F482913

General Info

Members Datasets Scaffolds Average Seq Length
836 397 1672 225

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0410636|Ga0501034_0410636_183_959
Length 258
Sequence MARKPKHQSQTPAPPSAPPPRGTSDRDKAIDALIALLAERPFDEIGLAEIAGRAGIKLSQLRAEFGSPLAIFAAHVKDIDRRVLDGGDTDMSDEAPRDRLFEVLMRRLDAMKPYREAVRSMLRSARRHPSLALALNAMAVRSQQWMLEAAGIHASGPKGLMRAQGSALMFARVLSVWIDDEDEGLDRTMAALDRGLASAERWAGFLNDLCAVPKCLVRGHRGSQRGLASIHHPEEPRSGPRRMTGTAPRPSILPLWVR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
388 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
389 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
390 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
391 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
397 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.32
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 6.46
Rhizosphere 90.67
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0410636 3300049571 Unclassified 1276
2 2214772988 2209111006 Bacteria 11988
3 ARcpr5oldR_c000150 3300000041 Bacteria 12077
4 ARSoilYngRDRAFT_c00394 3300000042 Bacteria 5757
5 ARcpr5yngRDRAFT_c000123 3300000043 Bacteria 12049
6 ARSoilOldRDRAFT_c000007 3300000044 Bacteria 55959
7 ARCol0oldRDRAFT_c00020 3300000045 Bacteria 12065
8 ARCol0yngRDRAFT_1000290 3300000652 Bacteria 7781
9 JGI24746J21847_1001263 3300001977 Bacteria 4039
10 JGI24747J21853_1005813 3300001978 Bacteria 1149
11 JGI24737J22298_10014250 3300001990 Bacteria 2582
12 JGI24750J21931_1000532 3300002070 Bacteria 5867
13 JGI24745J21846_1001764 3300002073 Bacteria 2134
14 JGI24748J21848_1001717 3300002074 Bacteria 2430
15 JGI24738J21930_10001430 3300002075 Bacteria 6625
16 JGI24744J21845_10003290 3300002077 Bacteria 3319
17 JGI24035J26624_1000877 3300002126 Bacteria 2842
18 JGI24034J26672_10000969 3300002239 Bacteria 3750
19 JGI24742J22300_10000325 3300002244 Bacteria 7086
20 Ga0065716_1001614 3300005277 Bacteria 5215
21 Ga0065704_10072439 3300005289 Bacteria 8525
22 Ga0065712_10071797 3300005290 Bacteria 5059
23 Ga0065715_10003150 3300005293 Bacteria 9200
24 Ga0065715_10089667 3300005293 Bacteria 9013
25 Ga0070658_10008781 3300005327 Bacteria 8120
26 Ga0070676_10033910 3300005328 Bacteria 2929
27 Ga0070683_100036987 3300005329 Bacteria 4467
28 Ga0070690_100012762 3300005330 Bacteria 4948
29 Ga0070690_100122896 3300005330 Bacteria 1744
30 Ga0070670_100006862 3300005331 Bacteria 9649
31 Ga0070677_10000988 3300005333 Bacteria 9191
32 Ga0068869_100006414 3300005334 Bacteria 7460
33 Ga0070666_10029109 3300005335 Bacteria 3629
34 Ga0070680_100002248 3300005336 Bacteria 14256
35 Ga0070680_100024074 3300005336 Bacteria 4860
36 Ga0070680_100044425 3300005336 Bacteria 3610
37 Ga0070680_100074935 3300005336 Bacteria 2785
38 Ga0070680_100080355 3300005336 Bacteria 2688
39 Ga0070680_100158004 3300005336 Bacteria 1905
40 Ga0070680_100268648 3300005336 Bacteria 1444
41 Ga0070682_100011702 3300005337 Bacteria 5017
42 Ga0070682_100213593 3300005337 Bacteria 1369
43 Ga0070682_100456343 3300005337 Bacteria 980
44 Ga0068868_100002461 3300005338 Bacteria 12859
45 Ga0070660_100024777 3300005339 Bacteria 4455
46 Ga0070660_100034337 3300005339 Bacteria 3831
47 Ga0070660_100158724 3300005339 Bacteria 1821
48 Ga0070689_100074333 3300005340 Bacteria 2659
49 Ga0070689_100287691 3300005340 Bacteria 1365
50 Ga0070689_100298063 3300005340 Bacteria 1341
51 Ga0070691_10001048 3300005341 Bacteria 11394
52 Ga0070691_10127262 3300005341 Bacteria 1288
53 Ga0070687_100001539 3300005343 Bacteria 8169
54 Ga0070687_100002921 3300005343 Bacteria 6556
55 Ga0070661_100142399 3300005344 Bacteria 1808
56 Ga0070692_10001006 3300005345 Bacteria 9699
57 Ga0070692_10073538 3300005345 Bacteria 1826
58 Ga0070668_100034942 3300005347 Bacteria 3831
59 Ga0070668_100095260 3300005347 Bacteria 2351
60 Ga0070668_100281096 3300005347 Unclassified 1390
61 Ga0070669_100002469 3300005353 Bacteria 13390
62 Ga0070669_100112134 3300005353 Bacteria 2071
63 Ga0070669_100527797 3300005353 Bacteria 982
64 Ga0070675_100007875 3300005354 Bacteria 8257
65 Ga0070675_100192967 3300005354 Bacteria 1765
66 Ga0070671_100027809 3300005355 Bacteria 4655
67 Ga0070674_100026094 3300005356 Bacteria 3812
68 Ga0070674_100230633 3300005356 Bacteria 1445
69 Ga0070673_100000950 3300005364 Bacteria 16418
70 Ga0070673_100484704 3300005364 Bacteria 1117
71 Ga0070688_100003204 3300005365 Bacteria 8386
72 Ga0070659_100006909 3300005366 Bacteria 8218
73 Ga0070659_100086149 3300005366 Bacteria 2513
74 Ga0070659_100286565 3300005366 Unclassified 1371
75 Ga0070659_100661369 3300005366 Bacteria 901
76 Ga0070667_100182185 3300005367 Bacteria 1858
77 Ga0070667_100227279 3300005367 Bacteria 1663
78 Ga0070709_10014181 3300005434 Bacteria 4502
79 Ga0070714_100049845 3300005435 Bacteria 3564
80 Ga0070714_100167523 3300005435 Bacteria 1992
81 Ga0070714_100168615 3300005435 Bacteria 1985
82 Ga0070714_100337229 3300005435 Bacteria 1413
83 Ga0070713_100207921 3300005436 Bacteria 1770
84 Ga0070710_10019546 3300005437 Bacteria 3502
85 Ga0070710_10028747 3300005437 Bacteria 2976
86 Ga0070701_10001420 3300005438 Bacteria 8867
87 Ga0070701_10016393 3300005438 Bacteria 3444
88 Ga0070711_100063686 3300005439 Bacteria 2574
89 Ga0070711_100151412 3300005439 Bacteria 1749
90 Ga0070711_100190525 3300005439 Bacteria 1576
91 Ga0070700_100014469 3300005441 Bacteria 4455
92 Ga0070694_100027621 3300005444 Bacteria 3687
93 Ga0070694_100058571 3300005444 Bacteria 2621
94 Ga0070694_100136162 3300005444 Bacteria 1780
95 Ga0070708_100487167 3300005445 Bacteria 1163
96 Ga0070663_100175121 3300005455 Bacteria 1661
97 Ga0070662_100059002 3300005457 Bacteria 2794
98 Ga0070662_100095940 3300005457 Bacteria 2236
99 Ga0070662_100162522 3300005457 Bacteria 1748
100 Ga0070681_10028339 3300005458 Bacteria 5629
101 Ga0070681_10039416 3300005458 Bacteria 4736
102 Ga0070681_10054250 3300005458 Bacteria 3994
103 Ga0070681_10200162 3300005458 Bacteria 1916
104 Ga0068867_100001504 3300005459 Bacteria 16138
105 Ga0068867_100444073 3300005459 Bacteria 1104
106 Ga0070685_10023092 3300005466 Bacteria 3401
107 Ga0070685_10064625 3300005466 Bacteria 2152
108 Ga0070707_100980370 3300005468 Unclassified 810
109 Ga0070699_100332377 3300005518 Bacteria 1367
110 Ga0070679_100058641 3300005530 Bacteria 3836
111 Ga0070679_100124721 3300005530 Bacteria 2558
112 Ga0070679_100142953 3300005530 Bacteria 2371
113 Ga0070679_100259971 3300005530 Bacteria 1691
114 Ga0070684_100003143 3300005535 Bacteria 12332
115 Ga0070684_100129503 3300005535 Bacteria 2276
116 Ga0068853_100006565 3300005539 Bacteria 9267
117 Ga0068853_100199077 3300005539 Bacteria 1822
118 Ga0070672_100153037 3300005543 Bacteria 1909
119 Ga0070672_100168917 3300005543 Bacteria 1818
120 Ga0070686_100003197 3300005544 Bacteria 8978
121 Ga0070686_100393737 3300005544 Unclassified 1052
122 Ga0070695_100014595 3300005545 Bacteria 4736
123 Ga0070696_100006401 3300005546 Bacteria 7881
124 Ga0070696_100024235 3300005546 Bacteria 4123
125 Ga0070696_100105465 3300005546 Bacteria 2025
126 Ga0070693_100023336 3300005547 Bacteria 3306
127 Ga0070693_100126925 3300005547 Bacteria 1589
128 Ga0070704_100018521 3300005549 Bacteria 4455
129 Ga0068855_100034704 3300005563 Bacteria 6012
130 Ga0068855_100050850 3300005563 Bacteria 4882
131 Ga0068855_100055497 3300005563 Bacteria 4653
132 Ga0068855_100063448 3300005563 Bacteria 4312
133 Ga0068855_100092066 3300005563 Bacteria 3496
134 Ga0068855_100421556 3300005563 Bacteria 1460
135 Ga0070664_100065346 3300005564 Bacteria 3103
136 Ga0070664_101111406 3300005564 Bacteria 745
137 Ga0068857_100000616 3300005577 Bacteria 26168
138 Ga0068857_100450248 3300005577 Bacteria 1203
139 Ga0068854_100003096 3300005578 Bacteria 10357
140 Ga0068854_100039018 3300005578 Bacteria 3343
141 Ga0068854_100086516 3300005578 Bacteria 2324
142 Ga0068856_100003598 3300005614 Bacteria 15595
143 Ga0068856_100302258 3300005614 Bacteria 1618
144 Ga0068852_100006718 3300005616 Bacteria 8344
145 Ga0068852_100333399 3300005616 Bacteria 1477
146 Ga0068859_100012599 3300005617 Bacteria 8504
147 Ga0068859_100202356 3300005617 Bacteria 2071
148 Ga0068864_100001534 3300005618 Bacteria 19014
149 Ga0068866_10003980 3300005718 Bacteria 6062
150 Ga0068861_100728868 3300005719 Bacteria 924
151 Ga0068870_10000289 3300005840 Bacteria 18688
152 Ga0068858_100009901 3300005842 Bacteria 9055
153 Ga0068858_100051708 3300005842 Bacteria 3801
154 Ga0068860_100017484 3300005843 Bacteria 6987
155 Ga0068860_100029565 3300005843 Bacteria 5272
156 Ga0068862_100005504 3300005844 Bacteria 10580
157 Ga0068862_100239992 3300005844 Bacteria 1647
158 Ga0081455_10000540 3300005937 Bacteria 49195
159 Ga0081455_10008929 3300005937 Bacteria 10360
160 Ga0081455_10014732 3300005937 Bacteria 7633
161 Ga0070717_10294740 3300006028 Bacteria 1441
162 Ga0075368_10058580 3300006042 Bacteria 1539
163 Ga0075363_100018969 3300006048 Bacteria 3433
164 Ga0075363_100090855 3300006048 Bacteria 1680
165 Ga0075363_100119038 3300006048 Bacteria 1473
166 Ga0070716_100034968 3300006173 Bacteria 2759
167 Ga0070712_100171085 3300006175 Bacteria 1685
168 Ga0070712_100706908 3300006175 Bacteria 860
169 Ga0075362_10044204 3300006177 Bacteria 1974
170 Ga0075367_10057035 3300006178 Bacteria 2322
171 Ga0075427_10000344 3300006194 Bacteria 5117
172 Ga0097621_100001930 3300006237 Bacteria 14142
173 Ga0097621_100094037 3300006237 Bacteria 2513
174 Ga0075370_10254295 3300006353 Bacteria 1041
175 Ga0068871_100001884 3300006358 Bacteria 14190
176 Ga0075428_100005389 3300006844 Bacteria 14223
177 Ga0075428_100313407 3300006844 Bacteria 1686
178 Ga0075430_100000426 3300006846 Bacteria 31396
179 Ga0075431_100005525 3300006847 Bacteria 12476
180 Ga0075433_10000029 3300006852 Bacteria 55893
181 Ga0075433_10005937 3300006852 Bacteria 9616
182 Ga0075433_10010527 3300006852 Bacteria 7429
183 Ga0075434_100000208 3300006871 Bacteria 39868
184 Ga0075434_100003871 3300006871 Bacteria 13392
185 Ga0075434_100058176 3300006871 Bacteria 3842
186 Ga0075434_100059772 3300006871 Bacteria 3790
187 Ga0075434_100097978 3300006871 Bacteria 2937
188 Ga0075434_100244633 3300006871 Bacteria 1814
189 Ga0075429_100000734 3300006880 Bacteria 25672
190 Ga0075436_100259605 3300006914 Bacteria 1239
191 Ga0075436_100284281 3300006914 Unclassified 1183
192 Ga0075436_100302194 3300006914 Bacteria 1147
193 Ga0097620_100012598 3300006931 Bacteria 8504
194 Ga0097620_100202349 3300006931 Bacteria 2071
195 Ga0075435_100001396 3300007076 Bacteria 15545
196 Ga0075435_100035116 3300007076 Bacteria 3977
197 Ga0075435_100056535 3300007076 Bacteria 3172
198 Ga0075435_100081695 3300007076 Bacteria 2655
199 Ga0075435_100253011 3300007076 Bacteria 1500
200 Ga0105240_10045619 3300009093 Bacteria 5559
201 Ga0105240_11075781 3300009093 Bacteria 857
202 Ga0111539_10001931 3300009094 Bacteria 27629
203 Ga0105245_10002784 3300009098 Bacteria 15726
204 Ga0105245_10011288 3300009098 Bacteria 7780
205 Ga0105245_10909693 3300009098 Unclassified 922
206 Ga0105247_10003272 3300009101 Bacteria 10625
207 Ga0105247_10510540 3300009101 Bacteria 877
208 Ga0105243_10131082 3300009148 Bacteria 2126
209 Ga0105243_10151695 3300009148 Bacteria 1989
210 Ga0105241_10000940 3300009174 Bacteria 21996
211 Ga0105241_10034680 3300009174 Bacteria 3792
212 Ga0105242_10259660 3300009176 Bacteria 1569
213 Ga0105248_10012521 3300009177 Bacteria 9355
214 Ga0105248_10013721 3300009177 Bacteria 8920
215 Ga0105248_10096829 3300009177 Bacteria 3324
216 Ga0105237_10095275 3300009545 Bacteria 2966
217 Ga0105238_10044004 3300009551 Bacteria 4516
218 Ga0105238_10193544 3300009551 Bacteria 2009
219 Ga0105249_10008288 3300009553 Bacteria 9052
220 Ga0105239_10171884 3300010375 Bacteria 2423
221 Ga0105239_10312868 3300010375 Bacteria 1770
222 Ga0105239_11006973 3300010375 Bacteria 958
223 Ga0105239_11083825 3300010375 Bacteria 922
224 Ga0105246_10014037 3300011119 Bacteria 5032
225 Ga0157373_10333937 3300013100 Bacteria 1079
226 Ga0157371_10022118 3300013102 Bacteria 4664
227 Ga0157371_10134407 3300013102 Bacteria 1761
228 Ga0157370_10387776 3300013104 Bacteria 1286
229 Ga0157369_10242476 3300013105 Bacteria 1882
230 Ga0157374_10308246 3300013296 Unclassified 1567
231 Ga0157378_10011895 3300013297 Bacteria 7622
232 Ga0157378_10059489 3300013297 Bacteria 3409
233 Ga0157372_10026975 3300013307 Bacteria 6254
234 Ga0157372_10591980 3300013307 Bacteria 1293
235 Ga0157372_11163556 3300013307 Bacteria 892
236 Ga0157375_10011247 3300013308 Bacteria 7898
237 Ga0163163_10001710 3300014325 Bacteria 18534
238 Ga0163163_10045479 3300014325 Bacteria 4308
239 Ga0157380_10004849 3300014326 Bacteria 9367
240 Ga0157377_10003757 3300014745 Bacteria 6888
241 Ga0157379_10031646 3300014968 Bacteria 4714
242 Ga0157379_10116794 3300014968 Bacteria 2400
243 Ga0157376_10002411 3300014969 Bacteria 12632
244 Ga0163161_10001476 3300017792 Bacteria 17368
245 Ga0197907_10034627 3300020069 Bacteria 2290
246 Ga0206356_10149498 3300020070 Bacteria 1033
247 Ga0206356_11516001 3300020070 Bacteria 847
248 Ga0206356_11782481 3300020070 Bacteria 2692
249 Ga0206356_11846112 3300020070 Bacteria 1551
250 Ga0206351_10124265 3300020077 Bacteria 738
251 Ga0206352_10069452 3300020078 Bacteria 1030
252 Ga0206350_11124917 3300020080 Bacteria 1129
253 Ga0206354_10235034 3300020081 Bacteria 947
254 Ga0206353_11809109 3300020082 Bacteria 1862
255 Ga0224712_10259867 3300022467 Bacteria 804
256 Ga0209233_1008959 3300025261 Bacteria 3063
257 Ga0207666_1000224 3300025271 Bacteria 8258
258 Ga0207673_1000001 3300025290 Bacteria 29268
259 Ga0207697_10002732 3300025315 Bacteria 9004
260 Ga0207697_10032683 3300025315 Bacteria 2129
261 Ga0207682_10000056 3300025893 Bacteria 48265
262 Ga0207692_10063961 3300025898 Bacteria 1914
263 Ga0207642_10001098 3300025899 Bacteria 8391
264 Ga0207642_10093155 3300025899 Bacteria 1493
265 Ga0207710_10169993 3300025900 Bacteria 1065
266 Ga0207688_10003180 3300025901 Bacteria 8955
267 Ga0207680_10016469 3300025903 Bacteria 3882
268 Ga0207647_10007813 3300025904 Bacteria 7699
269 Ga0207647_10037671 3300025904 Bacteria 3064
270 Ga0207685_10054018 3300025905 Bacteria 1563
271 Ga0207699_10185925 3300025906 Bacteria 1399
272 Ga0207699_10295613 3300025906 Unclassified 1129
273 Ga0207699_10373578 3300025906 Bacteria 1011
274 Ga0207645_10000249 3300025907 Bacteria 44921
275 Ga0207643_10000187 3300025908 Bacteria 42567
276 Ga0207705_10012753 3300025909 Bacteria 6064
277 Ga0207705_10021541 3300025909 Bacteria 4601
278 Ga0207684_10005931 3300025910 Bacteria 11183
279 Ga0207654_10002376 3300025911 Bacteria 9636
280 Ga0207707_10008213 3300025912 Bacteria 9059
281 Ga0207707_10028228 3300025912 Bacteria 4905
282 Ga0207707_10082519 3300025912 Bacteria 2806
283 Ga0207707_10109695 3300025912 Bacteria 2412
284 Ga0207707_10234401 3300025912 Bacteria 1597
285 Ga0207707_10299765 3300025912 Bacteria 1390
286 Ga0207707_10326177 3300025912 Bacteria 1325
287 Ga0207671_10026338 3300025914 Bacteria 4360
288 Ga0207671_10136790 3300025914 Bacteria 1884
289 Ga0207693_10004402 3300025915 Bacteria 11913
290 Ga0207693_10055395 3300025915 Bacteria 3111
291 Ga0207663_10007138 3300025916 Bacteria 5774
292 Ga0207663_10169015 3300025916 Bacteria 1551
293 Ga0207663_10379412 3300025916 Bacteria 1077
294 Ga0207660_10101618 3300025917 Bacteria 2148
295 Ga0207660_10125208 3300025917 Bacteria 1951
296 Ga0207660_10231954 3300025917 Bacteria 1451
297 Ga0207660_10592181 3300025917 Bacteria 903
298 Ga0207662_10003317 3300025918 Bacteria 8258
299 Ga0207662_10044847 3300025918 Bacteria 2612
300 Ga0207662_10257435 3300025918 Unclassified 1147
301 Ga0207657_10007814 3300025919 Bacteria 10915
302 Ga0207657_10012795 3300025919 Bacteria 8258
303 Ga0207657_10028541 3300025919 Bacteria 5089
304 Ga0207657_10060252 3300025919 Bacteria 3257
305 Ga0207649_10000852 3300025920 Bacteria 19557
306 Ga0207649_10492361 3300025920 Unclassified 931
307 Ga0207649_10640367 3300025920 Bacteria 821
308 Ga0207652_10009431 3300025921 Bacteria 7850
309 Ga0207652_10023346 3300025921 Bacteria 5123
310 Ga0207652_10181717 3300025921 Bacteria 1890
311 Ga0207652_10267242 3300025921 Bacteria 1543
312 Ga0207646_10108441 3300025922 Bacteria 2491
313 Ga0207681_10006377 3300025923 Bacteria 7241
314 Ga0207694_10175657 3300025924 Bacteria 1735
315 Ga0207659_10003644 3300025926 Bacteria 9276
316 Ga0207659_10305525 3300025926 Bacteria 1308
317 Ga0207687_10065991 3300025927 Bacteria 2571
318 Ga0207700_10132649 3300025928 Bacteria 2036
319 Ga0207664_10045030 3300025929 Bacteria 3458
320 Ga0207664_10271289 3300025929 Bacteria 1486
321 Ga0207644_10020542 3300025931 Bacteria 4491
322 Ga0207690_10023701 3300025932 Bacteria 3834
323 Ga0207690_10036618 3300025932 Bacteria 3178
324 Ga0207706_10001175 3300025933 Bacteria 26500
325 Ga0207706_10006829 3300025933 Bacteria 10549
326 Ga0207706_10053280 3300025933 Bacteria 3572
327 Ga0207686_10000898 3300025934 Bacteria 17933
328 Ga0207709_10006803 3300025935 Bacteria 6396
329 Ga0207709_10053131 3300025935 Bacteria 2492
330 Ga0207709_10357963 3300025935 Unclassified 1104
331 Ga0207670_10002663 3300025936 Bacteria 9392
332 Ga0207670_10492173 3300025936 Unclassified 994
333 Ga0207669_10000534 3300025937 Bacteria 16573
334 Ga0207704_10026200 3300025938 Bacteria 3195
335 Ga0207665_10307599 3300025939 Bacteria 1186
336 Ga0207691_10001992 3300025940 Bacteria 19980
337 Ga0207691_10235001 3300025940 Bacteria 1586
338 Ga0207711_10217910 3300025941 Bacteria 1745
339 Ga0207711_10475323 3300025941 Unclassified 1164
340 Ga0207689_10000424 3300025942 Bacteria 39635
341 Ga0207661_10002538 3300025944 Bacteria 12565
342 Ga0207661_10196111 3300025944 Bacteria 1773
343 Ga0207679_10000187 3300025945 Bacteria 49895
344 Ga0207679_10182235 3300025945 Bacteria 1738
345 Ga0207667_10182647 3300025949 Bacteria 2153
346 Ga0207667_10224059 3300025949 Bacteria 1926
347 Ga0207667_10521007 3300025949 Bacteria 1204
348 Ga0207651_10073255 3300025960 Bacteria 2435
349 Ga0207712_10001563 3300025961 Bacteria 15410
350 Ga0207712_10092033 3300025961 Bacteria 2235
351 Ga0207668_10000807 3300025972 Bacteria 19183
352 Ga0207668_10519897 3300025972 Unclassified 1027
353 Ga0207640_10026149 3300025981 Bacteria 3540
354 Ga0207640_10319023 3300025981 Bacteria 1236
355 Ga0207658_10016316 3300025986 Bacteria 5108
356 Ga0207658_10024327 3300025986 Bacteria 4237
357 Ga0207658_10099770 3300025986 Bacteria 2272
358 Ga0207658_10335314 3300025986 Bacteria 1313
359 Ga0207677_10008612 3300026023 Bacteria 5710
360 Ga0207703_10004096 3300026035 Bacteria 12028
361 Ga0207703_10301557 3300026035 Unclassified 1461
362 Ga0207678_10010172 3300026067 Bacteria 8258
363 Ga0207678_10087689 3300026067 Bacteria 2659
364 Ga0207678_10159384 3300026067 Bacteria 1927
365 Ga0207708_10007098 3300026075 Bacteria 8275
366 Ga0207708_10009482 3300026075 Bacteria 7211
367 Ga0207702_10195449 3300026078 Bacteria 1872
368 Ga0207702_10246459 3300026078 Bacteria 1676
369 Ga0207641_10001747 3300026088 Bacteria 20964
370 Ga0207648_10001031 3300026089 Bacteria 31313
371 Ga0207648_10009238 3300026089 Bacteria 9470
372 Ga0207648_10065841 3300026089 Bacteria 3159
373 Ga0207674_10015762 3300026116 Bacteria 8291
374 Ga0207674_10347251 3300026116 Bacteria 1434
375 Ga0207675_100010495 3300026118 Bacteria 8678
376 Ga0207675_100388450 3300026118 Bacteria 1373
377 Ga0207683_10000727 3300026121 Bacteria 29910
378 Ga0207683_10486395 3300026121 Unclassified 1139
379 Ga0207698_10001591 3300026142 Bacteria 13231
380 Ga0207698_10040765 3300026142 Bacteria 3454
381 Ga0207698_10217996 3300026142 Bacteria 1722
382 Ga0209968_1002657 3300027526 Bacteria 2691
383 Ga0209999_1006567 3300027543 Bacteria 2090
384 Ga0210002_1000950 3300027617 Bacteria 3996
385 Ga0209971_1020944 3300027682 Bacteria 1555
386 Ga0209998_10006128 3300027717 Bacteria 2501
387 Ga0209998_10007092 3300027717 Bacteria 2323
388 Ga0209813_10076578 3300027866 Bacteria 1098
389 Ga0209974_10038087 3300027876 Bacteria 1598
390 Ga0209974_10095556 3300027876 Bacteria 1034
391 Ga0207428_10000150 3300027907 Bacteria 94699
392 Ga0207428_10000360 3300027907 Bacteria 58478
393 Ga0207428_10001312 3300027907 Bacteria 26468
394 Ga0268265_10003058 3300028380 Bacteria 12198
395 Ga0268264_10002038 3300028381 Bacteria 18063
396 Ga0268264_10032654 3300028381 Bacteria 4272
397 Ga0265337_1001436 3300028556 Bacteria 11727
398 Ga0265338_10078817 3300028800 Bacteria 2776
399 Ga0265325_10000030 3300031241 Bacteria 103532
400 Ga0265325_10003470 3300031241 Bacteria 10281
401 Ga0265325_10014638 3300031241 Bacteria 4427
402 Ga0265325_10112669 3300031241 Bacteria 1320
403 Ga0265340_10050951 3300031247 Bacteria 2006
404 Ga0265340_10088816 3300031247 Bacteria 1447
405 Ga0265339_10065631 3300031249 Bacteria 1945
406 Ga0265339_10124148 3300031249 Bacteria 1325
407 Ga0265339_10270033 3300031249 Bacteria 818
408 Ga0265331_10013598 3300031250 Bacteria 4370
409 Ga0265316_10059331 3300031344 Bacteria 2976
410 Ga0265316_10291964 3300031344 Bacteria 1189
411 Ga0265313_10019962 3300031595 Bacteria 3712
412 Ga0265313_10061106 3300031595 Bacteria 1765
413 Ga0265313_10155657 3300031595 Bacteria 973
414 Ga0307508_10392924 3300031616 Bacteria 978
415 Ga0265314_10008756 3300031711 Bacteria 8650
416 Ga0265314_10124343 3300031711 Bacteria 1618
417 Ga0265314_10160132 3300031711 Bacteria 1371
418 Ga0265342_10007190 3300031712 Bacteria 8190
419 Ga0265342_10025981 3300031712 Bacteria 3674
420 Ga0316583_10000116 3300032133 Bacteria 18613
421 Ga0373950_0007317 3300034818 Bacteria 1710
422 Ga0373926_0060367 3300035083 Bacteria 1381
423 Ga0373934_0040238 3300035086 Bacteria 1843
424 Ga0373934_0046589 3300035086 Bacteria 1715
425 Ga0373934_0089871 3300035086 Unclassified 1237
426 Ga0373944_0006033 3300035089 Bacteria 3208
427 Ga0373944_0042431 3300035089 Bacteria 1410
428 Ga0373949_0025691 3300035090 Bacteria 1376
429 Ga0373951_0009307 3300035091 Bacteria 2213
430 Ga0373923_0000187 3300035111 Bacteria 12538
431 Ga0373923_0016081 3300035111 Bacteria 2835
432 Ga0373923_0055263 3300035111 Bacteria 1673
433 Ga0373939_0002170 3300035114 Bacteria 4659
434 Ga0373945_0000395 3300035116 Bacteria 12509
435 Ga0373945_0003211 3300035116 Bacteria 5126
436 Ga0373953_0019396 3300035117 Bacteria 2529
437 Ga0373953_0034980 3300035117 Unclassified 1972
438 Ga0373953_0046283 3300035117 Bacteria 1746
439 Ga0373954_0017828 3300035118 Bacteria 3192
440 Ga0373954_0034984 3300035118 Bacteria 2328
441 Ga0373954_0066955 3300035118 Bacteria 1701
442 Ga0373954_0115911 3300035118 Bacteria 1298
443 Ga0373956_0005701 3300035119 Bacteria 4979
444 Ga0373956_0254698 3300035119 Bacteria 835
445 Ga0373957_0135237 3300035120 Unclassified 1005
446 Ga0373960_0000484 3300035121 Bacteria 7885
447 Ga0373943_0034727 3300035170 Bacteria 2406
448 Ga0373943_0071276 3300035170 Bacteria 1760
449 Ga0373946_0004740 3300035171 Bacteria 4887
450 Ga0373955_0002533 3300035172 Bacteria 7993
451 Ga0373955_0005096 3300035172 Bacteria 5871
452 Ga0373955_0007708 3300035172 Bacteria 4958
453 Ga0373955_0023343 3300035172 Bacteria 3149
454 Ga0373955_0109181 3300035172 Bacteria 1598
455 Ga0373924_0005631 3300035410 Bacteria 4441
456 Ga0373924_0015589 3300035410 Bacteria 2891
457 Ga0373924_0016367 3300035410 Bacteria 2829
458 Ga0373931_0156013 3300035691 Unclassified 1334
459 Ga0373935_0054490 3300035692 Unclassified 2546
460 Ga0373935_0167895 3300035692 Bacteria 1499
461 Ga0373927_0379891 3300035695 Unclassified 931
462 Ga0373933_0001526 3300035724 Bacteria 13510
463 Ga0373933_0008071 3300035724 Bacteria 5746
464 Ga0373933_0009795 3300035724 Bacteria 5244
465 Ga0373933_0013460 3300035724 Bacteria 4535
466 Ga0373933_0043828 3300035724 Bacteria 2648
467 Ga0373947_0021752 3300035725 Bacteria 3714
468 Ga0373947_0030734 3300035725 Bacteria 3157
469 Ga0373947_0113525 3300035725 Bacteria 1714
470 Ga0373937_0002031 3300036401 Bacteria 16910
471 Ga0373937_0002067 3300036401 Bacteria 16792
472 Ga0373937_0004072 3300036401 Bacteria 12397
473 Ga0373937_0008320 3300036401 Bacteria 9010
474 Ga0373937_0087024 3300036401 Bacteria 2891
475 Ga0373925_0001686 3300037068 Bacteria 18583
476 Ga0373925_0031318 3300037068 Bacteria 3908
477 Ga0395899_0019740 3300037312 Bacteria 5117
478 Ga0395900_0052617 3300037418 Bacteria 4191
479 Ga0395898_0004229 3300037466 Bacteria 15742
480 Ga0395901_0080318 3300038443 Bacteria 3405
481 Ga0436361_0130184 3300039447 Bacteria 6038
482 Ga0439450_016497 3300042008 Bacteria 1528
483 Ga0466963_0070500 3300044694 Bacteria 2351
484 Ga0466957_0063752 3300044842 Bacteria 2266
485 Ga0466958_0082359 3300045836 Bacteria 1982
486 Ga0466958_0219030 3300045836 Unclassified 1214
487 Ga0466967_0029718 3300045976 Bacteria 4578
488 Ga0466967_0857896 3300045976 Unclassified 902
489 Ga0495592_0004354 3300046454 Bacteria 10357
490 Ga0495592_0027953 3300046454 Bacteria 4272
491 Ga0495592_0031428 3300046454 Bacteria 4012
492 Ga0495603_0001272 3300046455 Bacteria 14676
493 Ga0495629_0183377 3300046459 Bacteria 1450
494 Ga0495641_0009857 3300046461 Bacteria 5623
495 Ga0495641_0157066 3300046461 Bacteria 1017
496 Ga0495651_0017193 3300046462 Bacteria 5604
497 Ga0495651_0017806 3300046462 Bacteria 5501
498 Ga0495651_0019768 3300046462 Bacteria 5221
499 Ga0495651_0128542 3300046462 Bacteria 1852
500 Ga0495651_0407738 3300046462 Bacteria 886
501 Ga0495653_0023158 3300046463 Bacteria 5023
502 Ga0495653_0106288 3300046463 Bacteria 2025
503 Ga0495653_0124757 3300046463 Bacteria 1830
504 Ga0495653_0445627 3300046463 Bacteria 815
505 Ga0495582_0024852 3300046473 Bacteria 3280
506 Ga0495605_0129230 3300046474 Unclassified 1140
507 Ga0495639_0026384 3300046475 Bacteria 2567
508 Ga0495662_0002967 3300046476 Bacteria 8560
509 Ga0495662_0039088 3300046476 Bacteria 2292
510 Ga0495664_0015764 3300046477 Bacteria 4301
511 Ga0495664_0027553 3300046477 Bacteria 3313
512 Ga0495664_0040651 3300046477 Bacteria 2750
513 Ga0495584_0052151 3300046491 Unclassified 2059
514 Ga0495585_0003052 3300046492 Bacteria 11521
515 Ga0495607_0003738 3300046501 Bacteria 11518
516 Ga0495608_0020801 3300046511 Bacteria 4508
517 Ga0495618_0013696 3300046514 Bacteria 4934
518 Ga0495618_0052342 3300046514 Bacteria 2580
519 Ga0495618_0408031 3300046514 Bacteria 830
520 Ga0495628_0004484 3300046516 Bacteria 12371
521 Ga0495630_0166620 3300046517 Unclassified 1677
522 Ga0495630_0175702 3300046517 Bacteria 1632
523 Ga0495637_0015585 3300046520 Bacteria 3566
524 Ga0495644_0000312 3300046523 Bacteria 22452
525 Ga0495666_0003560 3300046526 Bacteria 7872
526 Ga0495652_0023265 3300046529 Bacteria 5493
527 Ga0495652_0051909 3300046529 Bacteria 3499
528 Ga0495652_0134790 3300046529 Bacteria 1950
529 Ga0495652_0158435 3300046529 Bacteria 1760
530 Ga0495652_0194778 3300046529 Unclassified 1543
531 Ga0495665_0007736 3300046531 Bacteria 5814
532 Ga0495665_0177461 3300046531 Bacteria 1108
533 Ga0495640_0022952 3300046533 Bacteria 4556
534 Ga0495640_0032635 3300046533 Bacteria 3708
535 Ga0495640_0040917 3300046533 Bacteria 3242
536 Ga0495640_0166599 3300046533 Bacteria 1409
537 Ga0495586_0226771 3300046535 Bacteria 1062
538 Ga0495587_0182006 3300046536 Bacteria 1191
539 Ga0495645_0001254 3300046543 Bacteria 17310
540 Ga0495645_0023097 3300046543 Bacteria 4503
541 Ga0495645_0262966 3300046543 Bacteria 1141
542 Ga0495622_0003315 3300046557 Bacteria 7609
543 Ga0495633_0001295 3300046558 Bacteria 19775
544 Ga0495667_0013991 3300046559 Bacteria 5418
545 Ga0495667_0056627 3300046559 Bacteria 2577
546 Ga0495667_0396024 3300046559 Bacteria 870
547 Ga0495656_0000338 3300046615 Bacteria 16110
548 Ga0495634_0041890 3300046642 Bacteria 3109
549 Ga0495634_0354786 3300046642 Unclassified 877
550 Ga0495611_0003977 3300046648 Bacteria 6430
551 Ga0495635_0017003 3300046663 Bacteria 5079
552 Ga0495635_0018319 3300046663 Bacteria 4886
553 Ga0495635_0049373 3300046663 Bacteria 2900
554 Ga0495635_0066075 3300046663 Bacteria 2481
555 Ga0495659_0000500 3300046664 Bacteria 14469
556 Ga0495661_0012316 3300046665 Bacteria 5775
557 Ga0495588_0007831 3300046674 Bacteria 4878
558 Ga0495657_0025807 3300046675 Bacteria 4169
559 Ga0495657_0060535 3300046675 Bacteria 2508
560 Ga0495599_0003098 3300046678 Bacteria 9682
561 Ga0495599_0082617 3300046678 Unclassified 2006
562 Ga0495599_0193896 3300046678 Bacteria 1249
563 Ga0495623_0001432 3300046679 Bacteria 16175
564 Ga0495623_0002450 3300046679 Bacteria 12303
565 Ga0495646_0002685 3300046680 Bacteria 11010
566 Ga0495646_0254689 3300046680 Bacteria 939
567 Ga0495647_0010841 3300046681 Bacteria 3112
568 Ga0495647_0070479 3300046681 Bacteria 1398
569 Ga0495658_0036768 3300046683 Bacteria 2703
570 Ga0495658_0354600 3300046683 Unclassified 932
571 Ga0495613_0043715 3300046689 Unclassified 3314
572 Ga0495613_0274231 3300046689 Bacteria 1172
573 Ga0495613_0380244 3300046689 Bacteria 966
574 Ga0495624_0165859 3300046690 Bacteria 1348
575 Ga0495670_0000232 3300046691 Bacteria 25466
576 Ga0495671_0108037 3300046692 Bacteria 1359
577 Ga0495589_0021795 3300046794 Bacteria 3274
578 Ga0495600_0012643 3300046809 Bacteria 5284
579 Ga0495600_0033437 3300046809 Bacteria 3338
580 Ga0495600_0077665 3300046809 Bacteria 2168
581 Ga0495581_0004228 3300047315 Bacteria 8276
582 Ga0495581_0359211 3300047315 Bacteria 850
583 Ga0495604_0023070 3300047317 Bacteria 4966
584 Ga0495604_0026371 3300047317 Bacteria 4626
585 Ga0495604_0028582 3300047317 Bacteria 4436
586 Ga0495604_0054077 3300047317 Bacteria 3100
587 Ga0495674_0021621 3300047319 Bacteria 5947
588 Ga0495674_0053744 3300047319 Bacteria 3539
589 Ga0495674_0071493 3300047319 Bacteria 2994
590 Ga0495680_0005660 3300047322 Bacteria 11705
591 Ga0495680_0013213 3300047322 Bacteria 7213
592 Ga0495680_0013375 3300047322 Bacteria 7163
593 Ga0495680_0096671 3300047322 Bacteria 2205
594 Ga0495680_0153143 3300047322 Bacteria 1679
595 Ga0495680_0465328 3300047322 Bacteria 863
596 Ga0495675_0001159 3300047444 Bacteria 15992
597 Ga0495675_0074768 3300047444 Bacteria 2135
598 Ga0495677_0020408 3300047445 Unclassified 2402
599 Ga0495679_011022 3300047446 Bacteria 3515
600 Ga0495684_0009284 3300047471 Bacteria 7592
601 Ga0495684_0139189 3300047471 Bacteria 1820
602 Ga0495593_0002529 3300047673 Bacteria 10984
603 Ga0495602_0001877 3300048088 Bacteria 21025
604 Ga0495602_0016985 3300048088 Bacteria 7301
605 Ga0495602_0093353 3300048088 Bacteria 2490
606 Ga0495602_0365239 3300048088 Unclassified 1038
607 Ga0495614_0026235 3300048089 Bacteria 2511
608 Ga0495614_0260052 3300048089 Bacteria 796
609 Ga0496100_0006271 3300048903 Bacteria 6475
610 Ga0496100_0030488 3300048903 Bacteria 3346
611 Ga0496100_0123679 3300048903 Bacteria 1813
612 Ga0496101_0000833 3300048904 Bacteria 18156
613 Ga0496101_0021356 3300048904 Bacteria 4448
614 Ga0496101_0143775 3300048904 Bacteria 1820
615 Ga0496102_0011433 3300048905 Bacteria 7653
616 Ga0496102_0045178 3300048905 Bacteria 3998
617 Ga0496103_0000963 3300048906 Bacteria 20444
618 Ga0496103_0043097 3300048906 Bacteria 2778
619 Ga0496103_0043842 3300048906 Bacteria 2755
620 Ga0496103_0419923 3300048906 Bacteria 858
621 Ga0496104_0000065 3300048907 Bacteria 108770
622 Ga0496104_0005391 3300048907 Bacteria 11192
623 Ga0496104_0038325 3300048907 Bacteria 4484
624 Ga0496104_0040089 3300048907 Bacteria 4388
625 Ga0496104_0120340 3300048907 Bacteria 2520
626 Ga0496105_0010839 3300048908 Bacteria 7176
627 Ga0496105_0023647 3300048908 Bacteria 4986
628 Ga0496105_0167840 3300048908 Bacteria 1800
629 Ga0496106_0002101 3300048909 Bacteria 14928
630 Ga0496106_0033955 3300048909 Bacteria 3808
631 Ga0496106_0044691 3300048909 Bacteria 3325
632 Ga0496106_0274819 3300048909 Bacteria 1349
633 Ga0496107_0011980 3300048910 Bacteria 6051
634 Ga0496107_0067509 3300048910 Bacteria 2595
635 Ga0496108_0016701 3300048911 Bacteria 5996
636 Ga0496108_0027237 3300048911 Bacteria 4717
637 Ga0496108_0028578 3300048911 Bacteria 4614
638 Ga0496108_0043867 3300048911 Bacteria 3735
639 Ga0496109_0001690 3300048912 Bacteria 18382
640 Ga0496109_0005126 3300048912 Bacteria 10937
641 Ga0496109_0015815 3300048912 Bacteria 6587
642 Ga0496109_0093978 3300048912 Bacteria 2775
643 Ga0496110_0023713 3300048913 Bacteria 5220
644 Ga0496110_0031756 3300048913 Bacteria 4558
645 Ga0496110_0285028 3300048913 Bacteria 1504
646 Ga0496110_0593173 3300048913 Bacteria 1005
647 Ga0496111_0025624 3300048914 Bacteria 4161
648 Ga0496111_0079212 3300048914 Bacteria 2396
649 Ga0496111_0094465 3300048914 Bacteria 2193
650 Ga0496112_0023903 3300048915 Bacteria 5846
651 Ga0496112_0102795 3300048915 Bacteria 2827
652 Ga0496112_0161739 3300048915 Bacteria 2205
653 Ga0496112_1010316 3300048915 Bacteria 751
654 Ga0496113_0000329 3300048916 Bacteria 22567
655 Ga0496113_0035504 3300048916 Bacteria 3646
656 Ga0496113_0083893 3300048916 Bacteria 2445
657 Ga0496114_0009201 3300048917 Bacteria 7835
658 Ga0496115_0044892 3300048918 Bacteria 3526
659 Ga0496115_0050554 3300048918 Bacteria 3330
660 Ga0496115_0073180 3300048918 Bacteria 2781
661 Ga0496115_0184978 3300048918 Bacteria 1721
662 Ga0496115_0297969 3300048918 Bacteria 1322
663 Ga0501031_0006312 3300049568 Bacteria 7730
664 Ga0501031_0060301 3300049568 Bacteria 2472
665 Ga0501032_0015540 3300049569 Bacteria 5368
666 Ga0501032_0017462 3300049569 Bacteria 5040
667 Ga0501033_0030659 3300049570 Bacteria 4040
668 Ga0501033_0107183 3300049570 Bacteria 2035
669 Ga0501033_0113285 3300049570 Bacteria 1972
670 Ga0501034_0001584 3300049571 Bacteria 29619
671 Ga0501034_0031753 3300049571 Bacteria 5364
672 Ga0501034_0071243 3300049571 Bacteria 3486
673 Ga0501034_0244523 3300049571 Bacteria 1739
674 Ga0501034_0340083 3300049571 Bacteria 1431
675 Ga0501034_0673519 3300049571 Bacteria 935
676 Ga0501036_0001347 3300049572 Bacteria 18840
677 Ga0501036_0009565 3300049572 Bacteria 7973
678 Ga0501036_0018017 3300049572 Bacteria 5912
679 Ga0501036_0044766 3300049572 Bacteria 3750
680 Ga0501036_0112893 3300049572 Bacteria 2296
681 Ga0501037_0001187 3300049573 Bacteria 19240
682 Ga0501037_0069506 3300049573 Bacteria 2563
683 Ga0501037_0083619 3300049573 Bacteria 2312
684 Ga0501037_0097960 3300049573 Bacteria 2119
685 Ga0501037_0203275 3300049573 Bacteria 1399
686 Ga0501038_0019987 3300049574 Bacteria 6028
687 Ga0501038_0020401 3300049574 Bacteria 5958
688 Ga0501038_0065777 3300049574 Bacteria 3088
689 Ga0501038_0507482 3300049574 Bacteria 921
690 Ga0501039_0018702 3300049575 Bacteria 5318
691 Ga0501039_0074330 3300049575 Bacteria 2641
692 Ga0501039_0123670 3300049575 Bacteria 2028
693 Ga0501039_0518880 3300049575 Bacteria 935
694 Ga0501040_0062313 3300049576 Bacteria 2566
695 Ga0501040_0063757 3300049576 Bacteria 2536
696 Ga0501042_0180269 3300049578 Bacteria 1524
697 Ga0501043_0001872 3300049579 Bacteria 18031
698 Ga0501043_0010758 3300049579 Bacteria 7165
699 Ga0501043_0070280 3300049579 Bacteria 2750
700 Ga0501046_0038531 3300049580 Bacteria 3835
701 Ga0501046_0053120 3300049580 Bacteria 3192
702 Ga0501047_0006650 3300049581 Bacteria 10866
703 Ga0501047_0011585 3300049581 Bacteria 8344
704 Ga0501047_0016035 3300049581 Bacteria 7144
705 Ga0501047_0023087 3300049581 Bacteria 5971
706 Ga0501047_0056959 3300049581 Bacteria 3780
707 Ga0501047_0119174 3300049581 Bacteria 2521
708 Ga0501047_0135638 3300049581 Bacteria 2341
709 Ga0501047_0177364 3300049581 Bacteria 1998
710 Ga0501047_0282384 3300049581 Bacteria 1504
711 Ga0501048_0000039 3300049582 Bacteria 63521
712 Ga0501048_0012298 3300049582 Bacteria 6370
713 Ga0501048_0023363 3300049582 Bacteria 4519
714 Ga0501067_0006525 3300049583 Bacteria 6467
715 Ga0501067_0225015 3300049583 Bacteria 1045
716 Ga0501068_0007550 3300049584 Bacteria 6017
717 Ga0501068_0012538 3300049584 Bacteria 4810
718 Ga0501068_0060494 3300049584 Bacteria 2300
719 Ga0501068_0126059 3300049584 Bacteria 1599
720 Ga0501068_0152702 3300049584 Bacteria 1452
721 Ga0501069_0020092 3300049585 Bacteria 3615
722 Ga0501069_0021374 3300049585 Bacteria 3510
723 Ga0501069_0090850 3300049585 Bacteria 1727
724 Ga0501069_0254017 3300049585 Bacteria 1026
725 Ga0501070_0006927 3300049586 Bacteria 9649
726 Ga0501070_0008380 3300049586 Bacteria 8733
727 Ga0501070_0009049 3300049586 Bacteria 8424
728 Ga0501070_0010886 3300049586 Bacteria 7683
729 Ga0501070_0033855 3300049586 Bacteria 4275
730 Ga0501070_0077826 3300049586 Bacteria 2744
731 Ga0501070_0206242 3300049586 Bacteria 1614
732 Ga0501070_0335663 3300049586 Bacteria 1228
733 Ga0501070_0400366 3300049586 Bacteria 1110
734 Ga0501071_0014377 3300049587 Bacteria 5412
735 Ga0501071_0020484 3300049587 Bacteria 4597
736 Ga0501071_0267814 3300049587 Bacteria 1291
737 Ga0501072_0019231 3300049588 Bacteria 5277
738 Ga0501072_0117623 3300049588 Bacteria 2117
739 Ga0501072_0135982 3300049588 Bacteria 1959
740 Ga0501072_0206496 3300049588 Bacteria 1566
741 Ga0501073_0015959 3300049589 Bacteria 5443
742 Ga0501073_0027790 3300049589 Bacteria 4043
743 Ga0501073_0309152 3300049589 Bacteria 1090
744 Ga0501074_0006728 3300049590 Bacteria 8292
745 Ga0501074_0021551 3300049590 Bacteria 4679
746 Ga0501074_0031302 3300049590 Bacteria 3854
747 Ga0501074_0099312 3300049590 Bacteria 2084
748 Ga0501074_0497655 3300049590 Bacteria 863
749 Ga0501075_0109585 3300049591 Bacteria 2099
750 Ga0501075_0132237 3300049591 Bacteria 1901
751 Ga0501076_0125461 3300049592 Bacteria 2080
752 Ga0501076_0184391 3300049592 Bacteria 1702
753 Ga0501077_0011615 3300049593 Bacteria 5504
754 Ga0501077_0080756 3300049593 Bacteria 2060
755 Ga0501079_0013096 3300049741 Bacteria 6324
756 Ga0501079_0408742 3300049741 Bacteria 1065
757 Ga0501079_0607745 3300049741 Unclassified 860
758 Ga0501080_0000022 3300049742 Bacteria 90630
759 Ga0501080_0026488 3300049742 Bacteria 5387
760 Ga0501080_0053406 3300049742 Bacteria 3762
761 Ga0501080_0146136 3300049742 Bacteria 2185
762 Ga0501080_0263059 3300049742 Bacteria 1571
763 Ga0501080_0266102 3300049742 Bacteria 1561
764 Ga0501080_0312795 3300049742 Bacteria 1423
765 Ga0501080_0399828 3300049742 Bacteria 1236
766 Ga0501080_0411889 3300049742 Bacteria 1215
767 Ga0501080_0451264 3300049742 Bacteria 1153
768 Ga0501081_0208998 3300049743 Bacteria 1417
769 Ga0501083_0001941 3300049744 Bacteria 14225
770 Ga0501083_0024820 3300049744 Bacteria 4152
771 Ga0501083_0026149 3300049744 Bacteria 4037
772 Ga0501083_0058001 3300049744 Bacteria 2591
773 Ga0501083_0128696 3300049744 Bacteria 1660
774 Ga0501035_0000655 3300049822 Bacteria 38162
775 Ga0501035_0008096 3300049822 Bacteria 9797
776 Ga0501035_0031789 3300049822 Bacteria 4807
777 Ga0501035_0155709 3300049822 Bacteria 1980
778 Ga0501035_0159289 3300049822 Bacteria 1955
779 Ga0501035_0216398 3300049822 Bacteria 1637
780 Ga0501044_0005112 3300049823 Bacteria 14631
781 Ga0501044_0023300 3300049823 Bacteria 6586
782 Ga0501044_0037388 3300049823 Bacteria 5074
783 Ga0501044_0106451 3300049823 Bacteria 2816
784 Ga0501044_0128195 3300049823 Bacteria 2533
785 Ga0501044_0298846 3300049823 Bacteria 1539
786 Ga0501044_0324039 3300049823 Bacteria 1464
787 Ga0501044_0354220 3300049823 Bacteria 1387
788 Ga0501045_0065925 3300049824 Bacteria 2659
789 Ga0501045_0126373 3300049824 Bacteria 1900
790 nmdc:mga03683_35426_c1 3300050489 Bacteria 2025
791 nmdc:mga00v17_146286_c1 3300050491 Bacteria 1517
792 nmdc:mga0k408_75369_c1 3300050493 Bacteria 1971
793 nmdc:mga06z11_445988_c1 3300050494 Bacteria 782
794 nmdc:mga0n895_54135_c1 3300050512 Bacteria 3945
795 nmdc:mga0n895_96925_c1 3300050512 Bacteria 2954
796 nmdc:mga0rr50_148960_c1 3300050513 Bacteria 1889
797 nmdc:mga0rr50_710982_c1 3300050513 Unclassified 857
798 nmdc:mga08x19_243843_c1 3300050514 Unclassified 1239
799 Ga0495601_0000225 3300053077 Bacteria 30328
800 Ga0495601_0001233 3300053077 Bacteria 14029
801 Ga0495601_0002814 3300053077 Bacteria 9872
802 Ga0495601_0007348 3300053077 Bacteria 6458
803 Ga0495612_0000405 3300053078 Bacteria 17265
804 Ga0495612_0005171 3300053078 Bacteria 5390
805 Ga0495612_0007159 3300053078 Bacteria 4564
806 Ga0495612_0027580 3300053078 Bacteria 2284
807 Ga0495595_0000616 3300053084 Bacteria 13570
808 Ga0495595_0003155 3300053084 Bacteria 6538
809 Ga0495595_0014630 3300053084 Bacteria 3332
810 Ga0495595_0016278 3300053084 Bacteria 3178
811 Ga0495595_0088257 3300053084 Bacteria 1485
812 Ga0495619_0000083 3300053085 Bacteria 70312
813 Ga0495619_0001284 3300053085 Bacteria 16486
814 Ga0495619_0012744 3300053085 Bacteria 5291
815 Ga0495619_0044225 3300053085 Bacteria 2923
816 Ga0495619_0045033 3300053085 Bacteria 2897
817 Ga0495619_0329939 3300053085 Bacteria 1056
818 Ga0500566_0060799 3300053094 Bacteria 2139
819 Ga0500566_0217555 3300053094 Bacteria 952
820 Ga0500641_0140510 3300053096 Bacteria 1043
821 Ga0500650_0163553 3300053098 Bacteria 1026
822 Ga0500562_030034 3300053108 Bacteria 1431
823 Ga0500595_000003 3300053119 Bacteria 419332
824 Ga0500618_024028 3300053125 Bacteria 1471
825 Ga0500658_0078082 3300053134 Bacteria 1411
826 Ga0500616_0000002 3300053153 Bacteria 1611257
827 Ga0501084_0013445 3300054114 Bacteria 6774
828 Ga0501084_0669724 3300054114 Bacteria 876
829 Ga0501082_0021232 3300060353 Bacteria 5602
830 Ga0501082_0083499 3300060353 Bacteria 2756
831 Ga0501082_0089643 3300060353 Bacteria 2655
832 Ga0501082_0105235 3300060353 Bacteria 2441
833 Ga0466962_0061657 3300061719 Bacteria 1790
834 Ga0530510_0107854 3300061734 Bacteria 2038
835 Ga0530510_0580173 3300061734 Unclassified 852
836 2643754955 2643221547 Bacteria 4740017
837 Ga0501034_0410636
838 2214772988
839 ARcpr5oldR_c000150
840 ARSoilYngRDRAFT_c00394
841 ARcpr5yngRDRAFT_c000123
842 ARSoilOldRDRAFT_c000007
843 ARCol0oldRDRAFT_c00020
844 ARCol0yngRDRAFT_1000290
845 JGI24746J21847_1001263
846 JGI24747J21853_1005813
847 JGI24737J22298_10014250
848 JGI24750J21931_1000532
849 JGI24745J21846_1001764
850 JGI24748J21848_1001717
851 JGI24738J21930_10001430
852 JGI24744J21845_10003290
853 JGI24035J26624_1000877
854 JGI24034J26672_10000969
855 JGI24742J22300_10000325
856 Ga0065716_1001614
857 Ga0065704_10072439
858 Ga0065712_10071797
859 Ga0065715_10003150
860 Ga0065715_10089667
861 Ga0070658_10008781
862 Ga0070676_10033910
863 Ga0070683_100036987
864 Ga0070690_100012762
865 Ga0070690_100122896
866 Ga0070670_100006862
867 Ga0070677_10000988
868 Ga0068869_100006414
869 Ga0070666_10029109
870 Ga0070680_100002248
871 Ga0070680_100024074
872 Ga0070680_100044425
873 Ga0070680_100074935
874 Ga0070680_100080355
875 Ga0070680_100158004
876 Ga0070680_100268648
877 Ga0070682_100011702
878 Ga0070682_100213593
879 Ga0070682_100456343
880 Ga0068868_100002461
881 Ga0070660_100024777
882 Ga0070660_100034337
883 Ga0070660_100158724
884 Ga0070689_100074333
885 Ga0070689_100287691
886 Ga0070689_100298063
887 Ga0070691_10001048
888 Ga0070691_10127262
889 Ga0070687_100001539
890 Ga0070687_100002921
891 Ga0070661_100142399
892 Ga0070692_10001006
893 Ga0070692_10073538
894 Ga0070668_100034942
895 Ga0070668_100095260
896 Ga0070668_100281096
897 Ga0070669_100002469
898 Ga0070669_100112134
899 Ga0070669_100527797
900 Ga0070675_100007875
901 Ga0070675_100192967
902 Ga0070671_100027809
903 Ga0070674_100026094
904 Ga0070674_100230633
905 Ga0070673_100000950
906 Ga0070673_100484704
907 Ga0070688_100003204
908 Ga0070659_100006909
909 Ga0070659_100086149
910 Ga0070659_100286565
911 Ga0070659_100661369
912 Ga0070667_100182185
913 Ga0070667_100227279
914 Ga0070709_10014181
915 Ga0070714_100049845
916 Ga0070714_100167523
917 Ga0070714_100168615
918 Ga0070714_100337229
919 Ga0070713_100207921
920 Ga0070710_10019546
921 Ga0070710_10028747
922 Ga0070701_10001420
923 Ga0070701_10016393
924 Ga0070711_100063686
925 Ga0070711_100151412
926 Ga0070711_100190525
927 Ga0070700_100014469
928 Ga0070694_100027621
929 Ga0070694_100058571
930 Ga0070694_100136162
931 Ga0070708_100487167
932 Ga0070663_100175121
933 Ga0070662_100059002
934 Ga0070662_100095940
935 Ga0070662_100162522
936 Ga0070681_10028339
937 Ga0070681_10039416
938 Ga0070681_10054250
939 Ga0070681_10200162
940 Ga0068867_100001504
941 Ga0068867_100444073
942 Ga0070685_10023092
943 Ga0070685_10064625
944 Ga0070707_100980370
945 Ga0070699_100332377
946 Ga0070679_100058641
947 Ga0070679_100124721
948 Ga0070679_100142953
949 Ga0070679_100259971
950 Ga0070684_100003143
951 Ga0070684_100129503
952 Ga0068853_100006565
953 Ga0068853_100199077
954 Ga0070672_100153037
955 Ga0070672_100168917
956 Ga0070686_100003197
957 Ga0070686_100393737
958 Ga0070695_100014595
959 Ga0070696_100006401
960 Ga0070696_100024235
961 Ga0070696_100105465
962 Ga0070693_100023336
963 Ga0070693_100126925
964 Ga0070704_100018521
965 Ga0068855_100034704
966 Ga0068855_100050850
967 Ga0068855_100055497
968 Ga0068855_100063448
969 Ga0068855_100092066
970 Ga0068855_100421556
971 Ga0070664_100065346
972 Ga0070664_101111406
973 Ga0068857_100000616
974 Ga0068857_100450248
975 Ga0068854_100003096
976 Ga0068854_100039018
977 Ga0068854_100086516
978 Ga0068856_100003598
979 Ga0068856_100302258
980 Ga0068852_100006718
981 Ga0068852_100333399
982 Ga0068859_100012599
983 Ga0068859_100202356
984 Ga0068864_100001534
985 Ga0068866_10003980
986 Ga0068861_100728868
987 Ga0068870_10000289
988 Ga0068858_100009901
989 Ga0068858_100051708
990 Ga0068860_100017484
991 Ga0068860_100029565
992 Ga0068862_100005504
993 Ga0068862_100239992
994 Ga0081455_10000540
995 Ga0081455_10008929
996 Ga0081455_10014732
997 Ga0070717_10294740
998 Ga0075368_10058580
999 Ga0075363_100018969
1000 Ga0075363_100090855
1001 Ga0075363_100119038
1002 Ga0070716_100034968
1003 Ga0070712_100171085
1004 Ga0070712_100706908
1005 Ga0075362_10044204
1006 Ga0075367_10057035
1007 Ga0075427_10000344
1008 Ga0097621_100001930
1009 Ga0097621_100094037
1010 Ga0075370_10254295
1011 Ga0068871_100001884
1012 Ga0075428_100005389
1013 Ga0075428_100313407
1014 Ga0075430_100000426
1015 Ga0075431_100005525
1016 Ga0075433_10000029
1017 Ga0075433_10005937
1018 Ga0075433_10010527
1019 Ga0075434_100000208
1020 Ga0075434_100003871
1021 Ga0075434_100058176
1022 Ga0075434_100059772
1023 Ga0075434_100097978
1024 Ga0075434_100244633
1025 Ga0075429_100000734
1026 Ga0075436_100259605
1027 Ga0075436_100284281
1028 Ga0075436_100302194
1029 Ga0097620_100012598
1030 Ga0097620_100202349
1031 Ga0075435_100001396
1032 Ga0075435_100035116
1033 Ga0075435_100056535
1034 Ga0075435_100081695
1035 Ga0075435_100253011
1036 Ga0105240_10045619
1037 Ga0105240_11075781
1038 Ga0111539_10001931
1039 Ga0105245_10002784
1040 Ga0105245_10011288
1041 Ga0105245_10909693
1042 Ga0105247_10003272
1043 Ga0105247_10510540
1044 Ga0105243_10131082
1045 Ga0105243_10151695
1046 Ga0105241_10000940
1047 Ga0105241_10034680
1048 Ga0105242_10259660
1049 Ga0105248_10012521
1050 Ga0105248_10013721
1051 Ga0105248_10096829
1052 Ga0105237_10095275
1053 Ga0105238_10044004
1054 Ga0105238_10193544
1055 Ga0105249_10008288
1056 Ga0105239_10171884
1057 Ga0105239_10312868
1058 Ga0105239_11006973
1059 Ga0105239_11083825
1060 Ga0105246_10014037
1061 Ga0157373_10333937
1062 Ga0157371_10022118
1063 Ga0157371_10134407
1064 Ga0157370_10387776
1065 Ga0157369_10242476
1066 Ga0157374_10308246
1067 Ga0157378_10011895
1068 Ga0157378_10059489
1069 Ga0157372_10026975
1070 Ga0157372_10591980
1071 Ga0157372_11163556
1072 Ga0157375_10011247
1073 Ga0163163_10001710
1074 Ga0163163_10045479
1075 Ga0157380_10004849
1076 Ga0157377_10003757
1077 Ga0157379_10031646
1078 Ga0157379_10116794
1079 Ga0157376_10002411
1080 Ga0163161_10001476
1081 Ga0197907_10034627
1082 Ga0206356_10149498
1083 Ga0206356_11516001
1084 Ga0206356_11782481
1085 Ga0206356_11846112
1086 Ga0206351_10124265
1087 Ga0206352_10069452
1088 Ga0206350_11124917
1089 Ga0206354_10235034
1090 Ga0206353_11809109
1091 Ga0224712_10259867
1092 Ga0209233_1008959
1093 Ga0207666_1000224
1094 Ga0207673_1000001
1095 Ga0207697_10002732
1096 Ga0207697_10032683
1097 Ga0207682_10000056
1098 Ga0207692_10063961
1099 Ga0207642_10001098
1100 Ga0207642_10093155
1101 Ga0207710_10169993
1102 Ga0207688_10003180
1103 Ga0207680_10016469
1104 Ga0207647_10007813
1105 Ga0207647_10037671
1106 Ga0207685_10054018
1107 Ga0207699_10185925
1108 Ga0207699_10295613
1109 Ga0207699_10373578
1110 Ga0207645_10000249
1111 Ga0207643_10000187
1112 Ga0207705_10012753
1113 Ga0207705_10021541
1114 Ga0207684_10005931
1115 Ga0207654_10002376
1116 Ga0207707_10008213
1117 Ga0207707_10028228
1118 Ga0207707_10082519
1119 Ga0207707_10109695
1120 Ga0207707_10234401
1121 Ga0207707_10299765
1122 Ga0207707_10326177
1123 Ga0207671_10026338
1124 Ga0207671_10136790
1125 Ga0207693_10004402
1126 Ga0207693_10055395
1127 Ga0207663_10007138
1128 Ga0207663_10169015
1129 Ga0207663_10379412
1130 Ga0207660_10101618
1131 Ga0207660_10125208
1132 Ga0207660_10231954
1133 Ga0207660_10592181
1134 Ga0207662_10003317
1135 Ga0207662_10044847
1136 Ga0207662_10257435
1137 Ga0207657_10007814
1138 Ga0207657_10012795
1139 Ga0207657_10028541
1140 Ga0207657_10060252
1141 Ga0207649_10000852
1142 Ga0207649_10492361
1143 Ga0207649_10640367
1144 Ga0207652_10009431
1145 Ga0207652_10023346
1146 Ga0207652_10181717
1147 Ga0207652_10267242
1148 Ga0207646_10108441
1149 Ga0207681_10006377
1150 Ga0207694_10175657
1151 Ga0207659_10003644
1152 Ga0207659_10305525
1153 Ga0207687_10065991
1154 Ga0207700_10132649
1155 Ga0207664_10045030
1156 Ga0207664_10271289
1157 Ga0207644_10020542
1158 Ga0207690_10023701
1159 Ga0207690_10036618
1160 Ga0207706_10001175
1161 Ga0207706_10006829
1162 Ga0207706_10053280
1163 Ga0207686_10000898
1164 Ga0207709_10006803
1165 Ga0207709_10053131
1166 Ga0207709_10357963
1167 Ga0207670_10002663
1168 Ga0207670_10492173
1169 Ga0207669_10000534
1170 Ga0207704_10026200
1171 Ga0207665_10307599
1172 Ga0207691_10001992
1173 Ga0207691_10235001
1174 Ga0207711_10217910
1175 Ga0207711_10475323
1176 Ga0207689_10000424
1177 Ga0207661_10002538
1178 Ga0207661_10196111
1179 Ga0207679_10000187
1180 Ga0207679_10182235
1181 Ga0207667_10182647
1182 Ga0207667_10224059
1183 Ga0207667_10521007
1184 Ga0207651_10073255
1185 Ga0207712_10001563
1186 Ga0207712_10092033
1187 Ga0207668_10000807
1188 Ga0207668_10519897
1189 Ga0207640_10026149
1190 Ga0207640_10319023
1191 Ga0207658_10016316
1192 Ga0207658_10024327
1193 Ga0207658_10099770
1194 Ga0207658_10335314
1195 Ga0207677_10008612
1196 Ga0207703_10004096
1197 Ga0207703_10301557
1198 Ga0207678_10010172
1199 Ga0207678_10087689
1200 Ga0207678_10159384
1201 Ga0207708_10007098
1202 Ga0207708_10009482
1203 Ga0207702_10195449
1204 Ga0207702_10246459
1205 Ga0207641_10001747
1206 Ga0207648_10001031
1207 Ga0207648_10009238
1208 Ga0207648_10065841
1209 Ga0207674_10015762
1210 Ga0207674_10347251
1211 Ga0207675_100010495
1212 Ga0207675_100388450
1213 Ga0207683_10000727
1214 Ga0207683_10486395
1215 Ga0207698_10001591
1216 Ga0207698_10040765
1217 Ga0207698_10217996
1218 Ga0209968_1002657
1219 Ga0209999_1006567
1220 Ga0210002_1000950
1221 Ga0209971_1020944
1222 Ga0209998_10006128
1223 Ga0209998_10007092
1224 Ga0209813_10076578
1225 Ga0209974_10038087
1226 Ga0209974_10095556
1227 Ga0207428_10000150
1228 Ga0207428_10000360
1229 Ga0207428_10001312
1230 Ga0268265_10003058
1231 Ga0268264_10002038
1232 Ga0268264_10032654
1233 Ga0265337_1001436
1234 Ga0265338_10078817
1235 Ga0265325_10000030
1236 Ga0265325_10003470
1237 Ga0265325_10014638
1238 Ga0265325_10112669
1239 Ga0265340_10050951
1240 Ga0265340_10088816
1241 Ga0265339_10065631
1242 Ga0265339_10124148
1243 Ga0265339_10270033
1244 Ga0265331_10013598
1245 Ga0265316_10059331
1246 Ga0265316_10291964
1247 Ga0265313_10019962
1248 Ga0265313_10061106
1249 Ga0265313_10155657
1250 Ga0307508_10392924
1251 Ga0265314_10008756
1252 Ga0265314_10124343
1253 Ga0265314_10160132
1254 Ga0265342_10007190
1255 Ga0265342_10025981
1256 Ga0316583_10000116
1257 Ga0373950_0007317
1258 Ga0373926_0060367
1259 Ga0373934_0040238
1260 Ga0373934_0046589
1261 Ga0373934_0089871
1262 Ga0373944_0006033
1263 Ga0373944_0042431
1264 Ga0373949_0025691
1265 Ga0373951_0009307
1266 Ga0373923_0000187
1267 Ga0373923_0016081
1268 Ga0373923_0055263
1269 Ga0373939_0002170
1270 Ga0373945_0000395
1271 Ga0373945_0003211
1272 Ga0373953_0019396
1273 Ga0373953_0034980
1274 Ga0373953_0046283
1275 Ga0373954_0017828
1276 Ga0373954_0034984
1277 Ga0373954_0066955
1278 Ga0373954_0115911
1279 Ga0373956_0005701
1280 Ga0373956_0254698
1281 Ga0373957_0135237
1282 Ga0373960_0000484
1283 Ga0373943_0034727
1284 Ga0373943_0071276
1285 Ga0373946_0004740
1286 Ga0373955_0002533
1287 Ga0373955_0005096
1288 Ga0373955_0007708
1289 Ga0373955_0023343
1290 Ga0373955_0109181
1291 Ga0373924_0005631
1292 Ga0373924_0015589
1293 Ga0373924_0016367
1294 Ga0373931_0156013
1295 Ga0373935_0054490
1296 Ga0373935_0167895
1297 Ga0373927_0379891
1298 Ga0373933_0001526
1299 Ga0373933_0008071
1300 Ga0373933_0009795
1301 Ga0373933_0013460
1302 Ga0373933_0043828
1303 Ga0373947_0021752
1304 Ga0373947_0030734
1305 Ga0373947_0113525
1306 Ga0373937_0002031
1307 Ga0373937_0002067
1308 Ga0373937_0004072
1309 Ga0373937_0008320
1310 Ga0373937_0087024
1311 Ga0373925_0001686
1312 Ga0373925_0031318
1313 Ga0395899_0019740
1314 Ga0395900_0052617
1315 Ga0395898_0004229
1316 Ga0395901_0080318
1317 Ga0436361_0130184
1318 Ga0439450_016497
1319 Ga0466963_0070500
1320 Ga0466957_0063752
1321 Ga0466958_0082359
1322 Ga0466958_0219030
1323 Ga0466967_0029718
1324 Ga0466967_0857896
1325 Ga0495592_0004354
1326 Ga0495592_0027953
1327 Ga0495592_0031428
1328 Ga0495603_0001272
1329 Ga0495629_0183377
1330 Ga0495641_0009857
1331 Ga0495641_0157066
1332 Ga0495651_0017193
1333 Ga0495651_0017806
1334 Ga0495651_0019768
1335 Ga0495651_0128542
1336 Ga0495651_0407738
1337 Ga0495653_0023158
1338 Ga0495653_0106288
1339 Ga0495653_0124757
1340 Ga0495653_0445627
1341 Ga0495582_0024852
1342 Ga0495605_0129230
1343 Ga0495639_0026384
1344 Ga0495662_0002967
1345 Ga0495662_0039088
1346 Ga0495664_0015764
1347 Ga0495664_0027553
1348 Ga0495664_0040651
1349 Ga0495584_0052151
1350 Ga0495585_0003052
1351 Ga0495607_0003738
1352 Ga0495608_0020801
1353 Ga0495618_0013696
1354 Ga0495618_0052342
1355 Ga0495618_0408031
1356 Ga0495628_0004484
1357 Ga0495630_0166620
1358 Ga0495630_0175702
1359 Ga0495637_0015585
1360 Ga0495644_0000312
1361 Ga0495666_0003560
1362 Ga0495652_0023265
1363 Ga0495652_0051909
1364 Ga0495652_0134790
1365 Ga0495652_0158435
1366 Ga0495652_0194778
1367 Ga0495665_0007736
1368 Ga0495665_0177461
1369 Ga0495640_0022952
1370 Ga0495640_0032635
1371 Ga0495640_0040917
1372 Ga0495640_0166599
1373 Ga0495586_0226771
1374 Ga0495587_0182006
1375 Ga0495645_0001254
1376 Ga0495645_0023097
1377 Ga0495645_0262966
1378 Ga0495622_0003315
1379 Ga0495633_0001295
1380 Ga0495667_0013991
1381 Ga0495667_0056627
1382 Ga0495667_0396024
1383 Ga0495656_0000338
1384 Ga0495634_0041890
1385 Ga0495634_0354786
1386 Ga0495611_0003977
1387 Ga0495635_0017003
1388 Ga0495635_0018319
1389 Ga0495635_0049373
1390 Ga0495635_0066075
1391 Ga0495659_0000500
1392 Ga0495661_0012316
1393 Ga0495588_0007831
1394 Ga0495657_0025807
1395 Ga0495657_0060535
1396 Ga0495599_0003098
1397 Ga0495599_0082617
1398 Ga0495599_0193896
1399 Ga0495623_0001432
1400 Ga0495623_0002450
1401 Ga0495646_0002685
1402 Ga0495646_0254689
1403 Ga0495647_0010841
1404 Ga0495647_0070479
1405 Ga0495658_0036768
1406 Ga0495658_0354600
1407 Ga0495613_0043715
1408 Ga0495613_0274231
1409 Ga0495613_0380244
1410 Ga0495624_0165859
1411 Ga0495670_0000232
1412 Ga0495671_0108037
1413 Ga0495589_0021795
1414 Ga0495600_0012643
1415 Ga0495600_0033437
1416 Ga0495600_0077665
1417 Ga0495581_0004228
1418 Ga0495581_0359211
1419 Ga0495604_0023070
1420 Ga0495604_0026371
1421 Ga0495604_0028582
1422 Ga0495604_0054077
1423 Ga0495674_0021621
1424 Ga0495674_0053744
1425 Ga0495674_0071493
1426 Ga0495680_0005660
1427 Ga0495680_0013213
1428 Ga0495680_0013375
1429 Ga0495680_0096671
1430 Ga0495680_0153143
1431 Ga0495680_0465328
1432 Ga0495675_0001159
1433 Ga0495675_0074768
1434 Ga0495677_0020408
1435 Ga0495679_011022
1436 Ga0495684_0009284
1437 Ga0495684_0139189
1438 Ga0495593_0002529
1439 Ga0495602_0001877
1440 Ga0495602_0016985
1441 Ga0495602_0093353
1442 Ga0495602_0365239
1443 Ga0495614_0026235
1444 Ga0495614_0260052
1445 Ga0496100_0006271
1446 Ga0496100_0030488
1447 Ga0496100_0123679
1448 Ga0496101_0000833
1449 Ga0496101_0021356
1450 Ga0496101_0143775
1451 Ga0496102_0011433
1452 Ga0496102_0045178
1453 Ga0496103_0000963
1454 Ga0496103_0043097
1455 Ga0496103_0043842
1456 Ga0496103_0419923
1457 Ga0496104_0000065
1458 Ga0496104_0005391
1459 Ga0496104_0038325
1460 Ga0496104_0040089
1461 Ga0496104_0120340
1462 Ga0496105_0010839
1463 Ga0496105_0023647
1464 Ga0496105_0167840
1465 Ga0496106_0002101
1466 Ga0496106_0033955
1467 Ga0496106_0044691
1468 Ga0496106_0274819
1469 Ga0496107_0011980
1470 Ga0496107_0067509
1471 Ga0496108_0016701
1472 Ga0496108_0027237
1473 Ga0496108_0028578
1474 Ga0496108_0043867
1475 Ga0496109_0001690
1476 Ga0496109_0005126
1477 Ga0496109_0015815
1478 Ga0496109_0093978
1479 Ga0496110_0023713
1480 Ga0496110_0031756
1481 Ga0496110_0285028
1482 Ga0496110_0593173
1483 Ga0496111_0025624
1484 Ga0496111_0079212
1485 Ga0496111_0094465
1486 Ga0496112_0023903
1487 Ga0496112_0102795
1488 Ga0496112_0161739
1489 Ga0496112_1010316
1490 Ga0496113_0000329
1491 Ga0496113_0035504
1492 Ga0496113_0083893
1493 Ga0496114_0009201
1494 Ga0496115_0044892
1495 Ga0496115_0050554
1496 Ga0496115_0073180
1497 Ga0496115_0184978
1498 Ga0496115_0297969
1499 Ga0501031_0006312
1500 Ga0501031_0060301
1501 Ga0501032_0015540
1502 Ga0501032_0017462
1503 Ga0501033_0030659
1504 Ga0501033_0107183
1505 Ga0501033_0113285
1506 Ga0501034_0001584
1507 Ga0501034_0031753
1508 Ga0501034_0071243
1509 Ga0501034_0244523
1510 Ga0501034_0340083
1511 Ga0501034_0673519
1512 Ga0501036_0001347
1513 Ga0501036_0009565
1514 Ga0501036_0018017
1515 Ga0501036_0044766
1516 Ga0501036_0112893
1517 Ga0501037_0001187
1518 Ga0501037_0069506
1519 Ga0501037_0083619
1520 Ga0501037_0097960
1521 Ga0501037_0203275
1522 Ga0501038_0019987
1523 Ga0501038_0020401
1524 Ga0501038_0065777
1525 Ga0501038_0507482
1526 Ga0501039_0018702
1527 Ga0501039_0074330
1528 Ga0501039_0123670
1529 Ga0501039_0518880
1530 Ga0501040_0062313
1531 Ga0501040_0063757
1532 Ga0501042_0180269
1533 Ga0501043_0001872
1534 Ga0501043_0010758
1535 Ga0501043_0070280
1536 Ga0501046_0038531
1537 Ga0501046_0053120
1538 Ga0501047_0006650
1539 Ga0501047_0011585
1540 Ga0501047_0016035
1541 Ga0501047_0023087
1542 Ga0501047_0056959
1543 Ga0501047_0119174
1544 Ga0501047_0135638
1545 Ga0501047_0177364
1546 Ga0501047_0282384
1547 Ga0501048_0000039
1548 Ga0501048_0012298
1549 Ga0501048_0023363
1550 Ga0501067_0006525
1551 Ga0501067_0225015
1552 Ga0501068_0007550
1553 Ga0501068_0012538
1554 Ga0501068_0060494
1555 Ga0501068_0126059
1556 Ga0501068_0152702
1557 Ga0501069_0020092
1558 Ga0501069_0021374
1559 Ga0501069_0090850
1560 Ga0501069_0254017
1561 Ga0501070_0006927
1562 Ga0501070_0008380
1563 Ga0501070_0009049
1564 Ga0501070_0010886
1565 Ga0501070_0033855
1566 Ga0501070_0077826
1567 Ga0501070_0206242
1568 Ga0501070_0335663
1569 Ga0501070_0400366
1570 Ga0501071_0014377
1571 Ga0501071_0020484
1572 Ga0501071_0267814
1573 Ga0501072_0019231
1574 Ga0501072_0117623
1575 Ga0501072_0135982
1576 Ga0501072_0206496
1577 Ga0501073_0015959
1578 Ga0501073_0027790
1579 Ga0501073_0309152
1580 Ga0501074_0006728
1581 Ga0501074_0021551
1582 Ga0501074_0031302
1583 Ga0501074_0099312
1584 Ga0501074_0497655
1585 Ga0501075_0109585
1586 Ga0501075_0132237
1587 Ga0501076_0125461
1588 Ga0501076_0184391
1589 Ga0501077_0011615
1590 Ga0501077_0080756
1591 Ga0501079_0013096
1592 Ga0501079_0408742
1593 Ga0501079_0607745
1594 Ga0501080_0000022
1595 Ga0501080_0026488
1596 Ga0501080_0053406
1597 Ga0501080_0146136
1598 Ga0501080_0263059
1599 Ga0501080_0266102
1600 Ga0501080_0312795
1601 Ga0501080_0399828
1602 Ga0501080_0411889
1603 Ga0501080_0451264
1604 Ga0501081_0208998
1605 Ga0501083_0001941
1606 Ga0501083_0024820
1607 Ga0501083_0026149
1608 Ga0501083_0058001
1609 Ga0501083_0128696
1610 Ga0501035_0000655
1611 Ga0501035_0008096
1612 Ga0501035_0031789
1613 Ga0501035_0155709
1614 Ga0501035_0159289
1615 Ga0501035_0216398
1616 Ga0501044_0005112
1617 Ga0501044_0023300
1618 Ga0501044_0037388
1619 Ga0501044_0106451
1620 Ga0501044_0128195
1621 Ga0501044_0298846
1622 Ga0501044_0324039
1623 Ga0501044_0354220
1624 Ga0501045_0065925
1625 Ga0501045_0126373
1626 nmdc:mga03683_35426_c1
1627 nmdc:mga00v17_146286_c1
1628 nmdc:mga0k408_75369_c1
1629 nmdc:mga06z11_445988_c1
1630 nmdc:mga0n895_54135_c1
1631 nmdc:mga0n895_96925_c1
1632 nmdc:mga0rr50_148960_c1
1633 nmdc:mga0rr50_710982_c1
1634 nmdc:mga08x19_243843_c1
1635 Ga0495601_0000225
1636 Ga0495601_0001233
1637 Ga0495601_0002814
1638 Ga0495601_0007348
1639 Ga0495612_0000405
1640 Ga0495612_0005171
1641 Ga0495612_0007159
1642 Ga0495612_0027580
1643 Ga0495595_0000616
1644 Ga0495595_0003155
1645 Ga0495595_0014630
1646 Ga0495595_0016278
1647 Ga0495595_0088257
1648 Ga0495619_0000083
1649 Ga0495619_0001284
1650 Ga0495619_0012744
1651 Ga0495619_0044225
1652 Ga0495619_0045033
1653 Ga0495619_0329939
1654 Ga0500566_0060799
1655 Ga0500566_0217555
1656 Ga0500641_0140510
1657 Ga0500650_0163553
1658 Ga0500562_030034
1659 Ga0500595_000003
1660 Ga0500618_024028
1661 Ga0500658_0078082
1662 Ga0500616_0000002
1663 Ga0501084_0013445
1664 Ga0501084_0669724
1665 Ga0501082_0021232
1666 Ga0501082_0083499
1667 Ga0501082_0089643
1668 Ga0501082_0105235
1669 Ga0466962_0061657
1670 Ga0530510_0107854
1671 Ga0530510_0580173
1672 2643754955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ni7-assembly1.cif.gz_B crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.8097 21 197
3ni7-assembly1.cif.gz_A crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.8044 23 197
3ni7-assembly1.cif.gz_B crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.7934 21 197
3ni7-assembly1.cif.gz_A crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.7802 23 197
3c07-assembly1.cif.gz_A crystal structure of a tetr family transcriptional regulator from streptomyces coelicolor a3(2) 0.7704 23 197
ID Description Score Start End Superfamily
6hodA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9551 21 64 1.10.10.60
6ho0A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9533 21 64 1.10.10.60
3g1oA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9502 22 64 1.10.10.60
6azhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9493 23 68 1.10.10.60
5f04A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9475 21 64 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7W0XMZ9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9855 22 209 GO:0003677
AF-A0A2N6B5K2-F1-model_v4 TetR family transcriptional regulator 0.9807 22 209
AF-A0A346R4N6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9767 22 215 GO:0003677
AF-A0A327JWW7-F1-model_v4 HTH tetR-type domain-containing protein 0.9765 22 216 GO:0003677
AF-A0A5D0VHX0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9754 22 215 GO:0003677

Map