F482938

General Info

Members Datasets Scaffolds Average Seq Length
837 290 837 208

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10354239|Ga0207681_103542391
Length 250
Sequence MSAKVLTKAAAKEAKIEIIENGRGTQAVHDAVVAMRAARRSGSANTKTKAEVDLSGAKPWRQKGTGRARAGYKSSPIWRGGGVVFGPKPRDYSKKVSKSVRRLAFHKALSERIKAGDVLTIDKFAVSELKTKSFVDLVRKQTDAEKVLIVSDSFDEKTFKSARNVKPPCSLIRLRTLRRAEDRDRHVVGLDAEVDDERHADLEVVLVAPFDVGHHPRTLLEIDHRGDVRHALVEGRKIVAAHVSLMDAPV

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
289 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
290 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 6.57
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1511392 2162886006 Bacteria 1295
2 SwRhRL2b_contig_157882 2162886007 Bacteria 7063
3 CNXas_1000052 3300000545 Bacteria 22151
4 JGI24035J26624_1001915 3300002126 Unclassified 1942
5 JGI25406J46586_10000001 3300003203 Bacteria 251772
6 JGI25406J46586_10000007 3300003203 Bacteria 112227
7 rootL2_10163792 3300003322 Bacteria 3522
8 JGI25405J52794_10000497 3300003911 Bacteria 5665
9 JGI25405J52794_10035337 3300003911 Bacteria 1046
10 JGI25405J52794_10045831 3300003911 Bacteria 931
11 Ga0065703_1019589 3300005272 Bacteria 2689
12 Ga0065704_10086836 3300005289 Bacteria 3079
13 Ga0065704_10245549 3300005289 Bacteria 1003
14 Ga0065712_10001341 3300005290 Bacteria 6456
15 Ga0065712_10006266 3300005290 Unclassified 2658
16 Ga0065712_10223303 3300005290 Bacteria 1034
17 Ga0065712_10273400 3300005290 Unclassified 911
18 Ga0065715_10001210 3300005293 Bacteria 9966
19 Ga0065715_10001337 3300005293 Bacteria 11995
20 Ga0065715_10006003 3300005293 Bacteria 6856
21 Ga0065715_10006907 3300005293 Bacteria 4196
22 Ga0065715_10104827 3300005293 Bacteria 2931
23 Ga0065715_10133814 3300005293 Unclassified 1962
24 Ga0065715_10308998 3300005293 Bacteria 1017
25 Ga0065707_10002326 3300005295 Bacteria 7744
26 Ga0065707_10105144 3300005295 Bacteria 2659
27 Ga0065707_10158891 3300005295 Unclassified 1582
28 Ga0070658_10025644 3300005327 Bacteria 4725
29 Ga0070658_10075379 3300005327 Bacteria 2767
30 Ga0070658_10084079 3300005327 Bacteria 2617
31 Ga0070658_10094139 3300005327 Bacteria 2471
32 Ga0070676_10006857 3300005328 Bacteria 6100
33 Ga0070676_10012318 3300005328 Bacteria 4663
34 Ga0070676_10013851 3300005328 Bacteria 4424
35 Ga0070683_100014335 3300005329 Bacteria 6932
36 Ga0070683_100014620 3300005329 Bacteria 6873
37 Ga0070683_100093797 3300005329 Bacteria 2821
38 Ga0070690_100053225 3300005330 Bacteria 2589
39 Ga0070670_100248667 3300005331 Bacteria 1549
40 Ga0070677_10005596 3300005333 Bacteria 4146
41 Ga0070666_10004276 3300005335 Bacteria 8684
42 Ga0070666_10026532 3300005335 Bacteria 3787
43 Ga0070666_10054780 3300005335 Bacteria 2690
44 Ga0070666_10199507 3300005335 Bacteria 1407
45 Ga0070666_10326257 3300005335 Unclassified 1095
46 Ga0068868_100029621 3300005338 Bacteria 4193
47 Ga0068868_100057916 3300005338 Bacteria 3062
48 Ga0068868_100067232 3300005338 Bacteria 2852
49 Ga0068868_100126997 3300005338 Bacteria 2084
50 Ga0068868_100194101 3300005338 Bacteria 1689
51 Ga0068868_100214619 3300005338 Bacteria 1609
52 Ga0068868_100325778 3300005338 Bacteria 1310
53 Ga0068868_100432416 3300005338 Bacteria 1141
54 Ga0070660_100103069 3300005339 Bacteria 2262
55 Ga0070660_100342014 3300005339 Unclassified 1231
56 Ga0070660_100438467 3300005339 Bacteria 1083
57 Ga0070689_100009585 3300005340 Bacteria 6870
58 Ga0070689_100114177 3300005340 Bacteria 2151
59 Ga0070689_100965139 3300005340 Unclassified 757
60 Ga0070687_100000382 3300005343 Bacteria 15047
61 Ga0070687_100308397 3300005343 Unclassified 1007
62 Ga0070661_100092920 3300005344 Unclassified 2236
63 Ga0070661_100729087 3300005344 Unclassified 809
64 Ga0070661_101206117 3300005344 Bacteria 633
65 Ga0070668_100000403 3300005347 Bacteria 28684
66 Ga0070668_100004836 3300005347 Bacteria 9989
67 Ga0070668_100007390 3300005347 Bacteria 8153
68 Ga0070668_100040758 3300005347 Bacteria 3554
69 Ga0070668_100175817 3300005347 Bacteria 1745
70 Ga0070669_100002011 3300005353 Bacteria 14710
71 Ga0070669_100008062 3300005353 Bacteria 7522
72 Ga0070669_100033499 3300005353 Bacteria 3716
73 Ga0070669_100065736 3300005353 Bacteria 2672
74 Ga0070669_100128080 3300005353 Unclassified 1944
75 Ga0070669_100182783 3300005353 Unclassified 1641
76 Ga0070675_100005920 3300005354 Bacteria 9365
77 Ga0070675_100008984 3300005354 Bacteria 7762
78 Ga0070675_100014207 3300005354 Bacteria 6276
79 Ga0070675_100069033 3300005354 Bacteria 2927
80 Ga0070675_100078814 3300005354 Bacteria 2744
81 Ga0070675_100197214 3300005354 Bacteria 1746
82 Ga0070675_100607122 3300005354 Bacteria 992
83 Ga0070675_100677838 3300005354 Unclassified 938
84 Ga0070671_100002459 3300005355 Bacteria 14322
85 Ga0070671_100011495 3300005355 Bacteria 7116
86 Ga0070671_100012710 3300005355 Bacteria 6787
87 Ga0070671_100047861 3300005355 Bacteria 3554
88 Ga0070671_100142680 3300005355 Bacteria 2021
89 Ga0070671_100249573 3300005355 Bacteria 1507
90 Ga0070671_100367312 3300005355 Unclassified 1229
91 Ga0070674_100000912 3300005356 Bacteria 15424
92 Ga0070674_100046469 3300005356 Bacteria 2970
93 Ga0070674_100129388 3300005356 Bacteria 1880
94 Ga0070673_100022910 3300005364 Bacteria 4556
95 Ga0070673_100091970 3300005364 Bacteria 2480
96 Ga0070673_100093233 3300005364 Bacteria 2465
97 Ga0070673_100280195 3300005364 Unclassified 1462
98 Ga0070673_100443023 3300005364 Bacteria 1167
99 Ga0070688_100000733 3300005365 Bacteria 16191
100 Ga0070688_100001414 3300005365 Bacteria 11953
101 Ga0070688_100036885 3300005365 Bacteria 2975
102 Ga0070688_100201836 3300005365 Bacteria 1391
103 Ga0070688_100357767 3300005365 Unclassified 1070
104 Ga0070659_100002483 3300005366 Bacteria 13098
105 Ga0070659_100004760 3300005366 Bacteria 9700
106 Ga0070659_100255238 3300005366 Unclassified 1454
107 Ga0070659_100343778 3300005366 Bacteria 1251
108 Ga0070667_100004665 3300005367 Bacteria 11504
109 Ga0070667_100018952 3300005367 Bacteria 5706
110 Ga0070667_100025188 3300005367 Bacteria 4945
111 Ga0070667_100037302 3300005367 Bacteria 4075
112 Ga0070667_100048750 3300005367 Bacteria 3565
113 Ga0070667_100054124 3300005367 Bacteria 3388
114 Ga0070667_100081996 3300005367 Bacteria 2760
115 Ga0070667_100788782 3300005367 Bacteria 882
116 Ga0070667_101070479 3300005367 Bacteria 753
117 Ga0070703_10042498 3300005406 Bacteria 1421
118 Ga0070709_10008550 3300005434 Bacteria 5627
119 Ga0070709_10295089 3300005434 Unclassified 1182
120 Ga0070714_100548650 3300005435 Unclassified 1106
121 Ga0070714_100814949 3300005435 Bacteria 904
122 Ga0070713_100005485 3300005436 Bacteria 8680
123 Ga0070713_100189526 3300005436 Bacteria 1852
124 Ga0070713_100346057 3300005436 Unclassified 1378
125 Ga0070710_10480747 3300005437 Bacteria 847
126 Ga0070701_10306214 3300005438 Bacteria 978
127 Ga0070711_100005001 3300005439 Bacteria 7876
128 Ga0070711_100060582 3300005439 Unclassified 2631
129 Ga0070711_100104829 3300005439 Bacteria 2064
130 Ga0070711_100193299 3300005439 Bacteria 1565
131 Ga0070711_100219627 3300005439 Bacteria 1477
132 Ga0070705_100015270 3300005440 Bacteria 3965
133 Ga0070705_100017440 3300005440 Bacteria 3748
134 Ga0070705_100383762 3300005440 Unclassified 1035
135 Ga0070700_100044032 3300005441 Bacteria 2747
136 Ga0070694_100016943 3300005444 Bacteria 4596
137 Ga0070694_100261255 3300005444 Bacteria 1313
138 Ga0070708_100023964 3300005445 Bacteria 5195
139 Ga0070708_100024432 3300005445 Bacteria 5156
140 Ga0070708_100031777 3300005445 Bacteria 4572
141 Ga0070708_100099238 3300005445 Bacteria 2664
142 Ga0070708_100138340 3300005445 Bacteria 2257
143 Ga0070708_100158709 3300005445 Unclassified 2107
144 Ga0070708_100180181 3300005445 Bacteria 1974
145 Ga0070708_100259323 3300005445 Bacteria 1634
146 Ga0070708_100371424 3300005445 Bacteria 1348
147 Ga0070708_100515544 3300005445 Bacteria 1128
148 Ga0070663_100033694 3300005455 Bacteria 3540
149 Ga0070678_100040339 3300005456 Bacteria 3303
150 Ga0070678_100108297 3300005456 Bacteria 2169
151 Ga0070678_100262041 3300005456 Bacteria 1454
152 Ga0070678_100508932 3300005456 Unclassified 1063
153 Ga0070662_100007763 3300005457 Bacteria 6969
154 Ga0070662_100024478 3300005457 Bacteria 4159
155 Ga0070662_100112438 3300005457 Bacteria 2076
156 Ga0070662_100231057 3300005457 Bacteria 1480
157 Ga0068867_100150920 3300005459 Bacteria 1825
158 Ga0068867_100197877 3300005459 Bacteria 1607
159 Ga0068867_100220792 3300005459 Bacteria 1527
160 Ga0070685_10045062 3300005466 Bacteria 2527
161 Ga0070685_10129998 3300005466 Bacteria 1573
162 Ga0070706_100000210 3300005467 Bacteria 71893
163 Ga0070706_100041224 3300005467 Bacteria 4262
164 Ga0070706_100068396 3300005467 Bacteria 3284
165 Ga0070706_100099800 3300005467 Unclassified 2697
166 Ga0070706_100100812 3300005467 Bacteria 2683
167 Ga0070706_100129058 3300005467 Bacteria 2358
168 Ga0070706_100153713 3300005467 Bacteria 2148
169 Ga0070706_100278642 3300005467 Bacteria 1560
170 Ga0070706_100293023 3300005467 Bacteria 1518
171 Ga0070706_100314451 3300005467 Bacteria 1461
172 Ga0070706_100323488 3300005467 Bacteria 1438
173 Ga0070706_100414212 3300005467 Bacteria 1254
174 Ga0070706_100882431 3300005467 Bacteria 826
175 Ga0070707_100001841 3300005468 Bacteria 20359
176 Ga0070707_100003721 3300005468 Bacteria 14386
177 Ga0070707_100033325 3300005468 Bacteria 4911
178 Ga0070707_100060424 3300005468 Bacteria 3635
179 Ga0070707_100062020 3300005468 Bacteria 3586
180 Ga0070707_100067576 3300005468 Unclassified 3438
181 Ga0070707_100098037 3300005468 Bacteria 2839
182 Ga0070707_100113761 3300005468 Unclassified 2626
183 Ga0070707_100197041 3300005468 Bacteria 1963
184 Ga0070707_100226363 3300005468 Bacteria 1821
185 Ga0070707_100351433 3300005468 Bacteria 1432
186 Ga0070707_100448468 3300005468 Unclassified 1251
187 Ga0070707_100574688 3300005468 Bacteria 1089
188 Ga0070698_100001836 3300005471 Bacteria 23657
189 Ga0070698_100012011 3300005471 Bacteria 9181
190 Ga0070698_100088458 3300005471 Bacteria 3083
191 Ga0070698_100105120 3300005471 Unclassified 2793
192 Ga0070698_100194316 3300005471 Bacteria 1966
193 Ga0070698_100246137 3300005471 Bacteria 1721
194 Ga0070698_100271036 3300005471 Bacteria 1629
195 Ga0070698_100798110 3300005471 Bacteria 888
196 Ga0070699_100089693 3300005518 Bacteria 2687
197 Ga0070699_100328077 3300005518 Bacteria 1376
198 Ga0070699_100379233 3300005518 Bacteria 1276
199 Ga0070679_100096055 3300005530 Unclassified 2951
200 Ga0070684_100001475 3300005535 Bacteria 16973
201 Ga0070684_100033042 3300005535 Bacteria 4414
202 Ga0070697_100000826 3300005536 Bacteria 23247
203 Ga0070697_100002768 3300005536 Bacteria 13496
204 Ga0070697_100022327 3300005536 Bacteria 5022
205 Ga0070697_100038008 3300005536 Bacteria 3888
206 Ga0070697_100076088 3300005536 Bacteria 2760
207 Ga0070697_100118459 3300005536 Bacteria 2213
208 Ga0070697_100149612 3300005536 Unclassified 1968
209 Ga0070697_100438585 3300005536 Unclassified 1136
210 Ga0070697_100765449 3300005536 Bacteria 853
211 Ga0068853_100406604 3300005539 Bacteria 1275
212 Ga0068853_100791601 3300005539 Bacteria 908
213 Ga0070672_100000808 3300005543 Bacteria 18707
214 Ga0070672_100046256 3300005543 Bacteria 3371
215 Ga0070672_100157475 3300005543 Unclassified 1882
216 Ga0070672_100199568 3300005543 Bacteria 1672
217 Ga0070672_100558585 3300005543 Bacteria 994
218 Ga0070686_100049196 3300005544 Unclassified 2673
219 Ga0070696_100032501 3300005546 Bacteria 3579
220 Ga0070665_100014536 3300005548 Bacteria 7897
221 Ga0070665_100015162 3300005548 Bacteria 7738
222 Ga0070665_100051910 3300005548 Bacteria 4112
223 Ga0070665_100090881 3300005548 Bacteria 3059
224 Ga0070665_100165819 3300005548 Bacteria 2211
225 Ga0070665_100171092 3300005548 Unclassified 2173
226 Ga0070704_100018431 3300005549 Bacteria 4464
227 Ga0070704_100078384 3300005549 Bacteria 2424
228 Ga0070704_100108655 3300005549 Unclassified 2106
229 Ga0068855_100130645 3300005563 Bacteria 2869
230 Ga0068855_100372390 3300005563 Bacteria 1570
231 Ga0068855_100753013 3300005563 Unclassified 1038
232 Ga0070664_100037306 3300005564 Bacteria 4086
233 Ga0070664_100163850 3300005564 Unclassified 1969
234 Ga0070664_100244117 3300005564 Unclassified 1613
235 Ga0068856_101450609 3300005614 Bacteria 700
236 Ga0070702_100662645 3300005615 Unclassified 791
237 Ga0068852_100477245 3300005616 Bacteria 1239
238 Ga0068852_100780153 3300005616 Unclassified 969
239 Ga0068859_100022886 3300005617 Bacteria 6266
240 Ga0068864_100098211 3300005618 Bacteria 2593
241 Ga0068864_100991929 3300005618 Bacteria 833
242 Ga0068866_10195272 3300005718 Bacteria 1205
243 Ga0068861_100086770 3300005719 Bacteria 2461
244 Ga0068851_10204951 3300005834 Bacteria 1102
245 Ga0068863_100007967 3300005841 Bacteria 10355
246 Ga0068858_100043497 3300005842 Bacteria 4164
247 Ga0068858_100092563 3300005842 Bacteria 2814
248 Ga0068858_100230990 3300005842 Bacteria 1754
249 Ga0068860_100010603 3300005843 Bacteria 9101
250 Ga0068860_100017144 3300005843 Bacteria 7061
251 Ga0068860_100174888 3300005843 Bacteria 2075
252 Ga0068860_100465972 3300005843 Bacteria 1258
253 Ga0068860_100985539 3300005843 Bacteria 860
254 Ga0068860_101162264 3300005843 Unclassified 792
255 Ga0068860_101170895 3300005843 Bacteria 789
256 Ga0068862_100008330 3300005844 Bacteria 8579
257 Ga0068862_100448989 3300005844 Bacteria 1215
258 Ga0068862_101102679 3300005844 Bacteria 789
259 Ga0081455_10000328 3300005937 Bacteria 62204
260 Ga0081455_10001697 3300005937 Bacteria 26660
261 Ga0081455_10021927 3300005937 Bacteria 5982
262 Ga0081455_10029562 3300005937 Bacteria 4994
263 Ga0081455_10063112 3300005937 Bacteria 3110
264 Ga0081455_10158887 3300005937 Bacteria 1735
265 Ga0081540_1000036 3300005983 Bacteria 140805
266 Ga0081540_1044314 3300005983 Bacteria 2272
267 Ga0081540_1095039 3300005983 Bacteria 1300
268 Ga0081539_10000014 3300005985 Bacteria 411270
269 Ga0081539_10003851 3300005985 Bacteria 17593
270 Ga0081539_10013488 3300005985 Bacteria 6152
271 Ga0081539_10015406 3300005985 Bacteria 5558
272 Ga0081539_10017541 3300005985 Bacteria 5019
273 Ga0070717_10002256 3300006028 Bacteria 13517
274 Ga0070717_10034711 3300006028 Bacteria 4079
275 Ga0070717_10037696 3300006028 Bacteria 3927
276 Ga0070717_10164607 3300006028 Bacteria 1926
277 Ga0070717_10254282 3300006028 Bacteria 1553
278 Ga0070717_10666151 3300006028 Unclassified 945
279 Ga0070717_10684583 3300006028 Bacteria 931
280 Ga0070715_10341462 3300006163 Bacteria 815
281 Ga0070716_100016810 3300006173 Bacteria 3783
282 Ga0070716_100036195 3300006173 Bacteria 2720
283 Ga0070716_100041479 3300006173 Bacteria 2564
284 Ga0070716_100254021 3300006173 Unclassified 1199
285 Ga0070716_100264003 3300006173 Bacteria 1179
286 Ga0070716_100697351 3300006173 Bacteria 775
287 Ga0070712_100050761 3300006175 Bacteria 2887
288 Ga0070712_100163392 3300006175 Bacteria 1721
289 Ga0070712_100712383 3300006175 Unclassified 856
290 Ga0075362_10005306 3300006177 Bacteria 4707
291 Ga0075367_10204473 3300006178 Bacteria 1234
292 Ga0075366_10001400 3300006195 Bacteria 12079
293 Ga0097621_100031766 3300006237 Bacteria 4191
294 Ga0097621_100064714 3300006237 Bacteria 3008
295 Ga0097621_100108150 3300006237 Bacteria 2347
296 Ga0097621_100281893 3300006237 Unclassified 1463
297 Ga0068871_100042623 3300006358 Bacteria 3644
298 Ga0068871_100063216 3300006358 Bacteria 3027
299 Ga0068871_100087068 3300006358 Bacteria 2596
300 Ga0068871_100129048 3300006358 Bacteria 2142
301 Ga0068871_100272171 3300006358 Unclassified 1480
302 Ga0075433_10212447 3300006852 Bacteria 1719
303 Ga0075434_100138435 3300006871 Bacteria 2454
304 Ga0075434_100534688 3300006871 Bacteria 1192
305 Ga0068865_100002077 3300006881 Bacteria 11832
306 Ga0068865_100068978 3300006881 Bacteria 2501
307 Ga0068865_100471370 3300006881 Bacteria 1042
308 Ga0075436_100055297 3300006914 Unclassified 2740
309 Ga0075436_100160296 3300006914 Bacteria 1585
310 Ga0097620_100022886 3300006931 Bacteria 6266
311 Ga0075435_100521424 3300007076 Bacteria 1028
312 Ga0105240_10462896 3300009093 Unclassified 1417
313 Ga0105240_11437792 3300009093 Bacteria 724
314 Ga0111539_10552707 3300009094 Bacteria 1341
315 Ga0105245_10075162 3300009098 Bacteria 3076
316 Ga0105245_10098347 3300009098 Bacteria 2704
317 Ga0105245_10302968 3300009098 Bacteria 1569
318 Ga0105245_10365270 3300009098 Unclassified 1433
319 Ga0105245_10396933 3300009098 Unclassified 1377
320 Ga0105245_10536584 3300009098 Bacteria 1190
321 Ga0105247_10064781 3300009101 Bacteria 2272
322 Ga0114129_10003445 3300009147 Bacteria 22244
323 Ga0114129_10248724 3300009147 Unclassified 2387
324 Ga0114129_10609702 3300009147 Bacteria 1413
325 Ga0105243_10018077 3300009148 Bacteria 5334
326 Ga0105243_10712699 3300009148 Unclassified 979
327 Ga0105242_11307757 3300009176 Bacteria 749
328 Ga0105237_10045082 3300009545 Bacteria 4439
329 Ga0105237_10074141 3300009545 Bacteria 3395
330 Ga0105249_10018684 3300009553 Bacteria 6174
331 Ga0105249_10074789 3300009553 Bacteria 3136
332 Ga0105249_10137449 3300009553 Bacteria 2340
333 Ga0105249_11302295 3300009553 Bacteria 798
334 Ga0099796_10008395 3300010159 Bacteria 2751
335 Ga0099796_10056587 3300010159 Unclassified 1377
336 Ga0099796_10167614 3300010159 Unclassified 874
337 Ga0105239_10038497 3300010375 Bacteria 5241
338 Ga0105239_10069667 3300010375 Bacteria 3864
339 Ga0105239_10169916 3300010375 Bacteria 2438
340 Ga0105239_10213327 3300010375 Bacteria 2164
341 Ga0105239_10245175 3300010375 Unclassified 2011
342 Ga0105246_10475549 3300011119 Bacteria 1056
343 Ga0105246_10748933 3300011119 Unclassified 861
344 Ga0157371_10545069 3300013102 Bacteria 859
345 Ga0157370_10234834 3300013104 Bacteria 1697
346 Ga0157369_10101890 3300013105 Bacteria 3060
347 Ga0157374_10000026 3300013296 Bacteria 238236
348 Ga0157374_10001473 3300013296 Bacteria 19879
349 Ga0157374_10005577 3300013296 Bacteria 10597
350 Ga0157374_10018842 3300013296 Bacteria 6100
351 Ga0157374_10056568 3300013296 Bacteria 3662
352 Ga0157374_10086985 3300013296 Unclassified 2974
353 Ga0157374_10092382 3300013296 Bacteria 2887
354 Ga0157374_10180939 3300013296 Bacteria 2059
355 Ga0157374_10221459 3300013296 Bacteria 1857
356 Ga0157374_10225899 3300013296 Bacteria 1838
357 Ga0157374_10598674 3300013296 Unclassified 1112
358 Ga0157374_10728606 3300013296 Bacteria 1006
359 Ga0157374_11113292 3300013296 Unclassified 810
360 Ga0157378_10009019 3300013297 Bacteria 8684
361 Ga0157378_10009704 3300013297 Bacteria 8385
362 Ga0157378_10021310 3300013297 Bacteria 5697
363 Ga0157378_10057797 3300013297 Bacteria 3458
364 Ga0157378_10216017 3300013297 Unclassified 1821
365 Ga0157378_10242977 3300013297 Bacteria 1720
366 Ga0157378_10275651 3300013297 Bacteria 1619
367 Ga0157378_10533444 3300013297 Bacteria 1177
368 Ga0157378_10534027 3300013297 Unclassified 1176
369 Ga0157378_10623515 3300013297 Bacteria 1092
370 Ga0163162_10002697 3300013306 Bacteria 16839
371 Ga0163162_10003249 3300013306 Bacteria 15541
372 Ga0163162_10014121 3300013306 Bacteria 7805
373 Ga0163162_10024438 3300013306 Bacteria 5964
374 Ga0163162_10112610 3300013306 Bacteria 2820
375 Ga0163162_10173422 3300013306 Bacteria 2281
376 Ga0157372_10045317 3300013307 Bacteria 4878
377 Ga0157372_10155739 3300013307 Unclassified 2639
378 Ga0157372_10329970 3300013307 Unclassified 1776
379 Ga0157372_10978731 3300013307 Bacteria 980
380 Ga0157372_11770033 3300013307 Bacteria 711
381 Ga0157375_10000287 3300013308 Bacteria 45998
382 Ga0157375_10001868 3300013308 Bacteria 18135
383 Ga0157375_10050268 3300013308 Bacteria 4089
384 Ga0157375_10089439 3300013308 Bacteria 3135
385 Ga0157375_10101429 3300013308 Bacteria 2961
386 Ga0157375_10156755 3300013308 Unclassified 2416
387 Ga0157375_11382136 3300013308 Unclassified 829
388 Ga0157375_11795681 3300013308 Bacteria 727
389 Ga0163163_10106345 3300014325 Bacteria 2832
390 Ga0163163_10659116 3300014325 Unclassified 1110
391 Ga0182008_10034693 3300014497 Bacteria 2529
392 Ga0157377_10077841 3300014745 Bacteria 1932
393 Ga0157379_10005647 3300014968 Bacteria 10748
394 Ga0157376_10000112 3300014969 Bacteria 58430
395 Ga0157376_10009509 3300014969 Bacteria 7064
396 Ga0157376_10020829 3300014969 Bacteria 5081
397 Ga0157376_10075816 3300014969 Bacteria 2871
398 Ga0157376_10079496 3300014969 Bacteria 2811
399 Ga0157376_10097176 3300014969 Bacteria 2565
400 Ga0157376_10966546 3300014969 Unclassified 873
401 Ga0163161_10017041 3300017792 Bacteria 5081
402 Ga0163161_10381344 3300017792 Unclassified 1127
403 Ga0163161_10551356 3300017792 Bacteria 945
404 Ga0213873_10026666 3300021358 Unclassified 1404
405 Ga0213876_10004179 3300021384 Bacteria 8101
406 Ga0213876_10042150 3300021384 Bacteria 2412
407 Ga0213871_10007052 3300021441 Bacteria 2410
408 Ga0213871_10061942 3300021441 Bacteria 1043
409 Ga0224712_10087708 3300022467 Bacteria 1297
410 Ga0207666_1000509 3300025271 Bacteria 4770
411 Ga0207666_1002371 3300025271 Unclassified 2268
412 Ga0207673_1000205 3300025290 Bacteria 5944
413 Ga0207673_1001361 3300025290 Bacteria 2654
414 Ga0207673_1007376 3300025290 Bacteria 1377
415 Ga0207697_10000010 3300025315 Bacteria 65144
416 Ga0207697_10000131 3300025315 Bacteria 36154
417 Ga0207697_10000495 3300025315 Bacteria 22147
418 Ga0207697_10001701 3300025315 Bacteria 11844
419 Ga0207697_10003343 3300025315 Bacteria 7977
420 Ga0207697_10003602 3300025315 Bacteria 7598
421 Ga0207697_10010508 3300025315 Bacteria 3954
422 Ga0207697_10021523 3300025315 Bacteria 2640
423 Ga0207653_10043816 3300025885 Bacteria 1474
424 Ga0207682_10011464 3300025893 Bacteria 3461
425 Ga0207682_10020163 3300025893 Bacteria 2616
426 Ga0207682_10143698 3300025893 Bacteria 1072
427 Ga0207692_10008534 3300025898 Bacteria 4243
428 Ga0207692_10015694 3300025898 Bacteria 3340
429 Ga0207692_10158731 3300025898 Bacteria 1302
430 Ga0207692_10205959 3300025898 Bacteria 1159
431 Ga0207692_10378593 3300025898 Bacteria 878
432 Ga0207688_10007718 3300025901 Bacteria 5860
433 Ga0207688_10010727 3300025901 Bacteria 4986
434 Ga0207688_10054862 3300025901 Unclassified 2236
435 Ga0207688_10062026 3300025901 Bacteria 2108
436 Ga0207688_10106988 3300025901 Bacteria 1620
437 Ga0207680_10014436 3300025903 Bacteria 4088
438 Ga0207680_10166630 3300025903 Unclassified 1481
439 Ga0207680_10779436 3300025903 Unclassified 685
440 Ga0207647_10009265 3300025904 Bacteria 7000
441 Ga0207647_10048527 3300025904 Bacteria 2636
442 Ga0207685_10131690 3300025905 Unclassified 1111
443 Ga0207699_10004362 3300025906 Bacteria 6764
444 Ga0207699_10022105 3300025906 Bacteria 3442
445 Ga0207699_10033788 3300025906 Bacteria 2894
446 Ga0207699_10205569 3300025906 Bacteria 1337
447 Ga0207645_10001786 3300025907 Bacteria 17391
448 Ga0207645_10002762 3300025907 Bacteria 13659
449 Ga0207645_10004253 3300025907 Bacteria 10632
450 Ga0207645_10004432 3300025907 Bacteria 10394
451 Ga0207645_10192675 3300025907 Bacteria 1340
452 Ga0207705_10068346 3300025909 Bacteria 2572
453 Ga0207705_10085665 3300025909 Bacteria 2302
454 Ga0207705_10182042 3300025909 Bacteria 1586
455 Ga0207705_10215974 3300025909 Bacteria 1455
456 Ga0207705_10917967 3300025909 Bacteria 678
457 Ga0207684_10000028 3300025910 Bacteria 306450
458 Ga0207684_10008671 3300025910 Bacteria 9025
459 Ga0207684_10018780 3300025910 Bacteria 5916
460 Ga0207684_10047663 3300025910 Bacteria 3634
461 Ga0207684_10049861 3300025910 Bacteria 3551
462 Ga0207684_10086390 3300025910 Bacteria 2672
463 Ga0207684_10160762 3300025910 Bacteria 1934
464 Ga0207684_10297383 3300025910 Bacteria 1392
465 Ga0207684_10343629 3300025910 Bacteria 1285
466 Ga0207684_10371059 3300025910 Bacteria 1231
467 Ga0207684_10394442 3300025910 Bacteria 1190
468 Ga0207684_10468236 3300025910 Unclassified 1081
469 Ga0207684_10643493 3300025910 Bacteria 904
470 Ga0207671_10026904 3300025914 Bacteria 4303
471 Ga0207671_10183802 3300025914 Unclassified 1628
472 Ga0207693_10000889 3300025915 Bacteria 26818
473 Ga0207693_10049459 3300025915 Bacteria 3301
474 Ga0207693_10187584 3300025915 Unclassified 1627
475 Ga0207693_10541698 3300025915 Unclassified 908
476 Ga0207663_10002290 3300025916 Bacteria 9171
477 Ga0207663_10008643 3300025916 Bacteria 5341
478 Ga0207663_10023185 3300025916 Bacteria 3558
479 Ga0207663_10145505 3300025916 Bacteria 1656
480 Ga0207662_10000699 3300025918 Bacteria 15308
481 Ga0207662_10024747 3300025918 Bacteria 3455
482 Ga0207657_10179662 3300025919 Bacteria 1711
483 Ga0207657_10200978 3300025919 Bacteria 1603
484 Ga0207657_10295962 3300025919 Bacteria 1283
485 Ga0207657_10323849 3300025919 Unclassified 1218
486 Ga0207649_10116647 3300025920 Bacteria 1793
487 Ga0207649_10319701 3300025920 Bacteria 1140
488 Ga0207649_10703969 3300025920 Unclassified 784
489 Ga0207652_10319734 3300025921 Bacteria 1401
490 Ga0207646_10000191 3300025922 Bacteria 83638
491 Ga0207646_10001393 3300025922 Bacteria 29980
492 Ga0207646_10010143 3300025922 Bacteria 9230
493 Ga0207646_10014393 3300025922 Bacteria 7515
494 Ga0207646_10016566 3300025922 Bacteria 6915
495 Ga0207646_10020049 3300025922 Bacteria 6201
496 Ga0207646_10104395 3300025922 Bacteria 2541
497 Ga0207646_10340306 3300025922 Unclassified 1356
498 Ga0207646_10355686 3300025922 Unclassified 1323
499 Ga0207646_10375822 3300025922 Bacteria 1284
500 Ga0207646_10464608 3300025922 Unclassified 1141
501 Ga0207681_10011518 3300025923 Bacteria 5432
502 Ga0207681_10014015 3300025923 Unclassified 4969
503 Ga0207681_10131300 3300025923 Bacteria 1852
504 Ga0207681_10354239 3300025923 Bacteria 1176
505 Ga0207681_10365037 3300025923 Unclassified 1159
506 Ga0207681_10481214 3300025923 Bacteria 1014
507 Ga0207650_10015937 3300025925 Bacteria 5244
508 Ga0207650_10614732 3300025925 Unclassified 914
509 Ga0207659_10005098 3300025926 Bacteria 7963
510 Ga0207659_10016965 3300025926 Bacteria 4751
511 Ga0207659_10071464 3300025926 Unclassified 2534
512 Ga0207659_10254896 3300025926 Bacteria 1425
513 Ga0207659_10955714 3300025926 Unclassified 737
514 Ga0207687_10067835 3300025927 Bacteria 2539
515 Ga0207687_10442189 3300025927 Unclassified 1077
516 Ga0207700_10003893 3300025928 Bacteria 8714
517 Ga0207700_10015667 3300025928 Bacteria 5010
518 Ga0207700_10039430 3300025928 Bacteria 3439
519 Ga0207700_10048816 3300025928 Bacteria 3145
520 Ga0207700_10114187 3300025928 Bacteria 2179
521 Ga0207700_10243586 3300025928 Unclassified 1533
522 Ga0207664_10051382 3300025929 Unclassified 3254
523 Ga0207664_10123283 3300025929 Bacteria 2172
524 Ga0207644_10014741 3300025931 Bacteria 5236
525 Ga0207644_10025745 3300025931 Bacteria 4047
526 Ga0207644_10032598 3300025931 Bacteria 3636
527 Ga0207644_10044420 3300025931 Bacteria 3157
528 Ga0207644_10054675 3300025931 Bacteria 2876
529 Ga0207644_10067172 3300025931 Bacteria 2612
530 Ga0207644_10172380 3300025931 Bacteria 1690
531 Ga0207690_10002640 3300025932 Bacteria 10795
532 Ga0207690_10142724 3300025932 Unclassified 1767
533 Ga0207706_10022549 3300025933 Bacteria 5650
534 Ga0207706_10037590 3300025933 Bacteria 4298
535 Ga0207706_10074996 3300025933 Bacteria 2974
536 Ga0207706_10134531 3300025933 Unclassified 2174
537 Ga0207706_10332854 3300025933 Bacteria 1321
538 Ga0207686_10211340 3300025934 Unclassified 1395
539 Ga0207709_10197983 3300025935 Bacteria 1432
540 Ga0207709_10263307 3300025935 Unclassified 1265
541 Ga0207670_10016878 3300025936 Bacteria 4400
542 Ga0207670_10035039 3300025936 Bacteria 3251
543 Ga0207669_10069350 3300025937 Bacteria 2206
544 Ga0207669_10102120 3300025937 Bacteria 1899
545 Ga0207704_10047899 3300025938 Bacteria 2559
546 Ga0207704_10278282 3300025938 Unclassified 1271
547 Ga0207704_10640352 3300025938 Unclassified 874
548 Ga0207665_10054719 3300025939 Bacteria 2691
549 Ga0207665_10076274 3300025939 Bacteria 2298
550 Ga0207665_10218229 3300025939 Bacteria 1396
551 Ga0207665_10275263 3300025939 Unclassified 1251
552 Ga0207665_10277367 3300025939 Unclassified 1246
553 Ga0207665_10360643 3300025939 Unclassified 1099
554 Ga0207691_10000142 3300025940 Bacteria 66224
555 Ga0207691_10000247 3300025940 Bacteria 53502
556 Ga0207691_10097501 3300025940 Bacteria 2628
557 Ga0207691_10102373 3300025940 Unclassified 2554
558 Ga0207691_10212905 3300025940 Bacteria 1678
559 Ga0207691_10221759 3300025940 Bacteria 1639
560 Ga0207679_10031450 3300025945 Bacteria 3714
561 Ga0207679_10228003 3300025945 Unclassified 1571
562 Ga0207679_10744123 3300025945 Bacteria 891
563 Ga0207667_10106198 3300025949 Bacteria 2897
564 Ga0207667_11001208 3300025949 Bacteria 823
565 Ga0207651_10012073 3300025960 Bacteria 4866
566 Ga0207651_10067156 3300025960 Unclassified 2522
567 Ga0207651_10566758 3300025960 Bacteria 989
568 Ga0207651_11339168 3300025960 Bacteria 644
569 Ga0207712_10114117 3300025961 Archaea 2032
570 Ga0207712_10889791 3300025961 Bacteria 786
571 Ga0207668_10006260 3300025972 Bacteria 7031
572 Ga0207668_10017541 3300025972 Bacteria 4486
573 Ga0207668_10027563 3300025972 Bacteria 3701
574 Ga0207668_10130077 3300025972 Bacteria 1921
575 Ga0207668_10145826 3300025972 Bacteria 1826
576 Ga0207668_10425105 3300025972 Unclassified 1128
577 Ga0207668_10558888 3300025972 Bacteria 992
578 Ga0207640_10075256 3300025981 Bacteria 2288
579 Ga0207658_10010987 3300025986 Bacteria 6166
580 Ga0207658_10026613 3300025986 Bacteria 4056
581 Ga0207658_10047043 3300025986 Bacteria 3155
582 Ga0207658_10187449 3300025986 Bacteria 1717
583 Ga0207658_10267108 3300025986 Unclassified 1460
584 Ga0207658_10290309 3300025986 Unclassified 1405
585 Ga0207677_10039629 3300026023 Bacteria 3100
586 Ga0207677_10047355 3300026023 Bacteria 2886
587 Ga0207677_10073923 3300026023 Bacteria 2416
588 Ga0207677_10075096 3300026023 Unclassified 2401
589 Ga0207677_10115001 3300026023 Bacteria 2012
590 Ga0207677_10122255 3300026023 Bacteria 1961
591 Ga0207703_10030916 3300026035 Bacteria 4233
592 Ga0207703_10072520 3300026035 Bacteria 2847
593 Ga0207703_10601425 3300026035 Bacteria 1040
594 Ga0207639_10258886 3300026041 Bacteria 1521
595 Ga0207639_10390691 3300026041 Bacteria 1251
596 Ga0207678_10040073 3300026067 Bacteria 4063
597 Ga0207708_10008844 3300026075 Bacteria 7454
598 Ga0207641_10218575 3300026088 Bacteria 1766
599 Ga0207641_10357683 3300026088 Bacteria 1393
600 Ga0207641_10702018 3300026088 Bacteria 996
601 Ga0207648_10067913 3300026089 Bacteria 3107
602 Ga0207648_10213801 3300026089 Bacteria 1712
603 Ga0207675_100064977 3300026118 Bacteria 3410
604 Ga0207675_100132193 3300026118 Bacteria 2366
605 Ga0207675_100382273 3300026118 Bacteria 1385
606 Ga0207683_10009866 3300026121 Bacteria 8145
607 Ga0207683_10051070 3300026121 Bacteria 3623
608 Ga0207683_10063965 3300026121 Bacteria 3241
609 Ga0207683_10071554 3300026121 Bacteria 3066
610 Ga0207683_10937305 3300026121 Unclassified 804
611 Ga0207698_10720233 3300026142 Bacteria 994
612 Ga0210002_1024755 3300027617 Unclassified 980
613 Ga0209998_10035192 3300027717 Unclassified 1122
614 Ga0209998_10040572 3300027717 Unclassified 1056
615 Ga0209974_10002731 3300027876 Bacteria 6397
616 Ga0268266_10004179 3300028379 Bacteria 13926
617 Ga0268266_10022713 3300028379 Bacteria 5341
618 Ga0268266_10025356 3300028379 Bacteria 5043
619 Ga0268266_10081503 3300028379 Bacteria 2822
620 Ga0268266_10132211 3300028379 Bacteria 2233
621 Ga0268266_10147129 3300028379 Unclassified 2119
622 Ga0268266_10227276 3300028379 Bacteria 1717
623 Ga0268266_10296583 3300028379 Bacteria 1507
624 Ga0268266_10770483 3300028379 Unclassified 929
625 Ga0268265_10118795 3300028380 Bacteria 2174
626 Ga0268265_10596345 3300028380 Bacteria 1055
627 Ga0268264_10052052 3300028381 Bacteria 3414
628 Ga0268264_10086546 3300028381 Bacteria 2693
629 Ga0268264_10243638 3300028381 Bacteria 1666
630 Ga0307513_10089511 3300031456 Bacteria 3142
631 Ga0373940_0045843 3300035088 Unclassified 1215
632 Ga0373944_0021902 3300035089 Bacteria 1854
633 Ga0373951_0088345 3300035091 Unclassified 811
634 Ga0373936_0168225 3300035113 Unclassified 958
635 Ga0373941_0103863 3300035115 Unclassified 993
636 Ga0373945_0035084 3300035116 Bacteria 1791
637 Ga0373945_0218129 3300035116 Bacteria 797
638 Ga0373943_0032504 3300035170 Bacteria 2481
639 Ga0373943_0034497 3300035170 Bacteria 2414
640 Ga0373943_0061880 3300035170 Bacteria 1872
641 Ga0373943_0092972 3300035170 Bacteria 1565
642 Ga0373946_0091629 3300035171 Unclassified 1348
643 Ga0373946_0280390 3300035171 Bacteria 820
644 Ga0373955_0009835 3300035172 Bacteria 4498
645 Ga0316574_0149687 3300035398 Bacteria 1504
646 Ga0373924_0219625 3300035410 Unclassified 840
647 Ga0373931_0015223 3300035691 Bacteria 3771
648 Ga0373931_0044383 3300035691 Bacteria 2344
649 Ga0373931_0051632 3300035691 Bacteria 2191
650 Ga0373931_0061865 3300035691 Bacteria 2020
651 Ga0373931_0516067 3300035691 Unclassified 773
652 Ga0373935_0018504 3300035692 Bacteria 4238
653 Ga0373935_0034768 3300035692 Bacteria 3143
654 Ga0373935_0049700 3300035692 Bacteria 2659
655 Ga0373935_0051886 3300035692 Bacteria 2605
656 Ga0373935_0727696 3300035692 Bacteria 730
657 Ga0373927_0010910 3300035695 Bacteria 6049
658 Ga0373927_0031272 3300035695 Bacteria 3470
659 Ga0373927_0090974 3300035695 Bacteria 1982
660 Ga0373927_0453312 3300035695 Bacteria 847
661 Ga0373927_0471573 3300035695 Bacteria 829
662 Ga0373933_0625568 3300035724 Bacteria 707
663 Ga0373947_0007924 3300035725 Bacteria 6126
664 Ga0373947_0020963 3300035725 Bacteria 3781
665 Ga0373947_0121377 3300035725 Bacteria 1660
666 Ga0373947_0133507 3300035725 Bacteria 1586
667 Ga0373947_0236510 3300035725 Bacteria 1204
668 Ga0373937_0007935 3300036401 Bacteria 9202
669 Ga0373937_0077805 3300036401 Bacteria 3065
670 Ga0373937_0142442 3300036401 Bacteria 2243
671 Ga0373937_0343076 3300036401 Bacteria 1414
672 Ga0373925_0078544 3300037068 Bacteria 2506
673 Ga0373925_0278365 3300037068 Unclassified 1347
674 Ga0373925_0484093 3300037068 Unclassified 1015
675 Ga0373925_0622931 3300037068 Unclassified 889
676 Ga0373925_0643210 3300037068 Bacteria 874
677 Ga0373925_0672882 3300037068 Bacteria 853
678 Ga0395899_0040689 3300037312 Bacteria 3476
679 Ga0395900_0008031 3300037418 Bacteria 10861
680 Ga0395900_0118855 3300037418 Bacteria 2713
681 Ga0395900_0616758 3300037418 Unclassified 1024
682 Ga0395898_0036909 3300037466 Bacteria 4850
683 Ga0395898_1077831 3300037466 Unclassified 737
684 Ga0395905_0022619 3300037471 Bacteria 5943
685 Ga0395905_0443355 3300037471 Bacteria 1196
686 Ga0395901_0002964 3300038443 Bacteria 17124
687 Ga0395901_0104360 3300038443 Bacteria 2975
688 Ga0436365_0592482 3300039437 Bacteria 10769
689 Ga0436365_0750598 3300039437 Unclassified 2405
690 Ga0436365_1383407 3300039437 Bacteria 77328
691 Ga0436360_0624627 3300039438 Bacteria 4317
692 Ga0436360_0890129 3300039438 Bacteria 5307
693 Ga0436361_0117688 3300039447 Bacteria 2764
694 Ga0436361_0182528 3300039447 Bacteria 2172
695 Ga0436361_0715339 3300039447 Bacteria 2090
696 Ga0436363_1019557 3300039450 Unclassified 808
697 Ga0451807_2029754 3300041486 Bacteria 1018
698 Ga0439451_005465 3300042009 Bacteria 2591
699 Ga0439455_0012285 3300042012 Bacteria 1920
700 Ga0439455_0108650 3300042012 Unclassified 770
701 Ga0439464_0015733 3300042439 Unclassified 2043
702 Ga0451577_0009264 3300042876 Bacteria 9490
703 Ga0451576_0046345 3300045051 Bacteria 4578
704 Ga0466967_0373597 3300045976 Bacteria 1383
705 Ga0495592_0004183 3300046454 Bacteria 10538
706 Ga0495592_0079240 3300046454 Bacteria 2378
707 Ga0495629_0116759 3300046459 Unclassified 1860
708 Ga0495629_0291497 3300046459 Unclassified 1118
709 Ga0495651_0140727 3300046462 Bacteria 1750
710 Ga0495651_0265033 3300046462 Bacteria 1167
711 Ga0495651_0411481 3300046462 Unclassified 881
712 Ga0495580_0387428 3300046472 Bacteria 944
713 Ga0495662_0148558 3300046476 Unclassified 1154
714 Ga0495664_0229922 3300046477 Bacteria 1122
715 Ga0495584_0173045 3300046491 Unclassified 1097
716 Ga0495583_0193524 3300046506 Bacteria 829
717 Ga0495618_0278347 3300046514 Bacteria 1044
718 Ga0495628_0004287 3300046516 Bacteria 12686
719 Ga0495630_0043877 3300046517 Bacteria 3341
720 Ga0495630_0186121 3300046517 Unclassified 1584
721 Ga0495631_0051981 3300046518 Bacteria 1790
722 Ga0495643_0000165 3300046522 Bacteria 105206
723 Ga0495644_0022155 3300046523 Unclassified 2422
724 Ga0495663_0014937 3300046525 Unclassified 2183
725 Ga0495666_0164495 3300046526 Bacteria 1028
726 Ga0495642_0035028 3300046528 Bacteria 2024
727 Ga0495652_0053015 3300046529 Bacteria 3458
728 Ga0495652_0270184 3300046529 Bacteria 1250
729 Ga0495640_0198898 3300046533 Bacteria 1271
730 Ga0495586_0019561 3300046535 Bacteria 3606
731 Ga0495587_0004117 3300046536 Bacteria 9614
732 Ga0495598_0010463 3300046537 Bacteria 2223
733 Ga0495609_0101466 3300046538 Unclassified 1247
734 Ga0495645_0001076 3300046543 Bacteria 18525
735 Ga0495645_0055058 3300046543 Bacteria 2889
736 Ga0495667_0272758 3300046559 Bacteria 1074
737 Ga0495588_0156994 3300046674 Bacteria 1203
738 Ga0495657_0158333 3300046675 Bacteria 1402
739 Ga0495599_0000317 3300046678 Bacteria 28802
740 Ga0495623_0000811 3300046679 Bacteria 21045
741 Ga0495646_0002940 3300046680 Bacteria 10561
742 Ga0495669_0010128 3300046684 Bacteria 3980
743 Ga0495613_0155202 3300046689 Bacteria 1631
744 Ga0495613_0576303 3300046689 Bacteria 751
745 Ga0495589_0102052 3300046794 Bacteria 1388
746 Ga0495581_0108942 3300047315 Unclassified 1610
747 Ga0495604_0023193 3300047317 Bacteria 4953
748 Ga0495674_0556471 3300047319 Unclassified 912
749 Ga0495674_0810677 3300047319 Bacteria 727
750 Ga0495680_0590104 3300047322 Bacteria 744
751 Ga0495675_0030344 3300047444 Bacteria 3449
752 Ga0495675_0242653 3300047444 Unclassified 1084
753 Ga0495681_0041225 3300047470 Unclassified 2242
754 Ga0495684_0009324 3300047471 Bacteria 7577
755 Ga0495684_0017471 3300047471 Bacteria 5523
756 Ga0495602_0027778 3300048088 Bacteria 5429
757 Ga0496100_0007185 3300048903 Bacteria 6120
758 Ga0496100_0122710 3300048903 Bacteria 1820
759 Ga0496101_0004352 3300048904 Bacteria 8892
760 Ga0496101_0475029 3300048904 Bacteria 987
761 Ga0496102_0103303 3300048905 Bacteria 2650
762 Ga0496102_0187224 3300048905 Bacteria 1951
763 Ga0496102_0202645 3300048905 Bacteria 1870
764 Ga0496102_0579595 3300048905 Bacteria 1045
765 Ga0496103_0002509 3300048906 Bacteria 11505
766 Ga0496104_0017573 3300048907 Bacteria 6516
767 Ga0496104_0121937 3300048907 Bacteria 2503
768 Ga0496104_0269348 3300048907 Bacteria 1616
769 Ga0496104_0929627 3300048907 Unclassified 774
770 Ga0496105_0535958 3300048908 Bacteria 915
771 Ga0496106_0003085 3300048909 Bacteria 12426
772 Ga0496106_0064483 3300048909 Bacteria 2787
773 Ga0496106_0211532 3300048909 Unclassified 1545
774 Ga0496107_0001730 3300048910 Bacteria 13711
775 Ga0496107_0026301 3300048910 Bacteria 4124
776 Ga0496107_0034242 3300048910 Bacteria 3638
777 Ga0496107_0169099 3300048910 Bacteria 1622
778 Ga0496107_0541237 3300048910 Unclassified 863
779 Ga0496108_0009866 3300048911 Bacteria 7739
780 Ga0496108_0086631 3300048911 Bacteria 2659
781 Ga0496108_0113977 3300048911 Bacteria 2314
782 Ga0496108_0151522 3300048911 Bacteria 2001
783 Ga0496108_0219188 3300048911 Bacteria 1653
784 Ga0496109_0007156 3300048912 Bacteria 9429
785 Ga0496109_0007242 3300048912 Bacteria 9381
786 Ga0496109_0195103 3300048912 Unclassified 1903
787 Ga0496109_0362236 3300048912 Unclassified 1370
788 Ga0496109_0695354 3300048912 Unclassified 954
789 Ga0496110_0029638 3300048913 Bacteria 4712
790 Ga0496110_0228364 3300048913 Bacteria 1693
791 Ga0496110_0479248 3300048913 Bacteria 1133
792 Ga0496111_0092502 3300048914 Bacteria 2217
793 Ga0496112_0022098 3300048915 Bacteria 6059
794 Ga0496112_0060138 3300048915 Bacteria 3743
795 Ga0496112_0080495 3300048915 Bacteria 3221
796 Ga0496112_0135302 3300048915 Bacteria 2435
797 Ga0496112_0187611 3300048915 Bacteria 2031
798 Ga0496112_0482204 3300048915 Unclassified 1176
799 Ga0496112_0541761 3300048915 Bacteria 1098
800 Ga0496112_0614248 3300048915 Unclassified 1018
801 Ga0496113_0010988 3300048916 Bacteria 6016
802 Ga0496113_0192486 3300048916 Bacteria 1619
803 Ga0496113_0437804 3300048916 Unclassified 1050
804 Ga0496114_0016126 3300048917 Bacteria 6013
805 Ga0496114_0018633 3300048917 Bacteria 5616
806 Ga0496115_0002575 3300048918 Bacteria 13018
807 Ga0496115_0004314 3300048918 Bacteria 10290
808 Ga0496115_0009305 3300048918 Bacteria 7301
809 Ga0496115_0081369 3300048918 Bacteria 2638
810 Ga0496115_0239799 3300048918 Bacteria 1494
811 Ga0501080_0229056 3300049742 Bacteria 1699
812 nmdc:mga05p37_104793_c1 3300050507 Bacteria 3479
813 nmdc:mga05p37_1415026_c1 3300050507 Unclassified 699
814 nmdc:mga05p37_3284_c1 3300050507 Bacteria 18853
815 nmdc:mga05p37_35285_c1 3300050507 Bacteria 1801
816 nmdc:mga05p37_517419_c1 3300050507 Bacteria 1366
817 nmdc:mga05p37_763753_c1 3300050507 Bacteria 1063
818 nmdc:mga08y16_410200_c1 3300050511 Bacteria 1385
819 nmdc:mga08y16_542313_c1 3300050511 Bacteria 1178
820 nmdc:mga0n895_44950_c1 3300050512 Bacteria 4307
821 nmdc:mga0n895_451569_c1 3300050512 Bacteria 1298
822 nmdc:mga0rr50_1068283_c1 3300050513 Bacteria 687
823 nmdc:mga0rr50_371260_c1 3300050513 Unclassified 1205
824 nmdc:mga0rr50_405962_c1 3300050513 Bacteria 1151
825 nmdc:mga0rr50_475436_c1 3300050513 Bacteria 1061
826 nmdc:mga08x19_141665_c1 3300050514 Bacteria 1624
827 nmdc:mga08x19_41356_c1 3300050514 Bacteria 2935
828 nmdc:mga0a205_311920_c1 3300050515 Bacteria 1445
829 nmdc:mga0a205_348373_c1 3300050515 Bacteria 1349
830 nmdc:mga0a205_476077_c1 3300050515 Unclassified 1107
831 nmdc:mga0a205_655097_c1 3300050515 Bacteria 901
832 Ga0495601_0001921 3300053077 Bacteria 11624
833 Ga0495612_0119550 3300053078 Bacteria 1132
834 Ga0500610_0071253 3300053079 Bacteria 1813
835 Ga0495655_0040681 3300053083 Unclassified 1185
836 Ga0500628_049086 3300053129 Bacteria 995
837 Ga0587077_003530 3300059493 Bacteria 1975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10000001 JGI25406J46586_10000001183 196
2 3300003203 JGI25406J46586_10000007 JGI25406J46586_1000000791 196
3 3300005985 Ga0081539_10000014 Ga0081539_10000014289 196
4 3300050507 nmdc:mga05p37_1415026_c1 nmdc:mga05p37_1415026_c1_15_617 200
5 3300003322 rootL2_10163792 rootL2_101637923 201
6 3300005327 Ga0070658_10025644 Ga0070658_100256443 201
7 3300005327 Ga0070658_10075379 Ga0070658_100753794 201
8 3300005327 Ga0070658_10084079 Ga0070658_100840792 201
9 3300005327 Ga0070658_10094139 Ga0070658_100941392 201
10 3300005344 Ga0070661_101206117 Ga0070661_1012061171 201
11 3300005366 Ga0070659_100343778 Ga0070659_1003437782 201
12 3300005367 Ga0070667_101070479 Ga0070667_1010704791 201
13 3300005436 Ga0070713_100005485 Ga0070713_1000054858 201
14 3300005539 Ga0068853_100791601 Ga0068853_1007916012 201
15 3300005563 Ga0068855_100130645 Ga0068855_1001306455 201
16 3300005563 Ga0068855_100372390 Ga0068855_1003723902 201
17 3300005616 Ga0068852_100477245 Ga0068852_1004772452 201
18 3300005618 Ga0068864_100991929 Ga0068864_1009919292 201
19 3300005842 Ga0068858_100043497 Ga0068858_1000434974 201
20 3300005842 Ga0068858_100230990 Ga0068858_1002309902 201
21 3300005843 Ga0068860_100465972 Ga0068860_1004659722 201
22 3300005843 Ga0068860_101170895 Ga0068860_1011708951 201
23 3300005844 Ga0068862_101102679 Ga0068862_1011026791 201
24 3300006028 Ga0070717_10164607 Ga0070717_101646072 201
25 3300006177 Ga0075362_10005306 Ga0075362_100053067 201
26 3300006178 Ga0075367_10204473 Ga0075367_102044731 201
27 3300006195 Ga0075366_10001400 Ga0075366_100014004 201
28 3300009093 Ga0105240_11437792 Ga0105240_114377921 201
29 3300009098 Ga0105245_10302968 Ga0105245_103029682 201
30 3300009545 Ga0105237_10045082 Ga0105237_100450826 201
31 3300009553 Ga0105249_11302295 Ga0105249_113022951 201
32 3300010375 Ga0105239_10069667 Ga0105239_100696672 201
33 3300010375 Ga0105239_10213327 Ga0105239_102133272 201
34 3300013296 Ga0157374_10000026 Ga0157374_10000026138 201
35 3300013296 Ga0157374_10225899 Ga0157374_102258993 201
36 3300013306 Ga0163162_10173422 Ga0163162_101734224 201
37 3300014969 Ga0157376_10000112 Ga0157376_1000011226 201
38 3300021358 Ga0213873_10026666 Ga0213873_100266663 201
39 3300021384 Ga0213876_10004179 Ga0213876_100041795 201
40 3300021384 Ga0213876_10042150 Ga0213876_100421503 201
41 3300021441 Ga0213871_10007052 Ga0213871_100070524 201
42 3300021441 Ga0213871_10061942 Ga0213871_100619423 201
43 3300022467 Ga0224712_10087708 Ga0224712_100877083 201
44 3300025906 Ga0207699_10205569 Ga0207699_102055692 201
45 3300025909 Ga0207705_10068346 Ga0207705_100683464 201
46 3300025909 Ga0207705_10085665 Ga0207705_100856652 201
47 3300025909 Ga0207705_10182042 Ga0207705_101820423 201
48 3300025909 Ga0207705_10917967 Ga0207705_109179671 201
49 3300025914 Ga0207671_10026904 Ga0207671_100269046 201
50 3300025919 Ga0207657_10179662 Ga0207657_101796622 201
51 3300025919 Ga0207657_10295962 Ga0207657_102959622 201
52 3300025920 Ga0207649_10319701 Ga0207649_103197013 201
53 3300025928 Ga0207700_10039430 Ga0207700_100394304 201
54 3300025931 Ga0207644_10044420 Ga0207644_100444204 201
55 3300025949 Ga0207667_10106198 Ga0207667_101061982 201
56 3300025949 Ga0207667_11001208 Ga0207667_110012082 201
57 3300025961 Ga0207712_10889791 Ga0207712_108897912 201
58 3300025986 Ga0207658_10187449 Ga0207658_101874493 201
59 3300026035 Ga0207703_10030916 Ga0207703_100309164 201
60 3300026035 Ga0207703_10072520 Ga0207703_100725202 201
61 3300026041 Ga0207639_10390691 Ga0207639_103906913 201
62 3300026088 Ga0207641_10357683 Ga0207641_103576833 201
63 3300026142 Ga0207698_10720233 Ga0207698_107202332 201
64 3300028379 Ga0268266_10132211 Ga0268266_101322114 201
65 3300028380 Ga0268265_10596345 Ga0268265_105963452 201
66 3300028381 Ga0268264_10243638 Ga0268264_102436382 201
67 3300037471 Ga0395905_0022619 Ga0395905_0022619_3417_4028 201
68 3300037471 Ga0395905_0443355 Ga0395905_0443355_496_1113 201
69 3300039437 Ga0436365_0592482 Ga0436365_0592482_8117_8725 201
70 3300039437 Ga0436365_0750598 Ga0436365_0750598_951_1565 201
71 3300039437 Ga0436365_1383407 Ga0436365_1383407_17550_18161 201
72 3300039438 Ga0436360_0624627 Ga0436360_0624627_2015_2623 201
73 3300039438 Ga0436360_0890129 Ga0436360_0890129_3706_4314 201
74 3300039447 Ga0436361_0117688 Ga0436361_0117688_786_1394 201
75 3300039447 Ga0436361_0182528 Ga0436361_0182528_343_951 201
76 3300039447 Ga0436361_0715339 Ga0436361_0715339_187_795 201
77 3300042876 Ga0451577_0009264 Ga0451577_0009264_4824_5435 201
78 3300046522 Ga0495643_0000165 Ga0495643_0000165_48799_49413 201
79 3300053079 Ga0500610_0071253 Ga0500610_0071253_610_1221 201
80 3300053129 Ga0500628_049086 Ga0500628_049086_140_751 201
81 3300059493 Ga0587077_003530 Ga0587077_003530_1270_1881 201
82 3300002126 JGI24035J26624_1001915 JGI24035J26624_10019153 202
83 3300005289 Ga0065704_10245549 Ga0065704_102455491 202
84 3300005290 Ga0065712_10006266 Ga0065712_100062663 202
85 3300005293 Ga0065715_10006003 Ga0065715_1000600313 202
86 3300005293 Ga0065715_10104827 Ga0065715_101048272 202
87 3300005329 Ga0070683_100014335 Ga0070683_1000143352 202
88 3300005330 Ga0070690_100053225 Ga0070690_1000532251 202
89 3300005335 Ga0070666_10326257 Ga0070666_103262573 202
90 3300005338 Ga0068868_100126997 Ga0068868_1001269973 202
91 3300005339 Ga0070660_100103069 Ga0070660_1001030693 202
92 3300005339 Ga0070660_100438467 Ga0070660_1004384671 202
93 3300005340 Ga0070689_100114177 Ga0070689_1001141774 202
94 3300005353 Ga0070669_100128080 Ga0070669_1001280803 202
95 3300005354 Ga0070675_100069033 Ga0070675_1000690334 202
96 3300005354 Ga0070675_100078814 Ga0070675_1000788142 202
97 3300005355 Ga0070671_100249573 Ga0070671_1002495732 202
98 3300005356 Ga0070674_100046469 Ga0070674_1000464693 202
99 3300005364 Ga0070673_100280195 Ga0070673_1002801952 202
100 3300005365 Ga0070688_100036885 Ga0070688_1000368853 202
101 3300005365 Ga0070688_100201836 Ga0070688_1002018362 202
102 3300005366 Ga0070659_100255238 Ga0070659_1002552382 202
103 3300005367 Ga0070667_100081996 Ga0070667_1000819962 202
104 3300005406 Ga0070703_10042498 Ga0070703_100424982 202
105 3300005434 Ga0070709_10008550 Ga0070709_100085504 202
106 3300005436 Ga0070713_100346057 Ga0070713_1003460572 202
107 3300005439 Ga0070711_100219627 Ga0070711_1002196272 202
108 3300005445 Ga0070708_100023964 Ga0070708_1000239643 202
109 3300005445 Ga0070708_100024432 Ga0070708_1000244324 202
110 3300005445 Ga0070708_100099238 Ga0070708_1000992384 202
111 3300005445 Ga0070708_100180181 Ga0070708_1001801812 202
112 3300005445 Ga0070708_100371424 Ga0070708_1003714242 202
113 3300005456 Ga0070678_100108297 Ga0070678_1001082971 202
114 3300005457 Ga0070662_100112438 Ga0070662_1001124383 202
115 3300005466 Ga0070685_10045062 Ga0070685_100450622 202
116 3300005466 Ga0070685_10129998 Ga0070685_101299982 202
117 3300005467 Ga0070706_100000210 Ga0070706_10000021073 202
118 3300005467 Ga0070706_100041224 Ga0070706_1000412244 202
119 3300005467 Ga0070706_100068396 Ga0070706_1000683964 202
120 3300005467 Ga0070706_100129058 Ga0070706_1001290582 202
121 3300005467 Ga0070706_100153713 Ga0070706_1001537132 202
122 3300005467 Ga0070706_100314451 Ga0070706_1003144512 202
123 3300005467 Ga0070706_100323488 Ga0070706_1003234882 202
124 3300005467 Ga0070706_100414212 Ga0070706_1004142121 202
125 3300005467 Ga0070706_100882431 Ga0070706_1008824312 202
126 3300005468 Ga0070707_100001841 Ga0070707_10000184122 202
127 3300005468 Ga0070707_100033325 Ga0070707_1000333252 202
128 3300005468 Ga0070707_100060424 Ga0070707_1000604242 202
129 3300005468 Ga0070707_100067576 Ga0070707_1000675762 202
130 3300005468 Ga0070707_100098037 Ga0070707_1000980373 202
131 3300005468 Ga0070707_100448468 Ga0070707_1004484682 202
132 3300005468 Ga0070707_100574688 Ga0070707_1005746882 202
133 3300005471 Ga0070698_100088458 Ga0070698_1000884583 202
134 3300005471 Ga0070698_100105120 Ga0070698_1001051203 202
135 3300005471 Ga0070698_100798110 Ga0070698_1007981101 202
136 3300005518 Ga0070699_100379233 Ga0070699_1003792332 202
137 3300005530 Ga0070679_100096055 Ga0070679_1000960553 202
138 3300005535 Ga0070684_100033042 Ga0070684_1000330426 202
139 3300005536 Ga0070697_100002768 Ga0070697_1000027684 202
140 3300005536 Ga0070697_100438585 Ga0070697_1004385852 202
141 3300005536 Ga0070697_100765449 Ga0070697_1007654492 202
142 3300005543 Ga0070672_100199568 Ga0070672_1001995682 202
143 3300005544 Ga0070686_100049196 Ga0070686_1000491964 202
144 3300005548 Ga0070665_100015162 Ga0070665_1000151626 202
145 3300005548 Ga0070665_100051910 Ga0070665_1000519106 202
146 3300005614 Ga0068856_101450609 Ga0068856_1014506092 202
147 3300005843 Ga0068860_101162264 Ga0068860_1011622642 202
148 3300005937 Ga0081455_10029562 Ga0081455_100295624 202
149 3300005985 Ga0081539_10017541 Ga0081539_100175417 202
150 3300006028 Ga0070717_10002256 Ga0070717_100022569 202
151 3300006028 Ga0070717_10034711 Ga0070717_100347117 202
152 3300006028 Ga0070717_10037696 Ga0070717_100376964 202
153 3300006173 Ga0070716_100016810 Ga0070716_1000168102 202
154 3300006237 Ga0097621_100108150 Ga0097621_1001081502 202
155 3300006358 Ga0068871_100087068 Ga0068871_1000870683 202
156 3300006914 Ga0075436_100055297 Ga0075436_1000552973 202
157 3300006914 Ga0075436_100160296 Ga0075436_1001602962 202
158 3300009093 Ga0105240_10462896 Ga0105240_104628962 202
159 3300009094 Ga0111539_10552707 Ga0111539_105527072 202
160 3300009098 Ga0105245_10536584 Ga0105245_105365842 202
161 3300009176 Ga0105242_11307757 Ga0105242_113077571 202
162 3300010159 Ga0099796_10008395 Ga0099796_100083954 202
163 3300010159 Ga0099796_10056587 Ga0099796_100565872 202
164 3300010375 Ga0105239_10245175 Ga0105239_102451752 202
165 3300013102 Ga0157371_10545069 Ga0157371_105450692 202
166 3300013104 Ga0157370_10234834 Ga0157370_102348343 202
167 3300013105 Ga0157369_10101890 Ga0157369_101018902 202
168 3300013296 Ga0157374_10056568 Ga0157374_100565684 202
169 3300013296 Ga0157374_10086985 Ga0157374_100869853 202
170 3300013297 Ga0157378_10009704 Ga0157378_1000970413 202
171 3300013297 Ga0157378_10021310 Ga0157378_100213106 202
172 3300013307 Ga0157372_10329970 Ga0157372_103299702 202
173 3300013307 Ga0157372_11770033 Ga0157372_117700331 202
174 3300013308 Ga0157375_10156755 Ga0157375_101567552 202
175 3300013308 Ga0157375_11382136 Ga0157375_113821361 202
176 3300013308 Ga0157375_11795681 Ga0157375_117956811 202
177 3300014497 Ga0182008_10034693 Ga0182008_100346933 202
178 3300014969 Ga0157376_10075816 Ga0157376_100758162 202
179 3300025271 Ga0207666_1000509 Ga0207666_10005097 202
180 3300025290 Ga0207673_1000205 Ga0207673_10002054 202
181 3300025315 Ga0207697_10010508 Ga0207697_100105087 202
182 3300025315 Ga0207697_10021523 Ga0207697_100215235 202
183 3300025885 Ga0207653_10043816 Ga0207653_100438162 202
184 3300025898 Ga0207692_10015694 Ga0207692_100156945 202
185 3300025898 Ga0207692_10158731 Ga0207692_101587312 202
186 3300025898 Ga0207692_10378593 Ga0207692_103785932 202
187 3300025901 Ga0207688_10106988 Ga0207688_101069881 202
188 3300025903 Ga0207680_10779436 Ga0207680_107794361 202
189 3300025906 Ga0207699_10033788 Ga0207699_100337885 202
190 3300025909 Ga0207705_10215974 Ga0207705_102159741 202
191 3300025910 Ga0207684_10000028 Ga0207684_100000288 202
192 3300025910 Ga0207684_10008671 Ga0207684_100086714 202
193 3300025910 Ga0207684_10047663 Ga0207684_100476634 202
194 3300025910 Ga0207684_10086390 Ga0207684_100863902 202
195 3300025910 Ga0207684_10297383 Ga0207684_102973832 202
196 3300025910 Ga0207684_10394442 Ga0207684_103944421 202
197 3300025910 Ga0207684_10643493 Ga0207684_106434932 202
198 3300025918 Ga0207662_10024747 Ga0207662_100247474 202
199 3300025919 Ga0207657_10200978 Ga0207657_102009783 202
200 3300025920 Ga0207649_10116647 Ga0207649_101166472 202
201 3300025921 Ga0207652_10319734 Ga0207652_103197342 202
202 3300025922 Ga0207646_10001393 Ga0207646_1000139324 202
203 3300025922 Ga0207646_10016566 Ga0207646_100165668 202
204 3300025922 Ga0207646_10104395 Ga0207646_101043953 202
205 3300025922 Ga0207646_10355686 Ga0207646_103556862 202
206 3300025922 Ga0207646_10464608 Ga0207646_104646082 202
207 3300025923 Ga0207681_10365037 Ga0207681_103650372 202
208 3300025926 Ga0207659_10071464 Ga0207659_100714644 202
209 3300025928 Ga0207700_10003893 Ga0207700_100038934 202
210 3300025929 Ga0207664_10123283 Ga0207664_101232834 202
211 3300025931 Ga0207644_10172380 Ga0207644_101723802 202
212 3300025932 Ga0207690_10142724 Ga0207690_101427243 202
213 3300025933 Ga0207706_10134531 Ga0207706_101345313 202
214 3300025934 Ga0207686_10211340 Ga0207686_102113402 202
215 3300025935 Ga0207709_10263307 Ga0207709_102633072 202
216 3300025938 Ga0207704_10640352 Ga0207704_106403521 202
217 3300025939 Ga0207665_10076274 Ga0207665_100762743 202
218 3300025939 Ga0207665_10277367 Ga0207665_102773672 202
219 3300025940 Ga0207691_10102373 Ga0207691_101023733 202
220 3300025960 Ga0207651_10067156 Ga0207651_100671563 202
221 3300025960 Ga0207651_11339168 Ga0207651_113391681 202
222 3300025972 Ga0207668_10558888 Ga0207668_105588882 202
223 3300025981 Ga0207640_10075256 Ga0207640_100752562 202
224 3300026023 Ga0207677_10122255 Ga0207677_101222553 202
225 3300026088 Ga0207641_10702018 Ga0207641_107020182 202
226 3300026121 Ga0207683_10071554 Ga0207683_100715545 202
227 3300028379 Ga0268266_10025356 Ga0268266_100253562 202
228 3300028379 Ga0268266_10770483 Ga0268266_107704832 202
229 3300035113 Ga0373936_0168225 Ga0373936_0168225_201_809 202
230 3300035116 Ga0373945_0218129 Ga0373945_0218129_148_756 202
231 3300035170 Ga0373943_0034497 Ga0373943_0034497_67_675 202
232 3300035171 Ga0373946_0280390 Ga0373946_0280390_102_710 202
233 3300035410 Ga0373924_0219625 Ga0373924_0219625_220_828 202
234 3300035692 Ga0373935_0018504 Ga0373935_0018504_1378_1986 202
235 3300035692 Ga0373935_0727696 Ga0373935_0727696_82_690 202
236 3300035695 Ga0373927_0090974 Ga0373927_0090974_42_650 202
237 3300035724 Ga0373933_0625568 Ga0373933_0625568_75_683 202
238 3300036401 Ga0373937_0007935 Ga0373937_0007935_4667_5275 202
239 3300036401 Ga0373937_0343076 Ga0373937_0343076_88_696 202
240 3300037068 Ga0373925_0484093 Ga0373925_0484093_175_783 202
241 3300037068 Ga0373925_0643210 Ga0373925_0643210_144_752 202
242 3300037068 Ga0373925_0672882 Ga0373925_0672882_104_712 202
243 3300041486 Ga0451807_2029754 Ga0451807_2029754_367_975 202
244 3300046454 Ga0495592_0004183 Ga0495592_0004183_8314_8922 202
245 3300046459 Ga0495629_0116759 Ga0495629_0116759_599_1207 202
246 3300046459 Ga0495629_0291497 Ga0495629_0291497_109_717 202
247 3300046462 Ga0495651_0265033 Ga0495651_0265033_424_1032 202
248 3300046472 Ga0495580_0387428 Ga0495580_0387428_148_756 202
249 3300046476 Ga0495662_0148558 Ga0495662_0148558_363_971 202
250 3300046477 Ga0495664_0229922 Ga0495664_0229922_409_1017 202
251 3300046491 Ga0495584_0173045 Ga0495584_0173045_465_1073 202
252 3300046514 Ga0495618_0278347 Ga0495618_0278347_363_971 202
253 3300046516 Ga0495628_0004287 Ga0495628_0004287_6436_7044 202
254 3300046517 Ga0495630_0043877 Ga0495630_0043877_523_1131 202
255 3300046523 Ga0495644_0022155 Ga0495644_0022155_1510_2118 202
256 3300046525 Ga0495663_0014937 Ga0495663_0014937_367_975 202
257 3300046526 Ga0495666_0164495 Ga0495666_0164495_75_683 202
258 3300046529 Ga0495652_0270184 Ga0495652_0270184_246_854 202
259 3300046535 Ga0495586_0019561 Ga0495586_0019561_2893_3501 202
260 3300046536 Ga0495587_0004117 Ga0495587_0004117_3443_4051 202
261 3300046538 Ga0495609_0101466 Ga0495609_0101466_478_1086 202
262 3300046543 Ga0495645_0001076 Ga0495645_0001076_6702_7310 202
263 3300046559 Ga0495667_0272758 Ga0495667_0272758_36_644 202
264 3300046675 Ga0495657_0158333 Ga0495657_0158333_582_1190 202
265 3300046678 Ga0495599_0000317 Ga0495599_0000317_15962_16570 202
266 3300046679 Ga0495623_0000811 Ga0495623_0000811_18425_19033 202
267 3300046680 Ga0495646_0002940 Ga0495646_0002940_834_1442 202
268 3300046689 Ga0495613_0155202 Ga0495613_0155202_901_1509 202
269 3300046794 Ga0495589_0102052 Ga0495589_0102052_750_1358 202
270 3300047315 Ga0495581_0108942 Ga0495581_0108942_127_735 202
271 3300047317 Ga0495604_0023193 Ga0495604_0023193_3721_4329 202
272 3300047319 Ga0495674_0556471 Ga0495674_0556471_188_796 202
273 3300047319 Ga0495674_0810677 Ga0495674_0810677_83_691 202
274 3300047322 Ga0495680_0590104 Ga0495680_0590104_105_713 202
275 3300047444 Ga0495675_0030344 Ga0495675_0030344_1370_1978 202
276 3300047471 Ga0495684_0017471 Ga0495684_0017471_2434_3042 202
277 3300048088 Ga0495602_0027778 Ga0495602_0027778_3672_4280 202
278 3300048908 Ga0496105_0535958 Ga0496105_0535958_120_728 202
279 3300048915 Ga0496112_0080495 Ga0496112_0080495_2443_3051 202
280 3300048917 Ga0496114_0016126 Ga0496114_0016126_2307_2915 202
281 3300049742 Ga0501080_0229056 Ga0501080_0229056_952_1572 202
282 3300050514 nmdc:mga08x19_141665_c1 nmdc:mga08x19_141665_c1_714_1322 202
283 3300050514 nmdc:mga08x19_41356_c1 nmdc:mga08x19_41356_c1_1420_2028 202
284 3300053077 Ga0495601_0001921 Ga0495601_0001921_205_813 202
285 3300053078 Ga0495612_0119550 Ga0495612_0119550_478_1086 202
286 3300053083 Ga0495655_0040681 Ga0495655_0040681_94_702 202
287 3300005272 Ga0065703_1019589 Ga0065703_10195893 203
288 3300005328 Ga0070676_10012318 Ga0070676_100123184 203
289 3300005335 Ga0070666_10026532 Ga0070666_100265325 203
290 3300005335 Ga0070666_10054780 Ga0070666_100547805 203
291 3300005338 Ga0068868_100067232 Ga0068868_1000672325 203
292 3300005338 Ga0068868_100194101 Ga0068868_1001941012 203
293 3300005338 Ga0068868_100214619 Ga0068868_1002146192 203
294 3300005344 Ga0070661_100729087 Ga0070661_1007290871 203
295 3300005347 Ga0070668_100000403 Ga0070668_10000040337 203
296 3300005353 Ga0070669_100002011 Ga0070669_10000201125 203
297 3300005354 Ga0070675_100197214 Ga0070675_1001972143 203
298 3300005354 Ga0070675_100677838 Ga0070675_1006778382 203
299 3300005355 Ga0070671_100002459 Ga0070671_10000245913 203
300 3300005355 Ga0070671_100012710 Ga0070671_1000127107 203
301 3300005356 Ga0070674_100129388 Ga0070674_1001293883 203
302 3300005364 Ga0070673_100093233 Ga0070673_1000932332 203
303 3300005365 Ga0070688_100000733 Ga0070688_10000073318 203
304 3300005367 Ga0070667_100004665 Ga0070667_1000046652 203
305 3300005367 Ga0070667_100048750 Ga0070667_1000487504 203
306 3300005367 Ga0070667_100054124 Ga0070667_1000541242 203
307 3300005445 Ga0070708_100259323 Ga0070708_1002593232 203
308 3300005456 Ga0070678_100040339 Ga0070678_1000403395 203
309 3300005456 Ga0070678_100262041 Ga0070678_1002620412 203
310 3300005459 Ga0068867_100150920 Ga0068867_1001509203 203
311 3300005459 Ga0068867_100220792 Ga0068867_1002207921 203
312 3300005548 Ga0070665_100090881 Ga0070665_1000908813 203
313 3300005564 Ga0070664_100037306 Ga0070664_1000373062 203
314 3300005618 Ga0068864_100098211 Ga0068864_1000982113 203
315 3300005718 Ga0068866_10195272 Ga0068866_101952722 203
316 3300005834 Ga0068851_10204951 Ga0068851_102049512 203
317 3300005843 Ga0068860_100174888 Ga0068860_1001748883 203
318 3300005844 Ga0068862_100448989 Ga0068862_1004489892 203
319 3300005985 Ga0081539_10003851 Ga0081539_1000385116 203
320 3300006173 Ga0070716_100697351 Ga0070716_1006973511 203
321 3300006237 Ga0097621_100064714 Ga0097621_1000647141 203
322 3300006358 Ga0068871_100042623 Ga0068871_1000426234 203
323 3300006358 Ga0068871_100063216 Ga0068871_1000632162 203
324 3300006358 Ga0068871_100272171 Ga0068871_1002721712 203
325 3300006871 Ga0075434_100534688 Ga0075434_1005346882 203
326 3300006881 Ga0068865_100002077 Ga0068865_10000207712 203
327 3300009098 Ga0105245_10075162 Ga0105245_100751622 203
328 3300009148 Ga0105243_10712699 Ga0105243_107126991 203
329 3300013296 Ga0157374_10001473 Ga0157374_1000147321 203
330 3300013296 Ga0157374_10005577 Ga0157374_100055772 203
331 3300013296 Ga0157374_10092382 Ga0157374_100923825 203
332 3300013297 Ga0157378_10009019 Ga0157378_100090195 203
333 3300013297 Ga0157378_10242977 Ga0157378_102429772 203
334 3300013306 Ga0163162_10003249 Ga0163162_1000324927 203
335 3300013306 Ga0163162_10112610 Ga0163162_101126102 203
336 3300013307 Ga0157372_10978731 Ga0157372_109787312 203
337 3300013308 Ga0157375_10000287 Ga0157375_1000028712 203
338 3300013308 Ga0157375_10001868 Ga0157375_1000186821 203
339 3300014969 Ga0157376_10009509 Ga0157376_100095092 203
340 3300014969 Ga0157376_10079496 Ga0157376_100794964 203
341 3300025315 Ga0207697_10000010 Ga0207697_1000001051 203
342 3300025893 Ga0207682_10020163 Ga0207682_100201634 203
343 3300025901 Ga0207688_10007718 Ga0207688_100077183 203
344 3300025903 Ga0207680_10014436 Ga0207680_100144364 203
345 3300025907 Ga0207645_10004432 Ga0207645_1000443218 203
346 3300025907 Ga0207645_10192675 Ga0207645_101926753 203
347 3300025920 Ga0207649_10703969 Ga0207649_107039692 203
348 3300025923 Ga0207681_10014015 Ga0207681_100140159 203
349 3300025923 Ga0207681_10131300 Ga0207681_101313003 203
350 3300025925 Ga0207650_10015937 Ga0207650_100159373 203
351 3300025926 Ga0207659_10955714 Ga0207659_109557142 203
352 3300025931 Ga0207644_10014741 Ga0207644_100147415 203
353 3300025931 Ga0207644_10025745 Ga0207644_100257456 203
354 3300025936 Ga0207670_10035039 Ga0207670_100350392 203
355 3300025937 Ga0207669_10102120 Ga0207669_101021202 203
356 3300025938 Ga0207704_10278282 Ga0207704_102782821 203
357 3300025939 Ga0207665_10360643 Ga0207665_103606433 203
358 3300025940 Ga0207691_10000142 Ga0207691_100001427 203
359 3300025945 Ga0207679_10228003 Ga0207679_102280032 203
360 3300025960 Ga0207651_10566758 Ga0207651_105667582 203
361 3300025972 Ga0207668_10027563 Ga0207668_100275634 203
362 3300025986 Ga0207658_10047043 Ga0207658_100470434 203
363 3300025986 Ga0207658_10290309 Ga0207658_102903092 203
364 3300026023 Ga0207677_10047355 Ga0207677_100473552 203
365 3300026023 Ga0207677_10115001 Ga0207677_101150013 203
366 3300026089 Ga0207648_10067913 Ga0207648_100679136 203
367 3300026121 Ga0207683_10009866 Ga0207683_1000986617 203
368 3300026121 Ga0207683_10937305 Ga0207683_109373051 203
369 3300028379 Ga0268266_10004179 Ga0268266_100041792 203
370 3300028379 Ga0268266_10296583 Ga0268266_102965832 203
371 3300028381 Ga0268264_10086546 Ga0268264_100865463 203
372 3300035115 Ga0373941_0103863 Ga0373941_0103863_250_861 203
373 3300035170 Ga0373943_0092972 Ga0373943_0092972_421_1032 203
374 3300035398 Ga0316574_0149687 Ga0316574_0149687_36_650 203
375 3300035691 Ga0373931_0061865 Ga0373931_0061865_1040_1651 203
376 3300035691 Ga0373931_0516067 Ga0373931_0516067_29_640 203
377 3300035725 Ga0373947_0020963 Ga0373947_0020963_783_1394 203
378 3300035725 Ga0373947_0121377 Ga0373947_0121377_647_1258 203
379 3300037068 Ga0373925_0622931 Ga0373925_0622931_100_711 203
380 3300039450 Ga0436363_1019557 Ga0436363_1019557_15_626 203
381 3300046674 Ga0495588_0156994 Ga0495588_0156994_390_1001 203
382 3300048911 Ga0496108_0086631 Ga0496108_0086631_1351_1962 203
383 3300048912 Ga0496109_0195103 Ga0496109_0195103_622_1233 203
384 3300048915 Ga0496112_0135302 Ga0496112_0135302_895_1506 203
385 3300048915 Ga0496112_0187611 Ga0496112_0187611_791_1402 203
386 3300000545 CNXas_1000052 CNXas_100005228 204
387 3300005353 Ga0070669_100182783 Ga0070669_1001827833 204
388 3300005355 Ga0070671_100047861 Ga0070671_1000478613 204
389 3300005365 Ga0070688_100357767 Ga0070688_1003577672 204
390 3300005543 Ga0070672_100157475 Ga0070672_1001574752 204
391 3300005843 Ga0068860_100985539 Ga0068860_1009855391 204
392 3300005985 Ga0081539_10013488 Ga0081539_100134884 204
393 3300006871 Ga0075434_100138435 Ga0075434_1001384352 204
394 3300009553 Ga0105249_10137449 Ga0105249_101374493 204
395 3300013297 Ga0157378_10275651 Ga0157378_102756512 204
396 3300013297 Ga0157378_10533444 Ga0157378_105334442 204
397 3300013308 Ga0157375_10050268 Ga0157375_100502684 204
398 3300025931 Ga0207644_10032598 Ga0207644_100325985 204
399 3300025940 Ga0207691_10097501 Ga0207691_100975014 204
400 3300031456 Ga0307513_10089511 Ga0307513_100895113 204
401 3300035171 Ga0373946_0091629 Ga0373946_0091629_452_1066 204
402 3300035172 Ga0373955_0009835 Ga0373955_0009835_2861_3475 204
403 3300036401 Ga0373937_0077805 Ga0373937_0077805_2387_3001 204
404 3300036401 Ga0373937_0142442 Ga0373937_0142442_1433_2047 204
405 3300046454 Ga0495592_0079240 Ga0495592_0079240_531_1145 204
406 3300046462 Ga0495651_0140727 Ga0495651_0140727_1008_1622 204
407 3300046462 Ga0495651_0411481 Ga0495651_0411481_24_638 204
408 3300046517 Ga0495630_0186121 Ga0495630_0186121_497_1111 204
409 3300046529 Ga0495652_0053015 Ga0495652_0053015_23_637 204
410 3300046533 Ga0495640_0198898 Ga0495640_0198898_580_1194 204
411 3300046543 Ga0495645_0055058 Ga0495645_0055058_1666_2280 204
412 3300047444 Ga0495675_0242653 Ga0495675_0242653_386_1000 204
413 3300047471 Ga0495684_0009324 Ga0495684_0009324_2002_2616 204
414 3300048915 Ga0496112_0541761 Ga0496112_0541761_422_1036 204
415 3300050512 nmdc:mga0n895_44950_c1 nmdc:mga0n895_44950_c1_718_1332 204
416 3300050513 nmdc:mga0rr50_1068283_c1 nmdc:mga0rr50_1068283_c1_13_627 204
417 2162886006 SwRhRL3b_contig_1511392 SwRhRL3b_0085.00001530 205
418 2162886007 SwRhRL2b_contig_157882 SwRhRL2b_0695.00001780 205
419 3300003911 JGI25405J52794_10000497 JGI25405J52794_100004972 205
420 3300003911 JGI25405J52794_10035337 JGI25405J52794_100353372 205
421 3300003911 JGI25405J52794_10045831 JGI25405J52794_100458312 205
422 3300005289 Ga0065704_10086836 Ga0065704_100868364 205
423 3300005290 Ga0065712_10001341 Ga0065712_100013414 205
424 3300005290 Ga0065712_10223303 Ga0065712_102233031 205
425 3300005290 Ga0065712_10273400 Ga0065712_102734001 205
426 3300005293 Ga0065715_10001210 Ga0065715_100012108 205
427 3300005293 Ga0065715_10001337 Ga0065715_100013372 205
428 3300005293 Ga0065715_10006907 Ga0065715_100069072 205
429 3300005293 Ga0065715_10133814 Ga0065715_101338143 205
430 3300005293 Ga0065715_10308998 Ga0065715_103089982 205
431 3300005295 Ga0065707_10002326 Ga0065707_100023265 205
432 3300005295 Ga0065707_10105144 Ga0065707_101051444 205
433 3300005295 Ga0065707_10158891 Ga0065707_101588912 205
434 3300005328 Ga0070676_10006857 Ga0070676_100068574 205
435 3300005328 Ga0070676_10013851 Ga0070676_100138513 205
436 3300005329 Ga0070683_100014620 Ga0070683_10001462011 205
437 3300005329 Ga0070683_100093797 Ga0070683_1000937974 205
438 3300005331 Ga0070670_100248667 Ga0070670_1002486672 205
439 3300005333 Ga0070677_10005596 Ga0070677_100055964 205
440 3300005335 Ga0070666_10004276 Ga0070666_100042766 205
441 3300005335 Ga0070666_10199507 Ga0070666_101995073 205
442 3300005338 Ga0068868_100029621 Ga0068868_1000296213 205
443 3300005338 Ga0068868_100057916 Ga0068868_1000579164 205
444 3300005338 Ga0068868_100325778 Ga0068868_1003257782 205
445 3300005338 Ga0068868_100432416 Ga0068868_1004324162 205
446 3300005339 Ga0070660_100342014 Ga0070660_1003420143 205
447 3300005340 Ga0070689_100009585 Ga0070689_10000958513 205
448 3300005340 Ga0070689_100965139 Ga0070689_1009651391 205
449 3300005343 Ga0070687_100000382 Ga0070687_10000038221 205
450 3300005343 Ga0070687_100308397 Ga0070687_1003083972 205
451 3300005344 Ga0070661_100092920 Ga0070661_1000929203 205
452 3300005347 Ga0070668_100004836 Ga0070668_10000483613 205
453 3300005347 Ga0070668_100007390 Ga0070668_1000073905 205
454 3300005347 Ga0070668_100040758 Ga0070668_1000407583 205
455 3300005347 Ga0070668_100175817 Ga0070668_1001758172 205
456 3300005353 Ga0070669_100008062 Ga0070669_1000080624 205
457 3300005353 Ga0070669_100033499 Ga0070669_1000334994 205
458 3300005353 Ga0070669_100065736 Ga0070669_1000657365 205
459 3300005354 Ga0070675_100005920 Ga0070675_10000592011 205
460 3300005354 Ga0070675_100008984 Ga0070675_1000089845 205
461 3300005354 Ga0070675_100014207 Ga0070675_1000142073 205
462 3300005354 Ga0070675_100607122 Ga0070675_1006071222 205
463 3300005355 Ga0070671_100011495 Ga0070671_10001149512 205
464 3300005355 Ga0070671_100142680 Ga0070671_1001426802 205
465 3300005355 Ga0070671_100367312 Ga0070671_1003673122 205
466 3300005356 Ga0070674_100000912 Ga0070674_10000091212 205
467 3300005364 Ga0070673_100022910 Ga0070673_1000229104 205
468 3300005364 Ga0070673_100091970 Ga0070673_1000919703 205
469 3300005364 Ga0070673_100443023 Ga0070673_1004430232 205
470 3300005365 Ga0070688_100001414 Ga0070688_10000141419 205
471 3300005366 Ga0070659_100002483 Ga0070659_1000024834 205
472 3300005366 Ga0070659_100004760 Ga0070659_1000047604 205
473 3300005367 Ga0070667_100018952 Ga0070667_1000189522 205
474 3300005367 Ga0070667_100025188 Ga0070667_1000251885 205
475 3300005367 Ga0070667_100037302 Ga0070667_1000373024 205
476 3300005367 Ga0070667_100788782 Ga0070667_1007887822 205
477 3300005434 Ga0070709_10295089 Ga0070709_102950892 205
478 3300005435 Ga0070714_100548650 Ga0070714_1005486502 205
479 3300005435 Ga0070714_100814949 Ga0070714_1008149491 205
480 3300005436 Ga0070713_100189526 Ga0070713_1001895263 205
481 3300005437 Ga0070710_10480747 Ga0070710_104807472 205
482 3300005438 Ga0070701_10306214 Ga0070701_103062141 205
483 3300005439 Ga0070711_100005001 Ga0070711_10000500113 205
484 3300005439 Ga0070711_100060582 Ga0070711_1000605824 205
485 3300005439 Ga0070711_100104829 Ga0070711_1001048292 205
486 3300005439 Ga0070711_100193299 Ga0070711_1001932993 205
487 3300005440 Ga0070705_100015270 Ga0070705_1000152704 205
488 3300005440 Ga0070705_100017440 Ga0070705_1000174404 205
489 3300005440 Ga0070705_100383762 Ga0070705_1003837621 205
490 3300005441 Ga0070700_100044032 Ga0070700_1000440322 205
491 3300005444 Ga0070694_100016943 Ga0070694_1000169435 205
492 3300005444 Ga0070694_100261255 Ga0070694_1002612551 205
493 3300005445 Ga0070708_100031777 Ga0070708_1000317774 205
494 3300005445 Ga0070708_100138340 Ga0070708_1001383403 205
495 3300005445 Ga0070708_100158709 Ga0070708_1001587093 205
496 3300005445 Ga0070708_100515544 Ga0070708_1005155441 205
497 3300005455 Ga0070663_100033694 Ga0070663_1000336946 205
498 3300005456 Ga0070678_100508932 Ga0070678_1005089322 205
499 3300005457 Ga0070662_100007763 Ga0070662_1000077634 205
500 3300005457 Ga0070662_100024478 Ga0070662_1000244784 205
501 3300005457 Ga0070662_100231057 Ga0070662_1002310572 205
502 3300005459 Ga0068867_100197877 Ga0068867_1001978772 205
503 3300005467 Ga0070706_100099800 Ga0070706_1000998002 205
504 3300005467 Ga0070706_100100812 Ga0070706_1001008125 205
505 3300005467 Ga0070706_100278642 Ga0070706_1002786421 205
506 3300005467 Ga0070706_100293023 Ga0070706_1002930232 205
507 3300005468 Ga0070707_100003721 Ga0070707_10000372124 205
508 3300005468 Ga0070707_100062020 Ga0070707_1000620204 205
509 3300005468 Ga0070707_100113761 Ga0070707_1001137614 205
510 3300005468 Ga0070707_100197041 Ga0070707_1001970412 205
511 3300005468 Ga0070707_100226363 Ga0070707_1002263631 205
512 3300005468 Ga0070707_100351433 Ga0070707_1003514331 205
513 3300005471 Ga0070698_100001836 Ga0070698_10000183628 205
514 3300005471 Ga0070698_100012011 Ga0070698_1000120118 205
515 3300005471 Ga0070698_100194316 Ga0070698_1001943163 205
516 3300005471 Ga0070698_100246137 Ga0070698_1002461373 205
517 3300005471 Ga0070698_100271036 Ga0070698_1002710364 205
518 3300005518 Ga0070699_100089693 Ga0070699_1000896933 205
519 3300005518 Ga0070699_100328077 Ga0070699_1003280772 205
520 3300005535 Ga0070684_100001475 Ga0070684_10000147516 205
521 3300005536 Ga0070697_100000826 Ga0070697_10000082630 205
522 3300005536 Ga0070697_100022327 Ga0070697_1000223272 205
523 3300005536 Ga0070697_100038008 Ga0070697_1000380082 205
524 3300005536 Ga0070697_100076088 Ga0070697_1000760885 205
525 3300005536 Ga0070697_100118459 Ga0070697_1001184593 205
526 3300005536 Ga0070697_100149612 Ga0070697_1001496121 205
527 3300005539 Ga0068853_100406604 Ga0068853_1004066043 205
528 3300005543 Ga0070672_100000808 Ga0070672_10000080818 205
529 3300005543 Ga0070672_100046256 Ga0070672_1000462564 205
530 3300005543 Ga0070672_100558585 Ga0070672_1005585851 205
531 3300005546 Ga0070696_100032501 Ga0070696_1000325014 205
532 3300005548 Ga0070665_100014536 Ga0070665_1000145366 205
533 3300005548 Ga0070665_100165819 Ga0070665_1001658192 205
534 3300005548 Ga0070665_100171092 Ga0070665_1001710923 205
535 3300005549 Ga0070704_100018431 Ga0070704_1000184313 205
536 3300005549 Ga0070704_100078384 Ga0070704_1000783843 205
537 3300005549 Ga0070704_100108655 Ga0070704_1001086552 205
538 3300005563 Ga0068855_100753013 Ga0068855_1007530132 205
539 3300005564 Ga0070664_100163850 Ga0070664_1001638503 205
540 3300005564 Ga0070664_100244117 Ga0070664_1002441172 205
541 3300005615 Ga0070702_100662645 Ga0070702_1006626451 205
542 3300005616 Ga0068852_100780153 Ga0068852_1007801531 205
543 3300005617 Ga0068859_100022886 Ga0068859_1000228864 205
544 3300005719 Ga0068861_100086770 Ga0068861_1000867704 205
545 3300005841 Ga0068863_100007967 Ga0068863_10000796719 205
546 3300005842 Ga0068858_100092563 Ga0068858_1000925634 205
547 3300005843 Ga0068860_100010603 Ga0068860_10001060315 205
548 3300005843 Ga0068860_100017144 Ga0068860_1000171445 205
549 3300005844 Ga0068862_100008330 Ga0068862_10000833010 205
550 3300005937 Ga0081455_10000328 Ga0081455_1000032836 205
551 3300005937 Ga0081455_10001697 Ga0081455_1000169712 205
552 3300005937 Ga0081455_10021927 Ga0081455_100219272 205
553 3300005937 Ga0081455_10063112 Ga0081455_100631123 205
554 3300005937 Ga0081455_10158887 Ga0081455_101588872 205
555 3300005983 Ga0081540_1000036 Ga0081540_100003628 205
556 3300005983 Ga0081540_1044314 Ga0081540_10443144 205
557 3300005983 Ga0081540_1095039 Ga0081540_10950392 205
558 3300005985 Ga0081539_10015406 Ga0081539_100154065 205
559 3300006028 Ga0070717_10254282 Ga0070717_102542822 205
560 3300006028 Ga0070717_10666151 Ga0070717_106661512 205
561 3300006028 Ga0070717_10684583 Ga0070717_106845832 205
562 3300006163 Ga0070715_10341462 Ga0070715_103414621 205
563 3300006173 Ga0070716_100036195 Ga0070716_1000361954 205
564 3300006173 Ga0070716_100041479 Ga0070716_1000414793 205
565 3300006173 Ga0070716_100254021 Ga0070716_1002540212 205
566 3300006173 Ga0070716_100264003 Ga0070716_1002640032 205
567 3300006175 Ga0070712_100050761 Ga0070712_1000507612 205
568 3300006175 Ga0070712_100163392 Ga0070712_1001633922 205
569 3300006175 Ga0070712_100712383 Ga0070712_1007123832 205
570 3300006237 Ga0097621_100031766 Ga0097621_1000317664 205
571 3300006237 Ga0097621_100281893 Ga0097621_1002818932 205
572 3300006358 Ga0068871_100129048 Ga0068871_1001290484 205
573 3300006852 Ga0075433_10212447 Ga0075433_102124473 205
574 3300006881 Ga0068865_100068978 Ga0068865_1000689782 205
575 3300006881 Ga0068865_100471370 Ga0068865_1004713702 205
576 3300006931 Ga0097620_100022886 Ga0097620_1000228864 205
577 3300007076 Ga0075435_100521424 Ga0075435_1005214241 205
578 3300009098 Ga0105245_10098347 Ga0105245_100983472 205
579 3300009098 Ga0105245_10365270 Ga0105245_103652703 205
580 3300009098 Ga0105245_10396933 Ga0105245_103969333 205
581 3300009101 Ga0105247_10064781 Ga0105247_100647812 205
582 3300009147 Ga0114129_10003445 Ga0114129_1000344516 205
583 3300009147 Ga0114129_10248724 Ga0114129_102487243 205
584 3300009147 Ga0114129_10609702 Ga0114129_106097022 205
585 3300009148 Ga0105243_10018077 Ga0105243_100180779 205
586 3300009545 Ga0105237_10074141 Ga0105237_100741414 205
587 3300009553 Ga0105249_10018684 Ga0105249_100186845 205
588 3300009553 Ga0105249_10074789 Ga0105249_100747891 205
589 3300010159 Ga0099796_10167614 Ga0099796_101676142 205
590 3300010375 Ga0105239_10038497 Ga0105239_100384977 205
591 3300010375 Ga0105239_10169916 Ga0105239_101699163 205
592 3300011119 Ga0105246_10475549 Ga0105246_104755492 205
593 3300011119 Ga0105246_10748933 Ga0105246_107489332 205
594 3300013296 Ga0157374_10018842 Ga0157374_100188427 205
595 3300013296 Ga0157374_10180939 Ga0157374_101809393 205
596 3300013296 Ga0157374_10221459 Ga0157374_102214593 205
597 3300013296 Ga0157374_10598674 Ga0157374_105986742 205
598 3300013296 Ga0157374_10728606 Ga0157374_107286062 205
599 3300013296 Ga0157374_11113292 Ga0157374_111132921 205
600 3300013297 Ga0157378_10057797 Ga0157378_100577974 205
601 3300013297 Ga0157378_10216017 Ga0157378_102160172 205
602 3300013297 Ga0157378_10534027 Ga0157378_105340272 205
603 3300013297 Ga0157378_10623515 Ga0157378_106235152 205
604 3300013306 Ga0163162_10002697 Ga0163162_1000269715 205
605 3300013306 Ga0163162_10014121 Ga0163162_100141212 205
606 3300013306 Ga0163162_10024438 Ga0163162_100244387 205
607 3300013307 Ga0157372_10045317 Ga0157372_100453173 205
608 3300013307 Ga0157372_10155739 Ga0157372_101557393 205
609 3300013308 Ga0157375_10089439 Ga0157375_100894394 205
610 3300013308 Ga0157375_10101429 Ga0157375_101014292 205
611 3300014325 Ga0163163_10106345 Ga0163163_101063454 205
612 3300014325 Ga0163163_10659116 Ga0163163_106591162 205
613 3300014745 Ga0157377_10077841 Ga0157377_100778411 205
614 3300014968 Ga0157379_10005647 Ga0157379_100056474 205
615 3300014969 Ga0157376_10020829 Ga0157376_100208295 205
616 3300014969 Ga0157376_10097176 Ga0157376_100971763 205
617 3300014969 Ga0157376_10966546 Ga0157376_109665462 205
618 3300017792 Ga0163161_10017041 Ga0163161_100170414 205
619 3300017792 Ga0163161_10381344 Ga0163161_103813442 205
620 3300017792 Ga0163161_10551356 Ga0163161_105513561 205
621 3300025271 Ga0207666_1002371 Ga0207666_10023711 205
622 3300025290 Ga0207673_1001361 Ga0207673_10013612 205
623 3300025290 Ga0207673_1007376 Ga0207673_10073762 205
624 3300025315 Ga0207697_10000131 Ga0207697_1000013140 205
625 3300025315 Ga0207697_10000495 Ga0207697_100004952 205
626 3300025315 Ga0207697_10001701 Ga0207697_100017014 205
627 3300025315 Ga0207697_10003343 Ga0207697_100033437 205
628 3300025315 Ga0207697_10003602 Ga0207697_100036026 205
629 3300025893 Ga0207682_10011464 Ga0207682_100114644 205
630 3300025893 Ga0207682_10143698 Ga0207682_101436982 205
631 3300025898 Ga0207692_10008534 Ga0207692_100085344 205
632 3300025898 Ga0207692_10205959 Ga0207692_102059592 205
633 3300025901 Ga0207688_10010727 Ga0207688_100107277 205
634 3300025901 Ga0207688_10054862 Ga0207688_100548623 205
635 3300025901 Ga0207688_10062026 Ga0207688_100620262 205
636 3300025903 Ga0207680_10166630 Ga0207680_101666303 205
637 3300025904 Ga0207647_10009265 Ga0207647_100092655 205
638 3300025904 Ga0207647_10048527 Ga0207647_100485272 205
639 3300025905 Ga0207685_10131690 Ga0207685_101316902 205
640 3300025906 Ga0207699_10004362 Ga0207699_100043622 205
641 3300025906 Ga0207699_10022105 Ga0207699_100221051 205
642 3300025907 Ga0207645_10001786 Ga0207645_1000178624 205
643 3300025907 Ga0207645_10002762 Ga0207645_1000276219 205
644 3300025907 Ga0207645_10004253 Ga0207645_1000425315 205
645 3300025910 Ga0207684_10018780 Ga0207684_100187806 205
646 3300025910 Ga0207684_10049861 Ga0207684_100498612 205
647 3300025910 Ga0207684_10160762 Ga0207684_101607624 205
648 3300025910 Ga0207684_10343629 Ga0207684_103436292 205
649 3300025910 Ga0207684_10371059 Ga0207684_103710592 205
650 3300025910 Ga0207684_10468236 Ga0207684_104682362 205
651 3300025914 Ga0207671_10183802 Ga0207671_101838023 205
652 3300025915 Ga0207693_10000889 Ga0207693_1000088917 205
653 3300025915 Ga0207693_10049459 Ga0207693_100494593 205
654 3300025915 Ga0207693_10187584 Ga0207693_101875843 205
655 3300025915 Ga0207693_10541698 Ga0207693_105416982 205
656 3300025916 Ga0207663_10002290 Ga0207663_100022905 205
657 3300025916 Ga0207663_10008643 Ga0207663_100086434 205
658 3300025916 Ga0207663_10023185 Ga0207663_100231853 205
659 3300025916 Ga0207663_10145505 Ga0207663_101455053 205
660 3300025918 Ga0207662_10000699 Ga0207662_100006995 205
661 3300025919 Ga0207657_10323849 Ga0207657_103238493 205
662 3300025922 Ga0207646_10000191 Ga0207646_1000019132 205
663 3300025922 Ga0207646_10010143 Ga0207646_1001014316 205
664 3300025922 Ga0207646_10014393 Ga0207646_100143938 205
665 3300025922 Ga0207646_10020049 Ga0207646_100200494 205
666 3300025922 Ga0207646_10340306 Ga0207646_103403062 205
667 3300025922 Ga0207646_10375822 Ga0207646_103758221 205
668 3300025923 Ga0207681_10011518 Ga0207681_100115184 205
669 3300025923 Ga0207681_10354239 Ga0207681_103542391 205
670 3300025923 Ga0207681_10481214 Ga0207681_104812142 205
671 3300025925 Ga0207650_10614732 Ga0207650_106147321 205
672 3300025926 Ga0207659_10005098 Ga0207659_100050982 205
673 3300025926 Ga0207659_10016965 Ga0207659_100169653 205
674 3300025926 Ga0207659_10254896 Ga0207659_102548963 205
675 3300025927 Ga0207687_10067835 Ga0207687_100678354 205
676 3300025927 Ga0207687_10442189 Ga0207687_104421892 205
677 3300025928 Ga0207700_10015667 Ga0207700_100156674 205
678 3300025928 Ga0207700_10048816 Ga0207700_100488163 205
679 3300025928 Ga0207700_10114187 Ga0207700_101141873 205
680 3300025928 Ga0207700_10243586 Ga0207700_102435862 205
681 3300025929 Ga0207664_10051382 Ga0207664_100513822 205
682 3300025931 Ga0207644_10054675 Ga0207644_100546752 205
683 3300025931 Ga0207644_10067172 Ga0207644_100671724 205
684 3300025932 Ga0207690_10002640 Ga0207690_1000264010 205
685 3300025933 Ga0207706_10022549 Ga0207706_100225497 205
686 3300025933 Ga0207706_10037590 Ga0207706_100375904 205
687 3300025933 Ga0207706_10074996 Ga0207706_100749965 205
688 3300025933 Ga0207706_10332854 Ga0207706_103328542 205
689 3300025935 Ga0207709_10197983 Ga0207709_101979832 205
690 3300025936 Ga0207670_10016878 Ga0207670_100168784 205
691 3300025937 Ga0207669_10069350 Ga0207669_100693503 205
692 3300025938 Ga0207704_10047899 Ga0207704_100478994 205
693 3300025939 Ga0207665_10054719 Ga0207665_100547193 205
694 3300025939 Ga0207665_10218229 Ga0207665_102182293 205
695 3300025939 Ga0207665_10275263 Ga0207665_102752632 205
696 3300025940 Ga0207691_10000247 Ga0207691_1000024722 205
697 3300025940 Ga0207691_10212905 Ga0207691_102129052 205
698 3300025940 Ga0207691_10221759 Ga0207691_102217593 205
699 3300025945 Ga0207679_10031450 Ga0207679_100314503 205
700 3300025945 Ga0207679_10744123 Ga0207679_107441231 205
701 3300025960 Ga0207651_10012073 Ga0207651_100120734 205
702 3300025961 Ga0207712_10114117 Ga0207712_101141171 205
703 3300025972 Ga0207668_10006260 Ga0207668_100062604 205
704 3300025972 Ga0207668_10017541 Ga0207668_100175416 205
705 3300025972 Ga0207668_10130077 Ga0207668_101300774 205
706 3300025972 Ga0207668_10145826 Ga0207668_101458263 205
707 3300025972 Ga0207668_10425105 Ga0207668_104251052 205
708 3300025986 Ga0207658_10010987 Ga0207658_100109876 205
709 3300025986 Ga0207658_10026613 Ga0207658_100266137 205
710 3300025986 Ga0207658_10267108 Ga0207658_102671082 205
711 3300026023 Ga0207677_10039629 Ga0207677_100396294 205
712 3300026023 Ga0207677_10073923 Ga0207677_100739234 205
713 3300026023 Ga0207677_10075096 Ga0207677_100750964 205
714 3300026035 Ga0207703_10601425 Ga0207703_106014252 205
715 3300026041 Ga0207639_10258886 Ga0207639_102588862 205
716 3300026067 Ga0207678_10040073 Ga0207678_100400733 205
717 3300026075 Ga0207708_10008844 Ga0207708_100088443 205
718 3300026088 Ga0207641_10218575 Ga0207641_102185752 205
719 3300026089 Ga0207648_10213801 Ga0207648_102138013 205
720 3300026118 Ga0207675_100064977 Ga0207675_1000649774 205
721 3300026118 Ga0207675_100132193 Ga0207675_1001321932 205
722 3300026118 Ga0207675_100382273 Ga0207675_1003822732 205
723 3300026121 Ga0207683_10051070 Ga0207683_100510705 205
724 3300026121 Ga0207683_10063965 Ga0207683_100639652 205
725 3300027617 Ga0210002_1024755 Ga0210002_10247552 205
726 3300027717 Ga0209998_10035192 Ga0209998_100351922 205
727 3300027717 Ga0209998_10040572 Ga0209998_100405722 205
728 3300027876 Ga0209974_10002731 Ga0209974_1000273113 205
729 3300028379 Ga0268266_10022713 Ga0268266_100227134 205
730 3300028379 Ga0268266_10081503 Ga0268266_100815035 205
731 3300028379 Ga0268266_10147129 Ga0268266_101471291 205
732 3300028379 Ga0268266_10227276 Ga0268266_102272763 205
733 3300028380 Ga0268265_10118795 Ga0268265_101187952 205
734 3300028381 Ga0268264_10052052 Ga0268264_100520525 205
735 3300035088 Ga0373940_0045843 Ga0373940_0045843_564_1193 205
736 3300035089 Ga0373944_0021902 Ga0373944_0021902_113_730 205
737 3300035091 Ga0373951_0088345 Ga0373951_0088345_110_727 205
738 3300035116 Ga0373945_0035084 Ga0373945_0035084_150_767 205
739 3300035170 Ga0373943_0032504 Ga0373943_0032504_1532_2170 205
740 3300035170 Ga0373943_0061880 Ga0373943_0061880_46_663 205
741 3300035691 Ga0373931_0015223 Ga0373931_0015223_2091_2720 205
742 3300035691 Ga0373931_0044383 Ga0373931_0044383_113_730 205
743 3300035691 Ga0373931_0051632 Ga0373931_0051632_896_1534 205
744 3300035692 Ga0373935_0034768 Ga0373935_0034768_2359_2994 205
745 3300035692 Ga0373935_0049700 Ga0373935_0049700_515_1153 205
746 3300035692 Ga0373935_0051886 Ga0373935_0051886_1735_2352 205
747 3300035695 Ga0373927_0010910 Ga0373927_0010910_209_844 205
748 3300035695 Ga0373927_0031272 Ga0373927_0031272_1952_2569 205
749 3300035695 Ga0373927_0453312 Ga0373927_0453312_107_745 205
750 3300035695 Ga0373927_0471573 Ga0373927_0471573_108_746 205
751 3300035725 Ga0373947_0007924 Ga0373947_0007924_2183_2821 205
752 3300035725 Ga0373947_0133507 Ga0373947_0133507_413_1030 205
753 3300035725 Ga0373947_0236510 Ga0373947_0236510_328_966 205
754 3300037068 Ga0373925_0078544 Ga0373925_0078544_56_694 205
755 3300037068 Ga0373925_0278365 Ga0373925_0278365_316_951 205
756 3300037312 Ga0395899_0040689 Ga0395899_0040689_1553_2188 205
757 3300037418 Ga0395900_0008031 Ga0395900_0008031_9213_9848 205
758 3300037418 Ga0395900_0118855 Ga0395900_0118855_1865_2500 205
759 3300037418 Ga0395900_0616758 Ga0395900_0616758_239_874 205
760 3300037466 Ga0395898_0036909 Ga0395898_0036909_4026_4661 205
761 3300037466 Ga0395898_1077831 Ga0395898_1077831_90_725 205
762 3300038443 Ga0395901_0002964 Ga0395901_0002964_8890_9525 205
763 3300038443 Ga0395901_0104360 Ga0395901_0104360_1775_2419 205
764 3300042009 Ga0439451_005465 Ga0439451_005465_1340_1984 205
765 3300042012 Ga0439455_0012285 Ga0439455_0012285_110_748 205
766 3300042012 Ga0439455_0108650 Ga0439455_0108650_101_736 205
767 3300042439 Ga0439464_0015733 Ga0439464_0015733_585_1220 205
768 3300045051 Ga0451576_0046345 Ga0451576_0046345_2014_2658 205
769 3300045976 Ga0466967_0373597 Ga0466967_0373597_634_1293 205
770 3300046506 Ga0495583_0193524 Ga0495583_0193524_103_720 205
771 3300046518 Ga0495631_0051981 Ga0495631_0051981_987_1604 205
772 3300046528 Ga0495642_0035028 Ga0495642_0035028_1338_1955 205
773 3300046537 Ga0495598_0010463 Ga0495598_0010463_387_1004 205
774 3300046684 Ga0495669_0010128 Ga0495669_0010128_2380_2997 205
775 3300046689 Ga0495613_0576303 Ga0495613_0576303_60_695 205
776 3300047470 Ga0495681_0041225 Ga0495681_0041225_215_832 205
777 3300048903 Ga0496100_0007185 Ga0496100_0007185_3415_4053 205
778 3300048903 Ga0496100_0122710 Ga0496100_0122710_598_1233 205
779 3300048904 Ga0496101_0004352 Ga0496101_0004352_3785_4423 205
780 3300048904 Ga0496101_0475029 Ga0496101_0475029_262_897 205
781 3300048905 Ga0496102_0103303 Ga0496102_0103303_204_872 205
782 3300048905 Ga0496102_0187224 Ga0496102_0187224_82_699 205
783 3300048905 Ga0496102_0202645 Ga0496102_0202645_1079_1756 205
784 3300048905 Ga0496102_0579595 Ga0496102_0579595_191_844 205
785 3300048906 Ga0496103_0002509 Ga0496103_0002509_1715_2353 205
786 3300048907 Ga0496104_0017573 Ga0496104_0017573_5082_5717 205
787 3300048907 Ga0496104_0121937 Ga0496104_0121937_1448_2065 205
788 3300048907 Ga0496104_0269348 Ga0496104_0269348_834_1463 205
789 3300048907 Ga0496104_0929627 Ga0496104_0929627_73_708 205
790 3300048909 Ga0496106_0003085 Ga0496106_0003085_5927_6565 205
791 3300048909 Ga0496106_0064483 Ga0496106_0064483_1736_2353 205
792 3300048909 Ga0496106_0211532 Ga0496106_0211532_345_980 205
793 3300048910 Ga0496107_0001730 Ga0496107_0001730_4006_4644 205
794 3300048910 Ga0496107_0026301 Ga0496107_0026301_858_1526 205
795 3300048910 Ga0496107_0034242 Ga0496107_0034242_2235_2852 205
796 3300048910 Ga0496107_0169099 Ga0496107_0169099_10_651 205
797 3300048910 Ga0496107_0541237 Ga0496107_0541237_48_725 205
798 3300048911 Ga0496108_0009866 Ga0496108_0009866_3937_4614 205
799 3300048911 Ga0496108_0113977 Ga0496108_0113977_1556_2173 205
800 3300048911 Ga0496108_0151522 Ga0496108_0151522_1154_1795 205
801 3300048911 Ga0496108_0219188 Ga0496108_0219188_868_1497 205
802 3300048912 Ga0496109_0007156 Ga0496109_0007156_8347_8988 205
803 3300048912 Ga0496109_0007242 Ga0496109_0007242_3935_4612 205
804 3300048912 Ga0496109_0362236 Ga0496109_0362236_588_1205 205
805 3300048912 Ga0496109_0695354 Ga0496109_0695354_193_831 205
806 3300048913 Ga0496110_0029638 Ga0496110_0029638_1853_2521 205
807 3300048913 Ga0496110_0228364 Ga0496110_0228364_684_1337 205
808 3300048913 Ga0496110_0479248 Ga0496110_0479248_350_991 205
809 3300048914 Ga0496111_0092502 Ga0496111_0092502_1330_1998 205
810 3300048915 Ga0496112_0022098 Ga0496112_0022098_569_1246 205
811 3300048915 Ga0496112_0060138 Ga0496112_0060138_1467_2084 205
812 3300048915 Ga0496112_0482204 Ga0496112_0482204_96_713 205
813 3300048915 Ga0496112_0614248 Ga0496112_0614248_141_779 205
814 3300048916 Ga0496113_0010988 Ga0496113_0010988_1568_2245 205
815 3300048916 Ga0496113_0192486 Ga0496113_0192486_787_1422 205
816 3300048916 Ga0496113_0437804 Ga0496113_0437804_202_870 205
817 3300048917 Ga0496114_0018633 Ga0496114_0018633_3544_4182 205
818 3300048918 Ga0496115_0002575 Ga0496115_0002575_12029_12664 205
819 3300048918 Ga0496115_0004314 Ga0496115_0004314_1350_2003 205
820 3300048918 Ga0496115_0009305 Ga0496115_0009305_1384_2022 205
821 3300048918 Ga0496115_0081369 Ga0496115_0081369_78_695 205
822 3300048918 Ga0496115_0239799 Ga0496115_0239799_467_1108 205
823 3300050507 nmdc:mga05p37_104793_c1 nmdc:mga05p37_104793_c1_1039_1674 205
824 3300050507 nmdc:mga05p37_3284_c1 nmdc:mga05p37_3284_c1_3960_4595 205
825 3300050507 nmdc:mga05p37_35285_c1 nmdc:mga05p37_35285_c1_524_1162 205
826 3300050507 nmdc:mga05p37_517419_c1 nmdc:mga05p37_517419_c1_605_1240 205
827 3300050507 nmdc:mga05p37_763753_c1 nmdc:mga05p37_763753_c1_93_722 205
828 3300050511 nmdc:mga08y16_410200_c1 nmdc:mga08y16_410200_c1_273_902 205
829 3300050511 nmdc:mga08y16_542313_c1 nmdc:mga08y16_542313_c1_56_697 205
830 3300050512 nmdc:mga0n895_451569_c1 nmdc:mga0n895_451569_c1_251_889 205
831 3300050513 nmdc:mga0rr50_371260_c1 nmdc:mga0rr50_371260_c1_404_1039 205
832 3300050513 nmdc:mga0rr50_405962_c1 nmdc:mga0rr50_405962_c1_274_912 205
833 3300050513 nmdc:mga0rr50_475436_c1 nmdc:mga0rr50_475436_c1_358_993 205
834 3300050515 nmdc:mga0a205_311920_c1 nmdc:mga0a205_311920_c1_160_795 205
835 3300050515 nmdc:mga0a205_348373_c1 nmdc:mga0a205_348373_c1_588_1223 205
836 3300050515 nmdc:mga0a205_476077_c1 nmdc:mga0a205_476077_c1_223_858 205
837 3300050515 nmdc:mga0a205_655097_c1 nmdc:mga0a205_655097_c1_236_871 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

15

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9235 95 201
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9225 93 201
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8209 11 201
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.805 11 201
1dmg-assembly1.cif.gz_A crystal structure of ribosomal protein l4 0.8022 90 201
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8022 90 201 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7228 13 201 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7167 15 205 3.40.1370.10
af_Q10NM5_49_283_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7136 24 205 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7134 13 199 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A1Q6X306-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.984 95 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1G3Z2J8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9617 94 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A536U9H5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.954 96 201 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1G3Z2J8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9451 94 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D2KWG5-F1-model_v4 deleted 0.9428 108 199

Feature Viewer

pLDDT pTM Quality
77.6 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map