F482938
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 837 | 290 | 837 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_10354239|Ga0207681_103542391 |
| Length | 250 |
| Sequence | MSAKVLTKAAAKEAKIEIIENGRGTQAVHDAVVAMRAARRSGSANTKTKAEVDLSGAKPWRQKGTGRARAGYKSSPIWRGGGVVFGPKPRDYSKKVSKSVRRLAFHKALSERIKAGDVLTIDKFAVSELKTKSFVDLVRKQTDAEKVLIVSDSFDEKTFKSARNVKPPCSLIRLRTLRRAEDRDRHVVGLDAEVDDERHADLEVVLVAPFDVGHHPRTLLEIDHRGDVRHALVEGRKIVAAHVSLMDAPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 215 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 216 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 288 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 290 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.6 |
| Nodule | 0 |
| Rhizoplane | 6.57 |
| Rhizosphere | 91.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1511392 | 2162886006 | Bacteria | 1295 |
| 2 | SwRhRL2b_contig_157882 | 2162886007 | Bacteria | 7063 |
| 3 | CNXas_1000052 | 3300000545 | Bacteria | 22151 |
| 4 | JGI24035J26624_1001915 | 3300002126 | Unclassified | 1942 |
| 5 | JGI25406J46586_10000001 | 3300003203 | Bacteria | 251772 |
| 6 | JGI25406J46586_10000007 | 3300003203 | Bacteria | 112227 |
| 7 | rootL2_10163792 | 3300003322 | Bacteria | 3522 |
| 8 | JGI25405J52794_10000497 | 3300003911 | Bacteria | 5665 |
| 9 | JGI25405J52794_10035337 | 3300003911 | Bacteria | 1046 |
| 10 | JGI25405J52794_10045831 | 3300003911 | Bacteria | 931 |
| 11 | Ga0065703_1019589 | 3300005272 | Bacteria | 2689 |
| 12 | Ga0065704_10086836 | 3300005289 | Bacteria | 3079 |
| 13 | Ga0065704_10245549 | 3300005289 | Bacteria | 1003 |
| 14 | Ga0065712_10001341 | 3300005290 | Bacteria | 6456 |
| 15 | Ga0065712_10006266 | 3300005290 | Unclassified | 2658 |
| 16 | Ga0065712_10223303 | 3300005290 | Bacteria | 1034 |
| 17 | Ga0065712_10273400 | 3300005290 | Unclassified | 911 |
| 18 | Ga0065715_10001210 | 3300005293 | Bacteria | 9966 |
| 19 | Ga0065715_10001337 | 3300005293 | Bacteria | 11995 |
| 20 | Ga0065715_10006003 | 3300005293 | Bacteria | 6856 |
| 21 | Ga0065715_10006907 | 3300005293 | Bacteria | 4196 |
| 22 | Ga0065715_10104827 | 3300005293 | Bacteria | 2931 |
| 23 | Ga0065715_10133814 | 3300005293 | Unclassified | 1962 |
| 24 | Ga0065715_10308998 | 3300005293 | Bacteria | 1017 |
| 25 | Ga0065707_10002326 | 3300005295 | Bacteria | 7744 |
| 26 | Ga0065707_10105144 | 3300005295 | Bacteria | 2659 |
| 27 | Ga0065707_10158891 | 3300005295 | Unclassified | 1582 |
| 28 | Ga0070658_10025644 | 3300005327 | Bacteria | 4725 |
| 29 | Ga0070658_10075379 | 3300005327 | Bacteria | 2767 |
| 30 | Ga0070658_10084079 | 3300005327 | Bacteria | 2617 |
| 31 | Ga0070658_10094139 | 3300005327 | Bacteria | 2471 |
| 32 | Ga0070676_10006857 | 3300005328 | Bacteria | 6100 |
| 33 | Ga0070676_10012318 | 3300005328 | Bacteria | 4663 |
| 34 | Ga0070676_10013851 | 3300005328 | Bacteria | 4424 |
| 35 | Ga0070683_100014335 | 3300005329 | Bacteria | 6932 |
| 36 | Ga0070683_100014620 | 3300005329 | Bacteria | 6873 |
| 37 | Ga0070683_100093797 | 3300005329 | Bacteria | 2821 |
| 38 | Ga0070690_100053225 | 3300005330 | Bacteria | 2589 |
| 39 | Ga0070670_100248667 | 3300005331 | Bacteria | 1549 |
| 40 | Ga0070677_10005596 | 3300005333 | Bacteria | 4146 |
| 41 | Ga0070666_10004276 | 3300005335 | Bacteria | 8684 |
| 42 | Ga0070666_10026532 | 3300005335 | Bacteria | 3787 |
| 43 | Ga0070666_10054780 | 3300005335 | Bacteria | 2690 |
| 44 | Ga0070666_10199507 | 3300005335 | Bacteria | 1407 |
| 45 | Ga0070666_10326257 | 3300005335 | Unclassified | 1095 |
| 46 | Ga0068868_100029621 | 3300005338 | Bacteria | 4193 |
| 47 | Ga0068868_100057916 | 3300005338 | Bacteria | 3062 |
| 48 | Ga0068868_100067232 | 3300005338 | Bacteria | 2852 |
| 49 | Ga0068868_100126997 | 3300005338 | Bacteria | 2084 |
| 50 | Ga0068868_100194101 | 3300005338 | Bacteria | 1689 |
| 51 | Ga0068868_100214619 | 3300005338 | Bacteria | 1609 |
| 52 | Ga0068868_100325778 | 3300005338 | Bacteria | 1310 |
| 53 | Ga0068868_100432416 | 3300005338 | Bacteria | 1141 |
| 54 | Ga0070660_100103069 | 3300005339 | Bacteria | 2262 |
| 55 | Ga0070660_100342014 | 3300005339 | Unclassified | 1231 |
| 56 | Ga0070660_100438467 | 3300005339 | Bacteria | 1083 |
| 57 | Ga0070689_100009585 | 3300005340 | Bacteria | 6870 |
| 58 | Ga0070689_100114177 | 3300005340 | Bacteria | 2151 |
| 59 | Ga0070689_100965139 | 3300005340 | Unclassified | 757 |
| 60 | Ga0070687_100000382 | 3300005343 | Bacteria | 15047 |
| 61 | Ga0070687_100308397 | 3300005343 | Unclassified | 1007 |
| 62 | Ga0070661_100092920 | 3300005344 | Unclassified | 2236 |
| 63 | Ga0070661_100729087 | 3300005344 | Unclassified | 809 |
| 64 | Ga0070661_101206117 | 3300005344 | Bacteria | 633 |
| 65 | Ga0070668_100000403 | 3300005347 | Bacteria | 28684 |
| 66 | Ga0070668_100004836 | 3300005347 | Bacteria | 9989 |
| 67 | Ga0070668_100007390 | 3300005347 | Bacteria | 8153 |
| 68 | Ga0070668_100040758 | 3300005347 | Bacteria | 3554 |
| 69 | Ga0070668_100175817 | 3300005347 | Bacteria | 1745 |
| 70 | Ga0070669_100002011 | 3300005353 | Bacteria | 14710 |
| 71 | Ga0070669_100008062 | 3300005353 | Bacteria | 7522 |
| 72 | Ga0070669_100033499 | 3300005353 | Bacteria | 3716 |
| 73 | Ga0070669_100065736 | 3300005353 | Bacteria | 2672 |
| 74 | Ga0070669_100128080 | 3300005353 | Unclassified | 1944 |
| 75 | Ga0070669_100182783 | 3300005353 | Unclassified | 1641 |
| 76 | Ga0070675_100005920 | 3300005354 | Bacteria | 9365 |
| 77 | Ga0070675_100008984 | 3300005354 | Bacteria | 7762 |
| 78 | Ga0070675_100014207 | 3300005354 | Bacteria | 6276 |
| 79 | Ga0070675_100069033 | 3300005354 | Bacteria | 2927 |
| 80 | Ga0070675_100078814 | 3300005354 | Bacteria | 2744 |
| 81 | Ga0070675_100197214 | 3300005354 | Bacteria | 1746 |
| 82 | Ga0070675_100607122 | 3300005354 | Bacteria | 992 |
| 83 | Ga0070675_100677838 | 3300005354 | Unclassified | 938 |
| 84 | Ga0070671_100002459 | 3300005355 | Bacteria | 14322 |
| 85 | Ga0070671_100011495 | 3300005355 | Bacteria | 7116 |
| 86 | Ga0070671_100012710 | 3300005355 | Bacteria | 6787 |
| 87 | Ga0070671_100047861 | 3300005355 | Bacteria | 3554 |
| 88 | Ga0070671_100142680 | 3300005355 | Bacteria | 2021 |
| 89 | Ga0070671_100249573 | 3300005355 | Bacteria | 1507 |
| 90 | Ga0070671_100367312 | 3300005355 | Unclassified | 1229 |
| 91 | Ga0070674_100000912 | 3300005356 | Bacteria | 15424 |
| 92 | Ga0070674_100046469 | 3300005356 | Bacteria | 2970 |
| 93 | Ga0070674_100129388 | 3300005356 | Bacteria | 1880 |
| 94 | Ga0070673_100022910 | 3300005364 | Bacteria | 4556 |
| 95 | Ga0070673_100091970 | 3300005364 | Bacteria | 2480 |
| 96 | Ga0070673_100093233 | 3300005364 | Bacteria | 2465 |
| 97 | Ga0070673_100280195 | 3300005364 | Unclassified | 1462 |
| 98 | Ga0070673_100443023 | 3300005364 | Bacteria | 1167 |
| 99 | Ga0070688_100000733 | 3300005365 | Bacteria | 16191 |
| 100 | Ga0070688_100001414 | 3300005365 | Bacteria | 11953 |
| 101 | Ga0070688_100036885 | 3300005365 | Bacteria | 2975 |
| 102 | Ga0070688_100201836 | 3300005365 | Bacteria | 1391 |
| 103 | Ga0070688_100357767 | 3300005365 | Unclassified | 1070 |
| 104 | Ga0070659_100002483 | 3300005366 | Bacteria | 13098 |
| 105 | Ga0070659_100004760 | 3300005366 | Bacteria | 9700 |
| 106 | Ga0070659_100255238 | 3300005366 | Unclassified | 1454 |
| 107 | Ga0070659_100343778 | 3300005366 | Bacteria | 1251 |
| 108 | Ga0070667_100004665 | 3300005367 | Bacteria | 11504 |
| 109 | Ga0070667_100018952 | 3300005367 | Bacteria | 5706 |
| 110 | Ga0070667_100025188 | 3300005367 | Bacteria | 4945 |
| 111 | Ga0070667_100037302 | 3300005367 | Bacteria | 4075 |
| 112 | Ga0070667_100048750 | 3300005367 | Bacteria | 3565 |
| 113 | Ga0070667_100054124 | 3300005367 | Bacteria | 3388 |
| 114 | Ga0070667_100081996 | 3300005367 | Bacteria | 2760 |
| 115 | Ga0070667_100788782 | 3300005367 | Bacteria | 882 |
| 116 | Ga0070667_101070479 | 3300005367 | Bacteria | 753 |
| 117 | Ga0070703_10042498 | 3300005406 | Bacteria | 1421 |
| 118 | Ga0070709_10008550 | 3300005434 | Bacteria | 5627 |
| 119 | Ga0070709_10295089 | 3300005434 | Unclassified | 1182 |
| 120 | Ga0070714_100548650 | 3300005435 | Unclassified | 1106 |
| 121 | Ga0070714_100814949 | 3300005435 | Bacteria | 904 |
| 122 | Ga0070713_100005485 | 3300005436 | Bacteria | 8680 |
| 123 | Ga0070713_100189526 | 3300005436 | Bacteria | 1852 |
| 124 | Ga0070713_100346057 | 3300005436 | Unclassified | 1378 |
| 125 | Ga0070710_10480747 | 3300005437 | Bacteria | 847 |
| 126 | Ga0070701_10306214 | 3300005438 | Bacteria | 978 |
| 127 | Ga0070711_100005001 | 3300005439 | Bacteria | 7876 |
| 128 | Ga0070711_100060582 | 3300005439 | Unclassified | 2631 |
| 129 | Ga0070711_100104829 | 3300005439 | Bacteria | 2064 |
| 130 | Ga0070711_100193299 | 3300005439 | Bacteria | 1565 |
| 131 | Ga0070711_100219627 | 3300005439 | Bacteria | 1477 |
| 132 | Ga0070705_100015270 | 3300005440 | Bacteria | 3965 |
| 133 | Ga0070705_100017440 | 3300005440 | Bacteria | 3748 |
| 134 | Ga0070705_100383762 | 3300005440 | Unclassified | 1035 |
| 135 | Ga0070700_100044032 | 3300005441 | Bacteria | 2747 |
| 136 | Ga0070694_100016943 | 3300005444 | Bacteria | 4596 |
| 137 | Ga0070694_100261255 | 3300005444 | Bacteria | 1313 |
| 138 | Ga0070708_100023964 | 3300005445 | Bacteria | 5195 |
| 139 | Ga0070708_100024432 | 3300005445 | Bacteria | 5156 |
| 140 | Ga0070708_100031777 | 3300005445 | Bacteria | 4572 |
| 141 | Ga0070708_100099238 | 3300005445 | Bacteria | 2664 |
| 142 | Ga0070708_100138340 | 3300005445 | Bacteria | 2257 |
| 143 | Ga0070708_100158709 | 3300005445 | Unclassified | 2107 |
| 144 | Ga0070708_100180181 | 3300005445 | Bacteria | 1974 |
| 145 | Ga0070708_100259323 | 3300005445 | Bacteria | 1634 |
| 146 | Ga0070708_100371424 | 3300005445 | Bacteria | 1348 |
| 147 | Ga0070708_100515544 | 3300005445 | Bacteria | 1128 |
| 148 | Ga0070663_100033694 | 3300005455 | Bacteria | 3540 |
| 149 | Ga0070678_100040339 | 3300005456 | Bacteria | 3303 |
| 150 | Ga0070678_100108297 | 3300005456 | Bacteria | 2169 |
| 151 | Ga0070678_100262041 | 3300005456 | Bacteria | 1454 |
| 152 | Ga0070678_100508932 | 3300005456 | Unclassified | 1063 |
| 153 | Ga0070662_100007763 | 3300005457 | Bacteria | 6969 |
| 154 | Ga0070662_100024478 | 3300005457 | Bacteria | 4159 |
| 155 | Ga0070662_100112438 | 3300005457 | Bacteria | 2076 |
| 156 | Ga0070662_100231057 | 3300005457 | Bacteria | 1480 |
| 157 | Ga0068867_100150920 | 3300005459 | Bacteria | 1825 |
| 158 | Ga0068867_100197877 | 3300005459 | Bacteria | 1607 |
| 159 | Ga0068867_100220792 | 3300005459 | Bacteria | 1527 |
| 160 | Ga0070685_10045062 | 3300005466 | Bacteria | 2527 |
| 161 | Ga0070685_10129998 | 3300005466 | Bacteria | 1573 |
| 162 | Ga0070706_100000210 | 3300005467 | Bacteria | 71893 |
| 163 | Ga0070706_100041224 | 3300005467 | Bacteria | 4262 |
| 164 | Ga0070706_100068396 | 3300005467 | Bacteria | 3284 |
| 165 | Ga0070706_100099800 | 3300005467 | Unclassified | 2697 |
| 166 | Ga0070706_100100812 | 3300005467 | Bacteria | 2683 |
| 167 | Ga0070706_100129058 | 3300005467 | Bacteria | 2358 |
| 168 | Ga0070706_100153713 | 3300005467 | Bacteria | 2148 |
| 169 | Ga0070706_100278642 | 3300005467 | Bacteria | 1560 |
| 170 | Ga0070706_100293023 | 3300005467 | Bacteria | 1518 |
| 171 | Ga0070706_100314451 | 3300005467 | Bacteria | 1461 |
| 172 | Ga0070706_100323488 | 3300005467 | Bacteria | 1438 |
| 173 | Ga0070706_100414212 | 3300005467 | Bacteria | 1254 |
| 174 | Ga0070706_100882431 | 3300005467 | Bacteria | 826 |
| 175 | Ga0070707_100001841 | 3300005468 | Bacteria | 20359 |
| 176 | Ga0070707_100003721 | 3300005468 | Bacteria | 14386 |
| 177 | Ga0070707_100033325 | 3300005468 | Bacteria | 4911 |
| 178 | Ga0070707_100060424 | 3300005468 | Bacteria | 3635 |
| 179 | Ga0070707_100062020 | 3300005468 | Bacteria | 3586 |
| 180 | Ga0070707_100067576 | 3300005468 | Unclassified | 3438 |
| 181 | Ga0070707_100098037 | 3300005468 | Bacteria | 2839 |
| 182 | Ga0070707_100113761 | 3300005468 | Unclassified | 2626 |
| 183 | Ga0070707_100197041 | 3300005468 | Bacteria | 1963 |
| 184 | Ga0070707_100226363 | 3300005468 | Bacteria | 1821 |
| 185 | Ga0070707_100351433 | 3300005468 | Bacteria | 1432 |
| 186 | Ga0070707_100448468 | 3300005468 | Unclassified | 1251 |
| 187 | Ga0070707_100574688 | 3300005468 | Bacteria | 1089 |
| 188 | Ga0070698_100001836 | 3300005471 | Bacteria | 23657 |
| 189 | Ga0070698_100012011 | 3300005471 | Bacteria | 9181 |
| 190 | Ga0070698_100088458 | 3300005471 | Bacteria | 3083 |
| 191 | Ga0070698_100105120 | 3300005471 | Unclassified | 2793 |
| 192 | Ga0070698_100194316 | 3300005471 | Bacteria | 1966 |
| 193 | Ga0070698_100246137 | 3300005471 | Bacteria | 1721 |
| 194 | Ga0070698_100271036 | 3300005471 | Bacteria | 1629 |
| 195 | Ga0070698_100798110 | 3300005471 | Bacteria | 888 |
| 196 | Ga0070699_100089693 | 3300005518 | Bacteria | 2687 |
| 197 | Ga0070699_100328077 | 3300005518 | Bacteria | 1376 |
| 198 | Ga0070699_100379233 | 3300005518 | Bacteria | 1276 |
| 199 | Ga0070679_100096055 | 3300005530 | Unclassified | 2951 |
| 200 | Ga0070684_100001475 | 3300005535 | Bacteria | 16973 |
| 201 | Ga0070684_100033042 | 3300005535 | Bacteria | 4414 |
| 202 | Ga0070697_100000826 | 3300005536 | Bacteria | 23247 |
| 203 | Ga0070697_100002768 | 3300005536 | Bacteria | 13496 |
| 204 | Ga0070697_100022327 | 3300005536 | Bacteria | 5022 |
| 205 | Ga0070697_100038008 | 3300005536 | Bacteria | 3888 |
| 206 | Ga0070697_100076088 | 3300005536 | Bacteria | 2760 |
| 207 | Ga0070697_100118459 | 3300005536 | Bacteria | 2213 |
| 208 | Ga0070697_100149612 | 3300005536 | Unclassified | 1968 |
| 209 | Ga0070697_100438585 | 3300005536 | Unclassified | 1136 |
| 210 | Ga0070697_100765449 | 3300005536 | Bacteria | 853 |
| 211 | Ga0068853_100406604 | 3300005539 | Bacteria | 1275 |
| 212 | Ga0068853_100791601 | 3300005539 | Bacteria | 908 |
| 213 | Ga0070672_100000808 | 3300005543 | Bacteria | 18707 |
| 214 | Ga0070672_100046256 | 3300005543 | Bacteria | 3371 |
| 215 | Ga0070672_100157475 | 3300005543 | Unclassified | 1882 |
| 216 | Ga0070672_100199568 | 3300005543 | Bacteria | 1672 |
| 217 | Ga0070672_100558585 | 3300005543 | Bacteria | 994 |
| 218 | Ga0070686_100049196 | 3300005544 | Unclassified | 2673 |
| 219 | Ga0070696_100032501 | 3300005546 | Bacteria | 3579 |
| 220 | Ga0070665_100014536 | 3300005548 | Bacteria | 7897 |
| 221 | Ga0070665_100015162 | 3300005548 | Bacteria | 7738 |
| 222 | Ga0070665_100051910 | 3300005548 | Bacteria | 4112 |
| 223 | Ga0070665_100090881 | 3300005548 | Bacteria | 3059 |
| 224 | Ga0070665_100165819 | 3300005548 | Bacteria | 2211 |
| 225 | Ga0070665_100171092 | 3300005548 | Unclassified | 2173 |
| 226 | Ga0070704_100018431 | 3300005549 | Bacteria | 4464 |
| 227 | Ga0070704_100078384 | 3300005549 | Bacteria | 2424 |
| 228 | Ga0070704_100108655 | 3300005549 | Unclassified | 2106 |
| 229 | Ga0068855_100130645 | 3300005563 | Bacteria | 2869 |
| 230 | Ga0068855_100372390 | 3300005563 | Bacteria | 1570 |
| 231 | Ga0068855_100753013 | 3300005563 | Unclassified | 1038 |
| 232 | Ga0070664_100037306 | 3300005564 | Bacteria | 4086 |
| 233 | Ga0070664_100163850 | 3300005564 | Unclassified | 1969 |
| 234 | Ga0070664_100244117 | 3300005564 | Unclassified | 1613 |
| 235 | Ga0068856_101450609 | 3300005614 | Bacteria | 700 |
| 236 | Ga0070702_100662645 | 3300005615 | Unclassified | 791 |
| 237 | Ga0068852_100477245 | 3300005616 | Bacteria | 1239 |
| 238 | Ga0068852_100780153 | 3300005616 | Unclassified | 969 |
| 239 | Ga0068859_100022886 | 3300005617 | Bacteria | 6266 |
| 240 | Ga0068864_100098211 | 3300005618 | Bacteria | 2593 |
| 241 | Ga0068864_100991929 | 3300005618 | Bacteria | 833 |
| 242 | Ga0068866_10195272 | 3300005718 | Bacteria | 1205 |
| 243 | Ga0068861_100086770 | 3300005719 | Bacteria | 2461 |
| 244 | Ga0068851_10204951 | 3300005834 | Bacteria | 1102 |
| 245 | Ga0068863_100007967 | 3300005841 | Bacteria | 10355 |
| 246 | Ga0068858_100043497 | 3300005842 | Bacteria | 4164 |
| 247 | Ga0068858_100092563 | 3300005842 | Bacteria | 2814 |
| 248 | Ga0068858_100230990 | 3300005842 | Bacteria | 1754 |
| 249 | Ga0068860_100010603 | 3300005843 | Bacteria | 9101 |
| 250 | Ga0068860_100017144 | 3300005843 | Bacteria | 7061 |
| 251 | Ga0068860_100174888 | 3300005843 | Bacteria | 2075 |
| 252 | Ga0068860_100465972 | 3300005843 | Bacteria | 1258 |
| 253 | Ga0068860_100985539 | 3300005843 | Bacteria | 860 |
| 254 | Ga0068860_101162264 | 3300005843 | Unclassified | 792 |
| 255 | Ga0068860_101170895 | 3300005843 | Bacteria | 789 |
| 256 | Ga0068862_100008330 | 3300005844 | Bacteria | 8579 |
| 257 | Ga0068862_100448989 | 3300005844 | Bacteria | 1215 |
| 258 | Ga0068862_101102679 | 3300005844 | Bacteria | 789 |
| 259 | Ga0081455_10000328 | 3300005937 | Bacteria | 62204 |
| 260 | Ga0081455_10001697 | 3300005937 | Bacteria | 26660 |
| 261 | Ga0081455_10021927 | 3300005937 | Bacteria | 5982 |
| 262 | Ga0081455_10029562 | 3300005937 | Bacteria | 4994 |
| 263 | Ga0081455_10063112 | 3300005937 | Bacteria | 3110 |
| 264 | Ga0081455_10158887 | 3300005937 | Bacteria | 1735 |
| 265 | Ga0081540_1000036 | 3300005983 | Bacteria | 140805 |
| 266 | Ga0081540_1044314 | 3300005983 | Bacteria | 2272 |
| 267 | Ga0081540_1095039 | 3300005983 | Bacteria | 1300 |
| 268 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 269 | Ga0081539_10003851 | 3300005985 | Bacteria | 17593 |
| 270 | Ga0081539_10013488 | 3300005985 | Bacteria | 6152 |
| 271 | Ga0081539_10015406 | 3300005985 | Bacteria | 5558 |
| 272 | Ga0081539_10017541 | 3300005985 | Bacteria | 5019 |
| 273 | Ga0070717_10002256 | 3300006028 | Bacteria | 13517 |
| 274 | Ga0070717_10034711 | 3300006028 | Bacteria | 4079 |
| 275 | Ga0070717_10037696 | 3300006028 | Bacteria | 3927 |
| 276 | Ga0070717_10164607 | 3300006028 | Bacteria | 1926 |
| 277 | Ga0070717_10254282 | 3300006028 | Bacteria | 1553 |
| 278 | Ga0070717_10666151 | 3300006028 | Unclassified | 945 |
| 279 | Ga0070717_10684583 | 3300006028 | Bacteria | 931 |
| 280 | Ga0070715_10341462 | 3300006163 | Bacteria | 815 |
| 281 | Ga0070716_100016810 | 3300006173 | Bacteria | 3783 |
| 282 | Ga0070716_100036195 | 3300006173 | Bacteria | 2720 |
| 283 | Ga0070716_100041479 | 3300006173 | Bacteria | 2564 |
| 284 | Ga0070716_100254021 | 3300006173 | Unclassified | 1199 |
| 285 | Ga0070716_100264003 | 3300006173 | Bacteria | 1179 |
| 286 | Ga0070716_100697351 | 3300006173 | Bacteria | 775 |
| 287 | Ga0070712_100050761 | 3300006175 | Bacteria | 2887 |
| 288 | Ga0070712_100163392 | 3300006175 | Bacteria | 1721 |
| 289 | Ga0070712_100712383 | 3300006175 | Unclassified | 856 |
| 290 | Ga0075362_10005306 | 3300006177 | Bacteria | 4707 |
| 291 | Ga0075367_10204473 | 3300006178 | Bacteria | 1234 |
| 292 | Ga0075366_10001400 | 3300006195 | Bacteria | 12079 |
| 293 | Ga0097621_100031766 | 3300006237 | Bacteria | 4191 |
| 294 | Ga0097621_100064714 | 3300006237 | Bacteria | 3008 |
| 295 | Ga0097621_100108150 | 3300006237 | Bacteria | 2347 |
| 296 | Ga0097621_100281893 | 3300006237 | Unclassified | 1463 |
| 297 | Ga0068871_100042623 | 3300006358 | Bacteria | 3644 |
| 298 | Ga0068871_100063216 | 3300006358 | Bacteria | 3027 |
| 299 | Ga0068871_100087068 | 3300006358 | Bacteria | 2596 |
| 300 | Ga0068871_100129048 | 3300006358 | Bacteria | 2142 |
| 301 | Ga0068871_100272171 | 3300006358 | Unclassified | 1480 |
| 302 | Ga0075433_10212447 | 3300006852 | Bacteria | 1719 |
| 303 | Ga0075434_100138435 | 3300006871 | Bacteria | 2454 |
| 304 | Ga0075434_100534688 | 3300006871 | Bacteria | 1192 |
| 305 | Ga0068865_100002077 | 3300006881 | Bacteria | 11832 |
| 306 | Ga0068865_100068978 | 3300006881 | Bacteria | 2501 |
| 307 | Ga0068865_100471370 | 3300006881 | Bacteria | 1042 |
| 308 | Ga0075436_100055297 | 3300006914 | Unclassified | 2740 |
| 309 | Ga0075436_100160296 | 3300006914 | Bacteria | 1585 |
| 310 | Ga0097620_100022886 | 3300006931 | Bacteria | 6266 |
| 311 | Ga0075435_100521424 | 3300007076 | Bacteria | 1028 |
| 312 | Ga0105240_10462896 | 3300009093 | Unclassified | 1417 |
| 313 | Ga0105240_11437792 | 3300009093 | Bacteria | 724 |
| 314 | Ga0111539_10552707 | 3300009094 | Bacteria | 1341 |
| 315 | Ga0105245_10075162 | 3300009098 | Bacteria | 3076 |
| 316 | Ga0105245_10098347 | 3300009098 | Bacteria | 2704 |
| 317 | Ga0105245_10302968 | 3300009098 | Bacteria | 1569 |
| 318 | Ga0105245_10365270 | 3300009098 | Unclassified | 1433 |
| 319 | Ga0105245_10396933 | 3300009098 | Unclassified | 1377 |
| 320 | Ga0105245_10536584 | 3300009098 | Bacteria | 1190 |
| 321 | Ga0105247_10064781 | 3300009101 | Bacteria | 2272 |
| 322 | Ga0114129_10003445 | 3300009147 | Bacteria | 22244 |
| 323 | Ga0114129_10248724 | 3300009147 | Unclassified | 2387 |
| 324 | Ga0114129_10609702 | 3300009147 | Bacteria | 1413 |
| 325 | Ga0105243_10018077 | 3300009148 | Bacteria | 5334 |
| 326 | Ga0105243_10712699 | 3300009148 | Unclassified | 979 |
| 327 | Ga0105242_11307757 | 3300009176 | Bacteria | 749 |
| 328 | Ga0105237_10045082 | 3300009545 | Bacteria | 4439 |
| 329 | Ga0105237_10074141 | 3300009545 | Bacteria | 3395 |
| 330 | Ga0105249_10018684 | 3300009553 | Bacteria | 6174 |
| 331 | Ga0105249_10074789 | 3300009553 | Bacteria | 3136 |
| 332 | Ga0105249_10137449 | 3300009553 | Bacteria | 2340 |
| 333 | Ga0105249_11302295 | 3300009553 | Bacteria | 798 |
| 334 | Ga0099796_10008395 | 3300010159 | Bacteria | 2751 |
| 335 | Ga0099796_10056587 | 3300010159 | Unclassified | 1377 |
| 336 | Ga0099796_10167614 | 3300010159 | Unclassified | 874 |
| 337 | Ga0105239_10038497 | 3300010375 | Bacteria | 5241 |
| 338 | Ga0105239_10069667 | 3300010375 | Bacteria | 3864 |
| 339 | Ga0105239_10169916 | 3300010375 | Bacteria | 2438 |
| 340 | Ga0105239_10213327 | 3300010375 | Bacteria | 2164 |
| 341 | Ga0105239_10245175 | 3300010375 | Unclassified | 2011 |
| 342 | Ga0105246_10475549 | 3300011119 | Bacteria | 1056 |
| 343 | Ga0105246_10748933 | 3300011119 | Unclassified | 861 |
| 344 | Ga0157371_10545069 | 3300013102 | Bacteria | 859 |
| 345 | Ga0157370_10234834 | 3300013104 | Bacteria | 1697 |
| 346 | Ga0157369_10101890 | 3300013105 | Bacteria | 3060 |
| 347 | Ga0157374_10000026 | 3300013296 | Bacteria | 238236 |
| 348 | Ga0157374_10001473 | 3300013296 | Bacteria | 19879 |
| 349 | Ga0157374_10005577 | 3300013296 | Bacteria | 10597 |
| 350 | Ga0157374_10018842 | 3300013296 | Bacteria | 6100 |
| 351 | Ga0157374_10056568 | 3300013296 | Bacteria | 3662 |
| 352 | Ga0157374_10086985 | 3300013296 | Unclassified | 2974 |
| 353 | Ga0157374_10092382 | 3300013296 | Bacteria | 2887 |
| 354 | Ga0157374_10180939 | 3300013296 | Bacteria | 2059 |
| 355 | Ga0157374_10221459 | 3300013296 | Bacteria | 1857 |
| 356 | Ga0157374_10225899 | 3300013296 | Bacteria | 1838 |
| 357 | Ga0157374_10598674 | 3300013296 | Unclassified | 1112 |
| 358 | Ga0157374_10728606 | 3300013296 | Bacteria | 1006 |
| 359 | Ga0157374_11113292 | 3300013296 | Unclassified | 810 |
| 360 | Ga0157378_10009019 | 3300013297 | Bacteria | 8684 |
| 361 | Ga0157378_10009704 | 3300013297 | Bacteria | 8385 |
| 362 | Ga0157378_10021310 | 3300013297 | Bacteria | 5697 |
| 363 | Ga0157378_10057797 | 3300013297 | Bacteria | 3458 |
| 364 | Ga0157378_10216017 | 3300013297 | Unclassified | 1821 |
| 365 | Ga0157378_10242977 | 3300013297 | Bacteria | 1720 |
| 366 | Ga0157378_10275651 | 3300013297 | Bacteria | 1619 |
| 367 | Ga0157378_10533444 | 3300013297 | Bacteria | 1177 |
| 368 | Ga0157378_10534027 | 3300013297 | Unclassified | 1176 |
| 369 | Ga0157378_10623515 | 3300013297 | Bacteria | 1092 |
| 370 | Ga0163162_10002697 | 3300013306 | Bacteria | 16839 |
| 371 | Ga0163162_10003249 | 3300013306 | Bacteria | 15541 |
| 372 | Ga0163162_10014121 | 3300013306 | Bacteria | 7805 |
| 373 | Ga0163162_10024438 | 3300013306 | Bacteria | 5964 |
| 374 | Ga0163162_10112610 | 3300013306 | Bacteria | 2820 |
| 375 | Ga0163162_10173422 | 3300013306 | Bacteria | 2281 |
| 376 | Ga0157372_10045317 | 3300013307 | Bacteria | 4878 |
| 377 | Ga0157372_10155739 | 3300013307 | Unclassified | 2639 |
| 378 | Ga0157372_10329970 | 3300013307 | Unclassified | 1776 |
| 379 | Ga0157372_10978731 | 3300013307 | Bacteria | 980 |
| 380 | Ga0157372_11770033 | 3300013307 | Bacteria | 711 |
| 381 | Ga0157375_10000287 | 3300013308 | Bacteria | 45998 |
| 382 | Ga0157375_10001868 | 3300013308 | Bacteria | 18135 |
| 383 | Ga0157375_10050268 | 3300013308 | Bacteria | 4089 |
| 384 | Ga0157375_10089439 | 3300013308 | Bacteria | 3135 |
| 385 | Ga0157375_10101429 | 3300013308 | Bacteria | 2961 |
| 386 | Ga0157375_10156755 | 3300013308 | Unclassified | 2416 |
| 387 | Ga0157375_11382136 | 3300013308 | Unclassified | 829 |
| 388 | Ga0157375_11795681 | 3300013308 | Bacteria | 727 |
| 389 | Ga0163163_10106345 | 3300014325 | Bacteria | 2832 |
| 390 | Ga0163163_10659116 | 3300014325 | Unclassified | 1110 |
| 391 | Ga0182008_10034693 | 3300014497 | Bacteria | 2529 |
| 392 | Ga0157377_10077841 | 3300014745 | Bacteria | 1932 |
| 393 | Ga0157379_10005647 | 3300014968 | Bacteria | 10748 |
| 394 | Ga0157376_10000112 | 3300014969 | Bacteria | 58430 |
| 395 | Ga0157376_10009509 | 3300014969 | Bacteria | 7064 |
| 396 | Ga0157376_10020829 | 3300014969 | Bacteria | 5081 |
| 397 | Ga0157376_10075816 | 3300014969 | Bacteria | 2871 |
| 398 | Ga0157376_10079496 | 3300014969 | Bacteria | 2811 |
| 399 | Ga0157376_10097176 | 3300014969 | Bacteria | 2565 |
| 400 | Ga0157376_10966546 | 3300014969 | Unclassified | 873 |
| 401 | Ga0163161_10017041 | 3300017792 | Bacteria | 5081 |
| 402 | Ga0163161_10381344 | 3300017792 | Unclassified | 1127 |
| 403 | Ga0163161_10551356 | 3300017792 | Bacteria | 945 |
| 404 | Ga0213873_10026666 | 3300021358 | Unclassified | 1404 |
| 405 | Ga0213876_10004179 | 3300021384 | Bacteria | 8101 |
| 406 | Ga0213876_10042150 | 3300021384 | Bacteria | 2412 |
| 407 | Ga0213871_10007052 | 3300021441 | Bacteria | 2410 |
| 408 | Ga0213871_10061942 | 3300021441 | Bacteria | 1043 |
| 409 | Ga0224712_10087708 | 3300022467 | Bacteria | 1297 |
| 410 | Ga0207666_1000509 | 3300025271 | Bacteria | 4770 |
| 411 | Ga0207666_1002371 | 3300025271 | Unclassified | 2268 |
| 412 | Ga0207673_1000205 | 3300025290 | Bacteria | 5944 |
| 413 | Ga0207673_1001361 | 3300025290 | Bacteria | 2654 |
| 414 | Ga0207673_1007376 | 3300025290 | Bacteria | 1377 |
| 415 | Ga0207697_10000010 | 3300025315 | Bacteria | 65144 |
| 416 | Ga0207697_10000131 | 3300025315 | Bacteria | 36154 |
| 417 | Ga0207697_10000495 | 3300025315 | Bacteria | 22147 |
| 418 | Ga0207697_10001701 | 3300025315 | Bacteria | 11844 |
| 419 | Ga0207697_10003343 | 3300025315 | Bacteria | 7977 |
| 420 | Ga0207697_10003602 | 3300025315 | Bacteria | 7598 |
| 421 | Ga0207697_10010508 | 3300025315 | Bacteria | 3954 |
| 422 | Ga0207697_10021523 | 3300025315 | Bacteria | 2640 |
| 423 | Ga0207653_10043816 | 3300025885 | Bacteria | 1474 |
| 424 | Ga0207682_10011464 | 3300025893 | Bacteria | 3461 |
| 425 | Ga0207682_10020163 | 3300025893 | Bacteria | 2616 |
| 426 | Ga0207682_10143698 | 3300025893 | Bacteria | 1072 |
| 427 | Ga0207692_10008534 | 3300025898 | Bacteria | 4243 |
| 428 | Ga0207692_10015694 | 3300025898 | Bacteria | 3340 |
| 429 | Ga0207692_10158731 | 3300025898 | Bacteria | 1302 |
| 430 | Ga0207692_10205959 | 3300025898 | Bacteria | 1159 |
| 431 | Ga0207692_10378593 | 3300025898 | Bacteria | 878 |
| 432 | Ga0207688_10007718 | 3300025901 | Bacteria | 5860 |
| 433 | Ga0207688_10010727 | 3300025901 | Bacteria | 4986 |
| 434 | Ga0207688_10054862 | 3300025901 | Unclassified | 2236 |
| 435 | Ga0207688_10062026 | 3300025901 | Bacteria | 2108 |
| 436 | Ga0207688_10106988 | 3300025901 | Bacteria | 1620 |
| 437 | Ga0207680_10014436 | 3300025903 | Bacteria | 4088 |
| 438 | Ga0207680_10166630 | 3300025903 | Unclassified | 1481 |
| 439 | Ga0207680_10779436 | 3300025903 | Unclassified | 685 |
| 440 | Ga0207647_10009265 | 3300025904 | Bacteria | 7000 |
| 441 | Ga0207647_10048527 | 3300025904 | Bacteria | 2636 |
| 442 | Ga0207685_10131690 | 3300025905 | Unclassified | 1111 |
| 443 | Ga0207699_10004362 | 3300025906 | Bacteria | 6764 |
| 444 | Ga0207699_10022105 | 3300025906 | Bacteria | 3442 |
| 445 | Ga0207699_10033788 | 3300025906 | Bacteria | 2894 |
| 446 | Ga0207699_10205569 | 3300025906 | Bacteria | 1337 |
| 447 | Ga0207645_10001786 | 3300025907 | Bacteria | 17391 |
| 448 | Ga0207645_10002762 | 3300025907 | Bacteria | 13659 |
| 449 | Ga0207645_10004253 | 3300025907 | Bacteria | 10632 |
| 450 | Ga0207645_10004432 | 3300025907 | Bacteria | 10394 |
| 451 | Ga0207645_10192675 | 3300025907 | Bacteria | 1340 |
| 452 | Ga0207705_10068346 | 3300025909 | Bacteria | 2572 |
| 453 | Ga0207705_10085665 | 3300025909 | Bacteria | 2302 |
| 454 | Ga0207705_10182042 | 3300025909 | Bacteria | 1586 |
| 455 | Ga0207705_10215974 | 3300025909 | Bacteria | 1455 |
| 456 | Ga0207705_10917967 | 3300025909 | Bacteria | 678 |
| 457 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 458 | Ga0207684_10008671 | 3300025910 | Bacteria | 9025 |
| 459 | Ga0207684_10018780 | 3300025910 | Bacteria | 5916 |
| 460 | Ga0207684_10047663 | 3300025910 | Bacteria | 3634 |
| 461 | Ga0207684_10049861 | 3300025910 | Bacteria | 3551 |
| 462 | Ga0207684_10086390 | 3300025910 | Bacteria | 2672 |
| 463 | Ga0207684_10160762 | 3300025910 | Bacteria | 1934 |
| 464 | Ga0207684_10297383 | 3300025910 | Bacteria | 1392 |
| 465 | Ga0207684_10343629 | 3300025910 | Bacteria | 1285 |
| 466 | Ga0207684_10371059 | 3300025910 | Bacteria | 1231 |
| 467 | Ga0207684_10394442 | 3300025910 | Bacteria | 1190 |
| 468 | Ga0207684_10468236 | 3300025910 | Unclassified | 1081 |
| 469 | Ga0207684_10643493 | 3300025910 | Bacteria | 904 |
| 470 | Ga0207671_10026904 | 3300025914 | Bacteria | 4303 |
| 471 | Ga0207671_10183802 | 3300025914 | Unclassified | 1628 |
| 472 | Ga0207693_10000889 | 3300025915 | Bacteria | 26818 |
| 473 | Ga0207693_10049459 | 3300025915 | Bacteria | 3301 |
| 474 | Ga0207693_10187584 | 3300025915 | Unclassified | 1627 |
| 475 | Ga0207693_10541698 | 3300025915 | Unclassified | 908 |
| 476 | Ga0207663_10002290 | 3300025916 | Bacteria | 9171 |
| 477 | Ga0207663_10008643 | 3300025916 | Bacteria | 5341 |
| 478 | Ga0207663_10023185 | 3300025916 | Bacteria | 3558 |
| 479 | Ga0207663_10145505 | 3300025916 | Bacteria | 1656 |
| 480 | Ga0207662_10000699 | 3300025918 | Bacteria | 15308 |
| 481 | Ga0207662_10024747 | 3300025918 | Bacteria | 3455 |
| 482 | Ga0207657_10179662 | 3300025919 | Bacteria | 1711 |
| 483 | Ga0207657_10200978 | 3300025919 | Bacteria | 1603 |
| 484 | Ga0207657_10295962 | 3300025919 | Bacteria | 1283 |
| 485 | Ga0207657_10323849 | 3300025919 | Unclassified | 1218 |
| 486 | Ga0207649_10116647 | 3300025920 | Bacteria | 1793 |
| 487 | Ga0207649_10319701 | 3300025920 | Bacteria | 1140 |
| 488 | Ga0207649_10703969 | 3300025920 | Unclassified | 784 |
| 489 | Ga0207652_10319734 | 3300025921 | Bacteria | 1401 |
| 490 | Ga0207646_10000191 | 3300025922 | Bacteria | 83638 |
| 491 | Ga0207646_10001393 | 3300025922 | Bacteria | 29980 |
| 492 | Ga0207646_10010143 | 3300025922 | Bacteria | 9230 |
| 493 | Ga0207646_10014393 | 3300025922 | Bacteria | 7515 |
| 494 | Ga0207646_10016566 | 3300025922 | Bacteria | 6915 |
| 495 | Ga0207646_10020049 | 3300025922 | Bacteria | 6201 |
| 496 | Ga0207646_10104395 | 3300025922 | Bacteria | 2541 |
| 497 | Ga0207646_10340306 | 3300025922 | Unclassified | 1356 |
| 498 | Ga0207646_10355686 | 3300025922 | Unclassified | 1323 |
| 499 | Ga0207646_10375822 | 3300025922 | Bacteria | 1284 |
| 500 | Ga0207646_10464608 | 3300025922 | Unclassified | 1141 |
| 501 | Ga0207681_10011518 | 3300025923 | Bacteria | 5432 |
| 502 | Ga0207681_10014015 | 3300025923 | Unclassified | 4969 |
| 503 | Ga0207681_10131300 | 3300025923 | Bacteria | 1852 |
| 504 | Ga0207681_10354239 | 3300025923 | Bacteria | 1176 |
| 505 | Ga0207681_10365037 | 3300025923 | Unclassified | 1159 |
| 506 | Ga0207681_10481214 | 3300025923 | Bacteria | 1014 |
| 507 | Ga0207650_10015937 | 3300025925 | Bacteria | 5244 |
| 508 | Ga0207650_10614732 | 3300025925 | Unclassified | 914 |
| 509 | Ga0207659_10005098 | 3300025926 | Bacteria | 7963 |
| 510 | Ga0207659_10016965 | 3300025926 | Bacteria | 4751 |
| 511 | Ga0207659_10071464 | 3300025926 | Unclassified | 2534 |
| 512 | Ga0207659_10254896 | 3300025926 | Bacteria | 1425 |
| 513 | Ga0207659_10955714 | 3300025926 | Unclassified | 737 |
| 514 | Ga0207687_10067835 | 3300025927 | Bacteria | 2539 |
| 515 | Ga0207687_10442189 | 3300025927 | Unclassified | 1077 |
| 516 | Ga0207700_10003893 | 3300025928 | Bacteria | 8714 |
| 517 | Ga0207700_10015667 | 3300025928 | Bacteria | 5010 |
| 518 | Ga0207700_10039430 | 3300025928 | Bacteria | 3439 |
| 519 | Ga0207700_10048816 | 3300025928 | Bacteria | 3145 |
| 520 | Ga0207700_10114187 | 3300025928 | Bacteria | 2179 |
| 521 | Ga0207700_10243586 | 3300025928 | Unclassified | 1533 |
| 522 | Ga0207664_10051382 | 3300025929 | Unclassified | 3254 |
| 523 | Ga0207664_10123283 | 3300025929 | Bacteria | 2172 |
| 524 | Ga0207644_10014741 | 3300025931 | Bacteria | 5236 |
| 525 | Ga0207644_10025745 | 3300025931 | Bacteria | 4047 |
| 526 | Ga0207644_10032598 | 3300025931 | Bacteria | 3636 |
| 527 | Ga0207644_10044420 | 3300025931 | Bacteria | 3157 |
| 528 | Ga0207644_10054675 | 3300025931 | Bacteria | 2876 |
| 529 | Ga0207644_10067172 | 3300025931 | Bacteria | 2612 |
| 530 | Ga0207644_10172380 | 3300025931 | Bacteria | 1690 |
| 531 | Ga0207690_10002640 | 3300025932 | Bacteria | 10795 |
| 532 | Ga0207690_10142724 | 3300025932 | Unclassified | 1767 |
| 533 | Ga0207706_10022549 | 3300025933 | Bacteria | 5650 |
| 534 | Ga0207706_10037590 | 3300025933 | Bacteria | 4298 |
| 535 | Ga0207706_10074996 | 3300025933 | Bacteria | 2974 |
| 536 | Ga0207706_10134531 | 3300025933 | Unclassified | 2174 |
| 537 | Ga0207706_10332854 | 3300025933 | Bacteria | 1321 |
| 538 | Ga0207686_10211340 | 3300025934 | Unclassified | 1395 |
| 539 | Ga0207709_10197983 | 3300025935 | Bacteria | 1432 |
| 540 | Ga0207709_10263307 | 3300025935 | Unclassified | 1265 |
| 541 | Ga0207670_10016878 | 3300025936 | Bacteria | 4400 |
| 542 | Ga0207670_10035039 | 3300025936 | Bacteria | 3251 |
| 543 | Ga0207669_10069350 | 3300025937 | Bacteria | 2206 |
| 544 | Ga0207669_10102120 | 3300025937 | Bacteria | 1899 |
| 545 | Ga0207704_10047899 | 3300025938 | Bacteria | 2559 |
| 546 | Ga0207704_10278282 | 3300025938 | Unclassified | 1271 |
| 547 | Ga0207704_10640352 | 3300025938 | Unclassified | 874 |
| 548 | Ga0207665_10054719 | 3300025939 | Bacteria | 2691 |
| 549 | Ga0207665_10076274 | 3300025939 | Bacteria | 2298 |
| 550 | Ga0207665_10218229 | 3300025939 | Bacteria | 1396 |
| 551 | Ga0207665_10275263 | 3300025939 | Unclassified | 1251 |
| 552 | Ga0207665_10277367 | 3300025939 | Unclassified | 1246 |
| 553 | Ga0207665_10360643 | 3300025939 | Unclassified | 1099 |
| 554 | Ga0207691_10000142 | 3300025940 | Bacteria | 66224 |
| 555 | Ga0207691_10000247 | 3300025940 | Bacteria | 53502 |
| 556 | Ga0207691_10097501 | 3300025940 | Bacteria | 2628 |
| 557 | Ga0207691_10102373 | 3300025940 | Unclassified | 2554 |
| 558 | Ga0207691_10212905 | 3300025940 | Bacteria | 1678 |
| 559 | Ga0207691_10221759 | 3300025940 | Bacteria | 1639 |
| 560 | Ga0207679_10031450 | 3300025945 | Bacteria | 3714 |
| 561 | Ga0207679_10228003 | 3300025945 | Unclassified | 1571 |
| 562 | Ga0207679_10744123 | 3300025945 | Bacteria | 891 |
| 563 | Ga0207667_10106198 | 3300025949 | Bacteria | 2897 |
| 564 | Ga0207667_11001208 | 3300025949 | Bacteria | 823 |
| 565 | Ga0207651_10012073 | 3300025960 | Bacteria | 4866 |
| 566 | Ga0207651_10067156 | 3300025960 | Unclassified | 2522 |
| 567 | Ga0207651_10566758 | 3300025960 | Bacteria | 989 |
| 568 | Ga0207651_11339168 | 3300025960 | Bacteria | 644 |
| 569 | Ga0207712_10114117 | 3300025961 | Archaea | 2032 |
| 570 | Ga0207712_10889791 | 3300025961 | Bacteria | 786 |
| 571 | Ga0207668_10006260 | 3300025972 | Bacteria | 7031 |
| 572 | Ga0207668_10017541 | 3300025972 | Bacteria | 4486 |
| 573 | Ga0207668_10027563 | 3300025972 | Bacteria | 3701 |
| 574 | Ga0207668_10130077 | 3300025972 | Bacteria | 1921 |
| 575 | Ga0207668_10145826 | 3300025972 | Bacteria | 1826 |
| 576 | Ga0207668_10425105 | 3300025972 | Unclassified | 1128 |
| 577 | Ga0207668_10558888 | 3300025972 | Bacteria | 992 |
| 578 | Ga0207640_10075256 | 3300025981 | Bacteria | 2288 |
| 579 | Ga0207658_10010987 | 3300025986 | Bacteria | 6166 |
| 580 | Ga0207658_10026613 | 3300025986 | Bacteria | 4056 |
| 581 | Ga0207658_10047043 | 3300025986 | Bacteria | 3155 |
| 582 | Ga0207658_10187449 | 3300025986 | Bacteria | 1717 |
| 583 | Ga0207658_10267108 | 3300025986 | Unclassified | 1460 |
| 584 | Ga0207658_10290309 | 3300025986 | Unclassified | 1405 |
| 585 | Ga0207677_10039629 | 3300026023 | Bacteria | 3100 |
| 586 | Ga0207677_10047355 | 3300026023 | Bacteria | 2886 |
| 587 | Ga0207677_10073923 | 3300026023 | Bacteria | 2416 |
| 588 | Ga0207677_10075096 | 3300026023 | Unclassified | 2401 |
| 589 | Ga0207677_10115001 | 3300026023 | Bacteria | 2012 |
| 590 | Ga0207677_10122255 | 3300026023 | Bacteria | 1961 |
| 591 | Ga0207703_10030916 | 3300026035 | Bacteria | 4233 |
| 592 | Ga0207703_10072520 | 3300026035 | Bacteria | 2847 |
| 593 | Ga0207703_10601425 | 3300026035 | Bacteria | 1040 |
| 594 | Ga0207639_10258886 | 3300026041 | Bacteria | 1521 |
| 595 | Ga0207639_10390691 | 3300026041 | Bacteria | 1251 |
| 596 | Ga0207678_10040073 | 3300026067 | Bacteria | 4063 |
| 597 | Ga0207708_10008844 | 3300026075 | Bacteria | 7454 |
| 598 | Ga0207641_10218575 | 3300026088 | Bacteria | 1766 |
| 599 | Ga0207641_10357683 | 3300026088 | Bacteria | 1393 |
| 600 | Ga0207641_10702018 | 3300026088 | Bacteria | 996 |
| 601 | Ga0207648_10067913 | 3300026089 | Bacteria | 3107 |
| 602 | Ga0207648_10213801 | 3300026089 | Bacteria | 1712 |
| 603 | Ga0207675_100064977 | 3300026118 | Bacteria | 3410 |
| 604 | Ga0207675_100132193 | 3300026118 | Bacteria | 2366 |
| 605 | Ga0207675_100382273 | 3300026118 | Bacteria | 1385 |
| 606 | Ga0207683_10009866 | 3300026121 | Bacteria | 8145 |
| 607 | Ga0207683_10051070 | 3300026121 | Bacteria | 3623 |
| 608 | Ga0207683_10063965 | 3300026121 | Bacteria | 3241 |
| 609 | Ga0207683_10071554 | 3300026121 | Bacteria | 3066 |
| 610 | Ga0207683_10937305 | 3300026121 | Unclassified | 804 |
| 611 | Ga0207698_10720233 | 3300026142 | Bacteria | 994 |
| 612 | Ga0210002_1024755 | 3300027617 | Unclassified | 980 |
| 613 | Ga0209998_10035192 | 3300027717 | Unclassified | 1122 |
| 614 | Ga0209998_10040572 | 3300027717 | Unclassified | 1056 |
| 615 | Ga0209974_10002731 | 3300027876 | Bacteria | 6397 |
| 616 | Ga0268266_10004179 | 3300028379 | Bacteria | 13926 |
| 617 | Ga0268266_10022713 | 3300028379 | Bacteria | 5341 |
| 618 | Ga0268266_10025356 | 3300028379 | Bacteria | 5043 |
| 619 | Ga0268266_10081503 | 3300028379 | Bacteria | 2822 |
| 620 | Ga0268266_10132211 | 3300028379 | Bacteria | 2233 |
| 621 | Ga0268266_10147129 | 3300028379 | Unclassified | 2119 |
| 622 | Ga0268266_10227276 | 3300028379 | Bacteria | 1717 |
| 623 | Ga0268266_10296583 | 3300028379 | Bacteria | 1507 |
| 624 | Ga0268266_10770483 | 3300028379 | Unclassified | 929 |
| 625 | Ga0268265_10118795 | 3300028380 | Bacteria | 2174 |
| 626 | Ga0268265_10596345 | 3300028380 | Bacteria | 1055 |
| 627 | Ga0268264_10052052 | 3300028381 | Bacteria | 3414 |
| 628 | Ga0268264_10086546 | 3300028381 | Bacteria | 2693 |
| 629 | Ga0268264_10243638 | 3300028381 | Bacteria | 1666 |
| 630 | Ga0307513_10089511 | 3300031456 | Bacteria | 3142 |
| 631 | Ga0373940_0045843 | 3300035088 | Unclassified | 1215 |
| 632 | Ga0373944_0021902 | 3300035089 | Bacteria | 1854 |
| 633 | Ga0373951_0088345 | 3300035091 | Unclassified | 811 |
| 634 | Ga0373936_0168225 | 3300035113 | Unclassified | 958 |
| 635 | Ga0373941_0103863 | 3300035115 | Unclassified | 993 |
| 636 | Ga0373945_0035084 | 3300035116 | Bacteria | 1791 |
| 637 | Ga0373945_0218129 | 3300035116 | Bacteria | 797 |
| 638 | Ga0373943_0032504 | 3300035170 | Bacteria | 2481 |
| 639 | Ga0373943_0034497 | 3300035170 | Bacteria | 2414 |
| 640 | Ga0373943_0061880 | 3300035170 | Bacteria | 1872 |
| 641 | Ga0373943_0092972 | 3300035170 | Bacteria | 1565 |
| 642 | Ga0373946_0091629 | 3300035171 | Unclassified | 1348 |
| 643 | Ga0373946_0280390 | 3300035171 | Bacteria | 820 |
| 644 | Ga0373955_0009835 | 3300035172 | Bacteria | 4498 |
| 645 | Ga0316574_0149687 | 3300035398 | Bacteria | 1504 |
| 646 | Ga0373924_0219625 | 3300035410 | Unclassified | 840 |
| 647 | Ga0373931_0015223 | 3300035691 | Bacteria | 3771 |
| 648 | Ga0373931_0044383 | 3300035691 | Bacteria | 2344 |
| 649 | Ga0373931_0051632 | 3300035691 | Bacteria | 2191 |
| 650 | Ga0373931_0061865 | 3300035691 | Bacteria | 2020 |
| 651 | Ga0373931_0516067 | 3300035691 | Unclassified | 773 |
| 652 | Ga0373935_0018504 | 3300035692 | Bacteria | 4238 |
| 653 | Ga0373935_0034768 | 3300035692 | Bacteria | 3143 |
| 654 | Ga0373935_0049700 | 3300035692 | Bacteria | 2659 |
| 655 | Ga0373935_0051886 | 3300035692 | Bacteria | 2605 |
| 656 | Ga0373935_0727696 | 3300035692 | Bacteria | 730 |
| 657 | Ga0373927_0010910 | 3300035695 | Bacteria | 6049 |
| 658 | Ga0373927_0031272 | 3300035695 | Bacteria | 3470 |
| 659 | Ga0373927_0090974 | 3300035695 | Bacteria | 1982 |
| 660 | Ga0373927_0453312 | 3300035695 | Bacteria | 847 |
| 661 | Ga0373927_0471573 | 3300035695 | Bacteria | 829 |
| 662 | Ga0373933_0625568 | 3300035724 | Bacteria | 707 |
| 663 | Ga0373947_0007924 | 3300035725 | Bacteria | 6126 |
| 664 | Ga0373947_0020963 | 3300035725 | Bacteria | 3781 |
| 665 | Ga0373947_0121377 | 3300035725 | Bacteria | 1660 |
| 666 | Ga0373947_0133507 | 3300035725 | Bacteria | 1586 |
| 667 | Ga0373947_0236510 | 3300035725 | Bacteria | 1204 |
| 668 | Ga0373937_0007935 | 3300036401 | Bacteria | 9202 |
| 669 | Ga0373937_0077805 | 3300036401 | Bacteria | 3065 |
| 670 | Ga0373937_0142442 | 3300036401 | Bacteria | 2243 |
| 671 | Ga0373937_0343076 | 3300036401 | Bacteria | 1414 |
| 672 | Ga0373925_0078544 | 3300037068 | Bacteria | 2506 |
| 673 | Ga0373925_0278365 | 3300037068 | Unclassified | 1347 |
| 674 | Ga0373925_0484093 | 3300037068 | Unclassified | 1015 |
| 675 | Ga0373925_0622931 | 3300037068 | Unclassified | 889 |
| 676 | Ga0373925_0643210 | 3300037068 | Bacteria | 874 |
| 677 | Ga0373925_0672882 | 3300037068 | Bacteria | 853 |
| 678 | Ga0395899_0040689 | 3300037312 | Bacteria | 3476 |
| 679 | Ga0395900_0008031 | 3300037418 | Bacteria | 10861 |
| 680 | Ga0395900_0118855 | 3300037418 | Bacteria | 2713 |
| 681 | Ga0395900_0616758 | 3300037418 | Unclassified | 1024 |
| 682 | Ga0395898_0036909 | 3300037466 | Bacteria | 4850 |
| 683 | Ga0395898_1077831 | 3300037466 | Unclassified | 737 |
| 684 | Ga0395905_0022619 | 3300037471 | Bacteria | 5943 |
| 685 | Ga0395905_0443355 | 3300037471 | Bacteria | 1196 |
| 686 | Ga0395901_0002964 | 3300038443 | Bacteria | 17124 |
| 687 | Ga0395901_0104360 | 3300038443 | Bacteria | 2975 |
| 688 | Ga0436365_0592482 | 3300039437 | Bacteria | 10769 |
| 689 | Ga0436365_0750598 | 3300039437 | Unclassified | 2405 |
| 690 | Ga0436365_1383407 | 3300039437 | Bacteria | 77328 |
| 691 | Ga0436360_0624627 | 3300039438 | Bacteria | 4317 |
| 692 | Ga0436360_0890129 | 3300039438 | Bacteria | 5307 |
| 693 | Ga0436361_0117688 | 3300039447 | Bacteria | 2764 |
| 694 | Ga0436361_0182528 | 3300039447 | Bacteria | 2172 |
| 695 | Ga0436361_0715339 | 3300039447 | Bacteria | 2090 |
| 696 | Ga0436363_1019557 | 3300039450 | Unclassified | 808 |
| 697 | Ga0451807_2029754 | 3300041486 | Bacteria | 1018 |
| 698 | Ga0439451_005465 | 3300042009 | Bacteria | 2591 |
| 699 | Ga0439455_0012285 | 3300042012 | Bacteria | 1920 |
| 700 | Ga0439455_0108650 | 3300042012 | Unclassified | 770 |
| 701 | Ga0439464_0015733 | 3300042439 | Unclassified | 2043 |
| 702 | Ga0451577_0009264 | 3300042876 | Bacteria | 9490 |
| 703 | Ga0451576_0046345 | 3300045051 | Bacteria | 4578 |
| 704 | Ga0466967_0373597 | 3300045976 | Bacteria | 1383 |
| 705 | Ga0495592_0004183 | 3300046454 | Bacteria | 10538 |
| 706 | Ga0495592_0079240 | 3300046454 | Bacteria | 2378 |
| 707 | Ga0495629_0116759 | 3300046459 | Unclassified | 1860 |
| 708 | Ga0495629_0291497 | 3300046459 | Unclassified | 1118 |
| 709 | Ga0495651_0140727 | 3300046462 | Bacteria | 1750 |
| 710 | Ga0495651_0265033 | 3300046462 | Bacteria | 1167 |
| 711 | Ga0495651_0411481 | 3300046462 | Unclassified | 881 |
| 712 | Ga0495580_0387428 | 3300046472 | Bacteria | 944 |
| 713 | Ga0495662_0148558 | 3300046476 | Unclassified | 1154 |
| 714 | Ga0495664_0229922 | 3300046477 | Bacteria | 1122 |
| 715 | Ga0495584_0173045 | 3300046491 | Unclassified | 1097 |
| 716 | Ga0495583_0193524 | 3300046506 | Bacteria | 829 |
| 717 | Ga0495618_0278347 | 3300046514 | Bacteria | 1044 |
| 718 | Ga0495628_0004287 | 3300046516 | Bacteria | 12686 |
| 719 | Ga0495630_0043877 | 3300046517 | Bacteria | 3341 |
| 720 | Ga0495630_0186121 | 3300046517 | Unclassified | 1584 |
| 721 | Ga0495631_0051981 | 3300046518 | Bacteria | 1790 |
| 722 | Ga0495643_0000165 | 3300046522 | Bacteria | 105206 |
| 723 | Ga0495644_0022155 | 3300046523 | Unclassified | 2422 |
| 724 | Ga0495663_0014937 | 3300046525 | Unclassified | 2183 |
| 725 | Ga0495666_0164495 | 3300046526 | Bacteria | 1028 |
| 726 | Ga0495642_0035028 | 3300046528 | Bacteria | 2024 |
| 727 | Ga0495652_0053015 | 3300046529 | Bacteria | 3458 |
| 728 | Ga0495652_0270184 | 3300046529 | Bacteria | 1250 |
| 729 | Ga0495640_0198898 | 3300046533 | Bacteria | 1271 |
| 730 | Ga0495586_0019561 | 3300046535 | Bacteria | 3606 |
| 731 | Ga0495587_0004117 | 3300046536 | Bacteria | 9614 |
| 732 | Ga0495598_0010463 | 3300046537 | Bacteria | 2223 |
| 733 | Ga0495609_0101466 | 3300046538 | Unclassified | 1247 |
| 734 | Ga0495645_0001076 | 3300046543 | Bacteria | 18525 |
| 735 | Ga0495645_0055058 | 3300046543 | Bacteria | 2889 |
| 736 | Ga0495667_0272758 | 3300046559 | Bacteria | 1074 |
| 737 | Ga0495588_0156994 | 3300046674 | Bacteria | 1203 |
| 738 | Ga0495657_0158333 | 3300046675 | Bacteria | 1402 |
| 739 | Ga0495599_0000317 | 3300046678 | Bacteria | 28802 |
| 740 | Ga0495623_0000811 | 3300046679 | Bacteria | 21045 |
| 741 | Ga0495646_0002940 | 3300046680 | Bacteria | 10561 |
| 742 | Ga0495669_0010128 | 3300046684 | Bacteria | 3980 |
| 743 | Ga0495613_0155202 | 3300046689 | Bacteria | 1631 |
| 744 | Ga0495613_0576303 | 3300046689 | Bacteria | 751 |
| 745 | Ga0495589_0102052 | 3300046794 | Bacteria | 1388 |
| 746 | Ga0495581_0108942 | 3300047315 | Unclassified | 1610 |
| 747 | Ga0495604_0023193 | 3300047317 | Bacteria | 4953 |
| 748 | Ga0495674_0556471 | 3300047319 | Unclassified | 912 |
| 749 | Ga0495674_0810677 | 3300047319 | Bacteria | 727 |
| 750 | Ga0495680_0590104 | 3300047322 | Bacteria | 744 |
| 751 | Ga0495675_0030344 | 3300047444 | Bacteria | 3449 |
| 752 | Ga0495675_0242653 | 3300047444 | Unclassified | 1084 |
| 753 | Ga0495681_0041225 | 3300047470 | Unclassified | 2242 |
| 754 | Ga0495684_0009324 | 3300047471 | Bacteria | 7577 |
| 755 | Ga0495684_0017471 | 3300047471 | Bacteria | 5523 |
| 756 | Ga0495602_0027778 | 3300048088 | Bacteria | 5429 |
| 757 | Ga0496100_0007185 | 3300048903 | Bacteria | 6120 |
| 758 | Ga0496100_0122710 | 3300048903 | Bacteria | 1820 |
| 759 | Ga0496101_0004352 | 3300048904 | Bacteria | 8892 |
| 760 | Ga0496101_0475029 | 3300048904 | Bacteria | 987 |
| 761 | Ga0496102_0103303 | 3300048905 | Bacteria | 2650 |
| 762 | Ga0496102_0187224 | 3300048905 | Bacteria | 1951 |
| 763 | Ga0496102_0202645 | 3300048905 | Bacteria | 1870 |
| 764 | Ga0496102_0579595 | 3300048905 | Bacteria | 1045 |
| 765 | Ga0496103_0002509 | 3300048906 | Bacteria | 11505 |
| 766 | Ga0496104_0017573 | 3300048907 | Bacteria | 6516 |
| 767 | Ga0496104_0121937 | 3300048907 | Bacteria | 2503 |
| 768 | Ga0496104_0269348 | 3300048907 | Bacteria | 1616 |
| 769 | Ga0496104_0929627 | 3300048907 | Unclassified | 774 |
| 770 | Ga0496105_0535958 | 3300048908 | Bacteria | 915 |
| 771 | Ga0496106_0003085 | 3300048909 | Bacteria | 12426 |
| 772 | Ga0496106_0064483 | 3300048909 | Bacteria | 2787 |
| 773 | Ga0496106_0211532 | 3300048909 | Unclassified | 1545 |
| 774 | Ga0496107_0001730 | 3300048910 | Bacteria | 13711 |
| 775 | Ga0496107_0026301 | 3300048910 | Bacteria | 4124 |
| 776 | Ga0496107_0034242 | 3300048910 | Bacteria | 3638 |
| 777 | Ga0496107_0169099 | 3300048910 | Bacteria | 1622 |
| 778 | Ga0496107_0541237 | 3300048910 | Unclassified | 863 |
| 779 | Ga0496108_0009866 | 3300048911 | Bacteria | 7739 |
| 780 | Ga0496108_0086631 | 3300048911 | Bacteria | 2659 |
| 781 | Ga0496108_0113977 | 3300048911 | Bacteria | 2314 |
| 782 | Ga0496108_0151522 | 3300048911 | Bacteria | 2001 |
| 783 | Ga0496108_0219188 | 3300048911 | Bacteria | 1653 |
| 784 | Ga0496109_0007156 | 3300048912 | Bacteria | 9429 |
| 785 | Ga0496109_0007242 | 3300048912 | Bacteria | 9381 |
| 786 | Ga0496109_0195103 | 3300048912 | Unclassified | 1903 |
| 787 | Ga0496109_0362236 | 3300048912 | Unclassified | 1370 |
| 788 | Ga0496109_0695354 | 3300048912 | Unclassified | 954 |
| 789 | Ga0496110_0029638 | 3300048913 | Bacteria | 4712 |
| 790 | Ga0496110_0228364 | 3300048913 | Bacteria | 1693 |
| 791 | Ga0496110_0479248 | 3300048913 | Bacteria | 1133 |
| 792 | Ga0496111_0092502 | 3300048914 | Bacteria | 2217 |
| 793 | Ga0496112_0022098 | 3300048915 | Bacteria | 6059 |
| 794 | Ga0496112_0060138 | 3300048915 | Bacteria | 3743 |
| 795 | Ga0496112_0080495 | 3300048915 | Bacteria | 3221 |
| 796 | Ga0496112_0135302 | 3300048915 | Bacteria | 2435 |
| 797 | Ga0496112_0187611 | 3300048915 | Bacteria | 2031 |
| 798 | Ga0496112_0482204 | 3300048915 | Unclassified | 1176 |
| 799 | Ga0496112_0541761 | 3300048915 | Bacteria | 1098 |
| 800 | Ga0496112_0614248 | 3300048915 | Unclassified | 1018 |
| 801 | Ga0496113_0010988 | 3300048916 | Bacteria | 6016 |
| 802 | Ga0496113_0192486 | 3300048916 | Bacteria | 1619 |
| 803 | Ga0496113_0437804 | 3300048916 | Unclassified | 1050 |
| 804 | Ga0496114_0016126 | 3300048917 | Bacteria | 6013 |
| 805 | Ga0496114_0018633 | 3300048917 | Bacteria | 5616 |
| 806 | Ga0496115_0002575 | 3300048918 | Bacteria | 13018 |
| 807 | Ga0496115_0004314 | 3300048918 | Bacteria | 10290 |
| 808 | Ga0496115_0009305 | 3300048918 | Bacteria | 7301 |
| 809 | Ga0496115_0081369 | 3300048918 | Bacteria | 2638 |
| 810 | Ga0496115_0239799 | 3300048918 | Bacteria | 1494 |
| 811 | Ga0501080_0229056 | 3300049742 | Bacteria | 1699 |
| 812 | nmdc:mga05p37_104793_c1 | 3300050507 | Bacteria | 3479 |
| 813 | nmdc:mga05p37_1415026_c1 | 3300050507 | Unclassified | 699 |
| 814 | nmdc:mga05p37_3284_c1 | 3300050507 | Bacteria | 18853 |
| 815 | nmdc:mga05p37_35285_c1 | 3300050507 | Bacteria | 1801 |
| 816 | nmdc:mga05p37_517419_c1 | 3300050507 | Bacteria | 1366 |
| 817 | nmdc:mga05p37_763753_c1 | 3300050507 | Bacteria | 1063 |
| 818 | nmdc:mga08y16_410200_c1 | 3300050511 | Bacteria | 1385 |
| 819 | nmdc:mga08y16_542313_c1 | 3300050511 | Bacteria | 1178 |
| 820 | nmdc:mga0n895_44950_c1 | 3300050512 | Bacteria | 4307 |
| 821 | nmdc:mga0n895_451569_c1 | 3300050512 | Bacteria | 1298 |
| 822 | nmdc:mga0rr50_1068283_c1 | 3300050513 | Bacteria | 687 |
| 823 | nmdc:mga0rr50_371260_c1 | 3300050513 | Unclassified | 1205 |
| 824 | nmdc:mga0rr50_405962_c1 | 3300050513 | Bacteria | 1151 |
| 825 | nmdc:mga0rr50_475436_c1 | 3300050513 | Bacteria | 1061 |
| 826 | nmdc:mga08x19_141665_c1 | 3300050514 | Bacteria | 1624 |
| 827 | nmdc:mga08x19_41356_c1 | 3300050514 | Bacteria | 2935 |
| 828 | nmdc:mga0a205_311920_c1 | 3300050515 | Bacteria | 1445 |
| 829 | nmdc:mga0a205_348373_c1 | 3300050515 | Bacteria | 1349 |
| 830 | nmdc:mga0a205_476077_c1 | 3300050515 | Unclassified | 1107 |
| 831 | nmdc:mga0a205_655097_c1 | 3300050515 | Bacteria | 901 |
| 832 | Ga0495601_0001921 | 3300053077 | Bacteria | 11624 |
| 833 | Ga0495612_0119550 | 3300053078 | Bacteria | 1132 |
| 834 | Ga0500610_0071253 | 3300053079 | Bacteria | 1813 |
| 835 | Ga0495655_0040681 | 3300053083 | Unclassified | 1185 |
| 836 | Ga0500628_049086 | 3300053129 | Bacteria | 995 |
| 837 | Ga0587077_003530 | 3300059493 | Bacteria | 1975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003203 | JGI25406J46586_10000001 | JGI25406J46586_10000001183 | 196 |
| 2 | 3300003203 | JGI25406J46586_10000007 | JGI25406J46586_1000000791 | 196 |
| 3 | 3300005985 | Ga0081539_10000014 | Ga0081539_10000014289 | 196 |
| 4 | 3300050507 | nmdc:mga05p37_1415026_c1 | nmdc:mga05p37_1415026_c1_15_617 | 200 |
| 5 | 3300003322 | rootL2_10163792 | rootL2_101637923 | 201 |
| 6 | 3300005327 | Ga0070658_10025644 | Ga0070658_100256443 | 201 |
| 7 | 3300005327 | Ga0070658_10075379 | Ga0070658_100753794 | 201 |
| 8 | 3300005327 | Ga0070658_10084079 | Ga0070658_100840792 | 201 |
| 9 | 3300005327 | Ga0070658_10094139 | Ga0070658_100941392 | 201 |
| 10 | 3300005344 | Ga0070661_101206117 | Ga0070661_1012061171 | 201 |
| 11 | 3300005366 | Ga0070659_100343778 | Ga0070659_1003437782 | 201 |
| 12 | 3300005367 | Ga0070667_101070479 | Ga0070667_1010704791 | 201 |
| 13 | 3300005436 | Ga0070713_100005485 | Ga0070713_1000054858 | 201 |
| 14 | 3300005539 | Ga0068853_100791601 | Ga0068853_1007916012 | 201 |
| 15 | 3300005563 | Ga0068855_100130645 | Ga0068855_1001306455 | 201 |
| 16 | 3300005563 | Ga0068855_100372390 | Ga0068855_1003723902 | 201 |
| 17 | 3300005616 | Ga0068852_100477245 | Ga0068852_1004772452 | 201 |
| 18 | 3300005618 | Ga0068864_100991929 | Ga0068864_1009919292 | 201 |
| 19 | 3300005842 | Ga0068858_100043497 | Ga0068858_1000434974 | 201 |
| 20 | 3300005842 | Ga0068858_100230990 | Ga0068858_1002309902 | 201 |
| 21 | 3300005843 | Ga0068860_100465972 | Ga0068860_1004659722 | 201 |
| 22 | 3300005843 | Ga0068860_101170895 | Ga0068860_1011708951 | 201 |
| 23 | 3300005844 | Ga0068862_101102679 | Ga0068862_1011026791 | 201 |
| 24 | 3300006028 | Ga0070717_10164607 | Ga0070717_101646072 | 201 |
| 25 | 3300006177 | Ga0075362_10005306 | Ga0075362_100053067 | 201 |
| 26 | 3300006178 | Ga0075367_10204473 | Ga0075367_102044731 | 201 |
| 27 | 3300006195 | Ga0075366_10001400 | Ga0075366_100014004 | 201 |
| 28 | 3300009093 | Ga0105240_11437792 | Ga0105240_114377921 | 201 |
| 29 | 3300009098 | Ga0105245_10302968 | Ga0105245_103029682 | 201 |
| 30 | 3300009545 | Ga0105237_10045082 | Ga0105237_100450826 | 201 |
| 31 | 3300009553 | Ga0105249_11302295 | Ga0105249_113022951 | 201 |
| 32 | 3300010375 | Ga0105239_10069667 | Ga0105239_100696672 | 201 |
| 33 | 3300010375 | Ga0105239_10213327 | Ga0105239_102133272 | 201 |
| 34 | 3300013296 | Ga0157374_10000026 | Ga0157374_10000026138 | 201 |
| 35 | 3300013296 | Ga0157374_10225899 | Ga0157374_102258993 | 201 |
| 36 | 3300013306 | Ga0163162_10173422 | Ga0163162_101734224 | 201 |
| 37 | 3300014969 | Ga0157376_10000112 | Ga0157376_1000011226 | 201 |
| 38 | 3300021358 | Ga0213873_10026666 | Ga0213873_100266663 | 201 |
| 39 | 3300021384 | Ga0213876_10004179 | Ga0213876_100041795 | 201 |
| 40 | 3300021384 | Ga0213876_10042150 | Ga0213876_100421503 | 201 |
| 41 | 3300021441 | Ga0213871_10007052 | Ga0213871_100070524 | 201 |
| 42 | 3300021441 | Ga0213871_10061942 | Ga0213871_100619423 | 201 |
| 43 | 3300022467 | Ga0224712_10087708 | Ga0224712_100877083 | 201 |
| 44 | 3300025906 | Ga0207699_10205569 | Ga0207699_102055692 | 201 |
| 45 | 3300025909 | Ga0207705_10068346 | Ga0207705_100683464 | 201 |
| 46 | 3300025909 | Ga0207705_10085665 | Ga0207705_100856652 | 201 |
| 47 | 3300025909 | Ga0207705_10182042 | Ga0207705_101820423 | 201 |
| 48 | 3300025909 | Ga0207705_10917967 | Ga0207705_109179671 | 201 |
| 49 | 3300025914 | Ga0207671_10026904 | Ga0207671_100269046 | 201 |
| 50 | 3300025919 | Ga0207657_10179662 | Ga0207657_101796622 | 201 |
| 51 | 3300025919 | Ga0207657_10295962 | Ga0207657_102959622 | 201 |
| 52 | 3300025920 | Ga0207649_10319701 | Ga0207649_103197013 | 201 |
| 53 | 3300025928 | Ga0207700_10039430 | Ga0207700_100394304 | 201 |
| 54 | 3300025931 | Ga0207644_10044420 | Ga0207644_100444204 | 201 |
| 55 | 3300025949 | Ga0207667_10106198 | Ga0207667_101061982 | 201 |
| 56 | 3300025949 | Ga0207667_11001208 | Ga0207667_110012082 | 201 |
| 57 | 3300025961 | Ga0207712_10889791 | Ga0207712_108897912 | 201 |
| 58 | 3300025986 | Ga0207658_10187449 | Ga0207658_101874493 | 201 |
| 59 | 3300026035 | Ga0207703_10030916 | Ga0207703_100309164 | 201 |
| 60 | 3300026035 | Ga0207703_10072520 | Ga0207703_100725202 | 201 |
| 61 | 3300026041 | Ga0207639_10390691 | Ga0207639_103906913 | 201 |
| 62 | 3300026088 | Ga0207641_10357683 | Ga0207641_103576833 | 201 |
| 63 | 3300026142 | Ga0207698_10720233 | Ga0207698_107202332 | 201 |
| 64 | 3300028379 | Ga0268266_10132211 | Ga0268266_101322114 | 201 |
| 65 | 3300028380 | Ga0268265_10596345 | Ga0268265_105963452 | 201 |
| 66 | 3300028381 | Ga0268264_10243638 | Ga0268264_102436382 | 201 |
| 67 | 3300037471 | Ga0395905_0022619 | Ga0395905_0022619_3417_4028 | 201 |
| 68 | 3300037471 | Ga0395905_0443355 | Ga0395905_0443355_496_1113 | 201 |
| 69 | 3300039437 | Ga0436365_0592482 | Ga0436365_0592482_8117_8725 | 201 |
| 70 | 3300039437 | Ga0436365_0750598 | Ga0436365_0750598_951_1565 | 201 |
| 71 | 3300039437 | Ga0436365_1383407 | Ga0436365_1383407_17550_18161 | 201 |
| 72 | 3300039438 | Ga0436360_0624627 | Ga0436360_0624627_2015_2623 | 201 |
| 73 | 3300039438 | Ga0436360_0890129 | Ga0436360_0890129_3706_4314 | 201 |
| 74 | 3300039447 | Ga0436361_0117688 | Ga0436361_0117688_786_1394 | 201 |
| 75 | 3300039447 | Ga0436361_0182528 | Ga0436361_0182528_343_951 | 201 |
| 76 | 3300039447 | Ga0436361_0715339 | Ga0436361_0715339_187_795 | 201 |
| 77 | 3300042876 | Ga0451577_0009264 | Ga0451577_0009264_4824_5435 | 201 |
| 78 | 3300046522 | Ga0495643_0000165 | Ga0495643_0000165_48799_49413 | 201 |
| 79 | 3300053079 | Ga0500610_0071253 | Ga0500610_0071253_610_1221 | 201 |
| 80 | 3300053129 | Ga0500628_049086 | Ga0500628_049086_140_751 | 201 |
| 81 | 3300059493 | Ga0587077_003530 | Ga0587077_003530_1270_1881 | 201 |
| 82 | 3300002126 | JGI24035J26624_1001915 | JGI24035J26624_10019153 | 202 |
| 83 | 3300005289 | Ga0065704_10245549 | Ga0065704_102455491 | 202 |
| 84 | 3300005290 | Ga0065712_10006266 | Ga0065712_100062663 | 202 |
| 85 | 3300005293 | Ga0065715_10006003 | Ga0065715_1000600313 | 202 |
| 86 | 3300005293 | Ga0065715_10104827 | Ga0065715_101048272 | 202 |
| 87 | 3300005329 | Ga0070683_100014335 | Ga0070683_1000143352 | 202 |
| 88 | 3300005330 | Ga0070690_100053225 | Ga0070690_1000532251 | 202 |
| 89 | 3300005335 | Ga0070666_10326257 | Ga0070666_103262573 | 202 |
| 90 | 3300005338 | Ga0068868_100126997 | Ga0068868_1001269973 | 202 |
| 91 | 3300005339 | Ga0070660_100103069 | Ga0070660_1001030693 | 202 |
| 92 | 3300005339 | Ga0070660_100438467 | Ga0070660_1004384671 | 202 |
| 93 | 3300005340 | Ga0070689_100114177 | Ga0070689_1001141774 | 202 |
| 94 | 3300005353 | Ga0070669_100128080 | Ga0070669_1001280803 | 202 |
| 95 | 3300005354 | Ga0070675_100069033 | Ga0070675_1000690334 | 202 |
| 96 | 3300005354 | Ga0070675_100078814 | Ga0070675_1000788142 | 202 |
| 97 | 3300005355 | Ga0070671_100249573 | Ga0070671_1002495732 | 202 |
| 98 | 3300005356 | Ga0070674_100046469 | Ga0070674_1000464693 | 202 |
| 99 | 3300005364 | Ga0070673_100280195 | Ga0070673_1002801952 | 202 |
| 100 | 3300005365 | Ga0070688_100036885 | Ga0070688_1000368853 | 202 |
| 101 | 3300005365 | Ga0070688_100201836 | Ga0070688_1002018362 | 202 |
| 102 | 3300005366 | Ga0070659_100255238 | Ga0070659_1002552382 | 202 |
| 103 | 3300005367 | Ga0070667_100081996 | Ga0070667_1000819962 | 202 |
| 104 | 3300005406 | Ga0070703_10042498 | Ga0070703_100424982 | 202 |
| 105 | 3300005434 | Ga0070709_10008550 | Ga0070709_100085504 | 202 |
| 106 | 3300005436 | Ga0070713_100346057 | Ga0070713_1003460572 | 202 |
| 107 | 3300005439 | Ga0070711_100219627 | Ga0070711_1002196272 | 202 |
| 108 | 3300005445 | Ga0070708_100023964 | Ga0070708_1000239643 | 202 |
| 109 | 3300005445 | Ga0070708_100024432 | Ga0070708_1000244324 | 202 |
| 110 | 3300005445 | Ga0070708_100099238 | Ga0070708_1000992384 | 202 |
| 111 | 3300005445 | Ga0070708_100180181 | Ga0070708_1001801812 | 202 |
| 112 | 3300005445 | Ga0070708_100371424 | Ga0070708_1003714242 | 202 |
| 113 | 3300005456 | Ga0070678_100108297 | Ga0070678_1001082971 | 202 |
| 114 | 3300005457 | Ga0070662_100112438 | Ga0070662_1001124383 | 202 |
| 115 | 3300005466 | Ga0070685_10045062 | Ga0070685_100450622 | 202 |
| 116 | 3300005466 | Ga0070685_10129998 | Ga0070685_101299982 | 202 |
| 117 | 3300005467 | Ga0070706_100000210 | Ga0070706_10000021073 | 202 |
| 118 | 3300005467 | Ga0070706_100041224 | Ga0070706_1000412244 | 202 |
| 119 | 3300005467 | Ga0070706_100068396 | Ga0070706_1000683964 | 202 |
| 120 | 3300005467 | Ga0070706_100129058 | Ga0070706_1001290582 | 202 |
| 121 | 3300005467 | Ga0070706_100153713 | Ga0070706_1001537132 | 202 |
| 122 | 3300005467 | Ga0070706_100314451 | Ga0070706_1003144512 | 202 |
| 123 | 3300005467 | Ga0070706_100323488 | Ga0070706_1003234882 | 202 |
| 124 | 3300005467 | Ga0070706_100414212 | Ga0070706_1004142121 | 202 |
| 125 | 3300005467 | Ga0070706_100882431 | Ga0070706_1008824312 | 202 |
| 126 | 3300005468 | Ga0070707_100001841 | Ga0070707_10000184122 | 202 |
| 127 | 3300005468 | Ga0070707_100033325 | Ga0070707_1000333252 | 202 |
| 128 | 3300005468 | Ga0070707_100060424 | Ga0070707_1000604242 | 202 |
| 129 | 3300005468 | Ga0070707_100067576 | Ga0070707_1000675762 | 202 |
| 130 | 3300005468 | Ga0070707_100098037 | Ga0070707_1000980373 | 202 |
| 131 | 3300005468 | Ga0070707_100448468 | Ga0070707_1004484682 | 202 |
| 132 | 3300005468 | Ga0070707_100574688 | Ga0070707_1005746882 | 202 |
| 133 | 3300005471 | Ga0070698_100088458 | Ga0070698_1000884583 | 202 |
| 134 | 3300005471 | Ga0070698_100105120 | Ga0070698_1001051203 | 202 |
| 135 | 3300005471 | Ga0070698_100798110 | Ga0070698_1007981101 | 202 |
| 136 | 3300005518 | Ga0070699_100379233 | Ga0070699_1003792332 | 202 |
| 137 | 3300005530 | Ga0070679_100096055 | Ga0070679_1000960553 | 202 |
| 138 | 3300005535 | Ga0070684_100033042 | Ga0070684_1000330426 | 202 |
| 139 | 3300005536 | Ga0070697_100002768 | Ga0070697_1000027684 | 202 |
| 140 | 3300005536 | Ga0070697_100438585 | Ga0070697_1004385852 | 202 |
| 141 | 3300005536 | Ga0070697_100765449 | Ga0070697_1007654492 | 202 |
| 142 | 3300005543 | Ga0070672_100199568 | Ga0070672_1001995682 | 202 |
| 143 | 3300005544 | Ga0070686_100049196 | Ga0070686_1000491964 | 202 |
| 144 | 3300005548 | Ga0070665_100015162 | Ga0070665_1000151626 | 202 |
| 145 | 3300005548 | Ga0070665_100051910 | Ga0070665_1000519106 | 202 |
| 146 | 3300005614 | Ga0068856_101450609 | Ga0068856_1014506092 | 202 |
| 147 | 3300005843 | Ga0068860_101162264 | Ga0068860_1011622642 | 202 |
| 148 | 3300005937 | Ga0081455_10029562 | Ga0081455_100295624 | 202 |
| 149 | 3300005985 | Ga0081539_10017541 | Ga0081539_100175417 | 202 |
| 150 | 3300006028 | Ga0070717_10002256 | Ga0070717_100022569 | 202 |
| 151 | 3300006028 | Ga0070717_10034711 | Ga0070717_100347117 | 202 |
| 152 | 3300006028 | Ga0070717_10037696 | Ga0070717_100376964 | 202 |
| 153 | 3300006173 | Ga0070716_100016810 | Ga0070716_1000168102 | 202 |
| 154 | 3300006237 | Ga0097621_100108150 | Ga0097621_1001081502 | 202 |
| 155 | 3300006358 | Ga0068871_100087068 | Ga0068871_1000870683 | 202 |
| 156 | 3300006914 | Ga0075436_100055297 | Ga0075436_1000552973 | 202 |
| 157 | 3300006914 | Ga0075436_100160296 | Ga0075436_1001602962 | 202 |
| 158 | 3300009093 | Ga0105240_10462896 | Ga0105240_104628962 | 202 |
| 159 | 3300009094 | Ga0111539_10552707 | Ga0111539_105527072 | 202 |
| 160 | 3300009098 | Ga0105245_10536584 | Ga0105245_105365842 | 202 |
| 161 | 3300009176 | Ga0105242_11307757 | Ga0105242_113077571 | 202 |
| 162 | 3300010159 | Ga0099796_10008395 | Ga0099796_100083954 | 202 |
| 163 | 3300010159 | Ga0099796_10056587 | Ga0099796_100565872 | 202 |
| 164 | 3300010375 | Ga0105239_10245175 | Ga0105239_102451752 | 202 |
| 165 | 3300013102 | Ga0157371_10545069 | Ga0157371_105450692 | 202 |
| 166 | 3300013104 | Ga0157370_10234834 | Ga0157370_102348343 | 202 |
| 167 | 3300013105 | Ga0157369_10101890 | Ga0157369_101018902 | 202 |
| 168 | 3300013296 | Ga0157374_10056568 | Ga0157374_100565684 | 202 |
| 169 | 3300013296 | Ga0157374_10086985 | Ga0157374_100869853 | 202 |
| 170 | 3300013297 | Ga0157378_10009704 | Ga0157378_1000970413 | 202 |
| 171 | 3300013297 | Ga0157378_10021310 | Ga0157378_100213106 | 202 |
| 172 | 3300013307 | Ga0157372_10329970 | Ga0157372_103299702 | 202 |
| 173 | 3300013307 | Ga0157372_11770033 | Ga0157372_117700331 | 202 |
| 174 | 3300013308 | Ga0157375_10156755 | Ga0157375_101567552 | 202 |
| 175 | 3300013308 | Ga0157375_11382136 | Ga0157375_113821361 | 202 |
| 176 | 3300013308 | Ga0157375_11795681 | Ga0157375_117956811 | 202 |
| 177 | 3300014497 | Ga0182008_10034693 | Ga0182008_100346933 | 202 |
| 178 | 3300014969 | Ga0157376_10075816 | Ga0157376_100758162 | 202 |
| 179 | 3300025271 | Ga0207666_1000509 | Ga0207666_10005097 | 202 |
| 180 | 3300025290 | Ga0207673_1000205 | Ga0207673_10002054 | 202 |
| 181 | 3300025315 | Ga0207697_10010508 | Ga0207697_100105087 | 202 |
| 182 | 3300025315 | Ga0207697_10021523 | Ga0207697_100215235 | 202 |
| 183 | 3300025885 | Ga0207653_10043816 | Ga0207653_100438162 | 202 |
| 184 | 3300025898 | Ga0207692_10015694 | Ga0207692_100156945 | 202 |
| 185 | 3300025898 | Ga0207692_10158731 | Ga0207692_101587312 | 202 |
| 186 | 3300025898 | Ga0207692_10378593 | Ga0207692_103785932 | 202 |
| 187 | 3300025901 | Ga0207688_10106988 | Ga0207688_101069881 | 202 |
| 188 | 3300025903 | Ga0207680_10779436 | Ga0207680_107794361 | 202 |
| 189 | 3300025906 | Ga0207699_10033788 | Ga0207699_100337885 | 202 |
| 190 | 3300025909 | Ga0207705_10215974 | Ga0207705_102159741 | 202 |
| 191 | 3300025910 | Ga0207684_10000028 | Ga0207684_100000288 | 202 |
| 192 | 3300025910 | Ga0207684_10008671 | Ga0207684_100086714 | 202 |
| 193 | 3300025910 | Ga0207684_10047663 | Ga0207684_100476634 | 202 |
| 194 | 3300025910 | Ga0207684_10086390 | Ga0207684_100863902 | 202 |
| 195 | 3300025910 | Ga0207684_10297383 | Ga0207684_102973832 | 202 |
| 196 | 3300025910 | Ga0207684_10394442 | Ga0207684_103944421 | 202 |
| 197 | 3300025910 | Ga0207684_10643493 | Ga0207684_106434932 | 202 |
| 198 | 3300025918 | Ga0207662_10024747 | Ga0207662_100247474 | 202 |
| 199 | 3300025919 | Ga0207657_10200978 | Ga0207657_102009783 | 202 |
| 200 | 3300025920 | Ga0207649_10116647 | Ga0207649_101166472 | 202 |
| 201 | 3300025921 | Ga0207652_10319734 | Ga0207652_103197342 | 202 |
| 202 | 3300025922 | Ga0207646_10001393 | Ga0207646_1000139324 | 202 |
| 203 | 3300025922 | Ga0207646_10016566 | Ga0207646_100165668 | 202 |
| 204 | 3300025922 | Ga0207646_10104395 | Ga0207646_101043953 | 202 |
| 205 | 3300025922 | Ga0207646_10355686 | Ga0207646_103556862 | 202 |
| 206 | 3300025922 | Ga0207646_10464608 | Ga0207646_104646082 | 202 |
| 207 | 3300025923 | Ga0207681_10365037 | Ga0207681_103650372 | 202 |
| 208 | 3300025926 | Ga0207659_10071464 | Ga0207659_100714644 | 202 |
| 209 | 3300025928 | Ga0207700_10003893 | Ga0207700_100038934 | 202 |
| 210 | 3300025929 | Ga0207664_10123283 | Ga0207664_101232834 | 202 |
| 211 | 3300025931 | Ga0207644_10172380 | Ga0207644_101723802 | 202 |
| 212 | 3300025932 | Ga0207690_10142724 | Ga0207690_101427243 | 202 |
| 213 | 3300025933 | Ga0207706_10134531 | Ga0207706_101345313 | 202 |
| 214 | 3300025934 | Ga0207686_10211340 | Ga0207686_102113402 | 202 |
| 215 | 3300025935 | Ga0207709_10263307 | Ga0207709_102633072 | 202 |
| 216 | 3300025938 | Ga0207704_10640352 | Ga0207704_106403521 | 202 |
| 217 | 3300025939 | Ga0207665_10076274 | Ga0207665_100762743 | 202 |
| 218 | 3300025939 | Ga0207665_10277367 | Ga0207665_102773672 | 202 |
| 219 | 3300025940 | Ga0207691_10102373 | Ga0207691_101023733 | 202 |
| 220 | 3300025960 | Ga0207651_10067156 | Ga0207651_100671563 | 202 |
| 221 | 3300025960 | Ga0207651_11339168 | Ga0207651_113391681 | 202 |
| 222 | 3300025972 | Ga0207668_10558888 | Ga0207668_105588882 | 202 |
| 223 | 3300025981 | Ga0207640_10075256 | Ga0207640_100752562 | 202 |
| 224 | 3300026023 | Ga0207677_10122255 | Ga0207677_101222553 | 202 |
| 225 | 3300026088 | Ga0207641_10702018 | Ga0207641_107020182 | 202 |
| 226 | 3300026121 | Ga0207683_10071554 | Ga0207683_100715545 | 202 |
| 227 | 3300028379 | Ga0268266_10025356 | Ga0268266_100253562 | 202 |
| 228 | 3300028379 | Ga0268266_10770483 | Ga0268266_107704832 | 202 |
| 229 | 3300035113 | Ga0373936_0168225 | Ga0373936_0168225_201_809 | 202 |
| 230 | 3300035116 | Ga0373945_0218129 | Ga0373945_0218129_148_756 | 202 |
| 231 | 3300035170 | Ga0373943_0034497 | Ga0373943_0034497_67_675 | 202 |
| 232 | 3300035171 | Ga0373946_0280390 | Ga0373946_0280390_102_710 | 202 |
| 233 | 3300035410 | Ga0373924_0219625 | Ga0373924_0219625_220_828 | 202 |
| 234 | 3300035692 | Ga0373935_0018504 | Ga0373935_0018504_1378_1986 | 202 |
| 235 | 3300035692 | Ga0373935_0727696 | Ga0373935_0727696_82_690 | 202 |
| 236 | 3300035695 | Ga0373927_0090974 | Ga0373927_0090974_42_650 | 202 |
| 237 | 3300035724 | Ga0373933_0625568 | Ga0373933_0625568_75_683 | 202 |
| 238 | 3300036401 | Ga0373937_0007935 | Ga0373937_0007935_4667_5275 | 202 |
| 239 | 3300036401 | Ga0373937_0343076 | Ga0373937_0343076_88_696 | 202 |
| 240 | 3300037068 | Ga0373925_0484093 | Ga0373925_0484093_175_783 | 202 |
| 241 | 3300037068 | Ga0373925_0643210 | Ga0373925_0643210_144_752 | 202 |
| 242 | 3300037068 | Ga0373925_0672882 | Ga0373925_0672882_104_712 | 202 |
| 243 | 3300041486 | Ga0451807_2029754 | Ga0451807_2029754_367_975 | 202 |
| 244 | 3300046454 | Ga0495592_0004183 | Ga0495592_0004183_8314_8922 | 202 |
| 245 | 3300046459 | Ga0495629_0116759 | Ga0495629_0116759_599_1207 | 202 |
| 246 | 3300046459 | Ga0495629_0291497 | Ga0495629_0291497_109_717 | 202 |
| 247 | 3300046462 | Ga0495651_0265033 | Ga0495651_0265033_424_1032 | 202 |
| 248 | 3300046472 | Ga0495580_0387428 | Ga0495580_0387428_148_756 | 202 |
| 249 | 3300046476 | Ga0495662_0148558 | Ga0495662_0148558_363_971 | 202 |
| 250 | 3300046477 | Ga0495664_0229922 | Ga0495664_0229922_409_1017 | 202 |
| 251 | 3300046491 | Ga0495584_0173045 | Ga0495584_0173045_465_1073 | 202 |
| 252 | 3300046514 | Ga0495618_0278347 | Ga0495618_0278347_363_971 | 202 |
| 253 | 3300046516 | Ga0495628_0004287 | Ga0495628_0004287_6436_7044 | 202 |
| 254 | 3300046517 | Ga0495630_0043877 | Ga0495630_0043877_523_1131 | 202 |
| 255 | 3300046523 | Ga0495644_0022155 | Ga0495644_0022155_1510_2118 | 202 |
| 256 | 3300046525 | Ga0495663_0014937 | Ga0495663_0014937_367_975 | 202 |
| 257 | 3300046526 | Ga0495666_0164495 | Ga0495666_0164495_75_683 | 202 |
| 258 | 3300046529 | Ga0495652_0270184 | Ga0495652_0270184_246_854 | 202 |
| 259 | 3300046535 | Ga0495586_0019561 | Ga0495586_0019561_2893_3501 | 202 |
| 260 | 3300046536 | Ga0495587_0004117 | Ga0495587_0004117_3443_4051 | 202 |
| 261 | 3300046538 | Ga0495609_0101466 | Ga0495609_0101466_478_1086 | 202 |
| 262 | 3300046543 | Ga0495645_0001076 | Ga0495645_0001076_6702_7310 | 202 |
| 263 | 3300046559 | Ga0495667_0272758 | Ga0495667_0272758_36_644 | 202 |
| 264 | 3300046675 | Ga0495657_0158333 | Ga0495657_0158333_582_1190 | 202 |
| 265 | 3300046678 | Ga0495599_0000317 | Ga0495599_0000317_15962_16570 | 202 |
| 266 | 3300046679 | Ga0495623_0000811 | Ga0495623_0000811_18425_19033 | 202 |
| 267 | 3300046680 | Ga0495646_0002940 | Ga0495646_0002940_834_1442 | 202 |
| 268 | 3300046689 | Ga0495613_0155202 | Ga0495613_0155202_901_1509 | 202 |
| 269 | 3300046794 | Ga0495589_0102052 | Ga0495589_0102052_750_1358 | 202 |
| 270 | 3300047315 | Ga0495581_0108942 | Ga0495581_0108942_127_735 | 202 |
| 271 | 3300047317 | Ga0495604_0023193 | Ga0495604_0023193_3721_4329 | 202 |
| 272 | 3300047319 | Ga0495674_0556471 | Ga0495674_0556471_188_796 | 202 |
| 273 | 3300047319 | Ga0495674_0810677 | Ga0495674_0810677_83_691 | 202 |
| 274 | 3300047322 | Ga0495680_0590104 | Ga0495680_0590104_105_713 | 202 |
| 275 | 3300047444 | Ga0495675_0030344 | Ga0495675_0030344_1370_1978 | 202 |
| 276 | 3300047471 | Ga0495684_0017471 | Ga0495684_0017471_2434_3042 | 202 |
| 277 | 3300048088 | Ga0495602_0027778 | Ga0495602_0027778_3672_4280 | 202 |
| 278 | 3300048908 | Ga0496105_0535958 | Ga0496105_0535958_120_728 | 202 |
| 279 | 3300048915 | Ga0496112_0080495 | Ga0496112_0080495_2443_3051 | 202 |
| 280 | 3300048917 | Ga0496114_0016126 | Ga0496114_0016126_2307_2915 | 202 |
| 281 | 3300049742 | Ga0501080_0229056 | Ga0501080_0229056_952_1572 | 202 |
| 282 | 3300050514 | nmdc:mga08x19_141665_c1 | nmdc:mga08x19_141665_c1_714_1322 | 202 |
| 283 | 3300050514 | nmdc:mga08x19_41356_c1 | nmdc:mga08x19_41356_c1_1420_2028 | 202 |
| 284 | 3300053077 | Ga0495601_0001921 | Ga0495601_0001921_205_813 | 202 |
| 285 | 3300053078 | Ga0495612_0119550 | Ga0495612_0119550_478_1086 | 202 |
| 286 | 3300053083 | Ga0495655_0040681 | Ga0495655_0040681_94_702 | 202 |
| 287 | 3300005272 | Ga0065703_1019589 | Ga0065703_10195893 | 203 |
| 288 | 3300005328 | Ga0070676_10012318 | Ga0070676_100123184 | 203 |
| 289 | 3300005335 | Ga0070666_10026532 | Ga0070666_100265325 | 203 |
| 290 | 3300005335 | Ga0070666_10054780 | Ga0070666_100547805 | 203 |
| 291 | 3300005338 | Ga0068868_100067232 | Ga0068868_1000672325 | 203 |
| 292 | 3300005338 | Ga0068868_100194101 | Ga0068868_1001941012 | 203 |
| 293 | 3300005338 | Ga0068868_100214619 | Ga0068868_1002146192 | 203 |
| 294 | 3300005344 | Ga0070661_100729087 | Ga0070661_1007290871 | 203 |
| 295 | 3300005347 | Ga0070668_100000403 | Ga0070668_10000040337 | 203 |
| 296 | 3300005353 | Ga0070669_100002011 | Ga0070669_10000201125 | 203 |
| 297 | 3300005354 | Ga0070675_100197214 | Ga0070675_1001972143 | 203 |
| 298 | 3300005354 | Ga0070675_100677838 | Ga0070675_1006778382 | 203 |
| 299 | 3300005355 | Ga0070671_100002459 | Ga0070671_10000245913 | 203 |
| 300 | 3300005355 | Ga0070671_100012710 | Ga0070671_1000127107 | 203 |
| 301 | 3300005356 | Ga0070674_100129388 | Ga0070674_1001293883 | 203 |
| 302 | 3300005364 | Ga0070673_100093233 | Ga0070673_1000932332 | 203 |
| 303 | 3300005365 | Ga0070688_100000733 | Ga0070688_10000073318 | 203 |
| 304 | 3300005367 | Ga0070667_100004665 | Ga0070667_1000046652 | 203 |
| 305 | 3300005367 | Ga0070667_100048750 | Ga0070667_1000487504 | 203 |
| 306 | 3300005367 | Ga0070667_100054124 | Ga0070667_1000541242 | 203 |
| 307 | 3300005445 | Ga0070708_100259323 | Ga0070708_1002593232 | 203 |
| 308 | 3300005456 | Ga0070678_100040339 | Ga0070678_1000403395 | 203 |
| 309 | 3300005456 | Ga0070678_100262041 | Ga0070678_1002620412 | 203 |
| 310 | 3300005459 | Ga0068867_100150920 | Ga0068867_1001509203 | 203 |
| 311 | 3300005459 | Ga0068867_100220792 | Ga0068867_1002207921 | 203 |
| 312 | 3300005548 | Ga0070665_100090881 | Ga0070665_1000908813 | 203 |
| 313 | 3300005564 | Ga0070664_100037306 | Ga0070664_1000373062 | 203 |
| 314 | 3300005618 | Ga0068864_100098211 | Ga0068864_1000982113 | 203 |
| 315 | 3300005718 | Ga0068866_10195272 | Ga0068866_101952722 | 203 |
| 316 | 3300005834 | Ga0068851_10204951 | Ga0068851_102049512 | 203 |
| 317 | 3300005843 | Ga0068860_100174888 | Ga0068860_1001748883 | 203 |
| 318 | 3300005844 | Ga0068862_100448989 | Ga0068862_1004489892 | 203 |
| 319 | 3300005985 | Ga0081539_10003851 | Ga0081539_1000385116 | 203 |
| 320 | 3300006173 | Ga0070716_100697351 | Ga0070716_1006973511 | 203 |
| 321 | 3300006237 | Ga0097621_100064714 | Ga0097621_1000647141 | 203 |
| 322 | 3300006358 | Ga0068871_100042623 | Ga0068871_1000426234 | 203 |
| 323 | 3300006358 | Ga0068871_100063216 | Ga0068871_1000632162 | 203 |
| 324 | 3300006358 | Ga0068871_100272171 | Ga0068871_1002721712 | 203 |
| 325 | 3300006871 | Ga0075434_100534688 | Ga0075434_1005346882 | 203 |
| 326 | 3300006881 | Ga0068865_100002077 | Ga0068865_10000207712 | 203 |
| 327 | 3300009098 | Ga0105245_10075162 | Ga0105245_100751622 | 203 |
| 328 | 3300009148 | Ga0105243_10712699 | Ga0105243_107126991 | 203 |
| 329 | 3300013296 | Ga0157374_10001473 | Ga0157374_1000147321 | 203 |
| 330 | 3300013296 | Ga0157374_10005577 | Ga0157374_100055772 | 203 |
| 331 | 3300013296 | Ga0157374_10092382 | Ga0157374_100923825 | 203 |
| 332 | 3300013297 | Ga0157378_10009019 | Ga0157378_100090195 | 203 |
| 333 | 3300013297 | Ga0157378_10242977 | Ga0157378_102429772 | 203 |
| 334 | 3300013306 | Ga0163162_10003249 | Ga0163162_1000324927 | 203 |
| 335 | 3300013306 | Ga0163162_10112610 | Ga0163162_101126102 | 203 |
| 336 | 3300013307 | Ga0157372_10978731 | Ga0157372_109787312 | 203 |
| 337 | 3300013308 | Ga0157375_10000287 | Ga0157375_1000028712 | 203 |
| 338 | 3300013308 | Ga0157375_10001868 | Ga0157375_1000186821 | 203 |
| 339 | 3300014969 | Ga0157376_10009509 | Ga0157376_100095092 | 203 |
| 340 | 3300014969 | Ga0157376_10079496 | Ga0157376_100794964 | 203 |
| 341 | 3300025315 | Ga0207697_10000010 | Ga0207697_1000001051 | 203 |
| 342 | 3300025893 | Ga0207682_10020163 | Ga0207682_100201634 | 203 |
| 343 | 3300025901 | Ga0207688_10007718 | Ga0207688_100077183 | 203 |
| 344 | 3300025903 | Ga0207680_10014436 | Ga0207680_100144364 | 203 |
| 345 | 3300025907 | Ga0207645_10004432 | Ga0207645_1000443218 | 203 |
| 346 | 3300025907 | Ga0207645_10192675 | Ga0207645_101926753 | 203 |
| 347 | 3300025920 | Ga0207649_10703969 | Ga0207649_107039692 | 203 |
| 348 | 3300025923 | Ga0207681_10014015 | Ga0207681_100140159 | 203 |
| 349 | 3300025923 | Ga0207681_10131300 | Ga0207681_101313003 | 203 |
| 350 | 3300025925 | Ga0207650_10015937 | Ga0207650_100159373 | 203 |
| 351 | 3300025926 | Ga0207659_10955714 | Ga0207659_109557142 | 203 |
| 352 | 3300025931 | Ga0207644_10014741 | Ga0207644_100147415 | 203 |
| 353 | 3300025931 | Ga0207644_10025745 | Ga0207644_100257456 | 203 |
| 354 | 3300025936 | Ga0207670_10035039 | Ga0207670_100350392 | 203 |
| 355 | 3300025937 | Ga0207669_10102120 | Ga0207669_101021202 | 203 |
| 356 | 3300025938 | Ga0207704_10278282 | Ga0207704_102782821 | 203 |
| 357 | 3300025939 | Ga0207665_10360643 | Ga0207665_103606433 | 203 |
| 358 | 3300025940 | Ga0207691_10000142 | Ga0207691_100001427 | 203 |
| 359 | 3300025945 | Ga0207679_10228003 | Ga0207679_102280032 | 203 |
| 360 | 3300025960 | Ga0207651_10566758 | Ga0207651_105667582 | 203 |
| 361 | 3300025972 | Ga0207668_10027563 | Ga0207668_100275634 | 203 |
| 362 | 3300025986 | Ga0207658_10047043 | Ga0207658_100470434 | 203 |
| 363 | 3300025986 | Ga0207658_10290309 | Ga0207658_102903092 | 203 |
| 364 | 3300026023 | Ga0207677_10047355 | Ga0207677_100473552 | 203 |
| 365 | 3300026023 | Ga0207677_10115001 | Ga0207677_101150013 | 203 |
| 366 | 3300026089 | Ga0207648_10067913 | Ga0207648_100679136 | 203 |
| 367 | 3300026121 | Ga0207683_10009866 | Ga0207683_1000986617 | 203 |
| 368 | 3300026121 | Ga0207683_10937305 | Ga0207683_109373051 | 203 |
| 369 | 3300028379 | Ga0268266_10004179 | Ga0268266_100041792 | 203 |
| 370 | 3300028379 | Ga0268266_10296583 | Ga0268266_102965832 | 203 |
| 371 | 3300028381 | Ga0268264_10086546 | Ga0268264_100865463 | 203 |
| 372 | 3300035115 | Ga0373941_0103863 | Ga0373941_0103863_250_861 | 203 |
| 373 | 3300035170 | Ga0373943_0092972 | Ga0373943_0092972_421_1032 | 203 |
| 374 | 3300035398 | Ga0316574_0149687 | Ga0316574_0149687_36_650 | 203 |
| 375 | 3300035691 | Ga0373931_0061865 | Ga0373931_0061865_1040_1651 | 203 |
| 376 | 3300035691 | Ga0373931_0516067 | Ga0373931_0516067_29_640 | 203 |
| 377 | 3300035725 | Ga0373947_0020963 | Ga0373947_0020963_783_1394 | 203 |
| 378 | 3300035725 | Ga0373947_0121377 | Ga0373947_0121377_647_1258 | 203 |
| 379 | 3300037068 | Ga0373925_0622931 | Ga0373925_0622931_100_711 | 203 |
| 380 | 3300039450 | Ga0436363_1019557 | Ga0436363_1019557_15_626 | 203 |
| 381 | 3300046674 | Ga0495588_0156994 | Ga0495588_0156994_390_1001 | 203 |
| 382 | 3300048911 | Ga0496108_0086631 | Ga0496108_0086631_1351_1962 | 203 |
| 383 | 3300048912 | Ga0496109_0195103 | Ga0496109_0195103_622_1233 | 203 |
| 384 | 3300048915 | Ga0496112_0135302 | Ga0496112_0135302_895_1506 | 203 |
| 385 | 3300048915 | Ga0496112_0187611 | Ga0496112_0187611_791_1402 | 203 |
| 386 | 3300000545 | CNXas_1000052 | CNXas_100005228 | 204 |
| 387 | 3300005353 | Ga0070669_100182783 | Ga0070669_1001827833 | 204 |
| 388 | 3300005355 | Ga0070671_100047861 | Ga0070671_1000478613 | 204 |
| 389 | 3300005365 | Ga0070688_100357767 | Ga0070688_1003577672 | 204 |
| 390 | 3300005543 | Ga0070672_100157475 | Ga0070672_1001574752 | 204 |
| 391 | 3300005843 | Ga0068860_100985539 | Ga0068860_1009855391 | 204 |
| 392 | 3300005985 | Ga0081539_10013488 | Ga0081539_100134884 | 204 |
| 393 | 3300006871 | Ga0075434_100138435 | Ga0075434_1001384352 | 204 |
| 394 | 3300009553 | Ga0105249_10137449 | Ga0105249_101374493 | 204 |
| 395 | 3300013297 | Ga0157378_10275651 | Ga0157378_102756512 | 204 |
| 396 | 3300013297 | Ga0157378_10533444 | Ga0157378_105334442 | 204 |
| 397 | 3300013308 | Ga0157375_10050268 | Ga0157375_100502684 | 204 |
| 398 | 3300025931 | Ga0207644_10032598 | Ga0207644_100325985 | 204 |
| 399 | 3300025940 | Ga0207691_10097501 | Ga0207691_100975014 | 204 |
| 400 | 3300031456 | Ga0307513_10089511 | Ga0307513_100895113 | 204 |
| 401 | 3300035171 | Ga0373946_0091629 | Ga0373946_0091629_452_1066 | 204 |
| 402 | 3300035172 | Ga0373955_0009835 | Ga0373955_0009835_2861_3475 | 204 |
| 403 | 3300036401 | Ga0373937_0077805 | Ga0373937_0077805_2387_3001 | 204 |
| 404 | 3300036401 | Ga0373937_0142442 | Ga0373937_0142442_1433_2047 | 204 |
| 405 | 3300046454 | Ga0495592_0079240 | Ga0495592_0079240_531_1145 | 204 |
| 406 | 3300046462 | Ga0495651_0140727 | Ga0495651_0140727_1008_1622 | 204 |
| 407 | 3300046462 | Ga0495651_0411481 | Ga0495651_0411481_24_638 | 204 |
| 408 | 3300046517 | Ga0495630_0186121 | Ga0495630_0186121_497_1111 | 204 |
| 409 | 3300046529 | Ga0495652_0053015 | Ga0495652_0053015_23_637 | 204 |
| 410 | 3300046533 | Ga0495640_0198898 | Ga0495640_0198898_580_1194 | 204 |
| 411 | 3300046543 | Ga0495645_0055058 | Ga0495645_0055058_1666_2280 | 204 |
| 412 | 3300047444 | Ga0495675_0242653 | Ga0495675_0242653_386_1000 | 204 |
| 413 | 3300047471 | Ga0495684_0009324 | Ga0495684_0009324_2002_2616 | 204 |
| 414 | 3300048915 | Ga0496112_0541761 | Ga0496112_0541761_422_1036 | 204 |
| 415 | 3300050512 | nmdc:mga0n895_44950_c1 | nmdc:mga0n895_44950_c1_718_1332 | 204 |
| 416 | 3300050513 | nmdc:mga0rr50_1068283_c1 | nmdc:mga0rr50_1068283_c1_13_627 | 204 |
| 417 | 2162886006 | SwRhRL3b_contig_1511392 | SwRhRL3b_0085.00001530 | 205 |
| 418 | 2162886007 | SwRhRL2b_contig_157882 | SwRhRL2b_0695.00001780 | 205 |
| 419 | 3300003911 | JGI25405J52794_10000497 | JGI25405J52794_100004972 | 205 |
| 420 | 3300003911 | JGI25405J52794_10035337 | JGI25405J52794_100353372 | 205 |
| 421 | 3300003911 | JGI25405J52794_10045831 | JGI25405J52794_100458312 | 205 |
| 422 | 3300005289 | Ga0065704_10086836 | Ga0065704_100868364 | 205 |
| 423 | 3300005290 | Ga0065712_10001341 | Ga0065712_100013414 | 205 |
| 424 | 3300005290 | Ga0065712_10223303 | Ga0065712_102233031 | 205 |
| 425 | 3300005290 | Ga0065712_10273400 | Ga0065712_102734001 | 205 |
| 426 | 3300005293 | Ga0065715_10001210 | Ga0065715_100012108 | 205 |
| 427 | 3300005293 | Ga0065715_10001337 | Ga0065715_100013372 | 205 |
| 428 | 3300005293 | Ga0065715_10006907 | Ga0065715_100069072 | 205 |
| 429 | 3300005293 | Ga0065715_10133814 | Ga0065715_101338143 | 205 |
| 430 | 3300005293 | Ga0065715_10308998 | Ga0065715_103089982 | 205 |
| 431 | 3300005295 | Ga0065707_10002326 | Ga0065707_100023265 | 205 |
| 432 | 3300005295 | Ga0065707_10105144 | Ga0065707_101051444 | 205 |
| 433 | 3300005295 | Ga0065707_10158891 | Ga0065707_101588912 | 205 |
| 434 | 3300005328 | Ga0070676_10006857 | Ga0070676_100068574 | 205 |
| 435 | 3300005328 | Ga0070676_10013851 | Ga0070676_100138513 | 205 |
| 436 | 3300005329 | Ga0070683_100014620 | Ga0070683_10001462011 | 205 |
| 437 | 3300005329 | Ga0070683_100093797 | Ga0070683_1000937974 | 205 |
| 438 | 3300005331 | Ga0070670_100248667 | Ga0070670_1002486672 | 205 |
| 439 | 3300005333 | Ga0070677_10005596 | Ga0070677_100055964 | 205 |
| 440 | 3300005335 | Ga0070666_10004276 | Ga0070666_100042766 | 205 |
| 441 | 3300005335 | Ga0070666_10199507 | Ga0070666_101995073 | 205 |
| 442 | 3300005338 | Ga0068868_100029621 | Ga0068868_1000296213 | 205 |
| 443 | 3300005338 | Ga0068868_100057916 | Ga0068868_1000579164 | 205 |
| 444 | 3300005338 | Ga0068868_100325778 | Ga0068868_1003257782 | 205 |
| 445 | 3300005338 | Ga0068868_100432416 | Ga0068868_1004324162 | 205 |
| 446 | 3300005339 | Ga0070660_100342014 | Ga0070660_1003420143 | 205 |
| 447 | 3300005340 | Ga0070689_100009585 | Ga0070689_10000958513 | 205 |
| 448 | 3300005340 | Ga0070689_100965139 | Ga0070689_1009651391 | 205 |
| 449 | 3300005343 | Ga0070687_100000382 | Ga0070687_10000038221 | 205 |
| 450 | 3300005343 | Ga0070687_100308397 | Ga0070687_1003083972 | 205 |
| 451 | 3300005344 | Ga0070661_100092920 | Ga0070661_1000929203 | 205 |
| 452 | 3300005347 | Ga0070668_100004836 | Ga0070668_10000483613 | 205 |
| 453 | 3300005347 | Ga0070668_100007390 | Ga0070668_1000073905 | 205 |
| 454 | 3300005347 | Ga0070668_100040758 | Ga0070668_1000407583 | 205 |
| 455 | 3300005347 | Ga0070668_100175817 | Ga0070668_1001758172 | 205 |
| 456 | 3300005353 | Ga0070669_100008062 | Ga0070669_1000080624 | 205 |
| 457 | 3300005353 | Ga0070669_100033499 | Ga0070669_1000334994 | 205 |
| 458 | 3300005353 | Ga0070669_100065736 | Ga0070669_1000657365 | 205 |
| 459 | 3300005354 | Ga0070675_100005920 | Ga0070675_10000592011 | 205 |
| 460 | 3300005354 | Ga0070675_100008984 | Ga0070675_1000089845 | 205 |
| 461 | 3300005354 | Ga0070675_100014207 | Ga0070675_1000142073 | 205 |
| 462 | 3300005354 | Ga0070675_100607122 | Ga0070675_1006071222 | 205 |
| 463 | 3300005355 | Ga0070671_100011495 | Ga0070671_10001149512 | 205 |
| 464 | 3300005355 | Ga0070671_100142680 | Ga0070671_1001426802 | 205 |
| 465 | 3300005355 | Ga0070671_100367312 | Ga0070671_1003673122 | 205 |
| 466 | 3300005356 | Ga0070674_100000912 | Ga0070674_10000091212 | 205 |
| 467 | 3300005364 | Ga0070673_100022910 | Ga0070673_1000229104 | 205 |
| 468 | 3300005364 | Ga0070673_100091970 | Ga0070673_1000919703 | 205 |
| 469 | 3300005364 | Ga0070673_100443023 | Ga0070673_1004430232 | 205 |
| 470 | 3300005365 | Ga0070688_100001414 | Ga0070688_10000141419 | 205 |
| 471 | 3300005366 | Ga0070659_100002483 | Ga0070659_1000024834 | 205 |
| 472 | 3300005366 | Ga0070659_100004760 | Ga0070659_1000047604 | 205 |
| 473 | 3300005367 | Ga0070667_100018952 | Ga0070667_1000189522 | 205 |
| 474 | 3300005367 | Ga0070667_100025188 | Ga0070667_1000251885 | 205 |
| 475 | 3300005367 | Ga0070667_100037302 | Ga0070667_1000373024 | 205 |
| 476 | 3300005367 | Ga0070667_100788782 | Ga0070667_1007887822 | 205 |
| 477 | 3300005434 | Ga0070709_10295089 | Ga0070709_102950892 | 205 |
| 478 | 3300005435 | Ga0070714_100548650 | Ga0070714_1005486502 | 205 |
| 479 | 3300005435 | Ga0070714_100814949 | Ga0070714_1008149491 | 205 |
| 480 | 3300005436 | Ga0070713_100189526 | Ga0070713_1001895263 | 205 |
| 481 | 3300005437 | Ga0070710_10480747 | Ga0070710_104807472 | 205 |
| 482 | 3300005438 | Ga0070701_10306214 | Ga0070701_103062141 | 205 |
| 483 | 3300005439 | Ga0070711_100005001 | Ga0070711_10000500113 | 205 |
| 484 | 3300005439 | Ga0070711_100060582 | Ga0070711_1000605824 | 205 |
| 485 | 3300005439 | Ga0070711_100104829 | Ga0070711_1001048292 | 205 |
| 486 | 3300005439 | Ga0070711_100193299 | Ga0070711_1001932993 | 205 |
| 487 | 3300005440 | Ga0070705_100015270 | Ga0070705_1000152704 | 205 |
| 488 | 3300005440 | Ga0070705_100017440 | Ga0070705_1000174404 | 205 |
| 489 | 3300005440 | Ga0070705_100383762 | Ga0070705_1003837621 | 205 |
| 490 | 3300005441 | Ga0070700_100044032 | Ga0070700_1000440322 | 205 |
| 491 | 3300005444 | Ga0070694_100016943 | Ga0070694_1000169435 | 205 |
| 492 | 3300005444 | Ga0070694_100261255 | Ga0070694_1002612551 | 205 |
| 493 | 3300005445 | Ga0070708_100031777 | Ga0070708_1000317774 | 205 |
| 494 | 3300005445 | Ga0070708_100138340 | Ga0070708_1001383403 | 205 |
| 495 | 3300005445 | Ga0070708_100158709 | Ga0070708_1001587093 | 205 |
| 496 | 3300005445 | Ga0070708_100515544 | Ga0070708_1005155441 | 205 |
| 497 | 3300005455 | Ga0070663_100033694 | Ga0070663_1000336946 | 205 |
| 498 | 3300005456 | Ga0070678_100508932 | Ga0070678_1005089322 | 205 |
| 499 | 3300005457 | Ga0070662_100007763 | Ga0070662_1000077634 | 205 |
| 500 | 3300005457 | Ga0070662_100024478 | Ga0070662_1000244784 | 205 |
| 501 | 3300005457 | Ga0070662_100231057 | Ga0070662_1002310572 | 205 |
| 502 | 3300005459 | Ga0068867_100197877 | Ga0068867_1001978772 | 205 |
| 503 | 3300005467 | Ga0070706_100099800 | Ga0070706_1000998002 | 205 |
| 504 | 3300005467 | Ga0070706_100100812 | Ga0070706_1001008125 | 205 |
| 505 | 3300005467 | Ga0070706_100278642 | Ga0070706_1002786421 | 205 |
| 506 | 3300005467 | Ga0070706_100293023 | Ga0070706_1002930232 | 205 |
| 507 | 3300005468 | Ga0070707_100003721 | Ga0070707_10000372124 | 205 |
| 508 | 3300005468 | Ga0070707_100062020 | Ga0070707_1000620204 | 205 |
| 509 | 3300005468 | Ga0070707_100113761 | Ga0070707_1001137614 | 205 |
| 510 | 3300005468 | Ga0070707_100197041 | Ga0070707_1001970412 | 205 |
| 511 | 3300005468 | Ga0070707_100226363 | Ga0070707_1002263631 | 205 |
| 512 | 3300005468 | Ga0070707_100351433 | Ga0070707_1003514331 | 205 |
| 513 | 3300005471 | Ga0070698_100001836 | Ga0070698_10000183628 | 205 |
| 514 | 3300005471 | Ga0070698_100012011 | Ga0070698_1000120118 | 205 |
| 515 | 3300005471 | Ga0070698_100194316 | Ga0070698_1001943163 | 205 |
| 516 | 3300005471 | Ga0070698_100246137 | Ga0070698_1002461373 | 205 |
| 517 | 3300005471 | Ga0070698_100271036 | Ga0070698_1002710364 | 205 |
| 518 | 3300005518 | Ga0070699_100089693 | Ga0070699_1000896933 | 205 |
| 519 | 3300005518 | Ga0070699_100328077 | Ga0070699_1003280772 | 205 |
| 520 | 3300005535 | Ga0070684_100001475 | Ga0070684_10000147516 | 205 |
| 521 | 3300005536 | Ga0070697_100000826 | Ga0070697_10000082630 | 205 |
| 522 | 3300005536 | Ga0070697_100022327 | Ga0070697_1000223272 | 205 |
| 523 | 3300005536 | Ga0070697_100038008 | Ga0070697_1000380082 | 205 |
| 524 | 3300005536 | Ga0070697_100076088 | Ga0070697_1000760885 | 205 |
| 525 | 3300005536 | Ga0070697_100118459 | Ga0070697_1001184593 | 205 |
| 526 | 3300005536 | Ga0070697_100149612 | Ga0070697_1001496121 | 205 |
| 527 | 3300005539 | Ga0068853_100406604 | Ga0068853_1004066043 | 205 |
| 528 | 3300005543 | Ga0070672_100000808 | Ga0070672_10000080818 | 205 |
| 529 | 3300005543 | Ga0070672_100046256 | Ga0070672_1000462564 | 205 |
| 530 | 3300005543 | Ga0070672_100558585 | Ga0070672_1005585851 | 205 |
| 531 | 3300005546 | Ga0070696_100032501 | Ga0070696_1000325014 | 205 |
| 532 | 3300005548 | Ga0070665_100014536 | Ga0070665_1000145366 | 205 |
| 533 | 3300005548 | Ga0070665_100165819 | Ga0070665_1001658192 | 205 |
| 534 | 3300005548 | Ga0070665_100171092 | Ga0070665_1001710923 | 205 |
| 535 | 3300005549 | Ga0070704_100018431 | Ga0070704_1000184313 | 205 |
| 536 | 3300005549 | Ga0070704_100078384 | Ga0070704_1000783843 | 205 |
| 537 | 3300005549 | Ga0070704_100108655 | Ga0070704_1001086552 | 205 |
| 538 | 3300005563 | Ga0068855_100753013 | Ga0068855_1007530132 | 205 |
| 539 | 3300005564 | Ga0070664_100163850 | Ga0070664_1001638503 | 205 |
| 540 | 3300005564 | Ga0070664_100244117 | Ga0070664_1002441172 | 205 |
| 541 | 3300005615 | Ga0070702_100662645 | Ga0070702_1006626451 | 205 |
| 542 | 3300005616 | Ga0068852_100780153 | Ga0068852_1007801531 | 205 |
| 543 | 3300005617 | Ga0068859_100022886 | Ga0068859_1000228864 | 205 |
| 544 | 3300005719 | Ga0068861_100086770 | Ga0068861_1000867704 | 205 |
| 545 | 3300005841 | Ga0068863_100007967 | Ga0068863_10000796719 | 205 |
| 546 | 3300005842 | Ga0068858_100092563 | Ga0068858_1000925634 | 205 |
| 547 | 3300005843 | Ga0068860_100010603 | Ga0068860_10001060315 | 205 |
| 548 | 3300005843 | Ga0068860_100017144 | Ga0068860_1000171445 | 205 |
| 549 | 3300005844 | Ga0068862_100008330 | Ga0068862_10000833010 | 205 |
| 550 | 3300005937 | Ga0081455_10000328 | Ga0081455_1000032836 | 205 |
| 551 | 3300005937 | Ga0081455_10001697 | Ga0081455_1000169712 | 205 |
| 552 | 3300005937 | Ga0081455_10021927 | Ga0081455_100219272 | 205 |
| 553 | 3300005937 | Ga0081455_10063112 | Ga0081455_100631123 | 205 |
| 554 | 3300005937 | Ga0081455_10158887 | Ga0081455_101588872 | 205 |
| 555 | 3300005983 | Ga0081540_1000036 | Ga0081540_100003628 | 205 |
| 556 | 3300005983 | Ga0081540_1044314 | Ga0081540_10443144 | 205 |
| 557 | 3300005983 | Ga0081540_1095039 | Ga0081540_10950392 | 205 |
| 558 | 3300005985 | Ga0081539_10015406 | Ga0081539_100154065 | 205 |
| 559 | 3300006028 | Ga0070717_10254282 | Ga0070717_102542822 | 205 |
| 560 | 3300006028 | Ga0070717_10666151 | Ga0070717_106661512 | 205 |
| 561 | 3300006028 | Ga0070717_10684583 | Ga0070717_106845832 | 205 |
| 562 | 3300006163 | Ga0070715_10341462 | Ga0070715_103414621 | 205 |
| 563 | 3300006173 | Ga0070716_100036195 | Ga0070716_1000361954 | 205 |
| 564 | 3300006173 | Ga0070716_100041479 | Ga0070716_1000414793 | 205 |
| 565 | 3300006173 | Ga0070716_100254021 | Ga0070716_1002540212 | 205 |
| 566 | 3300006173 | Ga0070716_100264003 | Ga0070716_1002640032 | 205 |
| 567 | 3300006175 | Ga0070712_100050761 | Ga0070712_1000507612 | 205 |
| 568 | 3300006175 | Ga0070712_100163392 | Ga0070712_1001633922 | 205 |
| 569 | 3300006175 | Ga0070712_100712383 | Ga0070712_1007123832 | 205 |
| 570 | 3300006237 | Ga0097621_100031766 | Ga0097621_1000317664 | 205 |
| 571 | 3300006237 | Ga0097621_100281893 | Ga0097621_1002818932 | 205 |
| 572 | 3300006358 | Ga0068871_100129048 | Ga0068871_1001290484 | 205 |
| 573 | 3300006852 | Ga0075433_10212447 | Ga0075433_102124473 | 205 |
| 574 | 3300006881 | Ga0068865_100068978 | Ga0068865_1000689782 | 205 |
| 575 | 3300006881 | Ga0068865_100471370 | Ga0068865_1004713702 | 205 |
| 576 | 3300006931 | Ga0097620_100022886 | Ga0097620_1000228864 | 205 |
| 577 | 3300007076 | Ga0075435_100521424 | Ga0075435_1005214241 | 205 |
| 578 | 3300009098 | Ga0105245_10098347 | Ga0105245_100983472 | 205 |
| 579 | 3300009098 | Ga0105245_10365270 | Ga0105245_103652703 | 205 |
| 580 | 3300009098 | Ga0105245_10396933 | Ga0105245_103969333 | 205 |
| 581 | 3300009101 | Ga0105247_10064781 | Ga0105247_100647812 | 205 |
| 582 | 3300009147 | Ga0114129_10003445 | Ga0114129_1000344516 | 205 |
| 583 | 3300009147 | Ga0114129_10248724 | Ga0114129_102487243 | 205 |
| 584 | 3300009147 | Ga0114129_10609702 | Ga0114129_106097022 | 205 |
| 585 | 3300009148 | Ga0105243_10018077 | Ga0105243_100180779 | 205 |
| 586 | 3300009545 | Ga0105237_10074141 | Ga0105237_100741414 | 205 |
| 587 | 3300009553 | Ga0105249_10018684 | Ga0105249_100186845 | 205 |
| 588 | 3300009553 | Ga0105249_10074789 | Ga0105249_100747891 | 205 |
| 589 | 3300010159 | Ga0099796_10167614 | Ga0099796_101676142 | 205 |
| 590 | 3300010375 | Ga0105239_10038497 | Ga0105239_100384977 | 205 |
| 591 | 3300010375 | Ga0105239_10169916 | Ga0105239_101699163 | 205 |
| 592 | 3300011119 | Ga0105246_10475549 | Ga0105246_104755492 | 205 |
| 593 | 3300011119 | Ga0105246_10748933 | Ga0105246_107489332 | 205 |
| 594 | 3300013296 | Ga0157374_10018842 | Ga0157374_100188427 | 205 |
| 595 | 3300013296 | Ga0157374_10180939 | Ga0157374_101809393 | 205 |
| 596 | 3300013296 | Ga0157374_10221459 | Ga0157374_102214593 | 205 |
| 597 | 3300013296 | Ga0157374_10598674 | Ga0157374_105986742 | 205 |
| 598 | 3300013296 | Ga0157374_10728606 | Ga0157374_107286062 | 205 |
| 599 | 3300013296 | Ga0157374_11113292 | Ga0157374_111132921 | 205 |
| 600 | 3300013297 | Ga0157378_10057797 | Ga0157378_100577974 | 205 |
| 601 | 3300013297 | Ga0157378_10216017 | Ga0157378_102160172 | 205 |
| 602 | 3300013297 | Ga0157378_10534027 | Ga0157378_105340272 | 205 |
| 603 | 3300013297 | Ga0157378_10623515 | Ga0157378_106235152 | 205 |
| 604 | 3300013306 | Ga0163162_10002697 | Ga0163162_1000269715 | 205 |
| 605 | 3300013306 | Ga0163162_10014121 | Ga0163162_100141212 | 205 |
| 606 | 3300013306 | Ga0163162_10024438 | Ga0163162_100244387 | 205 |
| 607 | 3300013307 | Ga0157372_10045317 | Ga0157372_100453173 | 205 |
| 608 | 3300013307 | Ga0157372_10155739 | Ga0157372_101557393 | 205 |
| 609 | 3300013308 | Ga0157375_10089439 | Ga0157375_100894394 | 205 |
| 610 | 3300013308 | Ga0157375_10101429 | Ga0157375_101014292 | 205 |
| 611 | 3300014325 | Ga0163163_10106345 | Ga0163163_101063454 | 205 |
| 612 | 3300014325 | Ga0163163_10659116 | Ga0163163_106591162 | 205 |
| 613 | 3300014745 | Ga0157377_10077841 | Ga0157377_100778411 | 205 |
| 614 | 3300014968 | Ga0157379_10005647 | Ga0157379_100056474 | 205 |
| 615 | 3300014969 | Ga0157376_10020829 | Ga0157376_100208295 | 205 |
| 616 | 3300014969 | Ga0157376_10097176 | Ga0157376_100971763 | 205 |
| 617 | 3300014969 | Ga0157376_10966546 | Ga0157376_109665462 | 205 |
| 618 | 3300017792 | Ga0163161_10017041 | Ga0163161_100170414 | 205 |
| 619 | 3300017792 | Ga0163161_10381344 | Ga0163161_103813442 | 205 |
| 620 | 3300017792 | Ga0163161_10551356 | Ga0163161_105513561 | 205 |
| 621 | 3300025271 | Ga0207666_1002371 | Ga0207666_10023711 | 205 |
| 622 | 3300025290 | Ga0207673_1001361 | Ga0207673_10013612 | 205 |
| 623 | 3300025290 | Ga0207673_1007376 | Ga0207673_10073762 | 205 |
| 624 | 3300025315 | Ga0207697_10000131 | Ga0207697_1000013140 | 205 |
| 625 | 3300025315 | Ga0207697_10000495 | Ga0207697_100004952 | 205 |
| 626 | 3300025315 | Ga0207697_10001701 | Ga0207697_100017014 | 205 |
| 627 | 3300025315 | Ga0207697_10003343 | Ga0207697_100033437 | 205 |
| 628 | 3300025315 | Ga0207697_10003602 | Ga0207697_100036026 | 205 |
| 629 | 3300025893 | Ga0207682_10011464 | Ga0207682_100114644 | 205 |
| 630 | 3300025893 | Ga0207682_10143698 | Ga0207682_101436982 | 205 |
| 631 | 3300025898 | Ga0207692_10008534 | Ga0207692_100085344 | 205 |
| 632 | 3300025898 | Ga0207692_10205959 | Ga0207692_102059592 | 205 |
| 633 | 3300025901 | Ga0207688_10010727 | Ga0207688_100107277 | 205 |
| 634 | 3300025901 | Ga0207688_10054862 | Ga0207688_100548623 | 205 |
| 635 | 3300025901 | Ga0207688_10062026 | Ga0207688_100620262 | 205 |
| 636 | 3300025903 | Ga0207680_10166630 | Ga0207680_101666303 | 205 |
| 637 | 3300025904 | Ga0207647_10009265 | Ga0207647_100092655 | 205 |
| 638 | 3300025904 | Ga0207647_10048527 | Ga0207647_100485272 | 205 |
| 639 | 3300025905 | Ga0207685_10131690 | Ga0207685_101316902 | 205 |
| 640 | 3300025906 | Ga0207699_10004362 | Ga0207699_100043622 | 205 |
| 641 | 3300025906 | Ga0207699_10022105 | Ga0207699_100221051 | 205 |
| 642 | 3300025907 | Ga0207645_10001786 | Ga0207645_1000178624 | 205 |
| 643 | 3300025907 | Ga0207645_10002762 | Ga0207645_1000276219 | 205 |
| 644 | 3300025907 | Ga0207645_10004253 | Ga0207645_1000425315 | 205 |
| 645 | 3300025910 | Ga0207684_10018780 | Ga0207684_100187806 | 205 |
| 646 | 3300025910 | Ga0207684_10049861 | Ga0207684_100498612 | 205 |
| 647 | 3300025910 | Ga0207684_10160762 | Ga0207684_101607624 | 205 |
| 648 | 3300025910 | Ga0207684_10343629 | Ga0207684_103436292 | 205 |
| 649 | 3300025910 | Ga0207684_10371059 | Ga0207684_103710592 | 205 |
| 650 | 3300025910 | Ga0207684_10468236 | Ga0207684_104682362 | 205 |
| 651 | 3300025914 | Ga0207671_10183802 | Ga0207671_101838023 | 205 |
| 652 | 3300025915 | Ga0207693_10000889 | Ga0207693_1000088917 | 205 |
| 653 | 3300025915 | Ga0207693_10049459 | Ga0207693_100494593 | 205 |
| 654 | 3300025915 | Ga0207693_10187584 | Ga0207693_101875843 | 205 |
| 655 | 3300025915 | Ga0207693_10541698 | Ga0207693_105416982 | 205 |
| 656 | 3300025916 | Ga0207663_10002290 | Ga0207663_100022905 | 205 |
| 657 | 3300025916 | Ga0207663_10008643 | Ga0207663_100086434 | 205 |
| 658 | 3300025916 | Ga0207663_10023185 | Ga0207663_100231853 | 205 |
| 659 | 3300025916 | Ga0207663_10145505 | Ga0207663_101455053 | 205 |
| 660 | 3300025918 | Ga0207662_10000699 | Ga0207662_100006995 | 205 |
| 661 | 3300025919 | Ga0207657_10323849 | Ga0207657_103238493 | 205 |
| 662 | 3300025922 | Ga0207646_10000191 | Ga0207646_1000019132 | 205 |
| 663 | 3300025922 | Ga0207646_10010143 | Ga0207646_1001014316 | 205 |
| 664 | 3300025922 | Ga0207646_10014393 | Ga0207646_100143938 | 205 |
| 665 | 3300025922 | Ga0207646_10020049 | Ga0207646_100200494 | 205 |
| 666 | 3300025922 | Ga0207646_10340306 | Ga0207646_103403062 | 205 |
| 667 | 3300025922 | Ga0207646_10375822 | Ga0207646_103758221 | 205 |
| 668 | 3300025923 | Ga0207681_10011518 | Ga0207681_100115184 | 205 |
| 669 | 3300025923 | Ga0207681_10354239 | Ga0207681_103542391 | 205 |
| 670 | 3300025923 | Ga0207681_10481214 | Ga0207681_104812142 | 205 |
| 671 | 3300025925 | Ga0207650_10614732 | Ga0207650_106147321 | 205 |
| 672 | 3300025926 | Ga0207659_10005098 | Ga0207659_100050982 | 205 |
| 673 | 3300025926 | Ga0207659_10016965 | Ga0207659_100169653 | 205 |
| 674 | 3300025926 | Ga0207659_10254896 | Ga0207659_102548963 | 205 |
| 675 | 3300025927 | Ga0207687_10067835 | Ga0207687_100678354 | 205 |
| 676 | 3300025927 | Ga0207687_10442189 | Ga0207687_104421892 | 205 |
| 677 | 3300025928 | Ga0207700_10015667 | Ga0207700_100156674 | 205 |
| 678 | 3300025928 | Ga0207700_10048816 | Ga0207700_100488163 | 205 |
| 679 | 3300025928 | Ga0207700_10114187 | Ga0207700_101141873 | 205 |
| 680 | 3300025928 | Ga0207700_10243586 | Ga0207700_102435862 | 205 |
| 681 | 3300025929 | Ga0207664_10051382 | Ga0207664_100513822 | 205 |
| 682 | 3300025931 | Ga0207644_10054675 | Ga0207644_100546752 | 205 |
| 683 | 3300025931 | Ga0207644_10067172 | Ga0207644_100671724 | 205 |
| 684 | 3300025932 | Ga0207690_10002640 | Ga0207690_1000264010 | 205 |
| 685 | 3300025933 | Ga0207706_10022549 | Ga0207706_100225497 | 205 |
| 686 | 3300025933 | Ga0207706_10037590 | Ga0207706_100375904 | 205 |
| 687 | 3300025933 | Ga0207706_10074996 | Ga0207706_100749965 | 205 |
| 688 | 3300025933 | Ga0207706_10332854 | Ga0207706_103328542 | 205 |
| 689 | 3300025935 | Ga0207709_10197983 | Ga0207709_101979832 | 205 |
| 690 | 3300025936 | Ga0207670_10016878 | Ga0207670_100168784 | 205 |
| 691 | 3300025937 | Ga0207669_10069350 | Ga0207669_100693503 | 205 |
| 692 | 3300025938 | Ga0207704_10047899 | Ga0207704_100478994 | 205 |
| 693 | 3300025939 | Ga0207665_10054719 | Ga0207665_100547193 | 205 |
| 694 | 3300025939 | Ga0207665_10218229 | Ga0207665_102182293 | 205 |
| 695 | 3300025939 | Ga0207665_10275263 | Ga0207665_102752632 | 205 |
| 696 | 3300025940 | Ga0207691_10000247 | Ga0207691_1000024722 | 205 |
| 697 | 3300025940 | Ga0207691_10212905 | Ga0207691_102129052 | 205 |
| 698 | 3300025940 | Ga0207691_10221759 | Ga0207691_102217593 | 205 |
| 699 | 3300025945 | Ga0207679_10031450 | Ga0207679_100314503 | 205 |
| 700 | 3300025945 | Ga0207679_10744123 | Ga0207679_107441231 | 205 |
| 701 | 3300025960 | Ga0207651_10012073 | Ga0207651_100120734 | 205 |
| 702 | 3300025961 | Ga0207712_10114117 | Ga0207712_101141171 | 205 |
| 703 | 3300025972 | Ga0207668_10006260 | Ga0207668_100062604 | 205 |
| 704 | 3300025972 | Ga0207668_10017541 | Ga0207668_100175416 | 205 |
| 705 | 3300025972 | Ga0207668_10130077 | Ga0207668_101300774 | 205 |
| 706 | 3300025972 | Ga0207668_10145826 | Ga0207668_101458263 | 205 |
| 707 | 3300025972 | Ga0207668_10425105 | Ga0207668_104251052 | 205 |
| 708 | 3300025986 | Ga0207658_10010987 | Ga0207658_100109876 | 205 |
| 709 | 3300025986 | Ga0207658_10026613 | Ga0207658_100266137 | 205 |
| 710 | 3300025986 | Ga0207658_10267108 | Ga0207658_102671082 | 205 |
| 711 | 3300026023 | Ga0207677_10039629 | Ga0207677_100396294 | 205 |
| 712 | 3300026023 | Ga0207677_10073923 | Ga0207677_100739234 | 205 |
| 713 | 3300026023 | Ga0207677_10075096 | Ga0207677_100750964 | 205 |
| 714 | 3300026035 | Ga0207703_10601425 | Ga0207703_106014252 | 205 |
| 715 | 3300026041 | Ga0207639_10258886 | Ga0207639_102588862 | 205 |
| 716 | 3300026067 | Ga0207678_10040073 | Ga0207678_100400733 | 205 |
| 717 | 3300026075 | Ga0207708_10008844 | Ga0207708_100088443 | 205 |
| 718 | 3300026088 | Ga0207641_10218575 | Ga0207641_102185752 | 205 |
| 719 | 3300026089 | Ga0207648_10213801 | Ga0207648_102138013 | 205 |
| 720 | 3300026118 | Ga0207675_100064977 | Ga0207675_1000649774 | 205 |
| 721 | 3300026118 | Ga0207675_100132193 | Ga0207675_1001321932 | 205 |
| 722 | 3300026118 | Ga0207675_100382273 | Ga0207675_1003822732 | 205 |
| 723 | 3300026121 | Ga0207683_10051070 | Ga0207683_100510705 | 205 |
| 724 | 3300026121 | Ga0207683_10063965 | Ga0207683_100639652 | 205 |
| 725 | 3300027617 | Ga0210002_1024755 | Ga0210002_10247552 | 205 |
| 726 | 3300027717 | Ga0209998_10035192 | Ga0209998_100351922 | 205 |
| 727 | 3300027717 | Ga0209998_10040572 | Ga0209998_100405722 | 205 |
| 728 | 3300027876 | Ga0209974_10002731 | Ga0209974_1000273113 | 205 |
| 729 | 3300028379 | Ga0268266_10022713 | Ga0268266_100227134 | 205 |
| 730 | 3300028379 | Ga0268266_10081503 | Ga0268266_100815035 | 205 |
| 731 | 3300028379 | Ga0268266_10147129 | Ga0268266_101471291 | 205 |
| 732 | 3300028379 | Ga0268266_10227276 | Ga0268266_102272763 | 205 |
| 733 | 3300028380 | Ga0268265_10118795 | Ga0268265_101187952 | 205 |
| 734 | 3300028381 | Ga0268264_10052052 | Ga0268264_100520525 | 205 |
| 735 | 3300035088 | Ga0373940_0045843 | Ga0373940_0045843_564_1193 | 205 |
| 736 | 3300035089 | Ga0373944_0021902 | Ga0373944_0021902_113_730 | 205 |
| 737 | 3300035091 | Ga0373951_0088345 | Ga0373951_0088345_110_727 | 205 |
| 738 | 3300035116 | Ga0373945_0035084 | Ga0373945_0035084_150_767 | 205 |
| 739 | 3300035170 | Ga0373943_0032504 | Ga0373943_0032504_1532_2170 | 205 |
| 740 | 3300035170 | Ga0373943_0061880 | Ga0373943_0061880_46_663 | 205 |
| 741 | 3300035691 | Ga0373931_0015223 | Ga0373931_0015223_2091_2720 | 205 |
| 742 | 3300035691 | Ga0373931_0044383 | Ga0373931_0044383_113_730 | 205 |
| 743 | 3300035691 | Ga0373931_0051632 | Ga0373931_0051632_896_1534 | 205 |
| 744 | 3300035692 | Ga0373935_0034768 | Ga0373935_0034768_2359_2994 | 205 |
| 745 | 3300035692 | Ga0373935_0049700 | Ga0373935_0049700_515_1153 | 205 |
| 746 | 3300035692 | Ga0373935_0051886 | Ga0373935_0051886_1735_2352 | 205 |
| 747 | 3300035695 | Ga0373927_0010910 | Ga0373927_0010910_209_844 | 205 |
| 748 | 3300035695 | Ga0373927_0031272 | Ga0373927_0031272_1952_2569 | 205 |
| 749 | 3300035695 | Ga0373927_0453312 | Ga0373927_0453312_107_745 | 205 |
| 750 | 3300035695 | Ga0373927_0471573 | Ga0373927_0471573_108_746 | 205 |
| 751 | 3300035725 | Ga0373947_0007924 | Ga0373947_0007924_2183_2821 | 205 |
| 752 | 3300035725 | Ga0373947_0133507 | Ga0373947_0133507_413_1030 | 205 |
| 753 | 3300035725 | Ga0373947_0236510 | Ga0373947_0236510_328_966 | 205 |
| 754 | 3300037068 | Ga0373925_0078544 | Ga0373925_0078544_56_694 | 205 |
| 755 | 3300037068 | Ga0373925_0278365 | Ga0373925_0278365_316_951 | 205 |
| 756 | 3300037312 | Ga0395899_0040689 | Ga0395899_0040689_1553_2188 | 205 |
| 757 | 3300037418 | Ga0395900_0008031 | Ga0395900_0008031_9213_9848 | 205 |
| 758 | 3300037418 | Ga0395900_0118855 | Ga0395900_0118855_1865_2500 | 205 |
| 759 | 3300037418 | Ga0395900_0616758 | Ga0395900_0616758_239_874 | 205 |
| 760 | 3300037466 | Ga0395898_0036909 | Ga0395898_0036909_4026_4661 | 205 |
| 761 | 3300037466 | Ga0395898_1077831 | Ga0395898_1077831_90_725 | 205 |
| 762 | 3300038443 | Ga0395901_0002964 | Ga0395901_0002964_8890_9525 | 205 |
| 763 | 3300038443 | Ga0395901_0104360 | Ga0395901_0104360_1775_2419 | 205 |
| 764 | 3300042009 | Ga0439451_005465 | Ga0439451_005465_1340_1984 | 205 |
| 765 | 3300042012 | Ga0439455_0012285 | Ga0439455_0012285_110_748 | 205 |
| 766 | 3300042012 | Ga0439455_0108650 | Ga0439455_0108650_101_736 | 205 |
| 767 | 3300042439 | Ga0439464_0015733 | Ga0439464_0015733_585_1220 | 205 |
| 768 | 3300045051 | Ga0451576_0046345 | Ga0451576_0046345_2014_2658 | 205 |
| 769 | 3300045976 | Ga0466967_0373597 | Ga0466967_0373597_634_1293 | 205 |
| 770 | 3300046506 | Ga0495583_0193524 | Ga0495583_0193524_103_720 | 205 |
| 771 | 3300046518 | Ga0495631_0051981 | Ga0495631_0051981_987_1604 | 205 |
| 772 | 3300046528 | Ga0495642_0035028 | Ga0495642_0035028_1338_1955 | 205 |
| 773 | 3300046537 | Ga0495598_0010463 | Ga0495598_0010463_387_1004 | 205 |
| 774 | 3300046684 | Ga0495669_0010128 | Ga0495669_0010128_2380_2997 | 205 |
| 775 | 3300046689 | Ga0495613_0576303 | Ga0495613_0576303_60_695 | 205 |
| 776 | 3300047470 | Ga0495681_0041225 | Ga0495681_0041225_215_832 | 205 |
| 777 | 3300048903 | Ga0496100_0007185 | Ga0496100_0007185_3415_4053 | 205 |
| 778 | 3300048903 | Ga0496100_0122710 | Ga0496100_0122710_598_1233 | 205 |
| 779 | 3300048904 | Ga0496101_0004352 | Ga0496101_0004352_3785_4423 | 205 |
| 780 | 3300048904 | Ga0496101_0475029 | Ga0496101_0475029_262_897 | 205 |
| 781 | 3300048905 | Ga0496102_0103303 | Ga0496102_0103303_204_872 | 205 |
| 782 | 3300048905 | Ga0496102_0187224 | Ga0496102_0187224_82_699 | 205 |
| 783 | 3300048905 | Ga0496102_0202645 | Ga0496102_0202645_1079_1756 | 205 |
| 784 | 3300048905 | Ga0496102_0579595 | Ga0496102_0579595_191_844 | 205 |
| 785 | 3300048906 | Ga0496103_0002509 | Ga0496103_0002509_1715_2353 | 205 |
| 786 | 3300048907 | Ga0496104_0017573 | Ga0496104_0017573_5082_5717 | 205 |
| 787 | 3300048907 | Ga0496104_0121937 | Ga0496104_0121937_1448_2065 | 205 |
| 788 | 3300048907 | Ga0496104_0269348 | Ga0496104_0269348_834_1463 | 205 |
| 789 | 3300048907 | Ga0496104_0929627 | Ga0496104_0929627_73_708 | 205 |
| 790 | 3300048909 | Ga0496106_0003085 | Ga0496106_0003085_5927_6565 | 205 |
| 791 | 3300048909 | Ga0496106_0064483 | Ga0496106_0064483_1736_2353 | 205 |
| 792 | 3300048909 | Ga0496106_0211532 | Ga0496106_0211532_345_980 | 205 |
| 793 | 3300048910 | Ga0496107_0001730 | Ga0496107_0001730_4006_4644 | 205 |
| 794 | 3300048910 | Ga0496107_0026301 | Ga0496107_0026301_858_1526 | 205 |
| 795 | 3300048910 | Ga0496107_0034242 | Ga0496107_0034242_2235_2852 | 205 |
| 796 | 3300048910 | Ga0496107_0169099 | Ga0496107_0169099_10_651 | 205 |
| 797 | 3300048910 | Ga0496107_0541237 | Ga0496107_0541237_48_725 | 205 |
| 798 | 3300048911 | Ga0496108_0009866 | Ga0496108_0009866_3937_4614 | 205 |
| 799 | 3300048911 | Ga0496108_0113977 | Ga0496108_0113977_1556_2173 | 205 |
| 800 | 3300048911 | Ga0496108_0151522 | Ga0496108_0151522_1154_1795 | 205 |
| 801 | 3300048911 | Ga0496108_0219188 | Ga0496108_0219188_868_1497 | 205 |
| 802 | 3300048912 | Ga0496109_0007156 | Ga0496109_0007156_8347_8988 | 205 |
| 803 | 3300048912 | Ga0496109_0007242 | Ga0496109_0007242_3935_4612 | 205 |
| 804 | 3300048912 | Ga0496109_0362236 | Ga0496109_0362236_588_1205 | 205 |
| 805 | 3300048912 | Ga0496109_0695354 | Ga0496109_0695354_193_831 | 205 |
| 806 | 3300048913 | Ga0496110_0029638 | Ga0496110_0029638_1853_2521 | 205 |
| 807 | 3300048913 | Ga0496110_0228364 | Ga0496110_0228364_684_1337 | 205 |
| 808 | 3300048913 | Ga0496110_0479248 | Ga0496110_0479248_350_991 | 205 |
| 809 | 3300048914 | Ga0496111_0092502 | Ga0496111_0092502_1330_1998 | 205 |
| 810 | 3300048915 | Ga0496112_0022098 | Ga0496112_0022098_569_1246 | 205 |
| 811 | 3300048915 | Ga0496112_0060138 | Ga0496112_0060138_1467_2084 | 205 |
| 812 | 3300048915 | Ga0496112_0482204 | Ga0496112_0482204_96_713 | 205 |
| 813 | 3300048915 | Ga0496112_0614248 | Ga0496112_0614248_141_779 | 205 |
| 814 | 3300048916 | Ga0496113_0010988 | Ga0496113_0010988_1568_2245 | 205 |
| 815 | 3300048916 | Ga0496113_0192486 | Ga0496113_0192486_787_1422 | 205 |
| 816 | 3300048916 | Ga0496113_0437804 | Ga0496113_0437804_202_870 | 205 |
| 817 | 3300048917 | Ga0496114_0018633 | Ga0496114_0018633_3544_4182 | 205 |
| 818 | 3300048918 | Ga0496115_0002575 | Ga0496115_0002575_12029_12664 | 205 |
| 819 | 3300048918 | Ga0496115_0004314 | Ga0496115_0004314_1350_2003 | 205 |
| 820 | 3300048918 | Ga0496115_0009305 | Ga0496115_0009305_1384_2022 | 205 |
| 821 | 3300048918 | Ga0496115_0081369 | Ga0496115_0081369_78_695 | 205 |
| 822 | 3300048918 | Ga0496115_0239799 | Ga0496115_0239799_467_1108 | 205 |
| 823 | 3300050507 | nmdc:mga05p37_104793_c1 | nmdc:mga05p37_104793_c1_1039_1674 | 205 |
| 824 | 3300050507 | nmdc:mga05p37_3284_c1 | nmdc:mga05p37_3284_c1_3960_4595 | 205 |
| 825 | 3300050507 | nmdc:mga05p37_35285_c1 | nmdc:mga05p37_35285_c1_524_1162 | 205 |
| 826 | 3300050507 | nmdc:mga05p37_517419_c1 | nmdc:mga05p37_517419_c1_605_1240 | 205 |
| 827 | 3300050507 | nmdc:mga05p37_763753_c1 | nmdc:mga05p37_763753_c1_93_722 | 205 |
| 828 | 3300050511 | nmdc:mga08y16_410200_c1 | nmdc:mga08y16_410200_c1_273_902 | 205 |
| 829 | 3300050511 | nmdc:mga08y16_542313_c1 | nmdc:mga08y16_542313_c1_56_697 | 205 |
| 830 | 3300050512 | nmdc:mga0n895_451569_c1 | nmdc:mga0n895_451569_c1_251_889 | 205 |
| 831 | 3300050513 | nmdc:mga0rr50_371260_c1 | nmdc:mga0rr50_371260_c1_404_1039 | 205 |
| 832 | 3300050513 | nmdc:mga0rr50_405962_c1 | nmdc:mga0rr50_405962_c1_274_912 | 205 |
| 833 | 3300050513 | nmdc:mga0rr50_475436_c1 | nmdc:mga0rr50_475436_c1_358_993 | 205 |
| 834 | 3300050515 | nmdc:mga0a205_311920_c1 | nmdc:mga0a205_311920_c1_160_795 | 205 |
| 835 | 3300050515 | nmdc:mga0a205_348373_c1 | nmdc:mga0a205_348373_c1_588_1223 | 205 |
| 836 | 3300050515 | nmdc:mga0a205_476077_c1 | nmdc:mga0a205_476077_c1_223_858 | 205 |
| 837 | 3300050515 | nmdc:mga0a205_655097_c1 | nmdc:mga0a205_655097_c1_236_871 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9235 | 95 | 201 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9225 | 93 | 201 |
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8209 | 11 | 201 |
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.805 | 11 | 201 |
| 1dmg-assembly1.cif.gz_A | crystal structure of ribosomal protein l4 | 0.8022 | 90 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.8022 | 90 | 201 | 3.40.1370.10 |
| af_P60723_1_201_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7228 | 13 | 201 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7167 | 15 | 205 | 3.40.1370.10 |
| af_Q10NM5_49_283_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7136 | 24 | 205 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7134 | 13 | 199 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q6X306-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.984 | 95 | 205 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1G3Z2J8-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9617 | 94 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A536U9H5-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.954 | 96 | 201 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1G3Z2J8-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9451 | 94 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3D2KWG5-F1-model_v4 | deleted | 0.9428 | 108 | 199 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar