F482900

General Info

Members Datasets Scaffolds Average Seq Length
836 369 798 230

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0112879|Ga0466967_0112879_175_942
Length 255
Sequence MSSSPLFGHSLPSHNTRRYYLYVRQHSGIGVLDKAVGVLHTIAESPCGLAELCERTGLPRATAYRLAAALEVHRLLARDDEGRWRLGPAVTELAARVNDPLLAASAAVLPALRETTGESVQLYRREGTSRVCVAALEPAAGLRDTVPVGARLPMTAGSGAKVLLAYADAATQKAVLPTAKFSDRALAEVRRRGWAQSVAEREPGVASVSAPVRDHRGVVIAAISVSGPVDRIGRRPGARWAADLLSAADALARRL

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2582580736 Prauserella sp. Am3 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
6 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
13 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
14 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
15 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
16 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
17 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
18 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
19 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
20 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
21 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
22 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
23 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
24 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
25 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
26 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
27 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
28 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
29 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
30 2922554459 Rhodococcus sp. 66b Isolate Unclassified
31 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
32 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
33 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
34 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
35 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
36 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
37 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
38 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
39 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
40 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
41 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
42 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
43 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
44 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
251 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
254 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
261 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
360 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
361 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
362 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
363 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
366 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0.12
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 11.36
Nodule 0.12
Rhizoplane 10.65
Rhizosphere 68.54
Stem 0
Stem Tuber 0
Unclassified 9.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1010674 3300002073 Bacteria 1046
2 JGI24738J21930_10007479 3300002075 Bacteria 2519
3 JGI24738J21930_10008857 3300002075 Bacteria 2279
4 JGI24749J21850_1005080 3300002076 Bacteria 1845
5 JGI24744J21845_10000383 3300002077 Bacteria 7570
6 JGI24742J22300_10000643 3300002244 Bacteria 5256
7 JGI24751J29686_10006298 3300002459 Bacteria 2417
8 JGI25406J46586_10004772 3300003203 Bacteria 6305
9 Ga0055540_1004388 3300003792 Bacteria 6387
10 Ga0055540_1009880 3300003792 Bacteria 3235
11 Ga0055540_1031021 3300003792 Bacteria 1233
12 Ga0070676_10119906 3300005328 Bacteria 1650
13 Ga0070683_100048295 3300005329 Bacteria 3935
14 Ga0070683_100834515 3300005329 Bacteria 884
15 Ga0070690_100001859 3300005330 Bacteria 11199
16 Ga0070690_100301823 3300005330 Bacteria 1149
17 Ga0068869_100058333 3300005334 Bacteria 2822
18 Ga0070666_10034987 3300005335 Bacteria 3329
19 Ga0070666_10639683 3300005335 Bacteria 778
20 Ga0070682_100070143 3300005337 Bacteria 2239
21 Ga0070682_100071726 3300005337 Bacteria 2218
22 Ga0070682_100135754 3300005337 Bacteria 1671
23 Ga0070682_100154163 3300005337 Bacteria 1580
24 Ga0068868_100001302 3300005338 Bacteria 17195
25 Ga0068868_100100301 3300005338 Bacteria 2343
26 Ga0068868_100258935 3300005338 Bacteria 1466
27 Ga0068868_100574735 3300005338 Bacteria 996
28 Ga0068868_101317228 3300005338 Bacteria 671
29 Ga0070660_100080398 3300005339 Bacteria 2558
30 Ga0070660_100360781 3300005339 Bacteria 1198
31 Ga0070689_100038951 3300005340 Bacteria 3638
32 Ga0070689_100143319 3300005340 Bacteria 1923
33 Ga0070691_10000684 3300005341 Bacteria 13222
34 Ga0070668_100001456 3300005347 Bacteria 17104
35 Ga0070668_100020142 3300005347 Bacteria 5030
36 Ga0070668_100084942 3300005347 Bacteria 2487
37 Ga0070668_100203841 3300005347 Bacteria 1624
38 Ga0070668_100505409 3300005347 Bacteria 1047
39 Ga0070671_100000475 3300005355 Bacteria 27987
40 Ga0070671_100002781 3300005355 Bacteria 13594
41 Ga0070671_100159640 3300005355 Bacteria 1906
42 Ga0070671_100276527 3300005355 Bacteria 1428
43 Ga0070671_100314598 3300005355 Bacteria 1334
44 Ga0070674_100001031 3300005356 Bacteria 14566
45 Ga0070674_100004224 3300005356 Bacteria 8162
46 Ga0070674_100117148 3300005356 Bacteria 1966
47 Ga0070674_100729462 3300005356 Bacteria 850
48 Ga0070674_100819082 3300005356 Bacteria 805
49 Ga0070673_100078206 3300005364 Bacteria 2676
50 Ga0070673_100425795 3300005364 Bacteria 1191
51 Ga0070688_100078052 3300005365 Bacteria 2135
52 Ga0070688_100364093 3300005365 Bacteria 1062
53 Ga0070659_100141002 3300005366 Bacteria 1962
54 Ga0070659_100153312 3300005366 Bacteria 1881
55 Ga0070659_100203915 3300005366 Bacteria 1628
56 Ga0070667_100000063 3300005367 Bacteria 138777
57 Ga0070667_100000620 3300005367 Bacteria 34660
58 Ga0070667_100020470 3300005367 Bacteria 5492
59 Ga0070667_100022417 3300005367 Bacteria 5237
60 Ga0070667_100413775 3300005367 Bacteria 1228
61 Ga0070667_101042934 3300005367 Bacteria 763
62 Ga0070709_10049623 3300005434 Bacteria 2625
63 Ga0070714_100067806 3300005435 Bacteria 3077
64 Ga0070714_100074821 3300005435 Bacteria 2937
65 Ga0070713_100930373 3300005436 Bacteria 837
66 Ga0070710_10006956 3300005437 Bacteria 5455
67 Ga0070710_10007817 3300005437 Bacteria 5190
68 Ga0070701_10017749 3300005438 Bacteria 3332
69 Ga0070711_100000327 3300005439 Bacteria 24630
70 Ga0070711_100001579 3300005439 Bacteria 12539
71 Ga0070711_100177825 3300005439 Bacteria 1627
72 Ga0070705_100502506 3300005440 Bacteria 921
73 Ga0070700_100015828 3300005441 Bacteria 4286
74 Ga0070694_100007834 3300005444 Bacteria 6519
75 Ga0070708_100291628 3300005445 Bacteria 1536
76 Ga0070663_100000066 3300005455 Bacteria 45121
77 Ga0070663_100070529 3300005455 Bacteria 2541
78 Ga0070663_100124548 3300005455 Bacteria 1951
79 Ga0070663_100169897 3300005455 Bacteria 1685
80 Ga0070663_100217488 3300005455 Bacteria 1499
81 Ga0070663_100554816 3300005455 Bacteria 961
82 Ga0070678_100000105 3300005456 Bacteria 32409
83 Ga0070662_100372063 3300005457 Bacteria 1174
84 Ga0068867_100000723 3300005459 Bacteria 22069
85 Ga0068867_100058057 3300005459 Bacteria 2867
86 Ga0070685_10311718 3300005466 Bacteria 1064
87 Ga0070706_100010948 3300005467 Bacteria 8421
88 Ga0070706_100488150 3300005467 Bacteria 1146
89 Ga0070707_100007178 3300005468 Bacteria 10334
90 Ga0070699_100164102 3300005518 Bacteria 1967
91 Ga0070679_100208611 3300005530 Bacteria 1918
92 Ga0070684_100379510 3300005535 Bacteria 1302
93 Ga0070684_100505720 3300005535 Bacteria 1119
94 Ga0070697_100548269 3300005536 Bacteria 1014
95 Ga0068853_100070499 3300005539 Bacteria 3042
96 Ga0068853_100110933 3300005539 Bacteria 2437
97 Ga0070672_100036537 3300005543 Bacteria 3743
98 Ga0070686_100117297 3300005544 Bacteria 1823
99 Ga0070695_100007265 3300005545 Bacteria 6567
100 Ga0070696_100001184 3300005546 Bacteria 16907
101 Ga0070696_100040911 3300005546 Bacteria 3201
102 Ga0070693_100067491 3300005547 Bacteria 2097
103 Ga0070665_100004232 3300005548 Bacteria 15101
104 Ga0070665_100005202 3300005548 Bacteria 13459
105 Ga0070665_100006023 3300005548 Bacteria 12392
106 Ga0070665_100077582 3300005548 Bacteria 3328
107 Ga0070665_100705310 3300005548 Bacteria 1022
108 Ga0070704_100000016 3300005549 Bacteria 57860
109 Ga0068855_100084004 3300005563 Bacteria 3687
110 Ga0068855_100790300 3300005563 Bacteria 1009
111 Ga0068854_100674914 3300005578 Bacteria 889
112 Ga0070702_100001709 3300005615 Bacteria 9119
113 Ga0070702_100046624 3300005615 Bacteria 2457
114 Ga0070702_100668495 3300005615 Bacteria 788
115 Ga0068852_100566152 3300005616 Bacteria 1138
116 Ga0068859_100000777 3300005617 Bacteria 32236
117 Ga0068859_100000989 3300005617 Bacteria 29085
118 Ga0068859_100074723 3300005617 Bacteria 3428
119 Ga0068859_100776883 3300005617 Bacteria 1046
120 Ga0068864_100225883 3300005618 Bacteria 1729
121 Ga0068864_100265520 3300005618 Bacteria 1598
122 Ga0068864_100723658 3300005618 Bacteria 974
123 Ga0068864_100806984 3300005618 Bacteria 923
124 Ga0068866_10000152 3300005718 Bacteria 31563
125 Ga0068861_100000157 3300005719 Bacteria 35512
126 Ga0068861_100118728 3300005719 Bacteria 2131
127 Ga0068861_100337227 3300005719 Bacteria 1318
128 Ga0068861_100509858 3300005719 Bacteria 1089
129 Ga0068851_10229086 3300005834 Bacteria 1047
130 Ga0068870_10480157 3300005840 Bacteria 825
131 Ga0068863_100000159 3300005841 Bacteria 71831
132 Ga0068863_100003604 3300005841 Bacteria 15290
133 Ga0068863_100028488 3300005841 Bacteria 5334
134 Ga0068863_100202456 3300005841 Bacteria 1910
135 Ga0068858_100000002 3300005842 Bacteria 351633
136 Ga0068858_100498310 3300005842 Bacteria 1176
137 Ga0068858_100955628 3300005842 Bacteria 839
138 Ga0068860_100000065 3300005843 Bacteria 186634
139 Ga0068860_100000663 3300005843 Bacteria 39893
140 Ga0068860_100050567 3300005843 Bacteria 3956
141 Ga0068862_100000028 3300005844 Bacteria 184197
142 Ga0068862_100010168 3300005844 Bacteria 7765
143 Ga0081455_10000995 3300005937 Bacteria 35927
144 Ga0081455_10230781 3300005937 Bacteria 1366
145 Ga0081539_10001153 3300005985 Bacteria 47882
146 Ga0070717_10179490 3300006028 Bacteria 1845
147 Ga0075365_10019826 3300006038 Bacteria 4159
148 Ga0075365_10097555 3300006038 Bacteria 2009
149 Ga0075365_10287685 3300006038 Bacteria 1156
150 Ga0075368_10050173 3300006042 Bacteria 1657
151 Ga0075363_100020572 3300006048 Bacteria 3311
152 Ga0075363_100031359 3300006048 Bacteria 2756
153 Ga0075363_100053055 3300006048 Bacteria 2166
154 Ga0075363_100112079 3300006048 Bacteria 1517
155 Ga0075363_100120597 3300006048 Bacteria 1464
156 Ga0075363_100272669 3300006048 Bacteria 977
157 Ga0075363_100300311 3300006048 Bacteria 932
158 Ga0075364_10003349 3300006051 Bacteria 9092
159 Ga0075364_10017435 3300006051 Bacteria 4486
160 Ga0075364_10036950 3300006051 Bacteria 3160
161 Ga0075364_10040932 3300006051 Bacteria 3006
162 Ga0075364_10337657 3300006051 Bacteria 1027
163 Ga0070715_10027904 3300006163 Bacteria 2259
164 Ga0070715_10028363 3300006163 Bacteria 2244
165 Ga0070716_100012209 3300006173 Bacteria 4348
166 Ga0070716_100023074 3300006173 Bacteria 3295
167 Ga0070712_100000926 3300006175 Bacteria 17635
168 Ga0070712_100019484 3300006175 Bacteria 4426
169 Ga0075362_10182328 3300006177 Bacteria 1018
170 Ga0075367_10127659 3300006178 Bacteria 1570
171 Ga0075367_10162130 3300006178 Bacteria 1391
172 Ga0075367_10400855 3300006178 Bacteria 868
173 Ga0075369_10003004 3300006186 Bacteria 6100
174 Ga0075369_10006451 3300006186 Bacteria 4436
175 Ga0075369_10008548 3300006186 Bacteria 3943
176 Ga0075369_10016201 3300006186 Bacteria 3003
177 Ga0075369_10022484 3300006186 Bacteria 2601
178 Ga0075369_10023619 3300006186 Bacteria 2543
179 Ga0075369_10093774 3300006186 Bacteria 1341
180 Ga0075369_10294186 3300006186 Bacteria 758
181 Ga0075366_10085861 3300006195 Bacteria 1883
182 Ga0097621_100077048 3300006237 Bacteria 2767
183 Ga0075370_10001708 3300006353 Bacteria 9755
184 Ga0075370_10001851 3300006353 Bacteria 9478
185 Ga0075370_10026581 3300006353 Bacteria 3206
186 Ga0075370_10090992 3300006353 Bacteria 1760
187 Ga0075370_10117182 3300006353 Bacteria 1549
188 Ga0075370_10133429 3300006353 Bacteria 1449
189 Ga0075370_10200994 3300006353 Bacteria 1175
190 Ga0068871_100119613 3300006358 Bacteria 2224
191 Ga0075428_100006335 3300006844 Bacteria 13164
192 Ga0075430_100083231 3300006846 Bacteria 2680
193 Ga0075431_100180299 3300006847 Bacteria 2168
194 Ga0075429_100269907 3300006880 Bacteria 1490
195 Ga0097620_100000777 3300006931 Bacteria 32236
196 Ga0097620_100000989 3300006931 Bacteria 29085
197 Ga0097620_100074725 3300006931 Bacteria 3428
198 Ga0097620_100776732 3300006931 Bacteria 1046
199 Ga0075435_100646585 3300007076 Bacteria 918
200 Ga0105250_10170395 3300009092 Bacteria 911
201 Ga0105240_10196936 3300009093 Bacteria 2364
202 Ga0111539_10191321 3300009094 Bacteria 2388
203 Ga0111539_10573693 3300009094 Bacteria 1314
204 Ga0111539_10761220 3300009094 Bacteria 1127
205 Ga0105245_10000172 3300009098 Bacteria 61572
206 Ga0105245_10033743 3300009098 Bacteria 4536
207 Ga0105245_10042813 3300009098 Bacteria 4039
208 Ga0105245_10056993 3300009098 Bacteria 3513
209 Ga0105247_10000009 3300009101 Bacteria 385991
210 Ga0105247_10000451 3300009101 Bacteria 34877
211 Ga0105247_10050375 3300009101 Bacteria 2562
212 Ga0105247_10639092 3300009101 Bacteria 794
213 Ga0114129_10045686 3300009147 Bacteria 6155
214 Ga0105243_10001407 3300009148 Bacteria 21285
215 Ga0105243_10001852 3300009148 Bacteria 18054
216 Ga0105243_10055548 3300009148 Bacteria 3147
217 Ga0105241_10097080 3300009174 Bacteria 2335
218 Ga0105241_10324085 3300009174 Bacteria 1329
219 Ga0105242_10000281 3300009176 Bacteria 40643
220 Ga0105242_10646999 3300009176 Bacteria 1027
221 Ga0105248_10000186 3300009177 Bacteria 72427
222 Ga0105248_10000943 3300009177 Bacteria 32364
223 Ga0105248_10001346 3300009177 Bacteria 27382
224 Ga0105248_10506794 3300009177 Bacteria 1361
225 Ga0105248_10547064 3300009177 Bacteria 1306
226 Ga0105237_10009360 3300009545 Bacteria 10493
227 Ga0105237_10091927 3300009545 Bacteria 3024
228 Ga0105237_10609182 3300009545 Bacteria 1099
229 Ga0105238_10646028 3300009551 Bacteria 1068
230 Ga0105249_10000011 3300009553 Bacteria 292812
231 Ga0105249_10000291 3300009553 Bacteria 51476
232 Ga0105249_10185635 3300009553 Bacteria 2026
233 Ga0105249_10260659 3300009553 Bacteria 1722
234 Ga0105249_11087294 3300009553 Bacteria 870
235 Ga0105239_10004844 3300010375 Bacteria 15921
236 Ga0105239_10013169 3300010375 Bacteria 9190
237 Ga0105239_10226287 3300010375 Bacteria 2098
238 Ga0105246_10117483 3300011119 Bacteria 1965
239 Ga0157371_10195262 3300013102 Bacteria 1450
240 Ga0157374_10058502 3300013296 Bacteria 3602
241 Ga0157378_10000282 3300013297 Bacteria 49400
242 Ga0157378_10081410 3300013297 Bacteria 2926
243 Ga0163162_10001346 3300013306 Bacteria 22877
244 Ga0163162_10136421 3300013306 Bacteria 2564
245 Ga0163162_10830724 3300013306 Bacteria 1040
246 Ga0163162_11413958 3300013306 Bacteria 791
247 Ga0157372_10008436 3300013307 Bacteria 10939
248 Ga0157372_10248274 3300013307 Bacteria 2065
249 Ga0157375_10000443 3300013308 Bacteria 37561
250 Ga0157375_10097647 3300013308 Bacteria 3012
251 Ga0163163_10012382 3300014325 Bacteria 7770
252 Ga0163163_10079654 3300014325 Bacteria 3274
253 Ga0163163_10110618 3300014325 Bacteria 2776
254 Ga0163163_10631623 3300014325 Bacteria 1134
255 Ga0157380_10035286 3300014326 Bacteria 3862
256 Ga0157380_10267553 3300014326 Bacteria 1556
257 Ga0157380_10294098 3300014326 Bacteria 1493
258 Ga0157377_10166689 3300014745 Bacteria 1374
259 Ga0157379_10000007 3300014968 Bacteria 142402
260 Ga0157379_10008216 3300014968 Bacteria 9062
261 Ga0157379_10053821 3300014968 Bacteria 3596
262 Ga0157379_10090968 3300014968 Bacteria 2737
263 Ga0163161_10001593 3300017792 Bacteria 16741
264 Ga0163161_10111328 3300017792 Bacteria 2047
265 Ga0206353_10744464 3300020082 Bacteria 3067
266 Ga0213873_10000052 3300021358 Bacteria 25748
267 Ga0213876_10006606 3300021384 Bacteria 6325
268 Ga0213876_10015198 3300021384 Bacteria 4077
269 Ga0213876_10017728 3300021384 Bacteria 3757
270 Ga0213876_10075210 3300021384 Bacteria 1784
271 Ga0213875_10000073 3300021388 Bacteria 119027
272 Ga0213875_10086117 3300021388 Bacteria 1465
273 Ga0213875_10145422 3300021388 Bacteria 1110
274 Ga0209673_1021887 3300025273 Bacteria 2222
275 Ga0209673_1044854 3300025273 Bacteria 1221
276 Ga0209051_1000075 3300025303 Bacteria 205011
277 Ga0209051_1000448 3300025303 Bacteria 54644
278 Ga0209051_1002630 3300025303 Bacteria 12609
279 Ga0209051_1009355 3300025303 Bacteria 5062
280 Ga0207653_10030501 3300025885 Bacteria 1740
281 Ga0207682_10015450 3300025893 Bacteria 2972
282 Ga0207692_10002256 3300025898 Bacteria 7387
283 Ga0207692_10019524 3300025898 Bacteria 3065
284 Ga0207642_10000264 3300025899 Bacteria 15769
285 Ga0207710_10000014 3300025900 Bacteria 408072
286 Ga0207710_10000721 3300025900 Bacteria 18358
287 Ga0207710_10044460 3300025900 Bacteria 1978
288 Ga0207688_10000335 3300025901 Bacteria 21839
289 Ga0207688_10002023 3300025901 Bacteria 10880
290 Ga0207688_10070823 3300025901 Bacteria 1978
291 Ga0207647_10058151 3300025904 Bacteria 2368
292 Ga0207685_10081337 3300025905 Bacteria 1341
293 Ga0207645_10036766 3300025907 Bacteria 3145
294 Ga0207645_10161229 3300025907 Bacteria 1467
295 Ga0207645_10469005 3300025907 Bacteria 851
296 Ga0207695_10288454 3300025913 Bacteria 1534
297 Ga0207695_10484227 3300025913 Bacteria 1119
298 Ga0207671_10013939 3300025914 Bacteria 6380
299 Ga0207671_10034188 3300025914 Bacteria 3778
300 Ga0207693_10000049 3300025915 Bacteria 100347
301 Ga0207693_10000258 3300025915 Bacteria 48916
302 Ga0207663_10000314 3300025916 Bacteria 21124
303 Ga0207663_10549649 3300025916 Bacteria 902
304 Ga0207660_10494423 3300025917 Bacteria 992
305 Ga0207657_10033008 3300025919 Bacteria 4670
306 Ga0207657_10155359 3300025919 Bacteria 1861
307 Ga0207649_10431184 3300025920 Bacteria 992
308 Ga0207652_10215678 3300025921 Bacteria 1729
309 Ga0207646_10085464 3300025922 Bacteria 2822
310 Ga0207681_10003263 3300025923 Bacteria 10159
311 Ga0207681_10009825 3300025923 Bacteria 5851
312 Ga0207694_10203101 3300025924 Bacteria 1613
313 Ga0207687_10000153 3300025927 Bacteria 46342
314 Ga0207687_10019107 3300025927 Bacteria 4536
315 Ga0207687_10027888 3300025927 Bacteria 3791
316 Ga0207687_10264634 3300025927 Bacteria 1372
317 Ga0207687_10356026 3300025927 Bacteria 1194
318 Ga0207700_10189724 3300025928 Bacteria 1727
319 Ga0207700_10506138 3300025928 Bacteria 1069
320 Ga0207700_10757072 3300025928 Bacteria 868
321 Ga0207700_10916487 3300025928 Bacteria 784
322 Ga0207664_10002749 3300025929 Bacteria 11679
323 Ga0207664_10019234 3300025929 Bacteria 5044
324 Ga0207664_10029135 3300025929 Bacteria 4203
325 Ga0207644_10000326 3300025931 Bacteria 30930
326 Ga0207644_10005846 3300025931 Bacteria 8016
327 Ga0207690_10079943 3300025932 Bacteria 2280
328 Ga0207690_10199324 3300025932 Bacteria 1519
329 Ga0207690_10283766 3300025932 Bacteria 1290
330 Ga0207706_10010210 3300025933 Bacteria 8588
331 Ga0207686_10000624 3300025934 Bacteria 22005
332 Ga0207686_10024748 3300025934 Bacteria 3483
333 Ga0207709_10004736 3300025935 Bacteria 7811
334 Ga0207709_10010027 3300025935 Bacteria 5220
335 Ga0207709_10293488 3300025935 Bacteria 1206
336 Ga0207670_10092663 3300025936 Bacteria 2139
337 Ga0207670_10433655 3300025936 Bacteria 1057
338 Ga0207669_10000277 3300025937 Bacteria 23524
339 Ga0207669_10570369 3300025937 Bacteria 916
340 Ga0207704_10000115 3300025938 Bacteria 44598
341 Ga0207665_10003528 3300025939 Bacteria 10446
342 Ga0207665_10011384 3300025939 Bacteria 5842
343 Ga0207691_10293704 3300025940 Bacteria 1397
344 Ga0207711_10000373 3300025941 Bacteria 47596
345 Ga0207711_10002761 3300025941 Bacteria 15466
346 Ga0207689_10049054 3300025942 Bacteria 3484
347 Ga0207689_10239736 3300025942 Bacteria 1499
348 Ga0207661_10041993 3300025944 Bacteria 3604
349 Ga0207661_10244336 3300025944 Bacteria 1594
350 Ga0207667_10176496 3300025949 Bacteria 2195
351 Ga0207651_10038678 3300025960 Bacteria 3138
352 Ga0207712_10000020 3300025961 Bacteria 292796
353 Ga0207712_10005489 3300025961 Bacteria 7999
354 Ga0207712_10017769 3300025961 Bacteria 4624
355 Ga0207668_10007226 3300025972 Bacteria 6594
356 Ga0207668_10018400 3300025972 Bacteria 4395
357 Ga0207668_10106013 3300025972 Bacteria 2099
358 Ga0207668_10115661 3300025972 Bacteria 2021
359 Ga0207640_10037694 3300025981 Bacteria 3044
360 Ga0207640_10056847 3300025981 Bacteria 2571
361 Ga0207658_10000573 3300025986 Bacteria 33277
362 Ga0207658_10004216 3300025986 Bacteria 10014
363 Ga0207658_10165273 3300025986 Bacteria 1817
364 Ga0207658_10201582 3300025986 Bacteria 1661
365 Ga0207658_10254972 3300025986 Bacteria 1492
366 Ga0207677_10003884 3300026023 Bacteria 7954
367 Ga0207677_10337820 3300026023 Bacteria 1257
368 Ga0207703_10000001 3300026035 Bacteria 822925
369 Ga0207703_10031288 3300026035 Bacteria 4206
370 Ga0207703_10138530 3300026035 Bacteria 2109
371 Ga0207703_10258490 3300026035 Bacteria 1573
372 Ga0207703_10603536 3300026035 Bacteria 1038
373 Ga0207639_10021972 3300026041 Bacteria 4591
374 Ga0207639_10214938 3300026041 Bacteria 1657
375 Ga0207639_10879006 3300026041 Bacteria 837
376 Ga0207678_10000511 3300026067 Bacteria 35188
377 Ga0207678_10025446 3300026067 Bacteria 5165
378 Ga0207678_10091782 3300026067 Bacteria 2596
379 Ga0207678_10107629 3300026067 Bacteria 2378
380 Ga0207678_10188382 3300026067 Bacteria 1763
381 Ga0207678_10273717 3300026067 Bacteria 1448
382 Ga0207678_10524397 3300026067 Bacteria 1034
383 Ga0207708_10003058 3300026075 Bacteria 12327
384 Ga0207708_10419609 3300026075 Bacteria 1109
385 Ga0207641_10000156 3300026088 Bacteria 97171
386 Ga0207641_10005483 3300026088 Bacteria 10821
387 Ga0207641_10089971 3300026088 Bacteria 2683
388 Ga0207641_10461165 3300026088 Bacteria 1229
389 Ga0207648_10001288 3300026089 Bacteria 27969
390 Ga0207648_10004514 3300026089 Bacteria 14272
391 Ga0207676_10115741 3300026095 Bacteria 2252
392 Ga0207676_10192849 3300026095 Bacteria 1794
393 Ga0207676_11043320 3300026095 Bacteria 807
394 Ga0207674_10399885 3300026116 Bacteria 1328
395 Ga0207675_100000220 3300026118 Bacteria 53425
396 Ga0207675_100048224 3300026118 Bacteria 3976
397 Ga0207675_100087933 3300026118 Bacteria 2919
398 Ga0207675_100584398 3300026118 Bacteria 1119
399 Ga0207683_10000184 3300026121 Bacteria 53332
400 Ga0207683_10087921 3300026121 Bacteria 2764
401 Ga0207683_10094962 3300026121 Bacteria 2658
402 Ga0207698_10538334 3300026142 Bacteria 1142
403 Ga0209813_10041598 3300027866 Bacteria 1401
404 Ga0207428_10156746 3300027907 Bacteria 1731
405 Ga0268266_10001619 3300028379 Bacteria 26252
406 Ga0268266_10005268 3300028379 Bacteria 12145
407 Ga0268266_10038405 3300028379 Bacteria 4076
408 Ga0268266_10059265 3300028379 Bacteria 3298
409 Ga0268266_10232488 3300028379 Bacteria 1698
410 Ga0268266_10492503 3300028379 Bacteria 1170
411 Ga0268266_10731830 3300028379 Bacteria 954
412 Ga0268265_10000004 3300028380 Bacteria 648376
413 Ga0268265_11104616 3300028380 Bacteria 787
414 Ga0268264_10000024 3300028381 Bacteria 470081
415 Ga0268264_10000925 3300028381 Bacteria 30466
416 Ga0268264_10040710 3300028381 Bacteria 3840
417 Ga0307515_10036541 3300028794 Bacteria 7942
418 Ga0307515_10071931 3300028794 Bacteria 4677
419 Ga0307511_10107688 3300030521 Bacteria 1793
420 Ga0307512_10031225 3300030522 Bacteria 4617
421 Ga0307512_10049847 3300030522 Bacteria 3371
422 Ga0265327_10000408 3300031251 Bacteria 79100
423 Ga0265327_10002762 3300031251 Bacteria 17817
424 Ga0265327_10047167 3300031251 Bacteria 2275
425 Ga0265327_10047549 3300031251 Bacteria 2262
426 Ga0316579_10108499 3300031691 Bacteria 1332
427 Ga0316578_10165914 3300031728 Bacteria 1331
428 Ga0307405_10099125 3300031731 Bacteria 1950
429 Ga0307405_10171799 3300031731 Bacteria 1547
430 Ga0307405_10189306 3300031731 Bacteria 1485
431 Ga0307405_10356381 3300031731 Bacteria 1130
432 Ga0307405_10549989 3300031731 Bacteria 934
433 Ga0307413_10001347 3300031824 Bacteria 9195
434 Ga0307413_10513638 3300031824 Bacteria 965
435 Ga0307518_10002521 3300031838 Bacteria 13370
436 Ga0307410_10054188 3300031852 Bacteria 2718
437 Ga0307410_10086914 3300031852 Bacteria 2210
438 Ga0307410_10190445 3300031852 Bacteria 1559
439 Ga0307410_10778350 3300031852 Bacteria 812
440 Ga0307406_10209805 3300031901 Bacteria 1440
441 Ga0307406_10657555 3300031901 Bacteria 870
442 Ga0307412_10522565 3300031911 Bacteria 992
443 Ga0307409_100518395 3300031995 Bacteria 1164
444 Ga0307416_100600064 3300032002 Bacteria 1181
445 Ga0307415_100030468 3300032126 Bacteria 3464
446 Ga0307507_10104243 3300033179 Bacteria 2354
447 Ga0307510_10022713 3300033180 Bacteria 7278
448 Ga0373929_0018691 3300035085 Bacteria 1380
449 Ga0373949_0058147 3300035090 Bacteria 989
450 Ga0373952_0051827 3300035092 Bacteria 981
451 Ga0373932_0105633 3300035112 Bacteria 922
452 Ga0373942_0097815 3300035207 Bacteria 893
453 Ga0373935_0052563 3300035692 Bacteria 2590
454 Ga0373927_0059608 3300035695 Bacteria 2469
455 Ga0373927_0413729 3300035695 Bacteria 890
456 Ga0316584_0054882 3300036712 Bacteria 2983
457 Ga0436364_0225372 3300037853 Bacteria 2916
458 Ga0436364_0755754 3300037853 Bacteria 3146
459 Ga0436364_1296457 3300037853 Bacteria 11314
460 Ga0436365_0201441 3300039437 Bacteria 25491
461 Ga0436365_0585474 3300039437 Bacteria 22245
462 Ga0436365_1307586 3300039437 Bacteria 971
463 Ga0436365_1920746 3300039437 Bacteria 19751
464 Ga0436361_0978287 3300039447 Bacteria 1213
465 Ga0436363_1156841 3300039450 Bacteria 1847
466 Ga0436363_1714028 3300039450 Bacteria 5323
467 Ga0439461_0002218 3300041410 Bacteria 3084
468 Ga0439461_0009967 3300041410 Bacteria 1734
469 Ga0439466_0001603 3300041411 Bacteria 8829
470 Ga0439466_0042342 3300041411 Bacteria 1516
471 Ga0439466_0069642 3300041411 Bacteria 1122
472 Ga0439465_0001837 3300041413 Bacteria 6947
473 Ga0439465_0003484 3300041413 Bacteria 5133
474 Ga0439465_0005400 3300041413 Bacteria 4077
475 Ga0439465_0029375 3300041413 Bacteria 1746
476 Ga0451797_1047338 3300041453 Bacteria 1115
477 Ga0451795_0769305 3300041456 Bacteria 1242
478 Ga0451853_0599558 3300041512 Bacteria 1086
479 Ga0439442_002097 3300042002 Bacteria 3916
480 Ga0439445_0001633 3300042004 Bacteria 4903
481 Ga0439448_0023867 3300042005 Bacteria 1910
482 Ga0439448_0060793 3300042005 Bacteria 1249
483 Ga0439434_0036660 3300042435 Bacteria 1500
484 Ga0439459_0023874 3300042438 Bacteria 1195
485 Ga0466969_0038497 3300044656 Bacteria 2406
486 Ga0466969_0054733 3300044656 Bacteria 1954
487 Ga0466969_0078646 3300044656 Bacteria 1577
488 Ga0466969_0119862 3300044656 Bacteria 1226
489 Ga0466972_0001186 3300044658 Bacteria 12519
490 Ga0466972_0004495 3300044658 Bacteria 6979
491 Ga0466972_0014460 3300044658 Bacteria 3952
492 Ga0466965_0001067 3300044683 Bacteria 10644
493 Ga0466965_0007511 3300044683 Bacteria 5009
494 Ga0466965_0029509 3300044683 Bacteria 2669
495 Ga0466965_0053638 3300044683 Bacteria 2004
496 Ga0466965_0249729 3300044683 Bacteria 951
497 Ga0466965_0452939 3300044683 Bacteria 715
498 Ga0466966_0010547 3300044684 Bacteria 6141
499 Ga0466966_0037675 3300044684 Bacteria 3117
500 Ga0466966_0315301 3300044684 Bacteria 940
501 Ga0466961_0003735 3300044693 Bacteria 9512
502 Ga0466961_0013068 3300044693 Bacteria 5312
503 Ga0466961_0018566 3300044693 Bacteria 4476
504 Ga0466961_0051284 3300044693 Bacteria 2636
505 Ga0466963_0008470 3300044694 Bacteria 6163
506 Ga0466963_0022414 3300044694 Bacteria 4000
507 Ga0466963_0041493 3300044694 Bacteria 3019
508 Ga0466963_0054645 3300044694 Bacteria 2655
509 Ga0466963_0067096 3300044694 Bacteria 2407
510 Ga0466963_0315608 3300044694 Bacteria 1100
511 Ga0466963_0441929 3300044694 Bacteria 918
512 Ga0466963_0469026 3300044694 Bacteria 888
513 Ga0466971_0017842 3300044719 Bacteria 3144
514 Ga0466971_0106608 3300044719 Bacteria 1291
515 Ga0466968_0001388 3300044735 Bacteria 8653
516 Ga0466968_0005428 3300044735 Bacteria 4772
517 Ga0466968_0075741 3300044735 Bacteria 1471
518 Ga0466968_0169814 3300044735 Bacteria 1010
519 Ga0466968_0222426 3300044735 Bacteria 889
520 Ga0466970_0016086 3300044765 Bacteria 3853
521 Ga0466970_0044015 3300044765 Bacteria 2377
522 Ga0466970_0165190 3300044765 Bacteria 1225
523 Ga0466957_0002569 3300044842 Bacteria 9770
524 Ga0466957_0080532 3300044842 Bacteria 2027
525 Ga0466957_0166457 3300044842 Bacteria 1434
526 Ga0466957_0179267 3300044842 Bacteria 1383
527 Ga0466957_0257020 3300044842 Bacteria 1163
528 Ga0466957_0403629 3300044842 Bacteria 935
529 Ga0466960_0000108 3300044901 Bacteria 27686
530 Ga0466960_0020121 3300044901 Bacteria 2952
531 Ga0466960_0041695 3300044901 Bacteria 2175
532 Ga0466960_0391397 3300044901 Bacteria 799
533 Ga0466959_0001743 3300045049 Bacteria 13537
534 Ga0466959_0021813 3300045049 Bacteria 4727
535 Ga0466959_0068186 3300045049 Bacteria 2578
536 Ga0466959_0097330 3300045049 Bacteria 2109
537 Ga0466958_0000249 3300045836 Bacteria 20765
538 Ga0466958_0015421 3300045836 Bacteria 4380
539 Ga0466958_0032807 3300045836 Bacteria 3091
540 Ga0466958_0062578 3300045836 Bacteria 2269
541 Ga0466958_0125469 3300045836 Bacteria 1609
542 Ga0466958_0139279 3300045836 Bacteria 1527
543 Ga0466967_0004216 3300045976 Bacteria 9641
544 Ga0466967_0017156 3300045976 Bacteria 5737
545 Ga0466967_0025921 3300045976 Bacteria 4844
546 Ga0466967_0033247 3300045976 Bacteria 4363
547 Ga0466967_0034434 3300045976 Bacteria 4299
548 Ga0466967_0068031 3300045976 Bacteria 3179
549 Ga0466967_0068924 3300045976 Bacteria 3160
550 Ga0466967_0112879 3300045976 Bacteria 2499
551 Ga0466967_0225616 3300045976 Bacteria 1782
552 Ga0466967_0283884 3300045976 Bacteria 1589
553 Ga0466967_0607720 3300045976 Bacteria 1080
554 Ga0466967_0752309 3300045976 Bacteria 967
555 Ga0466967_1001020 3300045976 Bacteria 832
556 Ga0495603_0014689 3300046455 Bacteria 4734
557 Ga0495629_0048770 3300046459 Bacteria 2969
558 Ga0495638_0001617 3300046460 Bacteria 20096
559 Ga0495638_0017392 3300046460 Bacteria 4795
560 Ga0495641_0020272 3300046461 Bacteria 3376
561 Ga0495580_0514200 3300046472 Bacteria 798
562 Ga0495639_0050203 3300046475 Bacteria 1894
563 Ga0495594_0060339 3300046499 Bacteria 2098
564 Ga0495606_0053870 3300046507 Bacteria 2608
565 Ga0495620_0136916 3300046515 Bacteria 959
566 Ga0495648_0002598 3300046524 Bacteria 16514
567 Ga0495665_0024144 3300046531 Bacteria 3266
568 Ga0495640_0093888 3300046533 Bacteria 1977
569 Ga0495668_0037545 3300046616 Bacteria 2710
570 Ga0495634_0188608 3300046642 Bacteria 1287
571 Ga0495658_0007185 3300046683 Bacteria 5500
572 Ga0495613_0577951 3300046689 Bacteria 749
573 Ga0495624_0026430 3300046690 Bacteria 3804
574 Ga0495649_0098020 3300046694 Bacteria 1559
575 Ga0495581_0007818 3300047315 Bacteria 6192
576 Ga0495604_0153294 3300047317 Bacteria 1635
577 Ga0495604_0516147 3300047317 Bacteria 774
578 Ga0495672_0015022 3300047320 Bacteria 5273
579 Ga0495672_0084143 3300047320 Bacteria 1765
580 Ga0495672_0087759 3300047320 Bacteria 1717
581 Ga0495672_0131013 3300047320 Bacteria 1319
582 Ga0495672_0136274 3300047320 Bacteria 1287
583 Ga0495676_0034773 3300047321 Bacteria 4224
584 Ga0495680_0175478 3300047322 Bacteria 1550
585 Ga0495673_0000355 3300047469 Bacteria 57060
586 Ga0495686_0021284 3300047472 Bacteria 4309
587 Ga0495686_0144366 3300047472 Bacteria 1402
588 Ga0495593_0013302 3300047673 Bacteria 4697
589 Ga0496100_0000009 3300048903 Bacteria 225785
590 Ga0496100_0003439 3300048903 Bacteria 8257
591 Ga0496100_0021910 3300048903 Bacteria 3857
592 Ga0496100_0104331 3300048903 Bacteria 1958
593 Ga0496100_0221613 3300048903 Bacteria 1388
594 Ga0496101_0000018 3300048904 Bacteria 236102
595 Ga0496101_0000114 3300048904 Bacteria 79796
596 Ga0496101_0002057 3300048904 Bacteria 12242
597 Ga0496101_0003076 3300048904 Bacteria 10312
598 Ga0496101_0004515 3300048904 Bacteria 8781
599 Ga0496101_0076723 3300048904 Bacteria 2462
600 Ga0496101_0297761 3300048904 Bacteria 1263
601 Ga0496102_0000014 3300048905 Bacteria 310241
602 Ga0496102_0000820 3300048905 Bacteria 30171
603 Ga0496102_0003481 3300048905 Bacteria 13347
604 Ga0496102_0003652 3300048905 Bacteria 13015
605 Ga0496102_0076420 3300048905 Bacteria 3080
606 Ga0496102_0142346 3300048905 Bacteria 2249
607 Ga0496102_0237016 3300048905 Bacteria 1720
608 Ga0496102_0268001 3300048905 Bacteria 1610
609 Ga0496102_0339862 3300048905 Bacteria 1414
610 Ga0496102_0382583 3300048905 Bacteria 1324
611 Ga0496102_0420470 3300048905 Bacteria 1255
612 Ga0496103_0000004 3300048906 Bacteria 510080
613 Ga0496103_0000473 3300048906 Bacteria 33859
614 Ga0496103_0000662 3300048906 Bacteria 25938
615 Ga0496103_0001547 3300048906 Bacteria 15288
616 Ga0496103_0038046 3300048906 Bacteria 2950
617 Ga0496103_0042581 3300048906 Bacteria 2795
618 Ga0496103_0307240 3300048906 Bacteria 1020
619 Ga0496104_0000285 3300048907 Bacteria 44731
620 Ga0496104_0008789 3300048907 Bacteria 8979
621 Ga0496104_0203954 3300048907 Bacteria 1889
622 Ga0496104_0280541 3300048907 Bacteria 1579
623 Ga0496105_0040584 3300048908 Bacteria 3837
624 Ga0496105_0199445 3300048908 Bacteria 1634
625 Ga0496105_0219740 3300048908 Bacteria 1547
626 Ga0496106_0003083 3300048909 Bacteria 12434
627 Ga0496106_0005366 3300048909 Bacteria 9485
628 Ga0496106_0026975 3300048909 Bacteria 4277
629 Ga0496106_0027196 3300048909 Bacteria 4260
630 Ga0496106_0071625 3300048909 Bacteria 2650
631 Ga0496107_0000152 3300048910 Bacteria 35028
632 Ga0496107_0000303 3300048910 Bacteria 26324
633 Ga0496107_0000364 3300048910 Bacteria 24565
634 Ga0496108_0000520 3300048911 Bacteria 30186
635 Ga0496108_0005587 3300048911 Bacteria 10174
636 Ga0496108_0022252 3300048911 Bacteria 5213
637 Ga0496108_0048364 3300048911 Bacteria 3556
638 Ga0496108_0848020 3300048911 Bacteria 786
639 Ga0496109_0000214 3300048912 Bacteria 56898
640 Ga0496109_0002624 3300048912 Bacteria 15074
641 Ga0496109_0017274 3300048912 Bacteria 6320
642 Ga0496109_0051609 3300048912 Bacteria 3746
643 Ga0496109_0222005 3300048912 Bacteria 1777
644 Ga0496109_0297274 3300048912 Bacteria 1522
645 Ga0496109_0490464 3300048912 Bacteria 1160
646 Ga0496109_0623128 3300048912 Bacteria 1015
647 Ga0496110_0015406 3300048913 Bacteria 6361
648 Ga0496110_0024790 3300048913 Bacteria 5117
649 Ga0496110_0030141 3300048913 Bacteria 4675
650 Ga0496110_0096592 3300048913 Bacteria 2648
651 Ga0496110_0831443 3300048913 Bacteria 828
652 Ga0496111_0005039 3300048914 Bacteria 8403
653 Ga0496111_0028064 3300048914 Bacteria 3987
654 Ga0496111_0492783 3300048914 Bacteria 902
655 Ga0496112_0001718 3300048915 Bacteria 17115
656 Ga0496112_0034180 3300048915 Bacteria 4947
657 Ga0496112_0059613 3300048915 Bacteria 3761
658 Ga0496112_0064234 3300048915 Bacteria 3622
659 Ga0496112_0114959 3300048915 Bacteria 2661
660 Ga0496112_0287583 3300048915 Bacteria 1590
661 Ga0496113_0047080 3300048916 Bacteria 3204
662 Ga0496113_0049429 3300048916 Bacteria 3131
663 Ga0496113_0137406 3300048916 Bacteria 1921
664 Ga0496114_0000108 3300048917 Bacteria 59737
665 Ga0496114_0000136 3300048917 Bacteria 53108
666 Ga0496114_0000166 3300048917 Bacteria 47004
667 Ga0496114_0080888 3300048917 Bacteria 2744
668 Ga0496114_0116485 3300048917 Bacteria 2294
669 Ga0496114_0127030 3300048917 Bacteria 2199
670 Ga0496114_0161578 3300048917 Bacteria 1948
671 Ga0496114_0400059 3300048917 Bacteria 1216
672 Ga0496115_0000620 3300048918 Bacteria 26937
673 Ga0496115_0002574 3300048918 Bacteria 13020
674 Ga0496115_0303140 3300048918 Bacteria 1309
675 Ga0496115_0406384 3300048918 Bacteria 1104
676 Ga0496116_0000428 3300048919 Bacteria 59070
677 Ga0496116_0010448 3300048919 Bacteria 7775
678 Ga0496116_0064942 3300048919 Bacteria 2343
679 Ga0496117_0000003 3300048920 Bacteria 1881097
680 Ga0496118_0000001 3300048921 Bacteria 1881100
681 Ga0496118_0000292 3300048921 Bacteria 87325
682 Ga0496118_0004368 3300048921 Bacteria 16812
683 Ga0496119_0001080 3300048922 Bacteria 34426
684 Ga0496119_0001862 3300048922 Bacteria 24358
685 Ga0496119_0028396 3300048922 Bacteria 3817
686 Ga0496120_0001263 3300048923 Bacteria 31791
687 Ga0496120_0003934 3300048923 Bacteria 12949
688 Ga0496120_0031778 3300048923 Bacteria 3192
689 Ga0496121_0000023 3300048924 Bacteria 463448
690 Ga0496121_0000032 3300048924 Bacteria 378997
691 Ga0496121_0004517 3300048924 Bacteria 18633
692 Ga0496122_0000164 3300048925 Bacteria 158055
693 Ga0496123_0006609 3300048926 Bacteria 11199
694 Ga0496123_0012134 3300048926 Bacteria 7380
695 Ga0496124_0000014 3300048927 Bacteria 463448
696 Ga0496124_0109899 3300048927 Bacteria 2220
697 Ga0496125_0000020 3300048928 Bacteria 463448
698 Ga0496125_0071017 3300048928 Bacteria 2722
699 Ga0496125_0119758 3300048928 Bacteria 1881
700 Ga0496126_0000023 3300048929 Bacteria 463448
701 Ga0496126_0000067 3300048929 Bacteria 249091
702 Ga0496126_0001990 3300048929 Bacteria 28976
703 Ga0496126_0002459 3300048929 Bacteria 24976
704 Ga0496126_0006797 3300048929 Bacteria 12687
705 Ga0496126_0071181 3300048929 Bacteria 3096
706 Ga0496126_0670904 3300048929 Bacteria 809
707 Ga0501032_0015981 3300049569 Bacteria 5283
708 Ga0501032_0264703 3300049569 Bacteria 1114
709 Ga0501033_0006709 3300049570 Bacteria 8992
710 Ga0501033_0039642 3300049570 Bacteria 3519
711 Ga0501034_0006051 3300049571 Bacteria 13067
712 Ga0501034_0011109 3300049571 Bacteria 9348
713 Ga0501034_0074634 3300049571 Bacteria 3399
714 Ga0501036_0016634 3300049572 Bacteria 6141
715 Ga0501036_0044342 3300049572 Bacteria 3767
716 Ga0501037_0000584 3300049573 Bacteria 28691
717 Ga0501037_0003783 3300049573 Bacteria 10981
718 Ga0501038_0003008 3300049574 Bacteria 15716
719 Ga0501039_0002202 3300049575 Bacteria 14422
720 Ga0501043_0001037 3300049579 Bacteria 24401
721 Ga0501043_0077857 3300049579 Bacteria 2605
722 Ga0501046_0001804 3300049580 Bacteria 20417
723 Ga0501047_0000372 3300049581 Bacteria 50660
724 Ga0501047_0433643 3300049581 Bacteria 1145
725 Ga0501048_0031651 3300049582 Bacteria 3826
726 Ga0501069_0036857 3300049585 Bacteria 2698
727 Ga0501069_0235466 3300049585 Bacteria 1066
728 Ga0501070_0000578 3300049586 Bacteria 33378
729 Ga0501070_0002976 3300049586 Bacteria 14755
730 Ga0501070_0039346 3300049586 Bacteria 3945
731 Ga0501070_0098697 3300049586 Bacteria 2416
732 Ga0501073_0024898 3300049589 Bacteria 4295
733 Ga0501073_0032431 3300049589 Bacteria 3724
734 Ga0501080_0042237 3300049742 Bacteria 4247
735 Ga0501080_0753878 3300049742 Bacteria 856
736 Ga0501035_0001032 3300049822 Bacteria 29280
737 Ga0501035_0436679 3300049822 Bacteria 1085
738 Ga0501044_0006896 3300049823 Bacteria 12507
739 Ga0501044_0008550 3300049823 Bacteria 11218
740 Ga0501044_0014604 3300049823 Bacteria 8469
741 Ga0501045_0264326 3300049824 Bacteria 1281
742 nmdc:mga03683_213621_c1 3300050489 Bacteria 888
743 nmdc:mga03683_32675_c1 3300050489 Bacteria 2095
744 nmdc:mga03n38_138016_c1 3300050490 Bacteria 1215
745 nmdc:mga03n38_25694_c1 3300050490 Bacteria 2423
746 nmdc:mga03n38_3325_c1 3300050490 Bacteria 5147
747 nmdc:mga03n38_40989_c1 3300050490 Bacteria 2015
748 nmdc:mga03n38_61400_c1 3300050490 Bacteria 1712
749 nmdc:mga00v17_147632_c1 3300050491 Bacteria 1510
750 nmdc:mga00v17_1649_c1 3300050491 Bacteria 11309
751 nmdc:mga00v17_227478_c1 3300050491 Bacteria 1208
752 nmdc:mga00v17_4701_c1 3300050491 Bacteria 7132
753 nmdc:mga00v17_50762_c1 3300050491 Bacteria 2522
754 nmdc:mga00v17_98783_c1 3300050491 Bacteria 1207
755 nmdc:mga0yw44_15444_c1 3300050492 Bacteria 4091
756 nmdc:mga0yw44_204468_c1 3300050492 Bacteria 1305
757 nmdc:mga0yw44_27434_c1 3300050492 Bacteria 1823
758 nmdc:mga0yw44_2876_c1 3300050492 Bacteria 7479
759 nmdc:mga0yw44_6915_c1 3300050492 Bacteria 5528
760 nmdc:mga06z11_112694_c1 3300050494 Bacteria 1508
761 nmdc:mga06z11_226856_c1 3300050494 Bacteria 1093
762 nmdc:mga06z11_5162_c1 3300050494 Bacteria 5212
763 nmdc:mga04h51_49795_c1 3300050495 Bacteria 1401
764 nmdc:mga07m45_11903_c1 3300050496 Bacteria 4583
765 nmdc:mga07m45_149346_c1 3300050496 Bacteria 1355
766 nmdc:mga07m45_17140_c1 3300050496 Bacteria 3885
767 nmdc:mga07m45_42124_c1 3300050496 Bacteria 2559
768 nmdc:mga07m45_54510_c1 3300050496 Bacteria 1577
769 nmdc:mga05p37_26882_c1 3300050507 Bacteria 7001
770 nmdc:mga09592_331376_c1 3300050508 Bacteria 1318
771 nmdc:mga0qj67_520316_c1 3300050509 Bacteria 956
772 nmdc:mga06r32_66396_c1 3300050510 Bacteria 3481
773 nmdc:mga08y16_187794_c1 3300050511 Bacteria 2144
774 nmdc:mga08y16_543028_c1 3300050511 Bacteria 1177
775 nmdc:mga0sz30_164225_c1 3300050516 Bacteria 984
776 nmdc:mga0sz30_18492_c1 3300050516 Bacteria 2357
777 nmdc:mga0sz30_199038_c1 3300050516 Bacteria 889
778 nmdc:mga0sz30_3091_c1 3300050516 Bacteria 5964
779 nmdc:mga0sz30_41704_c1 3300050516 Bacteria 1930
780 nmdc:mga0sz30_56390_c1 3300050516 Bacteria 1673
781 nmdc:mga0sz30_68233_c1 3300050516 Bacteria 1527
782 nmdc:mga0sz30_8902_c1 3300050516 Bacteria 3805
783 Ga0500610_0026618 3300053079 Bacteria 2896
784 Ga0500635_0000695 3300053080 Bacteria 8518
785 Ga0500643_011430 3300053087 Bacteria 3240
786 Ga0500643_017752 3300053087 Bacteria 2376
787 Ga0500650_0207813 3300053098 Bacteria 890
788 Ga0500556_0005325 3300053104 Bacteria 3637
789 Ga0500642_0039883 3300053130 Bacteria 2022
790 Ga0500652_000535 3300053131 Bacteria 13353
791 Ga0500577_0008155 3300053142 Bacteria 2971
792 Ga0500616_0007708 3300053153 Bacteria 6796
793 Ga0500616_0092688 3300053153 Bacteria 1493
794 Ga0500616_0206215 3300053153 Bacteria 867
795 Ga0500645_000075 3300053730 Bacteria 78736
796 Ga0500645_018737 3300053730 Bacteria 2158
797 Ga0466962_0028329 3300061719 Bacteria 2684
798 Ga0466962_0241866 3300061719 Bacteria 886

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_101317228 Ga0068868_1013172281 181
2 3300005468 Ga0070707_100007178 Ga0070707_1000071789 188
3 3300025922 Ga0207646_10085464 Ga0207646_100854643 188
4 3300005445 Ga0070708_100291628 Ga0070708_1002916282 196
5 3300005518 Ga0070699_100164102 Ga0070699_1001641022 196
6 3300044694 Ga0466963_0008470 Ga0466963_0008470_4303_5028 198
7 3300048907 Ga0496104_0203954 Ga0496104_0203954_619_1332 198
8 3300048911 Ga0496108_0022252 Ga0496108_0022252_1420_2133 198
9 3300048913 Ga0496110_0030141 Ga0496110_0030141_3236_3949 198
10 3300048907 Ga0496104_0280541 Ga0496104_0280541_77_790 200
11 3300048917 Ga0496114_0116485 Ga0496114_0116485_26_739 200
12 3300046515 Ga0495620_0136916 Ga0495620_0136916_328_942 204
13 3300047320 Ga0495672_0084143 Ga0495672_0084143_94_708 204
14 3300048911 Ga0496108_0848020 Ga0496108_0848020_19_633 204
15 3300048914 Ga0496111_0492783 Ga0496111_0492783_16_630 204
16 3300005467 Ga0070706_100010948 Ga0070706_1000109485 207
17 3300005536 Ga0070697_100548269 Ga0070697_1005482692 207
18 3300009098 Ga0105245_10033743 Ga0105245_100337432 207
19 3300025927 Ga0207687_10019107 Ga0207687_100191072 207
20 3300044694 Ga0466963_0067096 Ga0466963_0067096_366_989 207
21 3300045049 Ga0466959_0068186 Ga0466959_0068186_342_1025 209
22 3300061719 Ga0466962_0241866 Ga0466962_0241866_153_836 209
23 3300013102 Ga0157371_10195262 Ga0157371_101952622 212
24 3300014325 Ga0163163_10631623 Ga0163163_106316231 212
25 3300044656 Ga0466969_0119862 Ga0466969_0119862_282_989 214
26 3300044693 Ga0466961_0003735 Ga0466961_0003735_6656_7363 214
27 3300053153 Ga0500616_0206215 Ga0500616_0206215_20_685 214
28 iso_pu_bacteria 2558860280 2559429534 214
29 iso_pu_bacteria 2582580736 2583150348 214
30 iso_pu_bacteria 2791354901 2791910618 216
31 iso_pu_bacteria 2795385470 2795783599 216
32 iso_pu_bacteria 2795385472 2795794489 216
33 iso_pu_bacteria 2956939328 2956939378 216
34 iso_pu_bacteria 3001119090 3001122171 216
35 3300005355 Ga0070671_100000475 Ga0070671_10000047520 217
36 3300005548 Ga0070665_100005202 Ga0070665_10000520214 217
37 3300005841 Ga0068863_100028488 Ga0068863_1000284882 217
38 3300025931 Ga0207644_10000326 Ga0207644_1000032620 217
39 3300025972 Ga0207668_10115661 Ga0207668_101156612 217
40 3300026088 Ga0207641_10089971 Ga0207641_100899712 217
41 3300028379 Ga0268266_10038405 Ga0268266_100384052 217
42 3300031731 Ga0307405_10189306 Ga0307405_101893063 217
43 3300005347 Ga0070668_100001456 Ga0070668_1000014564 218
44 3300009094 Ga0111539_10761220 Ga0111539_107612202 218
45 3300031838 Ga0307518_10002521 Ga0307518_100025212 218
46 3300039437 Ga0436365_1307586 Ga0436365_1307586_207_863 218
47 3300046531 Ga0495665_0024144 Ga0495665_0024144_532_1188 218
48 3300021358 Ga0213873_10000052 Ga0213873_1000005216 219
49 3300021388 Ga0213875_10000073 Ga0213875_1000007375 219
50 3300003203 JGI25406J46586_10004772 JGI25406J46586_100047723 220
51 3300005329 Ga0070683_100048295 Ga0070683_1000482955 220
52 3300005337 Ga0070682_100070143 Ga0070682_1000701431 220
53 3300005338 Ga0068868_100574735 Ga0068868_1005747351 220
54 3300005366 Ga0070659_100203915 Ga0070659_1002039151 220
55 3300005455 Ga0070663_100000066 Ga0070663_10000006631 220
56 3300005455 Ga0070663_100217488 Ga0070663_1002174882 220
57 3300005455 Ga0070663_100554816 Ga0070663_1005548161 220
58 3300005535 Ga0070684_100505720 Ga0070684_1005057201 220
59 3300005578 Ga0068854_100674914 Ga0068854_1006749141 220
60 3300005617 Ga0068859_100074723 Ga0068859_1000747232 220
61 3300005617 Ga0068859_100776883 Ga0068859_1007768831 220
62 3300005618 Ga0068864_100265520 Ga0068864_1002655202 220
63 3300005719 Ga0068861_100337227 Ga0068861_1003372272 220
64 3300005834 Ga0068851_10229086 Ga0068851_102290861 220
65 3300005842 Ga0068858_100498310 Ga0068858_1004983102 220
66 3300005843 Ga0068860_100050567 Ga0068860_1000505672 220
67 3300005985 Ga0081539_10001153 Ga0081539_1000115340 220
68 3300006358 Ga0068871_100119613 Ga0068871_1001196132 220
69 3300006880 Ga0075429_100269907 Ga0075429_1002699072 220
70 3300006931 Ga0097620_100074725 Ga0097620_1000747252 220
71 3300006931 Ga0097620_100776732 Ga0097620_1007767321 220
72 3300013307 Ga0157372_10248274 Ga0157372_102482742 220
73 3300017792 Ga0163161_10111328 Ga0163161_101113282 220
74 3300021384 Ga0213876_10015198 Ga0213876_100151983 220
75 3300025900 Ga0207710_10044460 Ga0207710_100444604 220
76 3300025901 Ga0207688_10002023 Ga0207688_1000202311 220
77 3300025907 Ga0207645_10161229 Ga0207645_101612292 220
78 3300025907 Ga0207645_10469005 Ga0207645_104690051 220
79 3300025924 Ga0207694_10203101 Ga0207694_102031012 220
80 3300025927 Ga0207687_10356026 Ga0207687_103560262 220
81 3300025928 Ga0207700_10757072 Ga0207700_107570722 220
82 3300025929 Ga0207664_10002749 Ga0207664_100027495 220
83 3300025929 Ga0207664_10029135 Ga0207664_100291355 220
84 3300025932 Ga0207690_10199324 Ga0207690_101993241 220
85 3300025936 Ga0207670_10092663 Ga0207670_100926632 220
86 3300025942 Ga0207689_10049054 Ga0207689_100490542 220
87 3300025944 Ga0207661_10041993 Ga0207661_100419934 220
88 3300025960 Ga0207651_10038678 Ga0207651_100386783 220
89 3300025986 Ga0207658_10165273 Ga0207658_101652732 220
90 3300026023 Ga0207677_10337820 Ga0207677_103378202 220
91 3300026035 Ga0207703_10258490 Ga0207703_102584902 220
92 3300026067 Ga0207678_10000511 Ga0207678_1000051125 220
93 3300026067 Ga0207678_10025446 Ga0207678_100254461 220
94 3300026067 Ga0207678_10273717 Ga0207678_102737171 220
95 3300026067 Ga0207678_10524397 Ga0207678_105243972 220
96 3300026075 Ga0207708_10419609 Ga0207708_104196092 220
97 3300026088 Ga0207641_10461165 Ga0207641_104611652 220
98 3300026118 Ga0207675_100087933 Ga0207675_1000879332 220
99 3300026118 Ga0207675_100584398 Ga0207675_1005843981 220
100 3300028379 Ga0268266_10059265 Ga0268266_100592652 220
101 3300028381 Ga0268264_10040710 Ga0268264_100407102 220
102 3300028794 Ga0307515_10036541 Ga0307515_100365417 220
103 3300028794 Ga0307515_10071931 Ga0307515_100719311 220
104 3300030521 Ga0307511_10107688 Ga0307511_101076882 220
105 3300030522 Ga0307512_10031225 Ga0307512_100312252 220
106 3300030522 Ga0307512_10049847 Ga0307512_100498474 220
107 3300031731 Ga0307405_10356381 Ga0307405_103563812 220
108 3300031824 Ga0307413_10001347 Ga0307413_100013475 220
109 3300031824 Ga0307413_10513638 Ga0307413_105136381 220
110 3300033179 Ga0307507_10104243 Ga0307507_101042431 220
111 3300033180 Ga0307510_10022713 Ga0307510_100227134 220
112 3300044656 Ga0466969_0054733 Ga0466969_0054733_226_888 220
113 3300044658 Ga0466972_0001186 Ga0466972_0001186_9910_10572 220
114 3300044683 Ga0466965_0249729 Ga0466965_0249729_110_772 220
115 3300044683 Ga0466965_0452939 Ga0466965_0452939_13_675 220
116 3300044735 Ga0466968_0222426 Ga0466968_0222426_59_721 220
117 3300044765 Ga0466970_0044015 Ga0466970_0044015_1142_1804 220
118 3300044901 Ga0466960_0020121 Ga0466960_0020121_1514_2176 220
119 3300045976 Ga0466967_0225616 Ga0466967_0225616_430_1092 220
120 3300048929 Ga0496126_0670904 Ga0496126_0670904_12_674 220
121 3300049580 Ga0501046_0001804 Ga0501046_0001804_14624_15286 220
122 3300050508 nmdc:mga09592_331376_c1 nmdc:mga09592_331376_c1_139_801 220
123 3300053098 Ga0500650_0207813 Ga0500650_0207813_113_775 220
124 3300053142 Ga0500577_0008155 Ga0500577_0008155_1368_2030 220
125 iso_pu_bacteria 2751185734 2753070669 221
126 3300005937 Ga0081455_10000995 Ga0081455_1000099535 223
127 3300048905 Ga0496102_0268001 Ga0496102_0268001_116_802 224
128 3300049586 Ga0501070_0039346 Ga0501070_0039346_2070_2744 224
129 3300049742 Ga0501080_0042237 Ga0501080_0042237_305_979 224
130 3300005455 Ga0070663_100124548 Ga0070663_1001245484 225
131 3300005618 Ga0068864_100723658 Ga0068864_1007236582 225
132 3300005719 Ga0068861_100118728 Ga0068861_1001187284 225
133 3300005840 Ga0068870_10480157 Ga0068870_104801571 225
134 3300005842 Ga0068858_100000002 Ga0068858_100000002233 225
135 3300005842 Ga0068858_100955628 Ga0068858_1009556281 225
136 3300006038 Ga0075365_10019826 Ga0075365_100198266 225
137 3300009092 Ga0105250_10170395 Ga0105250_101703951 225
138 3300009094 Ga0111539_10573693 Ga0111539_105736931 225
139 3300009101 Ga0105247_10050375 Ga0105247_100503753 225
140 3300009148 Ga0105243_10001852 Ga0105243_1000185216 225
141 3300009177 Ga0105248_10000943 Ga0105248_1000094328 225
142 3300009177 Ga0105248_10547064 Ga0105248_105470644 225
143 3300009553 Ga0105249_10260659 Ga0105249_102606592 225
144 3300011119 Ga0105246_10117483 Ga0105246_101174832 225
145 3300013306 Ga0163162_10136421 Ga0163162_101364212 225
146 3300014325 Ga0163163_10012382 Ga0163163_100123826 225
147 3300014325 Ga0163163_10079654 Ga0163163_100796544 225
148 3300014745 Ga0157377_10166689 Ga0157377_101666891 225
149 3300014968 Ga0157379_10000007 Ga0157379_1000000784 225
150 3300014968 Ga0157379_10053821 Ga0157379_100538212 225
151 3300020082 Ga0206353_10744464 Ga0206353_107444644 225
152 3300025901 Ga0207688_10070823 Ga0207688_100708232 225
153 3300025927 Ga0207687_10027888 Ga0207687_100278882 225
154 3300025932 Ga0207690_10079943 Ga0207690_100799433 225
155 3300025941 Ga0207711_10002761 Ga0207711_100027612 225
156 3300025981 Ga0207640_10056847 Ga0207640_100568472 225
157 3300026035 Ga0207703_10000001 Ga0207703_10000001476 225
158 3300026035 Ga0207703_10603536 Ga0207703_106035361 225
159 3300026118 Ga0207675_100048224 Ga0207675_1000482243 225
160 3300026121 Ga0207683_10094962 Ga0207683_100949622 225
161 3300027907 Ga0207428_10156746 Ga0207428_101567463 225
162 3300028379 Ga0268266_10492503 Ga0268266_104925032 225
163 3300044694 Ga0466963_0041493 Ga0466963_0041493_2250_2936 225
164 3300044842 Ga0466957_0179267 Ga0466957_0179267_656_1342 225
165 3300048904 Ga0496101_0076723 Ga0496101_0076723_400_1077 225
166 3300048905 Ga0496102_0420470 Ga0496102_0420470_345_1022 225
167 3300048906 Ga0496103_0307240 Ga0496103_0307240_34_711 225
168 3300048908 Ga0496105_0199445 Ga0496105_0199445_80_757 225
169 3300048909 Ga0496106_0071625 Ga0496106_0071625_1613_2290 225
170 3300048911 Ga0496108_0000520 Ga0496108_0000520_9216_9893 225
171 3300048912 Ga0496109_0002624 Ga0496109_0002624_9768_10445 225
172 3300048913 Ga0496110_0096592 Ga0496110_0096592_1284_1961 225
173 3300048915 Ga0496112_0059613 Ga0496112_0059613_220_897 225
174 3300048916 Ga0496113_0047080 Ga0496113_0047080_2315_2992 225
175 3300050511 nmdc:mga08y16_543028_c1 nmdc:mga08y16_543028_c1_349_1026 225
176 3300031901 Ga0307406_10209805 Ga0307406_102098051 228
177 iso_pu_bacteria 2565956761 2566993123 229
178 iso_pu_bacteria 2643221687 2644486506 229
179 iso_pu_bacteria 2643221715 2644634930 229
180 iso_pu_bacteria 2738541264 2738667508 229
181 iso_pu_bacteria 2738541274 2738706029 229
182 iso_pu_bacteria 2738541308 2738889914 229
183 iso_pu_bacteria 2738541356 2739146578 229
184 iso_pu_bacteria 2738543028 2739333071 229
185 iso_pu_bacteria 2738543034 2739362242 229
186 iso_pu_bacteria 2744054611 2744954294 229
187 iso_pu_bacteria 2842134933 2842138523 229
188 iso_pu_bacteria 2902792274 2902798344 229
189 iso_pu_bacteria 2902799365 2902801788 229
190 iso_pu_bacteria 2902810491 2902817015 229
191 iso_pu_bacteria 2902837492 2902840077 229
192 iso_pu_bacteria 2904535858 2904538883 229
193 iso_pu_bacteria 2922554459 2922556819 229
194 iso_pu_bacteria 2928142448 2928142555 229
195 iso_pu_bacteria 2929212328 2929214760 229
196 iso_pu_bacteria 2939582691 2939586652 229
197 iso_pu_bacteria 2974315732 2974317184 229
198 iso_pu_bacteria 2984523437 2984525390 229
199 iso_pu_bacteria 2738543011 2739239707 230
200 iso_pu_bacteria 2889300758 2889300916 230
201 iso_pu_bacteria 2939743619 2939744430 230
202 iso_pu_bacteria 2904765812 2904770151 231
203 iso_pu_bacteria 2904770941 2904770999 231
204 iso_pu_bacteria 2908811453 2908815042 231
205 iso_pu_bacteria 2919420072 2919424473 231
206 iso_pu_bacteria 2919432681 2919436866 231
207 3300002073 JGI24745J21846_1010674 JGI24745J21846_10106742 233
208 3300002075 JGI24738J21930_10007479 JGI24738J21930_100074793 233
209 3300002075 JGI24738J21930_10008857 JGI24738J21930_100088571 233
210 3300002076 JGI24749J21850_1005080 JGI24749J21850_10050801 233
211 3300002077 JGI24744J21845_10000383 JGI24744J21845_100003836 233
212 3300002244 JGI24742J22300_10000643 JGI24742J22300_100006434 233
213 3300002459 JGI24751J29686_10006298 JGI24751J29686_100062984 233
214 3300003792 Ga0055540_1004388 Ga0055540_10043883 233
215 3300003792 Ga0055540_1009880 Ga0055540_10098803 233
216 3300003792 Ga0055540_1031021 Ga0055540_10310212 233
217 3300005328 Ga0070676_10119906 Ga0070676_101199063 233
218 3300005329 Ga0070683_100834515 Ga0070683_1008345151 233
219 3300005330 Ga0070690_100001859 Ga0070690_1000018594 233
220 3300005330 Ga0070690_100301823 Ga0070690_1003018231 233
221 3300005334 Ga0068869_100058333 Ga0068869_1000583332 233
222 3300005335 Ga0070666_10034987 Ga0070666_100349872 233
223 3300005335 Ga0070666_10639683 Ga0070666_106396831 233
224 3300005337 Ga0070682_100071726 Ga0070682_1000717262 233
225 3300005337 Ga0070682_100135754 Ga0070682_1001357542 233
226 3300005337 Ga0070682_100154163 Ga0070682_1001541633 233
227 3300005338 Ga0068868_100001302 Ga0068868_10000130210 233
228 3300005338 Ga0068868_100100301 Ga0068868_1001003012 233
229 3300005338 Ga0068868_100258935 Ga0068868_1002589352 233
230 3300005339 Ga0070660_100080398 Ga0070660_1000803984 233
231 3300005339 Ga0070660_100360781 Ga0070660_1003607812 233
232 3300005340 Ga0070689_100038951 Ga0070689_1000389512 233
233 3300005340 Ga0070689_100143319 Ga0070689_1001433191 233
234 3300005341 Ga0070691_10000684 Ga0070691_1000068411 233
235 3300005347 Ga0070668_100020142 Ga0070668_1000201424 233
236 3300005347 Ga0070668_100084942 Ga0070668_1000849424 233
237 3300005347 Ga0070668_100203841 Ga0070668_1002038411 233
238 3300005347 Ga0070668_100505409 Ga0070668_1005054092 233
239 3300005355 Ga0070671_100002781 Ga0070671_1000027817 233
240 3300005355 Ga0070671_100159640 Ga0070671_1001596401 233
241 3300005355 Ga0070671_100276527 Ga0070671_1002765272 233
242 3300005355 Ga0070671_100314598 Ga0070671_1003145982 233
243 3300005356 Ga0070674_100001031 Ga0070674_10000103115 233
244 3300005356 Ga0070674_100004224 Ga0070674_1000042246 233
245 3300005356 Ga0070674_100117148 Ga0070674_1001171482 233
246 3300005356 Ga0070674_100729462 Ga0070674_1007294621 233
247 3300005356 Ga0070674_100819082 Ga0070674_1008190821 233
248 3300005364 Ga0070673_100078206 Ga0070673_1000782062 233
249 3300005364 Ga0070673_100425795 Ga0070673_1004257952 233
250 3300005365 Ga0070688_100078052 Ga0070688_1000780523 233
251 3300005365 Ga0070688_100364093 Ga0070688_1003640932 233
252 3300005366 Ga0070659_100141002 Ga0070659_1001410022 233
253 3300005366 Ga0070659_100153312 Ga0070659_1001533122 233
254 3300005367 Ga0070667_100000063 Ga0070667_10000006367 233
255 3300005367 Ga0070667_100000620 Ga0070667_1000006202 233
256 3300005367 Ga0070667_100020470 Ga0070667_1000204706 233
257 3300005367 Ga0070667_100022417 Ga0070667_1000224175 233
258 3300005367 Ga0070667_100413775 Ga0070667_1004137752 233
259 3300005367 Ga0070667_101042934 Ga0070667_1010429341 233
260 3300005434 Ga0070709_10049623 Ga0070709_100496231 233
261 3300005435 Ga0070714_100067806 Ga0070714_1000678065 233
262 3300005435 Ga0070714_100074821 Ga0070714_1000748214 233
263 3300005436 Ga0070713_100930373 Ga0070713_1009303731 233
264 3300005437 Ga0070710_10006956 Ga0070710_100069562 233
265 3300005437 Ga0070710_10007817 Ga0070710_100078172 233
266 3300005438 Ga0070701_10017749 Ga0070701_100177494 233
267 3300005439 Ga0070711_100000327 Ga0070711_10000032727 233
268 3300005439 Ga0070711_100001579 Ga0070711_10000157915 233
269 3300005439 Ga0070711_100177825 Ga0070711_1001778252 233
270 3300005440 Ga0070705_100502506 Ga0070705_1005025062 233
271 3300005441 Ga0070700_100015828 Ga0070700_1000158282 233
272 3300005444 Ga0070694_100007834 Ga0070694_1000078347 233
273 3300005455 Ga0070663_100070529 Ga0070663_1000705293 233
274 3300005455 Ga0070663_100169897 Ga0070663_1001698973 233
275 3300005456 Ga0070678_100000105 Ga0070678_10000010515 233
276 3300005457 Ga0070662_100372063 Ga0070662_1003720632 233
277 3300005459 Ga0068867_100000723 Ga0068867_10000072322 233
278 3300005459 Ga0068867_100058057 Ga0068867_1000580572 233
279 3300005466 Ga0070685_10311718 Ga0070685_103117183 233
280 3300005467 Ga0070706_100488150 Ga0070706_1004881502 233
281 3300005530 Ga0070679_100208611 Ga0070679_1002086111 233
282 3300005535 Ga0070684_100379510 Ga0070684_1003795102 233
283 3300005539 Ga0068853_100070499 Ga0068853_1000704994 233
284 3300005539 Ga0068853_100110933 Ga0068853_1001109334 233
285 3300005543 Ga0070672_100036537 Ga0070672_1000365372 233
286 3300005544 Ga0070686_100117297 Ga0070686_1001172972 233
287 3300005545 Ga0070695_100007265 Ga0070695_1000072652 233
288 3300005546 Ga0070696_100001184 Ga0070696_1000011844 233
289 3300005546 Ga0070696_100040911 Ga0070696_1000409112 233
290 3300005547 Ga0070693_100067491 Ga0070693_1000674911 233
291 3300005548 Ga0070665_100004232 Ga0070665_1000042328 233
292 3300005548 Ga0070665_100006023 Ga0070665_1000060232 233
293 3300005548 Ga0070665_100077582 Ga0070665_1000775823 233
294 3300005548 Ga0070665_100705310 Ga0070665_1007053102 233
295 3300005549 Ga0070704_100000016 Ga0070704_10000001619 233
296 3300005563 Ga0068855_100084004 Ga0068855_1000840042 233
297 3300005563 Ga0068855_100790300 Ga0068855_1007903003 233
298 3300005615 Ga0070702_100001709 Ga0070702_10000170912 233
299 3300005615 Ga0070702_100046624 Ga0070702_1000466243 233
300 3300005615 Ga0070702_100668495 Ga0070702_1006684951 233
301 3300005616 Ga0068852_100566152 Ga0068852_1005661521 233
302 3300005617 Ga0068859_100000777 Ga0068859_10000077714 233
303 3300005617 Ga0068859_100000989 Ga0068859_1000009897 233
304 3300005618 Ga0068864_100225883 Ga0068864_1002258832 233
305 3300005618 Ga0068864_100806984 Ga0068864_1008069842 233
306 3300005718 Ga0068866_10000152 Ga0068866_1000015226 233
307 3300005719 Ga0068861_100000157 Ga0068861_10000015710 233
308 3300005719 Ga0068861_100509858 Ga0068861_1005098581 233
309 3300005841 Ga0068863_100000159 Ga0068863_10000015912 233
310 3300005841 Ga0068863_100003604 Ga0068863_10000360412 233
311 3300005841 Ga0068863_100202456 Ga0068863_1002024562 233
312 3300005843 Ga0068860_100000065 Ga0068860_10000006566 233
313 3300005843 Ga0068860_100000663 Ga0068860_10000066329 233
314 3300005844 Ga0068862_100000028 Ga0068862_10000002890 233
315 3300005844 Ga0068862_100010168 Ga0068862_10001016812 233
316 3300005937 Ga0081455_10230781 Ga0081455_102307812 233
317 3300006028 Ga0070717_10179490 Ga0070717_101794903 233
318 3300006038 Ga0075365_10097555 Ga0075365_100975554 233
319 3300006038 Ga0075365_10287685 Ga0075365_102876852 233
320 3300006042 Ga0075368_10050173 Ga0075368_100501732 233
321 3300006048 Ga0075363_100020572 Ga0075363_1000205724 233
322 3300006048 Ga0075363_100031359 Ga0075363_1000313592 233
323 3300006048 Ga0075363_100053055 Ga0075363_1000530552 233
324 3300006048 Ga0075363_100112079 Ga0075363_1001120792 233
325 3300006048 Ga0075363_100120597 Ga0075363_1001205972 233
326 3300006048 Ga0075363_100272669 Ga0075363_1002726692 233
327 3300006048 Ga0075363_100300311 Ga0075363_1003003111 233
328 3300006051 Ga0075364_10003349 Ga0075364_100033498 233
329 3300006051 Ga0075364_10017435 Ga0075364_100174355 233
330 3300006051 Ga0075364_10036950 Ga0075364_100369503 233
331 3300006051 Ga0075364_10040932 Ga0075364_100409324 233
332 3300006051 Ga0075364_10337657 Ga0075364_103376571 233
333 3300006163 Ga0070715_10027904 Ga0070715_100279044 233
334 3300006163 Ga0070715_10028363 Ga0070715_100283632 233
335 3300006173 Ga0070716_100012209 Ga0070716_1000122095 233
336 3300006173 Ga0070716_100023074 Ga0070716_1000230744 233
337 3300006175 Ga0070712_100000926 Ga0070712_10000092619 233
338 3300006175 Ga0070712_100019484 Ga0070712_1000194842 233
339 3300006177 Ga0075362_10182328 Ga0075362_101823281 233
340 3300006178 Ga0075367_10127659 Ga0075367_101276594 233
341 3300006178 Ga0075367_10162130 Ga0075367_101621302 233
342 3300006178 Ga0075367_10400855 Ga0075367_104008552 233
343 3300006186 Ga0075369_10003004 Ga0075369_100030041 233
344 3300006186 Ga0075369_10006451 Ga0075369_100064514 233
345 3300006186 Ga0075369_10008548 Ga0075369_100085481 233
346 3300006186 Ga0075369_10016201 Ga0075369_100162012 233
347 3300006186 Ga0075369_10022484 Ga0075369_100224844 233
348 3300006186 Ga0075369_10023619 Ga0075369_100236193 233
349 3300006186 Ga0075369_10093774 Ga0075369_100937742 233
350 3300006186 Ga0075369_10294186 Ga0075369_102941861 233
351 3300006195 Ga0075366_10085861 Ga0075366_100858613 233
352 3300006237 Ga0097621_100077048 Ga0097621_1000770482 233
353 3300006353 Ga0075370_10001708 Ga0075370_100017089 233
354 3300006353 Ga0075370_10001851 Ga0075370_100018516 233
355 3300006353 Ga0075370_10026581 Ga0075370_100265812 233
356 3300006353 Ga0075370_10090992 Ga0075370_100909921 233
357 3300006353 Ga0075370_10117182 Ga0075370_101171822 233
358 3300006353 Ga0075370_10133429 Ga0075370_101334291 233
359 3300006353 Ga0075370_10200994 Ga0075370_102009942 233
360 3300006844 Ga0075428_100006335 Ga0075428_10000633516 233
361 3300006846 Ga0075430_100083231 Ga0075430_1000832313 233
362 3300006847 Ga0075431_100180299 Ga0075431_1001802992 233
363 3300006931 Ga0097620_100000777 Ga0097620_10000077714 233
364 3300006931 Ga0097620_100000989 Ga0097620_10000098928 233
365 3300007076 Ga0075435_100646585 Ga0075435_1006465851 233
366 3300009093 Ga0105240_10196936 Ga0105240_101969362 233
367 3300009094 Ga0111539_10191321 Ga0111539_101913213 233
368 3300009098 Ga0105245_10000172 Ga0105245_1000017236 233
369 3300009098 Ga0105245_10042813 Ga0105245_100428132 233
370 3300009098 Ga0105245_10056993 Ga0105245_100569934 233
371 3300009101 Ga0105247_10000009 Ga0105247_1000000928 233
372 3300009101 Ga0105247_10000451 Ga0105247_1000045122 233
373 3300009101 Ga0105247_10639092 Ga0105247_106390921 233
374 3300009147 Ga0114129_10045686 Ga0114129_100456869 233
375 3300009148 Ga0105243_10001407 Ga0105243_100014079 233
376 3300009148 Ga0105243_10055548 Ga0105243_100555482 233
377 3300009174 Ga0105241_10097080 Ga0105241_100970804 233
378 3300009174 Ga0105241_10324085 Ga0105241_103240852 233
379 3300009176 Ga0105242_10000281 Ga0105242_100002814 233
380 3300009176 Ga0105242_10646999 Ga0105242_106469991 233
381 3300009177 Ga0105248_10000186 Ga0105248_100001866 233
382 3300009177 Ga0105248_10001346 Ga0105248_100013466 233
383 3300009177 Ga0105248_10506794 Ga0105248_105067942 233
384 3300009545 Ga0105237_10009360 Ga0105237_1000936010 233
385 3300009545 Ga0105237_10091927 Ga0105237_100919272 233
386 3300009545 Ga0105237_10609182 Ga0105237_106091821 233
387 3300009551 Ga0105238_10646028 Ga0105238_106460281 233
388 3300009553 Ga0105249_10000011 Ga0105249_10000011180 233
389 3300009553 Ga0105249_10000291 Ga0105249_100002913 233
390 3300009553 Ga0105249_10185635 Ga0105249_101856352 233
391 3300009553 Ga0105249_11087294 Ga0105249_110872942 233
392 3300010375 Ga0105239_10004844 Ga0105239_1000484416 233
393 3300010375 Ga0105239_10013169 Ga0105239_100131692 233
394 3300010375 Ga0105239_10226287 Ga0105239_102262872 233
395 3300013296 Ga0157374_10058502 Ga0157374_100585023 233
396 3300013297 Ga0157378_10000282 Ga0157378_100002829 233
397 3300013297 Ga0157378_10081410 Ga0157378_100814102 233
398 3300013306 Ga0163162_10001346 Ga0163162_1000134613 233
399 3300013306 Ga0163162_10830724 Ga0163162_108307242 233
400 3300013306 Ga0163162_11413958 Ga0163162_114139581 233
401 3300013307 Ga0157372_10008436 Ga0157372_1000843611 233
402 3300013308 Ga0157375_10000443 Ga0157375_1000044328 233
403 3300013308 Ga0157375_10097647 Ga0157375_100976472 233
404 3300014325 Ga0163163_10110618 Ga0163163_101106182 233
405 3300014326 Ga0157380_10035286 Ga0157380_100352864 233
406 3300014326 Ga0157380_10267553 Ga0157380_102675532 233
407 3300014326 Ga0157380_10294098 Ga0157380_102940982 233
408 3300014968 Ga0157379_10008216 Ga0157379_100082162 233
409 3300014968 Ga0157379_10090968 Ga0157379_100909683 233
410 3300017792 Ga0163161_10001593 Ga0163161_1000159313 233
411 3300021384 Ga0213876_10006606 Ga0213876_100066062 233
412 3300021384 Ga0213876_10017728 Ga0213876_100177284 233
413 3300021384 Ga0213876_10075210 Ga0213876_100752101 233
414 3300021388 Ga0213875_10086117 Ga0213875_100861172 233
415 3300021388 Ga0213875_10145422 Ga0213875_101454222 233
416 3300025273 Ga0209673_1021887 Ga0209673_10218874 233
417 3300025273 Ga0209673_1044854 Ga0209673_10448542 233
418 3300025303 Ga0209051_1000075 Ga0209051_100007598 233
419 3300025303 Ga0209051_1000448 Ga0209051_10004483 233
420 3300025303 Ga0209051_1002630 Ga0209051_10026309 233
421 3300025303 Ga0209051_1009355 Ga0209051_10093554 233
422 3300025885 Ga0207653_10030501 Ga0207653_100305011 233
423 3300025893 Ga0207682_10015450 Ga0207682_100154504 233
424 3300025898 Ga0207692_10002256 Ga0207692_100022568 233
425 3300025898 Ga0207692_10019524 Ga0207692_100195242 233
426 3300025899 Ga0207642_10000264 Ga0207642_1000026417 233
427 3300025900 Ga0207710_10000014 Ga0207710_1000001445 233
428 3300025900 Ga0207710_10000721 Ga0207710_1000072114 233
429 3300025901 Ga0207688_10000335 Ga0207688_1000033518 233
430 3300025904 Ga0207647_10058151 Ga0207647_100581512 233
431 3300025905 Ga0207685_10081337 Ga0207685_100813372 233
432 3300025907 Ga0207645_10036766 Ga0207645_100367662 233
433 3300025913 Ga0207695_10288454 Ga0207695_102884542 233
434 3300025913 Ga0207695_10484227 Ga0207695_104842272 233
435 3300025914 Ga0207671_10013939 Ga0207671_100139391 233
436 3300025914 Ga0207671_10034188 Ga0207671_100341886 233
437 3300025915 Ga0207693_10000049 Ga0207693_1000004955 233
438 3300025915 Ga0207693_10000258 Ga0207693_1000025827 233
439 3300025916 Ga0207663_10000314 Ga0207663_1000031410 233
440 3300025916 Ga0207663_10549649 Ga0207663_105496491 233
441 3300025917 Ga0207660_10494423 Ga0207660_104944231 233
442 3300025919 Ga0207657_10033008 Ga0207657_100330084 233
443 3300025919 Ga0207657_10155359 Ga0207657_101553591 233
444 3300025920 Ga0207649_10431184 Ga0207649_104311842 233
445 3300025921 Ga0207652_10215678 Ga0207652_102156782 233
446 3300025923 Ga0207681_10003263 Ga0207681_100032634 233
447 3300025923 Ga0207681_10009825 Ga0207681_100098252 233
448 3300025927 Ga0207687_10000153 Ga0207687_1000015345 233
449 3300025927 Ga0207687_10264634 Ga0207687_102646342 233
450 3300025928 Ga0207700_10189724 Ga0207700_101897242 233
451 3300025928 Ga0207700_10506138 Ga0207700_105061382 233
452 3300025928 Ga0207700_10916487 Ga0207700_109164871 233
453 3300025929 Ga0207664_10019234 Ga0207664_100192345 233
454 3300025931 Ga0207644_10005846 Ga0207644_100058467 233
455 3300025932 Ga0207690_10283766 Ga0207690_102837661 233
456 3300025933 Ga0207706_10010210 Ga0207706_100102103 233
457 3300025934 Ga0207686_10000624 Ga0207686_1000062425 233
458 3300025934 Ga0207686_10024748 Ga0207686_100247483 233
459 3300025935 Ga0207709_10004736 Ga0207709_100047368 233
460 3300025935 Ga0207709_10010027 Ga0207709_100100273 233
461 3300025935 Ga0207709_10293488 Ga0207709_102934882 233
462 3300025936 Ga0207670_10433655 Ga0207670_104336552 233
463 3300025937 Ga0207669_10000277 Ga0207669_100002771 233
464 3300025937 Ga0207669_10570369 Ga0207669_105703691 233
465 3300025938 Ga0207704_10000115 Ga0207704_1000011528 233
466 3300025939 Ga0207665_10003528 Ga0207665_100035288 233
467 3300025939 Ga0207665_10011384 Ga0207665_100113845 233
468 3300025940 Ga0207691_10293704 Ga0207691_102937042 233
469 3300025941 Ga0207711_10000373 Ga0207711_1000037319 233
470 3300025942 Ga0207689_10239736 Ga0207689_102397362 233
471 3300025944 Ga0207661_10244336 Ga0207661_102443361 233
472 3300025949 Ga0207667_10176496 Ga0207667_101764962 233
473 3300025961 Ga0207712_10000020 Ga0207712_10000020101 233
474 3300025961 Ga0207712_10005489 Ga0207712_100054899 233
475 3300025961 Ga0207712_10017769 Ga0207712_100177692 233
476 3300025972 Ga0207668_10007226 Ga0207668_100072261 233
477 3300025972 Ga0207668_10018400 Ga0207668_100184003 233
478 3300025972 Ga0207668_10106013 Ga0207668_101060131 233
479 3300025981 Ga0207640_10037694 Ga0207640_100376941 233
480 3300025986 Ga0207658_10000573 Ga0207658_1000057312 233
481 3300025986 Ga0207658_10004216 Ga0207658_100042162 233
482 3300025986 Ga0207658_10201582 Ga0207658_102015822 233
483 3300025986 Ga0207658_10254972 Ga0207658_102549722 233
484 3300026023 Ga0207677_10003884 Ga0207677_100038849 233
485 3300026035 Ga0207703_10031288 Ga0207703_100312884 233
486 3300026035 Ga0207703_10138530 Ga0207703_101385301 233
487 3300026041 Ga0207639_10021972 Ga0207639_100219726 233
488 3300026041 Ga0207639_10214938 Ga0207639_102149384 233
489 3300026041 Ga0207639_10879006 Ga0207639_108790061 233
490 3300026067 Ga0207678_10091782 Ga0207678_100917822 233
491 3300026067 Ga0207678_10107629 Ga0207678_101076294 233
492 3300026067 Ga0207678_10188382 Ga0207678_101883822 233
493 3300026075 Ga0207708_10003058 Ga0207708_1000305813 233
494 3300026088 Ga0207641_10000156 Ga0207641_1000015625 233
495 3300026088 Ga0207641_10005483 Ga0207641_1000548311 233
496 3300026089 Ga0207648_10001288 Ga0207648_100012889 233
497 3300026089 Ga0207648_10004514 Ga0207648_1000451413 233
498 3300026095 Ga0207676_10115741 Ga0207676_101157414 233
499 3300026095 Ga0207676_10192849 Ga0207676_101928494 233
500 3300026095 Ga0207676_11043320 Ga0207676_110433201 233
501 3300026116 Ga0207674_10399885 Ga0207674_103998851 233
502 3300026118 Ga0207675_100000220 Ga0207675_10000022016 233
503 3300026121 Ga0207683_10000184 Ga0207683_100001845 233
504 3300026121 Ga0207683_10087921 Ga0207683_100879213 233
505 3300026142 Ga0207698_10538334 Ga0207698_105383341 233
506 3300027866 Ga0209813_10041598 Ga0209813_100415982 233
507 3300028379 Ga0268266_10001619 Ga0268266_1000161914 233
508 3300028379 Ga0268266_10005268 Ga0268266_100052686 233
509 3300028379 Ga0268266_10232488 Ga0268266_102324882 233
510 3300028379 Ga0268266_10731830 Ga0268266_107318302 233
511 3300028380 Ga0268265_10000004 Ga0268265_10000004356 233
512 3300028380 Ga0268265_11104616 Ga0268265_111046161 233
513 3300028381 Ga0268264_10000024 Ga0268264_10000024336 233
514 3300028381 Ga0268264_10000925 Ga0268264_1000092513 233
515 3300031251 Ga0265327_10000408 Ga0265327_1000040867 233
516 3300031251 Ga0265327_10002762 Ga0265327_100027622 233
517 3300031251 Ga0265327_10047167 Ga0265327_100471672 233
518 3300031251 Ga0265327_10047549 Ga0265327_100475496 233
519 3300031691 Ga0316579_10108499 Ga0316579_101084992 233
520 3300031728 Ga0316578_10165914 Ga0316578_101659141 233
521 3300031731 Ga0307405_10099125 Ga0307405_100991252 233
522 3300031731 Ga0307405_10171799 Ga0307405_101717992 233
523 3300031731 Ga0307405_10549989 Ga0307405_105499892 233
524 3300031852 Ga0307410_10054188 Ga0307410_100541884 233
525 3300031852 Ga0307410_10086914 Ga0307410_100869142 233
526 3300031852 Ga0307410_10190445 Ga0307410_101904452 233
527 3300031852 Ga0307410_10778350 Ga0307410_107783501 233
528 3300031901 Ga0307406_10657555 Ga0307406_106575551 233
529 3300031911 Ga0307412_10522565 Ga0307412_105225651 233
530 3300031995 Ga0307409_100518395 Ga0307409_1005183951 233
531 3300032002 Ga0307416_100600064 Ga0307416_1006000642 233
532 3300032126 Ga0307415_100030468 Ga0307415_1000304683 233
533 3300035085 Ga0373929_0018691 Ga0373929_0018691_649_1350 233
534 3300035090 Ga0373949_0058147 Ga0373949_0058147_178_879 233
535 3300035092 Ga0373952_0051827 Ga0373952_0051827_196_897 233
536 3300035112 Ga0373932_0105633 Ga0373932_0105633_178_879 233
537 3300035207 Ga0373942_0097815 Ga0373942_0097815_78_779 233
538 3300035692 Ga0373935_0052563 Ga0373935_0052563_1523_2224 233
539 3300035695 Ga0373927_0059608 Ga0373927_0059608_1004_1708 233
540 3300035695 Ga0373927_0413729 Ga0373927_0413729_38_739 233
541 3300036712 Ga0316584_0054882 Ga0316584_0054882_997_1698 233
542 3300037853 Ga0436364_0225372 Ga0436364_0225372_1484_2194 233
543 3300037853 Ga0436364_0755754 Ga0436364_0755754_929_1630 233
544 3300037853 Ga0436364_1296457 Ga0436364_1296457_8450_9151 233
545 3300039437 Ga0436365_0201441 Ga0436365_0201441_22492_23193 233
546 3300039437 Ga0436365_0585474 Ga0436365_0585474_16955_17656 233
547 3300039437 Ga0436365_1920746 Ga0436365_1920746_12449_13150 233
548 3300039447 Ga0436361_0978287 Ga0436361_0978287_435_1136 233
549 3300039450 Ga0436363_1156841 Ga0436363_1156841_403_1104 233
550 3300039450 Ga0436363_1714028 Ga0436363_1714028_3558_4259 233
551 3300041410 Ga0439461_0002218 Ga0439461_0002218_1453_2154 233
552 3300041410 Ga0439461_0009967 Ga0439461_0009967_530_1231 233
553 3300041411 Ga0439466_0001603 Ga0439466_0001603_7382_8083 233
554 3300041411 Ga0439466_0042342 Ga0439466_0042342_399_1100 233
555 3300041411 Ga0439466_0069642 Ga0439466_0069642_155_856 233
556 3300041413 Ga0439465_0001837 Ga0439465_0001837_3252_3953 233
557 3300041413 Ga0439465_0003484 Ga0439465_0003484_3328_4029 233
558 3300041413 Ga0439465_0005400 Ga0439465_0005400_1674_2375 233
559 3300041413 Ga0439465_0029375 Ga0439465_0029375_351_1052 233
560 3300041453 Ga0451797_1047338 Ga0451797_1047338_139_840 233
561 3300041456 Ga0451795_0769305 Ga0451795_0769305_257_958 233
562 3300041512 Ga0451853_0599558 Ga0451853_0599558_248_949 233
563 3300042002 Ga0439442_002097 Ga0439442_002097_78_779 233
564 3300042004 Ga0439445_0001633 Ga0439445_0001633_2743_3444 233
565 3300042005 Ga0439448_0023867 Ga0439448_0023867_958_1659 233
566 3300042005 Ga0439448_0060793 Ga0439448_0060793_278_979 233
567 3300042435 Ga0439434_0036660 Ga0439434_0036660_320_1021 233
568 3300042438 Ga0439459_0023874 Ga0439459_0023874_253_954 233
569 3300044656 Ga0466969_0038497 Ga0466969_0038497_873_1574 233
570 3300044656 Ga0466969_0078646 Ga0466969_0078646_595_1296 233
571 3300044658 Ga0466972_0004495 Ga0466972_0004495_4071_4772 233
572 3300044658 Ga0466972_0014460 Ga0466972_0014460_1604_2305 233
573 3300044683 Ga0466965_0001067 Ga0466965_0001067_5279_5980 233
574 3300044683 Ga0466965_0007511 Ga0466965_0007511_3265_3966 233
575 3300044683 Ga0466965_0029509 Ga0466965_0029509_1521_2222 233
576 3300044683 Ga0466965_0053638 Ga0466965_0053638_1075_1776 233
577 3300044684 Ga0466966_0010547 Ga0466966_0010547_655_1356 233
578 3300044684 Ga0466966_0037675 Ga0466966_0037675_1689_2390 233
579 3300044684 Ga0466966_0315301 Ga0466966_0315301_46_747 233
580 3300044693 Ga0466961_0013068 Ga0466961_0013068_2599_3300 233
581 3300044693 Ga0466961_0018566 Ga0466961_0018566_1420_2121 233
582 3300044693 Ga0466961_0051284 Ga0466961_0051284_946_1656 233
583 3300044694 Ga0466963_0022414 Ga0466963_0022414_2025_2726 233
584 3300044694 Ga0466963_0054645 Ga0466963_0054645_1856_2557 233
585 3300044694 Ga0466963_0315608 Ga0466963_0315608_133_834 233
586 3300044694 Ga0466963_0441929 Ga0466963_0441929_148_849 233
587 3300044694 Ga0466963_0469026 Ga0466963_0469026_132_833 233
588 3300044719 Ga0466971_0017842 Ga0466971_0017842_358_1059 233
589 3300044719 Ga0466971_0106608 Ga0466971_0106608_406_1107 233
590 3300044735 Ga0466968_0001388 Ga0466968_0001388_1638_2339 233
591 3300044735 Ga0466968_0005428 Ga0466968_0005428_3219_3920 233
592 3300044735 Ga0466968_0075741 Ga0466968_0075741_98_799 233
593 3300044735 Ga0466968_0169814 Ga0466968_0169814_188_889 233
594 3300044765 Ga0466970_0016086 Ga0466970_0016086_31_732 233
595 3300044765 Ga0466970_0165190 Ga0466970_0165190_352_1053 233
596 3300044842 Ga0466957_0002569 Ga0466957_0002569_1277_1978 233
597 3300044842 Ga0466957_0080532 Ga0466957_0080532_1203_1904 233
598 3300044842 Ga0466957_0166457 Ga0466957_0166457_680_1381 233
599 3300044842 Ga0466957_0257020 Ga0466957_0257020_144_845 233
600 3300044842 Ga0466957_0403629 Ga0466957_0403629_14_715 233
601 3300044901 Ga0466960_0000108 Ga0466960_0000108_13203_13904 233
602 3300044901 Ga0466960_0041695 Ga0466960_0041695_134_835 233
603 3300044901 Ga0466960_0391397 Ga0466960_0391397_10_711 233
604 3300045049 Ga0466959_0001743 Ga0466959_0001743_6051_6752 233
605 3300045049 Ga0466959_0021813 Ga0466959_0021813_3167_3868 233
606 3300045049 Ga0466959_0097330 Ga0466959_0097330_1166_1867 233
607 3300045836 Ga0466958_0000249 Ga0466958_0000249_9374_10075 233
608 3300045836 Ga0466958_0015421 Ga0466958_0015421_206_907 233
609 3300045836 Ga0466958_0032807 Ga0466958_0032807_688_1389 233
610 3300045836 Ga0466958_0062578 Ga0466958_0062578_873_1601 233
611 3300045836 Ga0466958_0125469 Ga0466958_0125469_773_1474 233
612 3300045836 Ga0466958_0139279 Ga0466958_0139279_807_1508 233
613 3300045976 Ga0466967_0004216 Ga0466967_0004216_1786_2487 233
614 3300045976 Ga0466967_0017156 Ga0466967_0017156_2226_2927 233
615 3300045976 Ga0466967_0025921 Ga0466967_0025921_3052_3753 233
616 3300045976 Ga0466967_0033247 Ga0466967_0033247_1152_1853 233
617 3300045976 Ga0466967_0034434 Ga0466967_0034434_1947_2648 233
618 3300045976 Ga0466967_0068031 Ga0466967_0068031_662_1363 233
619 3300045976 Ga0466967_0068924 Ga0466967_0068924_718_1419 233
620 3300045976 Ga0466967_0112879 Ga0466967_0112879_175_942 233
621 3300045976 Ga0466967_0283884 Ga0466967_0283884_292_1005 233
622 3300045976 Ga0466967_0607720 Ga0466967_0607720_356_1057 233
623 3300045976 Ga0466967_0752309 Ga0466967_0752309_233_934 233
624 3300045976 Ga0466967_1001020 Ga0466967_1001020_104_805 233
625 3300046455 Ga0495603_0014689 Ga0495603_0014689_608_1309 233
626 3300046459 Ga0495629_0048770 Ga0495629_0048770_2055_2756 233
627 3300046460 Ga0495638_0001617 Ga0495638_0001617_9940_10641 233
628 3300046460 Ga0495638_0017392 Ga0495638_0017392_1247_1948 233
629 3300046461 Ga0495641_0020272 Ga0495641_0020272_1798_2499 233
630 3300046472 Ga0495580_0514200 Ga0495580_0514200_42_743 233
631 3300046475 Ga0495639_0050203 Ga0495639_0050203_1130_1831 233
632 3300046499 Ga0495594_0060339 Ga0495594_0060339_343_1044 233
633 3300046507 Ga0495606_0053870 Ga0495606_0053870_1029_1730 233
634 3300046524 Ga0495648_0002598 Ga0495648_0002598_8293_8994 233
635 3300046533 Ga0495640_0093888 Ga0495640_0093888_619_1320 233
636 3300046616 Ga0495668_0037545 Ga0495668_0037545_1401_2102 233
637 3300046642 Ga0495634_0188608 Ga0495634_0188608_134_835 233
638 3300046683 Ga0495658_0007185 Ga0495658_0007185_2062_2763 233
639 3300046689 Ga0495613_0577951 Ga0495613_0577951_10_711 233
640 3300046690 Ga0495624_0026430 Ga0495624_0026430_2845_3546 233
641 3300046694 Ga0495649_0098020 Ga0495649_0098020_236_937 233
642 3300047315 Ga0495581_0007818 Ga0495581_0007818_2828_3529 233
643 3300047317 Ga0495604_0153294 Ga0495604_0153294_131_832 233
644 3300047317 Ga0495604_0516147 Ga0495604_0516147_46_747 233
645 3300047320 Ga0495672_0015022 Ga0495672_0015022_1318_2019 233
646 3300047320 Ga0495672_0087759 Ga0495672_0087759_954_1655 233
647 3300047320 Ga0495672_0131013 Ga0495672_0131013_442_1143 233
648 3300047320 Ga0495672_0136274 Ga0495672_0136274_289_990 233
649 3300047321 Ga0495676_0034773 Ga0495676_0034773_1999_2700 233
650 3300047322 Ga0495680_0175478 Ga0495680_0175478_512_1213 233
651 3300047469 Ga0495673_0000355 Ga0495673_0000355_48850_49551 233
652 3300047472 Ga0495686_0021284 Ga0495686_0021284_719_1420 233
653 3300047472 Ga0495686_0144366 Ga0495686_0144366_34_735 233
654 3300047673 Ga0495593_0013302 Ga0495593_0013302_2136_2837 233
655 3300048903 Ga0496100_0000009 Ga0496100_0000009_50479_51180 233
656 3300048903 Ga0496100_0003439 Ga0496100_0003439_262_963 233
657 3300048903 Ga0496100_0021910 Ga0496100_0021910_2895_3596 233
658 3300048903 Ga0496100_0104331 Ga0496100_0104331_364_1065 233
659 3300048903 Ga0496100_0221613 Ga0496100_0221613_432_1133 233
660 3300048904 Ga0496101_0000018 Ga0496101_0000018_112220_112921 233
661 3300048904 Ga0496101_0000114 Ga0496101_0000114_12977_13678 233
662 3300048904 Ga0496101_0002057 Ga0496101_0002057_11091_11792 233
663 3300048904 Ga0496101_0003076 Ga0496101_0003076_3925_4626 233
664 3300048904 Ga0496101_0004515 Ga0496101_0004515_5389_6090 233
665 3300048904 Ga0496101_0297761 Ga0496101_0297761_412_1113 233
666 3300048905 Ga0496102_0000014 Ga0496102_0000014_275713_276414 233
667 3300048905 Ga0496102_0000820 Ga0496102_0000820_13141_13842 233
668 3300048905 Ga0496102_0003481 Ga0496102_0003481_7191_7892 233
669 3300048905 Ga0496102_0003652 Ga0496102_0003652_6963_7664 233
670 3300048905 Ga0496102_0076420 Ga0496102_0076420_1440_2141 233
671 3300048905 Ga0496102_0142346 Ga0496102_0142346_519_1220 233
672 3300048905 Ga0496102_0237016 Ga0496102_0237016_191_892 233
673 3300048905 Ga0496102_0339862 Ga0496102_0339862_180_881 233
674 3300048905 Ga0496102_0382583 Ga0496102_0382583_212_913 233
675 3300048906 Ga0496103_0000004 Ga0496103_0000004_276216_276917 233
676 3300048906 Ga0496103_0000473 Ga0496103_0000473_21554_22255 233
677 3300048906 Ga0496103_0000662 Ga0496103_0000662_20484_21185 233
678 3300048906 Ga0496103_0001547 Ga0496103_0001547_4436_5137 233
679 3300048906 Ga0496103_0038046 Ga0496103_0038046_368_1069 233
680 3300048906 Ga0496103_0042581 Ga0496103_0042581_211_912 233
681 3300048907 Ga0496104_0000285 Ga0496104_0000285_17054_17755 233
682 3300048907 Ga0496104_0008789 Ga0496104_0008789_2908_3609 233
683 3300048908 Ga0496105_0040584 Ga0496105_0040584_3055_3756 233
684 3300048908 Ga0496105_0219740 Ga0496105_0219740_254_955 233
685 3300048909 Ga0496106_0003083 Ga0496106_0003083_9646_10347 233
686 3300048909 Ga0496106_0005366 Ga0496106_0005366_8219_8920 233
687 3300048909 Ga0496106_0026975 Ga0496106_0026975_3104_3805 233
688 3300048909 Ga0496106_0027196 Ga0496106_0027196_652_1353 233
689 3300048910 Ga0496107_0000152 Ga0496107_0000152_19306_20007 233
690 3300048910 Ga0496107_0000303 Ga0496107_0000303_602_1303 233
691 3300048910 Ga0496107_0000364 Ga0496107_0000364_5355_6056 233
692 3300048911 Ga0496108_0005587 Ga0496108_0005587_3629_4330 233
693 3300048911 Ga0496108_0048364 Ga0496108_0048364_2051_2752 233
694 3300048912 Ga0496109_0000214 Ga0496109_0000214_46095_46796 233
695 3300048912 Ga0496109_0017274 Ga0496109_0017274_2979_3680 233
696 3300048912 Ga0496109_0051609 Ga0496109_0051609_807_1508 233
697 3300048912 Ga0496109_0222005 Ga0496109_0222005_363_1064 233
698 3300048912 Ga0496109_0297274 Ga0496109_0297274_179_880 233
699 3300048912 Ga0496109_0490464 Ga0496109_0490464_352_1053 233
700 3300048912 Ga0496109_0623128 Ga0496109_0623128_110_811 233
701 3300048913 Ga0496110_0015406 Ga0496110_0015406_767_1468 233
702 3300048913 Ga0496110_0024790 Ga0496110_0024790_202_903 233
703 3300048913 Ga0496110_0831443 Ga0496110_0831443_65_766 233
704 3300048914 Ga0496111_0005039 Ga0496111_0005039_1053_1754 233
705 3300048914 Ga0496111_0028064 Ga0496111_0028064_639_1340 233
706 3300048915 Ga0496112_0001718 Ga0496112_0001718_14162_14863 233
707 3300048915 Ga0496112_0034180 Ga0496112_0034180_2753_3454 233
708 3300048915 Ga0496112_0064234 Ga0496112_0064234_2718_3419 233
709 3300048915 Ga0496112_0114959 Ga0496112_0114959_182_883 233
710 3300048915 Ga0496112_0287583 Ga0496112_0287583_597_1298 233
711 3300048916 Ga0496113_0049429 Ga0496113_0049429_1401_2102 233
712 3300048916 Ga0496113_0137406 Ga0496113_0137406_636_1337 233
713 3300048917 Ga0496114_0000108 Ga0496114_0000108_55350_56051 233
714 3300048917 Ga0496114_0000136 Ga0496114_0000136_18087_18788 233
715 3300048917 Ga0496114_0000166 Ga0496114_0000166_22271_22972 233
716 3300048917 Ga0496114_0080888 Ga0496114_0080888_2022_2723 233
717 3300048917 Ga0496114_0127030 Ga0496114_0127030_757_1458 233
718 3300048917 Ga0496114_0161578 Ga0496114_0161578_351_1052 233
719 3300048917 Ga0496114_0400059 Ga0496114_0400059_239_940 233
720 3300048918 Ga0496115_0000620 Ga0496115_0000620_6988_7689 233
721 3300048918 Ga0496115_0002574 Ga0496115_0002574_9271_9972 233
722 3300048918 Ga0496115_0303140 Ga0496115_0303140_561_1262 233
723 3300048918 Ga0496115_0406384 Ga0496115_0406384_286_987 233
724 3300048919 Ga0496116_0000428 Ga0496116_0000428_24550_25251 233
725 3300048919 Ga0496116_0010448 Ga0496116_0010448_4997_5698 233
726 3300048919 Ga0496116_0064942 Ga0496116_0064942_203_904 233
727 3300048920 Ga0496117_0000003 Ga0496117_0000003_1474619_1475320 233
728 3300048921 Ga0496118_0000001 Ga0496118_0000001_1474622_1475323 233
729 3300048921 Ga0496118_0000292 Ga0496118_0000292_47827_48528 233
730 3300048921 Ga0496118_0004368 Ga0496118_0004368_13937_14638 233
731 3300048922 Ga0496119_0001080 Ga0496119_0001080_24587_25288 233
732 3300048922 Ga0496119_0001862 Ga0496119_0001862_12977_13678 233
733 3300048922 Ga0496119_0028396 Ga0496119_0028396_646_1347 233
734 3300048923 Ga0496120_0001263 Ga0496120_0001263_6508_7209 233
735 3300048923 Ga0496120_0003934 Ga0496120_0003934_4687_5388 233
736 3300048923 Ga0496120_0031778 Ga0496120_0031778_643_1344 233
737 3300048924 Ga0496121_0000023 Ga0496121_0000023_340584_341285 233
738 3300048924 Ga0496121_0000032 Ga0496121_0000032_370198_370899 233
739 3300048924 Ga0496121_0004517 Ga0496121_0004517_7771_8472 233
740 3300048925 Ga0496122_0000164 Ga0496122_0000164_44921_45622 233
741 3300048926 Ga0496123_0006609 Ga0496123_0006609_4445_5146 233
742 3300048926 Ga0496123_0012134 Ga0496123_0012134_4564_5265 233
743 3300048927 Ga0496124_0000014 Ga0496124_0000014_340584_341285 233
744 3300048927 Ga0496124_0109899 Ga0496124_0109899_1240_1941 233
745 3300048928 Ga0496125_0000020 Ga0496125_0000020_122164_122865 233
746 3300048928 Ga0496125_0071017 Ga0496125_0071017_1979_2680 233
747 3300048928 Ga0496125_0119758 Ga0496125_0119758_514_1215 233
748 3300048929 Ga0496126_0000023 Ga0496126_0000023_340584_341285 233
749 3300048929 Ga0496126_0000067 Ga0496126_0000067_32351_33052 233
750 3300048929 Ga0496126_0001990 Ga0496126_0001990_2861_3562 233
751 3300048929 Ga0496126_0002459 Ga0496126_0002459_15696_16397 233
752 3300048929 Ga0496126_0006797 Ga0496126_0006797_8116_8817 233
753 3300048929 Ga0496126_0071181 Ga0496126_0071181_538_1239 233
754 3300049569 Ga0501032_0015981 Ga0501032_0015981_4122_4823 233
755 3300049569 Ga0501032_0264703 Ga0501032_0264703_104_805 233
756 3300049570 Ga0501033_0006709 Ga0501033_0006709_7494_8195 233
757 3300049570 Ga0501033_0039642 Ga0501033_0039642_1490_2191 233
758 3300049571 Ga0501034_0006051 Ga0501034_0006051_165_866 233
759 3300049571 Ga0501034_0011109 Ga0501034_0011109_2266_2967 233
760 3300049571 Ga0501034_0074634 Ga0501034_0074634_2405_3106 233
761 3300049572 Ga0501036_0016634 Ga0501036_0016634_281_982 233
762 3300049572 Ga0501036_0044342 Ga0501036_0044342_776_1477 233
763 3300049573 Ga0501037_0000584 Ga0501037_0000584_24248_24949 233
764 3300049573 Ga0501037_0003783 Ga0501037_0003783_2990_3691 233
765 3300049574 Ga0501038_0003008 Ga0501038_0003008_6382_7083 233
766 3300049575 Ga0501039_0002202 Ga0501039_0002202_4960_5661 233
767 3300049579 Ga0501043_0001037 Ga0501043_0001037_6905_7606 233
768 3300049579 Ga0501043_0077857 Ga0501043_0077857_1658_2359 233
769 3300049581 Ga0501047_0000372 Ga0501047_0000372_7136_7837 233
770 3300049581 Ga0501047_0433643 Ga0501047_0433643_95_796 233
771 3300049582 Ga0501048_0031651 Ga0501048_0031651_2165_2866 233
772 3300049585 Ga0501069_0036857 Ga0501069_0036857_173_874 233
773 3300049585 Ga0501069_0235466 Ga0501069_0235466_63_764 233
774 3300049586 Ga0501070_0000578 Ga0501070_0000578_10127_10828 233
775 3300049586 Ga0501070_0002976 Ga0501070_0002976_3753_4454 233
776 3300049586 Ga0501070_0098697 Ga0501070_0098697_1658_2359 233
777 3300049589 Ga0501073_0024898 Ga0501073_0024898_756_1457 233
778 3300049589 Ga0501073_0032431 Ga0501073_0032431_2127_2828 233
779 3300049742 Ga0501080_0753878 Ga0501080_0753878_83_784 233
780 3300049822 Ga0501035_0001032 Ga0501035_0001032_16872_17573 233
781 3300049822 Ga0501035_0436679 Ga0501035_0436679_343_1044 233
782 3300049823 Ga0501044_0006896 Ga0501044_0006896_7182_7883 233
783 3300049823 Ga0501044_0008550 Ga0501044_0008550_1216_1917 233
784 3300049823 Ga0501044_0014604 Ga0501044_0014604_5997_6698 233
785 3300049824 Ga0501045_0264326 Ga0501045_0264326_135_836 233
786 3300050489 nmdc:mga03683_213621_c1 nmdc:mga03683_213621_c1_136_837 233
787 3300050489 nmdc:mga03683_32675_c1 nmdc:mga03683_32675_c1_1281_1982 233
788 3300050490 nmdc:mga03n38_138016_c1 nmdc:mga03n38_138016_c1_389_1090 233
789 3300050490 nmdc:mga03n38_25694_c1 nmdc:mga03n38_25694_c1_64_765 233
790 3300050490 nmdc:mga03n38_3325_c1 nmdc:mga03n38_3325_c1_3961_4662 233
791 3300050490 nmdc:mga03n38_40989_c1 nmdc:mga03n38_40989_c1_342_1043 233
792 3300050490 nmdc:mga03n38_61400_c1 nmdc:mga03n38_61400_c1_352_1053 233
793 3300050491 nmdc:mga00v17_147632_c1 nmdc:mga00v17_147632_c1_516_1217 233
794 3300050491 nmdc:mga00v17_1649_c1 nmdc:mga00v17_1649_c1_3855_4556 233
795 3300050491 nmdc:mga00v17_227478_c1 nmdc:mga00v17_227478_c1_476_1177 233
796 3300050491 nmdc:mga00v17_4701_c1 nmdc:mga00v17_4701_c1_2259_2960 233
797 3300050491 nmdc:mga00v17_50762_c1 nmdc:mga00v17_50762_c1_1173_1874 233
798 3300050491 nmdc:mga00v17_98783_c1 nmdc:mga00v17_98783_c1_491_1192 233
799 3300050492 nmdc:mga0yw44_15444_c1 nmdc:mga0yw44_15444_c1_2972_3673 233
800 3300050492 nmdc:mga0yw44_204468_c1 nmdc:mga0yw44_204468_c1_162_863 233
801 3300050492 nmdc:mga0yw44_27434_c1 nmdc:mga0yw44_27434_c1_1061_1762 233
802 3300050492 nmdc:mga0yw44_2876_c1 nmdc:mga0yw44_2876_c1_5161_5862 233
803 3300050492 nmdc:mga0yw44_6915_c1 nmdc:mga0yw44_6915_c1_1137_1838 233
804 3300050494 nmdc:mga06z11_112694_c1 nmdc:mga06z11_112694_c1_647_1348 233
805 3300050494 nmdc:mga06z11_226856_c1 nmdc:mga06z11_226856_c1_64_765 233
806 3300050494 nmdc:mga06z11_5162_c1 nmdc:mga06z11_5162_c1_255_956 233
807 3300050495 nmdc:mga04h51_49795_c1 nmdc:mga04h51_49795_c1_43_744 233
808 3300050496 nmdc:mga07m45_11903_c1 nmdc:mga07m45_11903_c1_2308_3009 233
809 3300050496 nmdc:mga07m45_149346_c1 nmdc:mga07m45_149346_c1_265_966 233
810 3300050496 nmdc:mga07m45_17140_c1 nmdc:mga07m45_17140_c1_2852_3553 233
811 3300050496 nmdc:mga07m45_42124_c1 nmdc:mga07m45_42124_c1_242_943 233
812 3300050496 nmdc:mga07m45_54510_c1 nmdc:mga07m45_54510_c1_97_798 233
813 3300050507 nmdc:mga05p37_26882_c1 nmdc:mga05p37_26882_c1_5331_6032 233
814 3300050509 nmdc:mga0qj67_520316_c1 nmdc:mga0qj67_520316_c1_239_940 233
815 3300050510 nmdc:mga06r32_66396_c1 nmdc:mga06r32_66396_c1_1661_2362 233
816 3300050511 nmdc:mga08y16_187794_c1 nmdc:mga08y16_187794_c1_1423_2124 233
817 3300050516 nmdc:mga0sz30_164225_c1 nmdc:mga0sz30_164225_c1_270_971 233
818 3300050516 nmdc:mga0sz30_18492_c1 nmdc:mga0sz30_18492_c1_386_1087 233
819 3300050516 nmdc:mga0sz30_199038_c1 nmdc:mga0sz30_199038_c1_30_731 233
820 3300050516 nmdc:mga0sz30_3091_c1 nmdc:mga0sz30_3091_c1_3675_4376 233
821 3300050516 nmdc:mga0sz30_41704_c1 nmdc:mga0sz30_41704_c1_1128_1829 233
822 3300050516 nmdc:mga0sz30_56390_c1 nmdc:mga0sz30_56390_c1_905_1606 233
823 3300050516 nmdc:mga0sz30_68233_c1 nmdc:mga0sz30_68233_c1_634_1335 233
824 3300050516 nmdc:mga0sz30_8902_c1 nmdc:mga0sz30_8902_c1_1043_1744 233
825 3300053079 Ga0500610_0026618 Ga0500610_0026618_639_1340 233
826 3300053080 Ga0500635_0000695 Ga0500635_0000695_2308_3009 233
827 3300053087 Ga0500643_011430 Ga0500643_011430_607_1308 233
828 3300053087 Ga0500643_017752 Ga0500643_017752_982_1683 233
829 3300053104 Ga0500556_0005325 Ga0500556_0005325_690_1391 233
830 3300053130 Ga0500642_0039883 Ga0500642_0039883_771_1472 233
831 3300053131 Ga0500652_000535 Ga0500652_000535_9373_10074 233
832 3300053153 Ga0500616_0007708 Ga0500616_0007708_1772_2473 233
833 3300053153 Ga0500616_0092688 Ga0500616_0092688_26_727 233
834 3300053730 Ga0500645_000075 Ga0500645_000075_41978_42679 233
835 3300053730 Ga0500645_018737 Ga0500645_018737_1272_1973 233
836 3300061719 Ga0466962_0028329 Ga0466962_0028329_601_1302 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

31

80

0.96

PF01614

IclR

Bacterial transcriptional regulator

94

253

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tf1-assembly2.cif.gz_B crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain 0.9025 78 231
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.895 10 64
3obf-assembly2.cif.gz_B crystal structure of putative transcriptional regulator, iclr family; targeted domain 129...302 0.8911 81 233
4ou0-assembly1.cif.gz_A crystal structure of rpa32c 0.8885 12 64
3bjn-assembly1.cif.gz_A crystal structure of c-terminal domain of putative transcriptional regulator from vibrio cholerae, targeted domain 79-240 0.8865 80 228
ID Description Score Start End Superfamily
af_O53238_78_233_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9967 78 233 3.30.450.40
af_O53238_78_233_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9903 78 233 3.30.450.40
af_O53238_2_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9386 2 75 1.10.10.10
af_P16528_22_97_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9372 7 72 1.10.10.10
2xroE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 9 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A401N4W8-F1-model_v4 deleted 1.004 133 233
AF-A0A401N4W8-F1-model_v4 deleted 0.9842 133 233
AF-A0A6B3F3U2-F1-model_v4 IclR family transcriptional regulator NdgR 0.9472 79 178 GO:0003677
GO:0003700
GO:0045892
AF-A0A3E0K091-F1-model_v4 deleted 0.9318 22 232
AF-A0A6B3F3U2-F1-model_v4 IclR family transcriptional regulator NdgR 0.9291 79 178 GO:0003677
GO:0003700
GO:0045892

Feature Viewer

pLDDT pTM Quality
94.13 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map