Ga0105247_10639092 | Ga0105247_106390921 | 233 |
| 374 | 3300009147 | Ga0114129_10045686 | Ga0114129_100456869 | 233 |
| 375 | 3300009148 | Ga0105243_10001407 | Ga0105243_100014079 | 233 |
| 376 | 3300009148 | Ga0105243_10055548 | Ga0105243_100555482 | 233 |
| 377 | 3300009174 | Ga0105241_10097080 | Ga0105241_100970804 | 233 |
| 378 | 3300009174 | Ga0105241_10324085 | Ga0105241_103240852 | 233 |
| 379 | 3300009176 | Ga0105242_10000281 | Ga0105242_100002814 | 233 |
| 380 | 3300009176 | Ga0105242_10646999 | Ga0105242_106469991 | 233 |
| 381 | 3300009177 | Ga0105248_10000186 | Ga0105248_100001866 | 233 |
| 382 | 3300009177 | Ga0105248_10001346 | Ga0105248_100013466 | 233 |
| 383 | 3300009177 | Ga0105248_10506794 | Ga0105248_105067942 | 233 |
| 384 | 3300009545 | Ga0105237_10009360 | Ga0105237_1000936010 | 233 |
| 385 | 3300009545 | Ga0105237_10091927 | Ga0105237_100919272 | 233 |
| 386 | 3300009545 | Ga0105237_10609182 | Ga0105237_106091821 | 233 |
| 387 | 3300009551 | Ga0105238_10646028 | Ga0105238_106460281 | 233 |
| 388 | 3300009553 | Ga0105249_10000011 | Ga0105249_10000011180 | 233 |
| 389 | 3300009553 | Ga0105249_10000291 | Ga0105249_100002913 | 233 |
| 390 | 3300009553 | Ga0105249_10185635 | Ga0105249_101856352 | 233 |
| 391 | 3300009553 | Ga0105249_11087294 | Ga0105249_110872942 | 233 |
| 392 | 3300010375 | Ga0105239_10004844 | Ga0105239_1000484416 | 233 |
| 393 | 3300010375 | Ga0105239_10013169 | Ga0105239_100131692 | 233 |
| 394 | 3300010375 | Ga0105239_10226287 | Ga0105239_102262872 | 233 |
| 395 | 3300013296 | Ga0157374_10058502 | Ga0157374_100585023 | 233 |
| 396 | 3300013297 | Ga0157378_10000282 | Ga0157378_100002829 | 233 |
| 397 | 3300013297 | Ga0157378_10081410 | Ga0157378_100814102 | 233 |
| 398 | 3300013306 | Ga0163162_10001346 | Ga0163162_1000134613 | 233 |
| 399 | 3300013306 | Ga0163162_10830724 | Ga0163162_108307242 | 233 |
| 400 | 3300013306 | Ga0163162_11413958 | Ga0163162_114139581 | 233 |
| 401 | 3300013307 | Ga0157372_10008436 | Ga0157372_1000843611 | 233 |
| 402 | 3300013308 | Ga0157375_10000443 | Ga0157375_1000044328 | 233 |
| 403 | 3300013308 | Ga0157375_10097647 | Ga0157375_100976472 | 233 |
| 404 | 3300014325 | Ga0163163_10110618 | Ga0163163_101106182 | 233 |
| 405 | 3300014326 | Ga0157380_10035286 | Ga0157380_100352864 | 233 |
| 406 | 3300014326 | Ga0157380_10267553 | Ga0157380_102675532 | 233 |
| 407 | 3300014326 | Ga0157380_10294098 | Ga0157380_102940982 | 233 |
| 408 | 3300014968 | Ga0157379_10008216 | Ga0157379_100082162 | 233 |
| 409 | 3300014968 | Ga0157379_10090968 | Ga0157379_100909683 | 233 |
| 410 | 3300017792 | Ga0163161_10001593 | Ga0163161_1000159313 | 233 |
| 411 | 3300021384 | Ga0213876_10006606 | Ga0213876_100066062 | 233 |
| 412 | 3300021384 | Ga0213876_10017728 | Ga0213876_100177284 | 233 |
| 413 | 3300021384 | Ga0213876_10075210 | Ga0213876_100752101 | 233 |
| 414 | 3300021388 | Ga0213875_10086117 | Ga0213875_100861172 | 233 |
| 415 | 3300021388 | Ga0213875_10145422 | Ga0213875_101454222 | 233 |
| 416 | 3300025273 | Ga0209673_1021887 | Ga0209673_10218874 | 233 |
| 417 | 3300025273 | Ga0209673_1044854 | Ga0209673_10448542 | 233 |
| 418 | 3300025303 | Ga0209051_1000075 | Ga0209051_100007598 | 233 |
| 419 | 3300025303 | Ga0209051_1000448 | Ga0209051_10004483 | 233 |
| 420 | 3300025303 | Ga0209051_1002630 | Ga0209051_10026309 | 233 |
| 421 | 3300025303 | Ga0209051_1009355 | Ga0209051_10093554 | 233 |
| 422 | 3300025885 | Ga0207653_10030501 | Ga0207653_100305011 | 233 |
| 423 | 3300025893 | Ga0207682_10015450 | Ga0207682_100154504 | 233 |
| 424 | 3300025898 | Ga0207692_10002256 | Ga0207692_100022568 | 233 |
| 425 | 3300025898 | Ga0207692_10019524 | Ga0207692_100195242 | 233 |
| 426 | 3300025899 | Ga0207642_10000264 | Ga0207642_1000026417 | 233 |
| 427 | 3300025900 | Ga0207710_10000014 | Ga0207710_1000001445 | 233 |
| 428 | 3300025900 | Ga0207710_10000721 | Ga0207710_1000072114 | 233 |
| 429 | 3300025901 | Ga0207688_10000335 | Ga0207688_1000033518 | 233 |
| 430 | 3300025904 | Ga0207647_10058151 | Ga0207647_100581512 | 233 |
| 431 | 3300025905 | Ga0207685_10081337 | Ga0207685_100813372 | 233 |
| 432 | 3300025907 | Ga0207645_10036766 | Ga0207645_100367662 | 233 |
| 433 | 3300025913 | Ga0207695_10288454 | Ga0207695_102884542 | 233 |
| 434 | 3300025913 | Ga0207695_10484227 | Ga0207695_104842272 | 233 |
| 435 | 3300025914 | Ga0207671_10013939 | Ga0207671_100139391 | 233 |
| 436 | 3300025914 | Ga0207671_10034188 | Ga0207671_100341886 | 233 |
| 437 | 3300025915 | Ga0207693_10000049 | Ga0207693_1000004955 | 233 |
| 438 | 3300025915 | Ga0207693_10000258 | Ga0207693_1000025827 | 233 |
| 439 | 3300025916 | Ga0207663_10000314 | Ga0207663_1000031410 | 233 |
| 440 | 3300025916 | Ga0207663_10549649 | Ga0207663_105496491 | 233 |
| 441 | 3300025917 | Ga0207660_10494423 | Ga0207660_104944231 | 233 |
| 442 | 3300025919 | Ga0207657_10033008 | Ga0207657_100330084 | 233 |
| 443 | 3300025919 | Ga0207657_10155359 | Ga0207657_101553591 | 233 |
| 444 | 3300025920 | Ga0207649_10431184 | Ga0207649_104311842 | 233 |
| 445 | 3300025921 | Ga0207652_10215678 | Ga0207652_102156782 | 233 |
| 446 | 3300025923 | Ga0207681_10003263 | Ga0207681_100032634 | 233 |
| 447 | 3300025923 | Ga0207681_10009825 | Ga0207681_100098252 | 233 |
| 448 | 3300025927 | Ga0207687_10000153 | Ga0207687_1000015345 | 233 |
| 449 | 3300025927 | Ga0207687_10264634 | Ga0207687_102646342 | 233 |
| 450 | 3300025928 | Ga0207700_10189724 | Ga0207700_101897242 | 233 |
| 451 | 3300025928 | Ga0207700_10506138 | Ga0207700_105061382 | 233 |
| 452 | 3300025928 | Ga0207700_10916487 | Ga0207700_109164871 | 233 |
| 453 | 3300025929 | Ga0207664_10019234 | Ga0207664_100192345 | 233 |
| 454 | 3300025931 | Ga0207644_10005846 | Ga0207644_100058467 | 233 |
| 455 | 3300025932 | Ga0207690_10283766 | Ga0207690_102837661 | 233 |
| 456 | 3300025933 | Ga0207706_10010210 | Ga0207706_100102103 | 233 |
| 457 | 3300025934 | Ga0207686_10000624 | Ga0207686_1000062425 | 233 |
| 458 | 3300025934 | Ga0207686_10024748 | Ga0207686_100247483 | 233 |
| 459 | 3300025935 | Ga0207709_10004736 | Ga0207709_100047368 | 233 |
| 460 | 3300025935 | Ga0207709_10010027 | Ga0207709_100100273 | 233 |
| 461 | 3300025935 | Ga0207709_10293488 | Ga0207709_102934882 | 233 |
| 462 | 3300025936 | Ga0207670_10433655 | Ga0207670_104336552 | 233 |
| 463 | 3300025937 | Ga0207669_10000277 | Ga0207669_100002771 | 233 |
| 464 | 3300025937 | Ga0207669_10570369 | Ga0207669_105703691 | 233 |
| 465 | 3300025938 | Ga0207704_10000115 | Ga0207704_1000011528 | 233 |
| 466 | 3300025939 | Ga0207665_10003528 | Ga0207665_100035288 | 233 |
| 467 | 3300025939 | Ga0207665_10011384 | Ga0207665_100113845 | 233 |
| 468 | 3300025940 | Ga0207691_10293704 | Ga0207691_102937042 | 233 |
| 469 | 3300025941 | Ga0207711_10000373 | Ga0207711_1000037319 | 233 |
| 470 | 3300025942 | Ga0207689_10239736 | Ga0207689_102397362 | 233 |
| 471 | 3300025944 | Ga0207661_10244336 | Ga0207661_102443361 | 233 |
| 472 | 3300025949 | Ga0207667_10176496 | Ga0207667_101764962 | 233 |
| 473 | 3300025961 | Ga0207712_10000020 | Ga0207712_10000020101 | 233 |
| 474 | 3300025961 | Ga0207712_10005489 | Ga0207712_100054899 | 233 |
| 475 | 3300025961 | Ga0207712_10017769 | Ga0207712_100177692 | 233 |
| 476 | 3300025972 | Ga0207668_10007226 | Ga0207668_100072261 | 233 |
| 477 | 3300025972 | Ga0207668_10018400 | Ga0207668_100184003 | 233 |
| 478 | 3300025972 | Ga0207668_10106013 | Ga0207668_101060131 | 233 |
| 479 | 3300025981 | Ga0207640_10037694 | Ga0207640_100376941 | 233 |
| 480 | 3300025986 | Ga0207658_10000573 | Ga0207658_1000057312 | 233 |
| 481 | 3300025986 | Ga0207658_10004216 | Ga0207658_100042162 | 233 |
| 482 | 3300025986 | Ga0207658_10201582 | Ga0207658_102015822 | 233 |
| 483 | 3300025986 | Ga0207658_10254972 | Ga0207658_102549722 | 233 |
| 484 | 3300026023 | Ga0207677_10003884 | Ga0207677_100038849 | 233 |
| 485 | 3300026035 | Ga0207703_10031288 | Ga0207703_100312884 | 233 |
| 486 | 3300026035 | Ga0207703_10138530 | Ga0207703_101385301 | 233 |
| 487 | 3300026041 | Ga0207639_10021972 | Ga0207639_100219726 | 233 |
| 488 | 3300026041 | Ga0207639_10214938 | Ga0207639_102149384 | 233 |
| 489 | 3300026041 | Ga0207639_10879006 | Ga0207639_108790061 | 233 |
| 490 | 3300026067 | Ga0207678_10091782 | Ga0207678_100917822 | 233 |
| 491 | 3300026067 | Ga0207678_10107629 | Ga0207678_101076294 | 233 |
| 492 | 3300026067 | Ga0207678_10188382 | Ga0207678_101883822 | 233 |
| 493 | 3300026075 | Ga0207708_10003058 | Ga0207708_1000305813 | 233 |
| 494 | 3300026088 | Ga0207641_10000156 | Ga0207641_1000015625 | 233 |
| 495 | 3300026088 | Ga0207641_10005483 | Ga0207641_1000548311 | 233 |
| 496 | 3300026089 | Ga0207648_10001288 | Ga0207648_100012889 | 233 |
| 497 | 3300026089 | Ga0207648_10004514 | Ga0207648_1000451413 | 233 |
| 498 | 3300026095 | Ga0207676_10115741 | Ga0207676_101157414 | 233 |
| 499 | 3300026095 | Ga0207676_10192849 | Ga0207676_101928494 | 233 |
| 500 | 3300026095 | Ga0207676_11043320 | Ga0207676_110433201 | 233 |
| 501 | 3300026116 | Ga0207674_10399885 | Ga0207674_103998851 | 233 |
| 502 | 3300026118 | Ga0207675_100000220 | Ga0207675_10000022016 | 233 |
| 503 | 3300026121 | Ga0207683_10000184 | Ga0207683_100001845 | 233 |
| 504 | 3300026121 | Ga0207683_10087921 | Ga0207683_100879213 | 233 |
| 505 | 3300026142 | Ga0207698_10538334 | Ga0207698_105383341 | 233 |
| 506 | 3300027866 | Ga0209813_10041598 | Ga0209813_100415982 | 233 |
| 507 | 3300028379 | Ga0268266_10001619 | Ga0268266_1000161914 | 233 |
| 508 | 3300028379 | Ga0268266_10005268 | Ga0268266_100052686 | 233 |
| 509 | 3300028379 | Ga0268266_10232488 | Ga0268266_102324882 | 233 |
| 510 | 3300028379 | Ga0268266_10731830 | Ga0268266_107318302 | 233 |
| 511 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004356 | 233 |
| 512 | 3300028380 | Ga0268265_11104616 | Ga0268265_111046161 | 233 |
| 513 | 3300028381 | Ga0268264_10000024 | Ga0268264_10000024336 | 233 |
| 514 | 3300028381 | Ga0268264_10000925 | Ga0268264_1000092513 | 233 |
| 515 | 3300031251 | Ga0265327_10000408 | Ga0265327_1000040867 | 233 |
| 516 | 3300031251 | Ga0265327_10002762 | Ga0265327_100027622 | 233 |
| 517 | 3300031251 | Ga0265327_10047167 | Ga0265327_100471672 | 233 |
| 518 | 3300031251 | Ga0265327_10047549 | Ga0265327_100475496 | 233 |
| 519 | 3300031691 | Ga0316579_10108499 | Ga0316579_101084992 | 233 |
| 520 | 3300031728 | Ga0316578_10165914 | Ga0316578_101659141 | 233 |
| 521 | 3300031731 | Ga0307405_10099125 | Ga0307405_100991252 | 233 |
| 522 | 3300031731 | Ga0307405_10171799 | Ga0307405_101717992 | 233 |
| 523 | 3300031731 | Ga0307405_10549989 | Ga0307405_105499892 | 233 |
| 524 | 3300031852 | Ga0307410_10054188 | Ga0307410_100541884 | 233 |
| 525 | 3300031852 | Ga0307410_10086914 | Ga0307410_100869142 | 233 |
| 526 | 3300031852 | Ga0307410_10190445 | Ga0307410_101904452 | 233 |
| 527 | 3300031852 | Ga0307410_10778350 | Ga0307410_107783501 | 233 |
| 528 | 3300031901 | Ga0307406_10657555 | Ga0307406_106575551 | 233 |
| 529 | 3300031911 | Ga0307412_10522565 | Ga0307412_105225651 | 233 |
| 530 | 3300031995 | Ga0307409_100518395 | Ga0307409_1005183951 | 233 |
| 531 | 3300032002 | Ga0307416_100600064 | Ga0307416_1006000642 | 233 |
| 532 | 3300032126 | Ga0307415_100030468 | Ga0307415_1000304683 | 233 |
| 533 | 3300035085 | Ga0373929_0018691 | Ga0373929_0018691_649_1350 | 233 |
| 534 | 3300035090 | Ga0373949_0058147 | Ga0373949_0058147_178_879 | 233 |
| 535 | 3300035092 | Ga0373952_0051827 | Ga0373952_0051827_196_897 | 233 |
| 536 | 3300035112 | Ga0373932_0105633 | Ga0373932_0105633_178_879 | 233 |
| 537 | 3300035207 | Ga0373942_0097815 | Ga0373942_0097815_78_779 | 233 |
| 538 | 3300035692 | Ga0373935_0052563 | Ga0373935_0052563_1523_2224 | 233 |
| 539 | 3300035695 | Ga0373927_0059608 | Ga0373927_0059608_1004_1708 | 233 |
| 540 | 3300035695 | Ga0373927_0413729 | Ga0373927_0413729_38_739 | 233 |
| 541 | 3300036712 | Ga0316584_0054882 | Ga0316584_0054882_997_1698 | 233 |
| 542 | 3300037853 | Ga0436364_0225372 | Ga0436364_0225372_1484_2194 | 233 |
| 543 | 3300037853 | Ga0436364_0755754 | Ga0436364_0755754_929_1630 | 233 |
| 544 | 3300037853 | Ga0436364_1296457 | Ga0436364_1296457_8450_9151 | 233 |
| 545 | 3300039437 | Ga0436365_0201441 | Ga0436365_0201441_22492_23193 | 233 |
| 546 | 3300039437 | Ga0436365_0585474 | Ga0436365_0585474_16955_17656 | 233 |
| 547 | 3300039437 | Ga0436365_1920746 | Ga0436365_1920746_12449_13150 | 233 |
| 548 | 3300039447 | Ga0436361_0978287 | Ga0436361_0978287_435_1136 | 233 |
| 549 | 3300039450 | Ga0436363_1156841 | Ga0436363_1156841_403_1104 | 233 |
| 550 | 3300039450 | Ga0436363_1714028 | Ga0436363_1714028_3558_4259 | 233 |
| 551 | 3300041410 | Ga0439461_0002218 | Ga0439461_0002218_1453_2154 | 233 |
| 552 | 3300041410 | Ga0439461_0009967 | Ga0439461_0009967_530_1231 | 233 |
| 553 | 3300041411 | Ga0439466_0001603 | Ga0439466_0001603_7382_8083 | 233 |
| 554 | 3300041411 | Ga0439466_0042342 | Ga0439466_0042342_399_1100 | 233 |
| 555 | 3300041411 | Ga0439466_0069642 | Ga0439466_0069642_155_856 | 233 |
| 556 | 3300041413 | Ga0439465_0001837 | Ga0439465_0001837_3252_3953 | 233 |
| 557 | 3300041413 | Ga0439465_0003484 | Ga0439465_0003484_3328_4029 | 233 |
| 558 | 3300041413 | Ga0439465_0005400 | Ga0439465_0005400_1674_2375 | 233 |
| 559 | 3300041413 | Ga0439465_0029375 | Ga0439465_0029375_351_1052 | 233 |
| 560 | 3300041453 | Ga0451797_1047338 | Ga0451797_1047338_139_840 | 233 |
| 561 | 3300041456 | Ga0451795_0769305 | Ga0451795_0769305_257_958 | 233 |
| 562 | 3300041512 | Ga0451853_0599558 | Ga0451853_0599558_248_949 | 233 |
| 563 | 3300042002 | Ga0439442_002097 | Ga0439442_002097_78_779 | 233 |
| 564 | 3300042004 | Ga0439445_0001633 | Ga0439445_0001633_2743_3444 | 233 |
| 565 | 3300042005 | Ga0439448_0023867 | Ga0439448_0023867_958_1659 | 233 |
| 566 | 3300042005 | Ga0439448_0060793 | Ga0439448_0060793_278_979 | 233 |
| 567 | 3300042435 | Ga0439434_0036660 | Ga0439434_0036660_320_1021 | 233 |
| 568 | 3300042438 | Ga0439459_0023874 | Ga0439459_0023874_253_954 | 233 |
| 569 | 3300044656 | Ga0466969_0038497 | Ga0466969_0038497_873_1574 | 233 |
| 570 | 3300044656 | Ga0466969_0078646 | Ga0466969_0078646_595_1296 | 233 |
| 571 | 3300044658 | Ga0466972_0004495 | Ga0466972_0004495_4071_4772 | 233 |
| 572 | 3300044658 | Ga0466972_0014460 | Ga0466972_0014460_1604_2305 | 233 |
| 573 | 3300044683 | Ga0466965_0001067 | Ga0466965_0001067_5279_5980 | 233 |
| 574 | 3300044683 | Ga0466965_0007511 | Ga0466965_0007511_3265_3966 | 233 |
| 575 | 3300044683 | Ga0466965_0029509 | Ga0466965_0029509_1521_2222 | 233 |
| 576 | 3300044683 | Ga0466965_0053638 | Ga0466965_0053638_1075_1776 | 233 |
| 577 | 3300044684 | Ga0466966_0010547 | Ga0466966_0010547_655_1356 | 233 |
| 578 | 3300044684 | Ga0466966_0037675 | Ga0466966_0037675_1689_2390 | 233 |
| 579 | 3300044684 | Ga0466966_0315301 | Ga0466966_0315301_46_747 | 233 |
| 580 | 3300044693 | Ga0466961_0013068 | Ga0466961_0013068_2599_3300 | 233 |
| 581 | 3300044693 | Ga0466961_0018566 | Ga0466961_0018566_1420_2121 | 233 |
| 582 | 3300044693 | Ga0466961_0051284 | Ga0466961_0051284_946_1656 | 233 |
| 583 | 3300044694 | Ga0466963_0022414 | Ga0466963_0022414_2025_2726 | 233 |
| 584 | 3300044694 | Ga0466963_0054645 | Ga0466963_0054645_1856_2557 | 233 |
| 585 | 3300044694 | Ga0466963_0315608 | Ga0466963_0315608_133_834 | 233 |
| 586 | 3300044694 | Ga0466963_0441929 | Ga0466963_0441929_148_849 | 233 |
| 587 | 3300044694 | Ga0466963_0469026 | Ga0466963_0469026_132_833 | 233 |
| 588 | 3300044719 | Ga0466971_0017842 | Ga0466971_0017842_358_1059 | 233 |
| 589 | 3300044719 | Ga0466971_0106608 | Ga0466971_0106608_406_1107 | 233 |
| 590 | 3300044735 | Ga0466968_0001388 | Ga0466968_0001388_1638_2339 | 233 |
| 591 | 3300044735 | Ga0466968_0005428 | Ga0466968_0005428_3219_3920 | 233 |
| 592 | 3300044735 | Ga0466968_0075741 | Ga0466968_0075741_98_799 | 233 |
| 593 | 3300044735 | Ga0466968_0169814 | Ga0466968_0169814_188_889 | 233 |
| 594 | 3300044765 | Ga0466970_0016086 | Ga0466970_0016086_31_732 | 233 |
| 595 | 3300044765 | Ga0466970_0165190 | Ga0466970_0165190_352_1053 | 233 |
| 596 | 3300044842 | Ga0466957_0002569 | Ga0466957_0002569_1277_1978 | 233 |
| 597 | 3300044842 | Ga0466957_0080532 | Ga0466957_0080532_1203_1904 | 233 |
| 598 | 3300044842 | Ga0466957_0166457 | Ga0466957_0166457_680_1381 | 233 |
| 599 | 3300044842 | Ga0466957_0257020 | Ga0466957_0257020_144_845 | 233 |
| 600 | 3300044842 | Ga0466957_0403629 | Ga0466957_0403629_14_715 | 233 |
| 601 | 3300044901 | Ga0466960_0000108 | Ga0466960_0000108_13203_13904 | 233 |
| 602 | 3300044901 | Ga0466960_0041695 | Ga0466960_0041695_134_835 | 233 |
| 603 | 3300044901 | Ga0466960_0391397 | Ga0466960_0391397_10_711 | 233 |
| 604 | 3300045049 | Ga0466959_0001743 | Ga0466959_0001743_6051_6752 | 233 |
| 605 | 3300045049 | Ga0466959_0021813 | Ga0466959_0021813_3167_3868 | 233 |
| 606 | 3300045049 | Ga0466959_0097330 | Ga0466959_0097330_1166_1867 | 233 |
| 607 | 3300045836 | Ga0466958_0000249 | Ga0466958_0000249_9374_10075 | 233 |
| 608 | 3300045836 | Ga0466958_0015421 | Ga0466958_0015421_206_907 | 233 |
| 609 | 3300045836 | Ga0466958_0032807 | Ga0466958_0032807_688_1389 | 233 |
| 610 | 3300045836 | Ga0466958_0062578 | Ga0466958_0062578_873_1601 | 233 |
| 611 | 3300045836 | Ga0466958_0125469 | Ga0466958_0125469_773_1474 | 233 |
| 612 | 3300045836 | Ga0466958_0139279 | Ga0466958_0139279_807_1508 | 233 |
| 613 | 3300045976 | Ga0466967_0004216 | Ga0466967_0004216_1786_2487 | 233 |
| 614 | 3300045976 | Ga0466967_0017156 | Ga0466967_0017156_2226_2927 | 233 |
| 615 | 3300045976 | Ga0466967_0025921 | Ga0466967_0025921_3052_3753 | 233 |
| 616 | 3300045976 | Ga0466967_0033247 | Ga0466967_0033247_1152_1853 | 233 |
| 617 | 3300045976 | Ga0466967_0034434 | Ga0466967_0034434_1947_2648 | 233 |
| 618 | 3300045976 | Ga0466967_0068031 | Ga0466967_0068031_662_1363 | 233 |
| 619 | 3300045976 | Ga0466967_0068924 | Ga0466967_0068924_718_1419 | 233 |
| 620 | 3300045976 | Ga0466967_0112879 | Ga0466967_0112879_175_942 | 233 |
| 621 | 3300045976 | Ga0466967_0283884 | Ga0466967_0283884_292_1005 | 233 |
| 622 | 3300045976 | Ga0466967_0607720 | Ga0466967_0607720_356_1057 | 233 |
| 623 | 3300045976 | Ga0466967_0752309 | Ga0466967_0752309_233_934 | 233 |
| 624 | 3300045976 | Ga0466967_1001020 | Ga0466967_1001020_104_805 | 233 |
| 625 | 3300046455 | Ga0495603_0014689 | Ga0495603_0014689_608_1309 | 233 |
| 626 | 3300046459 | Ga0495629_0048770 | Ga0495629_0048770_2055_2756 | 233 |
| 627 | 3300046460 | Ga0495638_0001617 | Ga0495638_0001617_9940_10641 | 233 |
| 628 | 3300046460 | Ga0495638_0017392 | Ga0495638_0017392_1247_1948 | 233 |
| 629 | 3300046461 | Ga0495641_0020272 | Ga0495641_0020272_1798_2499 | 233 |
| 630 | 3300046472 | Ga0495580_0514200 | Ga0495580_0514200_42_743 | 233 |
| 631 | 3300046475 | Ga0495639_0050203 | Ga0495639_0050203_1130_1831 | 233 |
| 632 | 3300046499 | Ga0495594_0060339 | Ga0495594_0060339_343_1044 | 233 |
| 633 | 3300046507 | Ga0495606_0053870 | Ga0495606_0053870_1029_1730 | 233 |
| 634 | 3300046524 | Ga0495648_0002598 | Ga0495648_0002598_8293_8994 | 233 |
| 635 | 3300046533 | Ga0495640_0093888 | Ga0495640_0093888_619_1320 | 233 |
| 636 | 3300046616 | Ga0495668_0037545 | Ga0495668_0037545_1401_2102 | 233 |
| 637 | 3300046642 | Ga0495634_0188608 | Ga0495634_0188608_134_835 | 233 |
| 638 | 3300046683 | Ga0495658_0007185 | Ga0495658_0007185_2062_2763 | 233 |
| 639 | 3300046689 | Ga0495613_0577951 | Ga0495613_0577951_10_711 | 233 |
| 640 | 3300046690 | Ga0495624_0026430 | Ga0495624_0026430_2845_3546 | 233 |
| 641 | 3300046694 | Ga0495649_0098020 | Ga0495649_0098020_236_937 | 233 |
| 642 | 3300047315 | Ga0495581_0007818 | Ga0495581_0007818_2828_3529 | 233 |
| 643 | 3300047317 | Ga0495604_0153294 | Ga0495604_0153294_131_832 | 233 |
| 644 | 3300047317 | Ga0495604_0516147 | Ga0495604_0516147_46_747 | 233 |
| 645 | 3300047320 | Ga0495672_0015022 | Ga0495672_0015022_1318_2019 | 233 |
| 646 | 3300047320 | Ga0495672_0087759 | Ga0495672_0087759_954_1655 | 233 |
| 647 | 3300047320 | Ga0495672_0131013 | Ga0495672_0131013_442_1143 | 233 |
| 648 | 3300047320 | Ga0495672_0136274 | Ga0495672_0136274_289_990 | 233 |
| 649 | 3300047321 | Ga0495676_0034773 | Ga0495676_0034773_1999_2700 | 233 |
| 650 | 3300047322 | Ga0495680_0175478 | Ga0495680_0175478_512_1213 | 233 |
| 651 | 3300047469 | Ga0495673_0000355 | Ga0495673_0000355_48850_49551 | 233 |
| 652 | 3300047472 | Ga0495686_0021284 | Ga0495686_0021284_719_1420 | 233 |
| 653 | 3300047472 | Ga0495686_0144366 | Ga0495686_0144366_34_735 | 233 |
| 654 | 3300047673 | Ga0495593_0013302 | Ga0495593_0013302_2136_2837 | 233 |
| 655 | 3300048903 | Ga0496100_0000009 | Ga0496100_0000009_50479_51180 | 233 |
| 656 | 3300048903 | Ga0496100_0003439 | Ga0496100_0003439_262_963 | 233 |
| 657 | 3300048903 | Ga0496100_0021910 | Ga0496100_0021910_2895_3596 | 233 |
| 658 | 3300048903 | Ga0496100_0104331 | Ga0496100_0104331_364_1065 | 233 |
| 659 | 3300048903 | Ga0496100_0221613 | Ga0496100_0221613_432_1133 | 233 |
| 660 | 3300048904 | Ga0496101_0000018 | Ga0496101_0000018_112220_112921 | 233 |
| 661 | 3300048904 | Ga0496101_0000114 | Ga0496101_0000114_12977_13678 | 233 |
| 662 | 3300048904 | Ga0496101_0002057 | Ga0496101_0002057_11091_11792 | 233 |
| 663 | 3300048904 | Ga0496101_0003076 | Ga0496101_0003076_3925_4626 | 233 |
| 664 | 3300048904 | Ga0496101_0004515 | Ga0496101_0004515_5389_6090 | 233 |
| 665 | 3300048904 | Ga0496101_0297761 | Ga0496101_0297761_412_1113 | 233 |
| 666 | 3300048905 | Ga0496102_0000014 | Ga0496102_0000014_275713_276414 | 233 |
| 667 | 3300048905 | Ga0496102_0000820 | Ga0496102_0000820_13141_13842 | 233 |
| 668 | 3300048905 | Ga0496102_0003481 | Ga0496102_0003481_7191_7892 | 233 |
| 669 | 3300048905 | Ga0496102_0003652 | Ga0496102_0003652_6963_7664 | 233 |
| 670 | 3300048905 | Ga0496102_0076420 | Ga0496102_0076420_1440_2141 | 233 |
| 671 | 3300048905 | Ga0496102_0142346 | Ga0496102_0142346_519_1220 | 233 |
| 672 | 3300048905 | Ga0496102_0237016 | Ga0496102_0237016_191_892 | 233 |
| 673 | 3300048905 | Ga0496102_0339862 | Ga0496102_0339862_180_881 | 233 |
| 674 | 3300048905 | Ga0496102_0382583 | Ga0496102_0382583_212_913 | 233 |
| 675 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_276216_276917 | 233 |
| 676 | 3300048906 | Ga0496103_0000473 | Ga0496103_0000473_21554_22255 | 233 |
| 677 | 3300048906 | Ga0496103_0000662 | Ga0496103_0000662_20484_21185 | 233 |
| 678 | 3300048906 | Ga0496103_0001547 | Ga0496103_0001547_4436_5137 | 233 |
| 679 | 3300048906 | Ga0496103_0038046 | Ga0496103_0038046_368_1069 | 233 |
| 680 | 3300048906 | Ga0496103_0042581 | Ga0496103_0042581_211_912 | 233 |
| 681 | 3300048907 | Ga0496104_0000285 | Ga0496104_0000285_17054_17755 | 233 |
| 682 | 3300048907 | Ga0496104_0008789 | Ga0496104_0008789_2908_3609 | 233 |
| 683 | 3300048908 | Ga0496105_0040584 | Ga0496105_0040584_3055_3756 | 233 |
| 684 | 3300048908 | Ga0496105_0219740 | Ga0496105_0219740_254_955 | 233 |
| 685 | 3300048909 | Ga0496106_0003083 | Ga0496106_0003083_9646_10347 | 233 |
| 686 | 3300048909 | Ga0496106_0005366 | Ga0496106_0005366_8219_8920 | 233 |
| 687 | 3300048909 | Ga0496106_0026975 | Ga0496106_0026975_3104_3805 | 233 |
| 688 | 3300048909 | Ga0496106_0027196 | Ga0496106_0027196_652_1353 | 233 |
| 689 | 3300048910 | Ga0496107_0000152 | Ga0496107_0000152_19306_20007 | 233 |
| 690 | 3300048910 | Ga0496107_0000303 | Ga0496107_0000303_602_1303 | 233 |
| 691 | 3300048910 | Ga0496107_0000364 | Ga0496107_0000364_5355_6056 | 233 |
| 692 | 3300048911 | Ga0496108_0005587 | Ga0496108_0005587_3629_4330 | 233 |
| 693 | 3300048911 | Ga0496108_0048364 | Ga0496108_0048364_2051_2752 | 233 |
| 694 | 3300048912 | Ga0496109_0000214 | Ga0496109_0000214_46095_46796 | 233 |
| 695 | 3300048912 | Ga0496109_0017274 | Ga0496109_0017274_2979_3680 | 233 |
| 696 | 3300048912 | Ga0496109_0051609 | Ga0496109_0051609_807_1508 | 233 |
| 697 | 3300048912 | Ga0496109_0222005 | Ga0496109_0222005_363_1064 | 233 |
| 698 | 3300048912 | Ga0496109_0297274 | Ga0496109_0297274_179_880 | 233 |
| 699 | 3300048912 | Ga0496109_0490464 | Ga0496109_0490464_352_1053 | 233 |
| 700 | 3300048912 | Ga0496109_0623128 | Ga0496109_0623128_110_811 | 233 |
| 701 | 3300048913 | Ga0496110_0015406 | Ga0496110_0015406_767_1468 | 233 |
| 702 | 3300048913 | Ga0496110_0024790 | Ga0496110_0024790_202_903 | 233 |
| 703 | 3300048913 | Ga0496110_0831443 | Ga0496110_0831443_65_766 | 233 |
| 704 | 3300048914 | Ga0496111_0005039 | Ga0496111_0005039_1053_1754 | 233 |
| 705 | 3300048914 | Ga0496111_0028064 | Ga0496111_0028064_639_1340 | 233 |
| 706 | 3300048915 | Ga0496112_0001718 | Ga0496112_0001718_14162_14863 | 233 |
| 707 | 3300048915 | Ga0496112_0034180 | Ga0496112_0034180_2753_3454 | 233 |
| 708 | 3300048915 | Ga0496112_0064234 | Ga0496112_0064234_2718_3419 | 233 |
| 709 | 3300048915 | Ga0496112_0114959 | Ga0496112_0114959_182_883 | 233 |
| 710 | 3300048915 | Ga0496112_0287583 | Ga0496112_0287583_597_1298 | 233 |
| 711 | 3300048916 | Ga0496113_0049429 | Ga0496113_0049429_1401_2102 | 233 |
| 712 | 3300048916 | Ga0496113_0137406 | Ga0496113_0137406_636_1337 | 233 |
| 713 | 3300048917 | Ga0496114_0000108 | Ga0496114_0000108_55350_56051 | 233 |
| 714 | 3300048917 | Ga0496114_0000136 | Ga0496114_0000136_18087_18788 | 233 |
| 715 | 3300048917 | Ga0496114_0000166 | Ga0496114_0000166_22271_22972 | 233 |
| 716 | 3300048917 | Ga0496114_0080888 | Ga0496114_0080888_2022_2723 | 233 |
| 717 | 3300048917 | Ga0496114_0127030 | Ga0496114_0127030_757_1458 | 233 |
| 718 | 3300048917 | Ga0496114_0161578 | Ga0496114_0161578_351_1052 | 233 |
| 719 | 3300048917 | Ga0496114_0400059 | Ga0496114_0400059_239_940 | 233 |
| 720 | 3300048918 | Ga0496115_0000620 | Ga0496115_0000620_6988_7689 | 233 |
| 721 | 3300048918 | Ga0496115_0002574 | Ga0496115_0002574_9271_9972 | 233 |
| 722 | 3300048918 | Ga0496115_0303140 | Ga0496115_0303140_561_1262 | 233 |
| 723 | 3300048918 | Ga0496115_0406384 | Ga0496115_0406384_286_987 | 233 |
| 724 | 3300048919 | Ga0496116_0000428 | Ga0496116_0000428_24550_25251 | 233 |
| 725 | 3300048919 | Ga0496116_0010448 | Ga0496116_0010448_4997_5698 | 233 |
| 726 | 3300048919 | Ga0496116_0064942 | Ga0496116_0064942_203_904 | 233 |
| 727 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1474619_1475320 | 233 |
| 728 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1474622_1475323 | 233 |
| 729 | 3300048921 | Ga0496118_0000292 | Ga0496118_0000292_47827_48528 | 233 |
| 730 | 3300048921 | Ga0496118_0004368 | Ga0496118_0004368_13937_14638 | 233 |
| 731 | 3300048922 | Ga0496119_0001080 | Ga0496119_0001080_24587_25288 | 233 |
| 732 | 3300048922 | Ga0496119_0001862 | Ga0496119_0001862_12977_13678 | 233 |
| 733 | 3300048922 | Ga0496119_0028396 | Ga0496119_0028396_646_1347 | 233 |
| 734 | 3300048923 | Ga0496120_0001263 | Ga0496120_0001263_6508_7209 | 233 |
| 735 | 3300048923 | Ga0496120_0003934 | Ga0496120_0003934_4687_5388 | 233 |
| 736 | 3300048923 | Ga0496120_0031778 | Ga0496120_0031778_643_1344 | 233 |
| 737 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_340584_341285 | 233 |
| 738 | 3300048924 | Ga0496121_0000032 | Ga0496121_0000032_370198_370899 | 233 |
| 739 | 3300048924 | Ga0496121_0004517 | Ga0496121_0004517_7771_8472 | 233 |
| 740 | 3300048925 | Ga0496122_0000164 | Ga0496122_0000164_44921_45622 | 233 |
| 741 | 3300048926 | Ga0496123_0006609 | Ga0496123_0006609_4445_5146 | 233 |
| 742 | 3300048926 | Ga0496123_0012134 | Ga0496123_0012134_4564_5265 | 233 |
| 743 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_340584_341285 | 233 |
| 744 | 3300048927 | Ga0496124_0109899 | Ga0496124_0109899_1240_1941 | 233 |
| 745 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_122164_122865 | 233 |
| 746 | 3300048928 | Ga0496125_0071017 | Ga0496125_0071017_1979_2680 | 233 |
| 747 | 3300048928 | Ga0496125_0119758 | Ga0496125_0119758_514_1215 | 233 |
| 748 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_340584_341285 | 233 |
| 749 | 3300048929 | Ga0496126_0000067 | Ga0496126_0000067_32351_33052 | 233 |
| 750 | 3300048929 | Ga0496126_0001990 | Ga0496126_0001990_2861_3562 | 233 |
| 751 | 3300048929 | Ga0496126_0002459 | Ga0496126_0002459_15696_16397 | 233 |
| 752 | 3300048929 | Ga0496126_0006797 | Ga0496126_0006797_8116_8817 | 233 |
| 753 | 3300048929 | Ga0496126_0071181 | Ga0496126_0071181_538_1239 | 233 |
| 754 | 3300049569 | Ga0501032_0015981 | Ga0501032_0015981_4122_4823 | 233 |
| 755 | 3300049569 | Ga0501032_0264703 | Ga0501032_0264703_104_805 | 233 |
| 756 | 3300049570 | Ga0501033_0006709 | Ga0501033_0006709_7494_8195 | 233 |
| 757 | 3300049570 | Ga0501033_0039642 | Ga0501033_0039642_1490_2191 | 233 |
| 758 | 3300049571 | Ga0501034_0006051 | Ga0501034_0006051_165_866 | 233 |
| 759 | 3300049571 | Ga0501034_0011109 | Ga0501034_0011109_2266_2967 | 233 |
| 760 | 3300049571 | Ga0501034_0074634 | Ga0501034_0074634_2405_3106 | 233 |
| 761 | 3300049572 | Ga0501036_0016634 | Ga0501036_0016634_281_982 | 233 |
| 762 | 3300049572 | Ga0501036_0044342 | Ga0501036_0044342_776_1477 | 233 |
| 763 | 3300049573 | Ga0501037_0000584 | Ga0501037_0000584_24248_24949 | 233 |
| 764 | 3300049573 | Ga0501037_0003783 | Ga0501037_0003783_2990_3691 | 233 |
| 765 | 3300049574 | Ga0501038_0003008 | Ga0501038_0003008_6382_7083 | 233 |
| 766 | 3300049575 | Ga0501039_0002202 | Ga0501039_0002202_4960_5661 | 233 |
| 767 | 3300049579 | Ga0501043_0001037 | Ga0501043_0001037_6905_7606 | 233 |
| 768 | 3300049579 | Ga0501043_0077857 | Ga0501043_0077857_1658_2359 | 233 |
| 769 | 3300049581 | Ga0501047_0000372 | Ga0501047_0000372_7136_7837 | 233 |
| 770 | 3300049581 | Ga0501047_0433643 | Ga0501047_0433643_95_796 | 233 |
| 771 | 3300049582 | Ga0501048_0031651 | Ga0501048_0031651_2165_2866 | 233 |
| 772 | 3300049585 | Ga0501069_0036857 | Ga0501069_0036857_173_874 | 233 |
| 773 | 3300049585 | Ga0501069_0235466 | Ga0501069_0235466_63_764 | 233 |
| 774 | 3300049586 | Ga0501070_0000578 | Ga0501070_0000578_10127_10828 | 233 |
| 775 | 3300049586 | Ga0501070_0002976 | Ga0501070_0002976_3753_4454 | 233 |
| 776 | 3300049586 | Ga0501070_0098697 | Ga0501070_0098697_1658_2359 | 233 |
| 777 | 3300049589 | Ga0501073_0024898 | Ga0501073_0024898_756_1457 | 233 |
| 778 | 3300049589 | Ga0501073_0032431 | Ga0501073_0032431_2127_2828 | 233 |
| 779 | 3300049742 | Ga0501080_0753878 | Ga0501080_0753878_83_784 | 233 |
| 780 | 3300049822 | Ga0501035_0001032 | Ga0501035_0001032_16872_17573 | 233 |
| 781 | 3300049822 | Ga0501035_0436679 | Ga0501035_0436679_343_1044 | 233 |
| 782 | 3300049823 | Ga0501044_0006896 | Ga0501044_0006896_7182_7883 | 233 |
| 783 | 3300049823 | Ga0501044_0008550 | Ga0501044_0008550_1216_1917 | 233 |
| 784 | 3300049823 | Ga0501044_0014604 | Ga0501044_0014604_5997_6698 | 233 |
| 785 | 3300049824 | Ga0501045_0264326 | Ga0501045_0264326_135_836 | 233 |
| 786 | 3300050489 | nmdc:mga03683_213621_c1 | nmdc:mga03683_213621_c1_136_837 | 233 |
| 787 | 3300050489 | nmdc:mga03683_32675_c1 | nmdc:mga03683_32675_c1_1281_1982 | 233 |
| 788 | 3300050490 | nmdc:mga03n38_138016_c1 | nmdc:mga03n38_138016_c1_389_1090 | 233 |
| 789 | 3300050490 | nmdc:mga03n38_25694_c1 | nmdc:mga03n38_25694_c1_64_765 | 233 |
| 790 | 3300050490 | nmdc:mga03n38_3325_c1 | nmdc:mga03n38_3325_c1_3961_4662 | 233 |
| 791 | 3300050490 | nmdc:mga03n38_40989_c1 | nmdc:mga03n38_40989_c1_342_1043 | 233 |
| 792 | 3300050490 | nmdc:mga03n38_61400_c1 | nmdc:mga03n38_61400_c1_352_1053 | 233 |
| 793 | 3300050491 | nmdc:mga00v17_147632_c1 | nmdc:mga00v17_147632_c1_516_1217 | 233 |
| 794 | 3300050491 | nmdc:mga00v17_1649_c1 | nmdc:mga00v17_1649_c1_3855_4556 | 233 |
| 795 | 3300050491 | nmdc:mga00v17_227478_c1 | nmdc:mga00v17_227478_c1_476_1177 | 233 |
| 796 | 3300050491 | nmdc:mga00v17_4701_c1 | nmdc:mga00v17_4701_c1_2259_2960 | 233 |
| 797 | 3300050491 | nmdc:mga00v17_50762_c1 | nmdc:mga00v17_50762_c1_1173_1874 | 233 |
| 798 | 3300050491 | nmdc:mga00v17_98783_c1 | nmdc:mga00v17_98783_c1_491_1192 | 233 |
| 799 | 3300050492 | nmdc:mga0yw44_15444_c1 | nmdc:mga0yw44_15444_c1_2972_3673 | 233 |
| 800 | 3300050492 | nmdc:mga0yw44_204468_c1 | nmdc:mga0yw44_204468_c1_162_863 | 233 |
| 801 | 3300050492 | nmdc:mga0yw44_27434_c1 | nmdc:mga0yw44_27434_c1_1061_1762 | 233 |
| 802 | 3300050492 | nmdc:mga0yw44_2876_c1 | nmdc:mga0yw44_2876_c1_5161_5862 | 233 |
| 803 | 3300050492 | nmdc:mga0yw44_6915_c1 | nmdc:mga0yw44_6915_c1_1137_1838 | 233 |
| 804 | 3300050494 | nmdc:mga06z11_112694_c1 | nmdc:mga06z11_112694_c1_647_1348 | 233 |
| 805 | 3300050494 | nmdc:mga06z11_226856_c1 | nmdc:mga06z11_226856_c1_64_765 | 233 |
| 806 | 3300050494 | nmdc:mga06z11_5162_c1 | nmdc:mga06z11_5162_c1_255_956 | 233 |
| 807 | 3300050495 | nmdc:mga04h51_49795_c1 | nmdc:mga04h51_49795_c1_43_744 | 233 |
| 808 | 3300050496 | nmdc:mga07m45_11903_c1 | nmdc:mga07m45_11903_c1_2308_3009 | 233 |
| 809 | 3300050496 | nmdc:mga07m45_149346_c1 | nmdc:mga07m45_149346_c1_265_966 | 233 |
| 810 | 3300050496 | nmdc:mga07m45_17140_c1 | nmdc:mga07m45_17140_c1_2852_3553 | 233 |
| 811 | 3300050496 | nmdc:mga07m45_42124_c1 | nmdc:mga07m45_42124_c1_242_943 | 233 |
| 812 | 3300050496 | nmdc:mga07m45_54510_c1 | nmdc:mga07m45_54510_c1_97_798 | 233 |
| 813 | 3300050507 | nmdc:mga05p37_26882_c1 | nmdc:mga05p37_26882_c1_5331_6032 | 233 |
| 814 | 3300050509 | nmdc:mga0qj67_520316_c1 | nmdc:mga0qj67_520316_c1_239_940 | 233 |
| 815 | 3300050510 | nmdc:mga06r32_66396_c1 | nmdc:mga06r32_66396_c1_1661_2362 | 233 |
| 816 | 3300050511 | nmdc:mga08y16_187794_c1 | nmdc:mga08y16_187794_c1_1423_2124 | 233 |
| 817 | 3300050516 | nmdc:mga0sz30_164225_c1 | nmdc:mga0sz30_164225_c1_270_971 | 233 |
| 818 | 3300050516 | nmdc:mga0sz30_18492_c1 | nmdc:mga0sz30_18492_c1_386_1087 | 233 |
| 819 | 3300050516 | nmdc:mga0sz30_199038_c1 | nmdc:mga0sz30_199038_c1_30_731 | 233 |
| 820 | 3300050516 | nmdc:mga0sz30_3091_c1 | nmdc:mga0sz30_3091_c1_3675_4376 | 233 |
| 821 | 3300050516 | nmdc:mga0sz30_41704_c1 | nmdc:mga0sz30_41704_c1_1128_1829 | 233 |
| 822 | 3300050516 | nmdc:mga0sz30_56390_c1 | nmdc:mga0sz30_56390_c1_905_1606 | 233 |
| 823 | 3300050516 | nmdc:mga0sz30_68233_c1 | nmdc:mga0sz30_68233_c1_634_1335 | 233 |
| 824 | 3300050516 | nmdc:mga0sz30_8902_c1 | nmdc:mga0sz30_8902_c1_1043_1744 | 233 |
| 825 | 3300053079 | Ga0500610_0026618 | Ga0500610_0026618_639_1340 | 233 |
| 826 | 3300053080 | Ga0500635_0000695 | Ga0500635_0000695_2308_3009 | 233 |
| 827 | 3300053087 | Ga0500643_011430 | Ga0500643_011430_607_1308 | 233 |
| 828 | 3300053087 | Ga0500643_017752 | Ga0500643_017752_982_1683 | 233 |
| 829 | 3300053104 | Ga0500556_0005325 | Ga0500556_0005325_690_1391 | 233 |
| 830 | 3300053130 | Ga0500642_0039883 | Ga0500642_0039883_771_1472 | 233 |
| 831 | 3300053131 | Ga0500652_000535 | Ga0500652_000535_9373_10074 | 233 |
| 832 | 3300053153 | Ga0500616_0007708 | Ga0500616_0007708_1772_2473 | 233 |
| 833 | 3300053153 | Ga0500616_0092688 | Ga0500616_0092688_26_727 | 233 |
| 834 | 3300053730 | Ga0500645_000075 | Ga0500645_000075_41978_42679 | 233 |
| 835 | 3300053730 | Ga0500645_018737 | Ga0500645_018737_1272_1973 | 233 |
| 836 | 3300061719 | Ga0466962_0028329 | Ga0466962_0028329_601_1302 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tf1-assembly2.cif.gz_B | crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain | 0.9025 | 78 | 231 |
| 4wcg-assembly1.cif.gz_B | the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna | 0.895 | 10 | 64 |
| 3obf-assembly2.cif.gz_B | crystal structure of putative transcriptional regulator, iclr family; targeted domain 129...302 | 0.8911 | 81 | 233 |
| 4ou0-assembly1.cif.gz_A | crystal structure of rpa32c | 0.8885 | 12 | 64 |
| 3bjn-assembly1.cif.gz_A | crystal structure of c-terminal domain of putative transcriptional regulator from vibrio cholerae, targeted domain 79-240 | 0.8865 | 80 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53238_78_233_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9967 | 78 | 233 | 3.30.450.40 |
| af_O53238_78_233_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9903 | 78 | 233 | 3.30.450.40 |
| af_O53238_2_75_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9386 | 2 | 75 | 1.10.10.10 |
| af_P16528_22_97_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9372 | 7 | 72 | 1.10.10.10 |
| 2xroE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9281 | 9 | 75 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A401N4W8-F1-model_v4 | deleted | 1.004 | 133 | 233 |
|
| AF-A0A401N4W8-F1-model_v4 | deleted | 0.9842 | 133 | 233 |
|
| AF-A0A6B3F3U2-F1-model_v4 | IclR family transcriptional regulator NdgR | 0.9472 | 79 | 178 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A3E0K091-F1-model_v4 | deleted | 0.9318 | 22 | 232 |
|
| AF-A0A6B3F3U2-F1-model_v4 | IclR family transcriptional regulator NdgR | 0.9291 | 79 | 178 |
GO:0003677
GO:0003700 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar