F482941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 837 | 229 | 837 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10198134|Ga0307413_101981341 |
| Length | 357 |
| Sequence | LDPDRIAHMTTPWGLPDFDAHEDLHFIDDEKCGLKAIIAVHSTHLGPAAGGARFWHYAEDAEAVTDALRLSRGMSYKNAMAGLPLGGGKSVILAPAERTKSPDLLHAFGKAVDHLGGRYVTAEDVGMSVADMIEVRRSTRFVAGLPNSGSDVGGDPGPHTSLGVFLGIKAAVKRALGKDDVAGLHIAVQGAGSVATGVALHSAAEGARLSIADVDQAKAKKLADATGGNVVAPDDILTIEADVVSPNALGAILNEQTIASLNTPIVAGGANNQLATAQDGARLQQRGILYAPDYVINAGGIINVCTEYLGDGDASLVRRRIEGIPVRLEQIWAESETSGRDPASVADAMAQRLIGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 184 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 213 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 214 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 215 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 217 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 221 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 223 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 224 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 225 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 228 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 3.11 |
| Rhizosphere | 95.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1007340 | 3300001904 | Bacteria | 1853 |
| 2 | JGI24741J21665_1007685 | 3300001915 | Bacteria | 2079 |
| 3 | JGI24740J21852_10003460 | 3300001979 | Bacteria | 6935 |
| 4 | JGI24740J21852_10003889 | 3300001979 | Bacteria | 6483 |
| 5 | JGI24739J22299_10000218 | 3300001989 | Bacteria | 19232 |
| 6 | JGI24739J22299_10001372 | 3300001989 | Bacteria | 9140 |
| 7 | JGI24739J22299_10014854 | 3300001989 | Bacteria | 2831 |
| 8 | JGI24737J22298_10006943 | 3300001990 | Bacteria | 3841 |
| 9 | JGI24737J22298_10021448 | 3300001990 | Bacteria | 2059 |
| 10 | JGI24735J21928_10009988 | 3300002067 | Bacteria | 3038 |
| 11 | JGI24735J21928_10011025 | 3300002067 | Bacteria | 2871 |
| 12 | JGI24738J21930_10007099 | 3300002075 | Bacteria | 2600 |
| 13 | JGI24738J21930_10009853 | 3300002075 | Bacteria | 2141 |
| 14 | Ga0065712_10010017 | 3300005290 | Bacteria | 2214 |
| 15 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 16 | Ga0070658_10000426 | 3300005327 | Bacteria | 36543 |
| 17 | Ga0070658_10001369 | 3300005327 | Bacteria | 20845 |
| 18 | Ga0070658_10015608 | 3300005327 | Bacteria | 6074 |
| 19 | Ga0070658_10020672 | 3300005327 | Bacteria | 5273 |
| 20 | Ga0070658_10031474 | 3300005327 | Bacteria | 4260 |
| 21 | Ga0070658_10047146 | 3300005327 | Bacteria | 3487 |
| 22 | Ga0070658_10058028 | 3300005327 | Bacteria | 3149 |
| 23 | Ga0070658_10058443 | 3300005327 | Bacteria | 3139 |
| 24 | Ga0070658_10094141 | 3300005327 | Bacteria | 2471 |
| 25 | Ga0070676_10013539 | 3300005328 | Bacteria | 4471 |
| 26 | Ga0070676_10030697 | 3300005328 | Bacteria | 3067 |
| 27 | Ga0070676_10035989 | 3300005328 | Bacteria | 2850 |
| 28 | Ga0070676_10197552 | 3300005328 | Bacteria | 1317 |
| 29 | Ga0070683_100014521 | 3300005329 | Bacteria | 6892 |
| 30 | Ga0070683_100034542 | 3300005329 | Bacteria | 4620 |
| 31 | Ga0070683_100042584 | 3300005329 | Bacteria | 4182 |
| 32 | Ga0070683_100053839 | 3300005329 | Bacteria | 3729 |
| 33 | Ga0070683_100058792 | 3300005329 | Bacteria | 3571 |
| 34 | Ga0070690_100009606 | 3300005330 | Bacteria | 5609 |
| 35 | Ga0070690_100013058 | 3300005330 | Bacteria | 4901 |
| 36 | Ga0070670_100000600 | 3300005331 | Bacteria | 28387 |
| 37 | Ga0070670_100016348 | 3300005331 | Bacteria | 6372 |
| 38 | Ga0070670_100020985 | 3300005331 | Bacteria | 5617 |
| 39 | Ga0070670_100024180 | 3300005331 | Bacteria | 5227 |
| 40 | Ga0070670_100030156 | 3300005331 | Bacteria | 4671 |
| 41 | Ga0070670_100084867 | 3300005331 | Bacteria | 2721 |
| 42 | Ga0070670_100157626 | 3300005331 | Bacteria | 1967 |
| 43 | Ga0070677_10000470 | 3300005333 | Bacteria | 13787 |
| 44 | Ga0070677_10000735 | 3300005333 | Bacteria | 10923 |
| 45 | Ga0070677_10007431 | 3300005333 | Bacteria | 3656 |
| 46 | Ga0070666_10000527 | 3300005335 | Bacteria | 23198 |
| 47 | Ga0070666_10000731 | 3300005335 | Bacteria | 19890 |
| 48 | Ga0070666_10002935 | 3300005335 | Bacteria | 10315 |
| 49 | Ga0070666_10004646 | 3300005335 | Bacteria | 8385 |
| 50 | Ga0070680_100000455 | 3300005336 | Bacteria | 27823 |
| 51 | Ga0070680_100001350 | 3300005336 | Bacteria | 17748 |
| 52 | Ga0070680_100005439 | 3300005336 | Bacteria | 9638 |
| 53 | Ga0070680_100008690 | 3300005336 | Bacteria | 7784 |
| 54 | Ga0070680_100027597 | 3300005336 | Bacteria | 4546 |
| 55 | Ga0070680_100145463 | 3300005336 | Bacteria | 1988 |
| 56 | Ga0070682_100011412 | 3300005337 | Bacteria | 5076 |
| 57 | Ga0068868_100001563 | 3300005338 | Bacteria | 15617 |
| 58 | Ga0068868_100002334 | 3300005338 | Bacteria | 13125 |
| 59 | Ga0068868_100008603 | 3300005338 | Bacteria | 7310 |
| 60 | Ga0070660_100000055 | 3300005339 | Bacteria | 67100 |
| 61 | Ga0070660_100000196 | 3300005339 | Bacteria | 40291 |
| 62 | Ga0070660_100000441 | 3300005339 | Bacteria | 27579 |
| 63 | Ga0070660_100003142 | 3300005339 | Bacteria | 11347 |
| 64 | Ga0070660_100005952 | 3300005339 | Bacteria | 8432 |
| 65 | Ga0070660_100028221 | 3300005339 | Bacteria | 4197 |
| 66 | Ga0070660_100033897 | 3300005339 | Bacteria | 3853 |
| 67 | Ga0070660_100068737 | 3300005339 | Bacteria | 2761 |
| 68 | Ga0070691_10005536 | 3300005341 | Bacteria | 5747 |
| 69 | Ga0070687_100028974 | 3300005343 | Bacteria | 2691 |
| 70 | Ga0070661_100000112 | 3300005344 | Bacteria | 67887 |
| 71 | Ga0070661_100011135 | 3300005344 | Bacteria | 6264 |
| 72 | Ga0070661_100024211 | 3300005344 | Bacteria | 4354 |
| 73 | Ga0070661_100028151 | 3300005344 | Bacteria | 4052 |
| 74 | Ga0070661_100034264 | 3300005344 | Bacteria | 3682 |
| 75 | Ga0070661_100273782 | 3300005344 | Bacteria | 1308 |
| 76 | Ga0070668_100000910 | 3300005347 | Bacteria | 20612 |
| 77 | Ga0070668_100006467 | 3300005347 | Bacteria | 8687 |
| 78 | Ga0070668_100146793 | 3300005347 | Bacteria | 1904 |
| 79 | Ga0070669_100000937 | 3300005353 | Bacteria | 21274 |
| 80 | Ga0070669_100006302 | 3300005353 | Bacteria | 8552 |
| 81 | Ga0070669_100033628 | 3300005353 | Bacteria | 3709 |
| 82 | Ga0070669_100046775 | 3300005353 | Bacteria | 3155 |
| 83 | Ga0070675_100001185 | 3300005354 | Bacteria | 18941 |
| 84 | Ga0070675_100007982 | 3300005354 | Bacteria | 8201 |
| 85 | Ga0070675_100009299 | 3300005354 | Bacteria | 7641 |
| 86 | Ga0070671_100000190 | 3300005355 | Bacteria | 41368 |
| 87 | Ga0070671_100001894 | 3300005355 | Bacteria | 15993 |
| 88 | Ga0070671_100005756 | 3300005355 | Bacteria | 9873 |
| 89 | Ga0070671_100008115 | 3300005355 | Bacteria | 8409 |
| 90 | Ga0070671_100012610 | 3300005355 | Bacteria | 6810 |
| 91 | Ga0070671_100022674 | 3300005355 | Bacteria | 5129 |
| 92 | Ga0070671_100032862 | 3300005355 | Bacteria | 4289 |
| 93 | Ga0070671_100037062 | 3300005355 | Bacteria | 4044 |
| 94 | Ga0070674_100009591 | 3300005356 | Bacteria | 5801 |
| 95 | Ga0070674_100027796 | 3300005356 | Bacteria | 3710 |
| 96 | Ga0070674_100038592 | 3300005356 | Bacteria | 3219 |
| 97 | Ga0070674_100039714 | 3300005356 | Bacteria | 3179 |
| 98 | Ga0070674_100081424 | 3300005356 | Bacteria | 2314 |
| 99 | Ga0070673_100004514 | 3300005364 | Bacteria | 8810 |
| 100 | Ga0070673_100016722 | 3300005364 | Bacteria | 5197 |
| 101 | Ga0070673_100040011 | 3300005364 | Bacteria | 3593 |
| 102 | Ga0070673_100040329 | 3300005364 | Bacteria | 3581 |
| 103 | Ga0070673_100050239 | 3300005364 | Bacteria | 3260 |
| 104 | Ga0070673_100167857 | 3300005364 | Bacteria | 1871 |
| 105 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 106 | Ga0070659_100000295 | 3300005366 | Bacteria | 39046 |
| 107 | Ga0070659_100005980 | 3300005366 | Bacteria | 8772 |
| 108 | Ga0070659_100031126 | 3300005366 | Bacteria | 4132 |
| 109 | Ga0070659_100035310 | 3300005366 | Bacteria | 3893 |
| 110 | Ga0070659_100054904 | 3300005366 | Bacteria | 3138 |
| 111 | Ga0070659_100069514 | 3300005366 | Bacteria | 2795 |
| 112 | Ga0070659_100188507 | 3300005366 | Bacteria | 1695 |
| 113 | Ga0070667_100001536 | 3300005367 | Bacteria | 20668 |
| 114 | Ga0070667_100007857 | 3300005367 | Bacteria | 8846 |
| 115 | Ga0070667_100012023 | 3300005367 | Bacteria | 7165 |
| 116 | Ga0070667_100024176 | 3300005367 | Bacteria | 5046 |
| 117 | Ga0070667_100047454 | 3300005367 | Bacteria | 3613 |
| 118 | Ga0070667_100127810 | 3300005367 | Bacteria | 2216 |
| 119 | Ga0070667_100139951 | 3300005367 | Bacteria | 2118 |
| 120 | Ga0070667_100229598 | 3300005367 | Bacteria | 1654 |
| 121 | Ga0070709_10010514 | 3300005434 | Bacteria | 5127 |
| 122 | Ga0070714_100025773 | 3300005435 | Bacteria | 4856 |
| 123 | Ga0070714_100069564 | 3300005435 | Bacteria | 3041 |
| 124 | Ga0070714_100111912 | 3300005435 | Bacteria | 2418 |
| 125 | Ga0070714_100289642 | 3300005435 | Bacteria | 1524 |
| 126 | Ga0070713_100010126 | 3300005436 | Bacteria | 6799 |
| 127 | Ga0070713_100086864 | 3300005436 | Bacteria | 2683 |
| 128 | Ga0070713_100148263 | 3300005436 | Bacteria | 2084 |
| 129 | Ga0070694_100033313 | 3300005444 | Bacteria | 3390 |
| 130 | Ga0070663_100000130 | 3300005455 | Bacteria | 35749 |
| 131 | Ga0070663_100010112 | 3300005455 | Bacteria | 5869 |
| 132 | Ga0070663_100064756 | 3300005455 | Bacteria | 2643 |
| 133 | Ga0070678_100058163 | 3300005456 | Bacteria | 2837 |
| 134 | Ga0070678_100078439 | 3300005456 | Bacteria | 2495 |
| 135 | Ga0070662_100000115 | 3300005457 | Bacteria | 44962 |
| 136 | Ga0070662_100001246 | 3300005457 | Bacteria | 15625 |
| 137 | Ga0070662_100003210 | 3300005457 | Bacteria | 10163 |
| 138 | Ga0070662_100007707 | 3300005457 | Bacteria | 6987 |
| 139 | Ga0070662_100008681 | 3300005457 | Bacteria | 6627 |
| 140 | Ga0070662_100057048 | 3300005457 | Bacteria | 2837 |
| 141 | Ga0070662_100060965 | 3300005457 | Bacteria | 2753 |
| 142 | Ga0070662_100159844 | 3300005457 | Bacteria | 1761 |
| 143 | Ga0070662_100185634 | 3300005457 | Bacteria | 1642 |
| 144 | Ga0070681_10020816 | 3300005458 | Bacteria | 6569 |
| 145 | Ga0070681_10173349 | 3300005458 | Bacteria | 2079 |
| 146 | Ga0070681_10293180 | 3300005458 | Bacteria | 1537 |
| 147 | Ga0068867_100017080 | 3300005459 | Bacteria | 5155 |
| 148 | Ga0068867_100019242 | 3300005459 | Bacteria | 4866 |
| 149 | Ga0068867_100020911 | 3300005459 | Bacteria | 4667 |
| 150 | Ga0068867_100228984 | 3300005459 | Bacteria | 1501 |
| 151 | Ga0070685_10214598 | 3300005466 | Bacteria | 1258 |
| 152 | Ga0070679_100085003 | 3300005530 | Bacteria | 3151 |
| 153 | Ga0070679_100088611 | 3300005530 | Bacteria | 3082 |
| 154 | Ga0070679_100103498 | 3300005530 | Bacteria | 2833 |
| 155 | Ga0070679_100148260 | 3300005530 | Bacteria | 2323 |
| 156 | Ga0070684_100004039 | 3300005535 | Bacteria | 11106 |
| 157 | Ga0070684_100005057 | 3300005535 | Bacteria | 10068 |
| 158 | Ga0070684_100013064 | 3300005535 | Bacteria | 6682 |
| 159 | Ga0070684_100170801 | 3300005535 | Bacteria | 1975 |
| 160 | Ga0070684_100197560 | 3300005535 | Bacteria | 1832 |
| 161 | Ga0068853_100001932 | 3300005539 | Bacteria | 15277 |
| 162 | Ga0068853_100004667 | 3300005539 | Bacteria | 10623 |
| 163 | Ga0068853_100007042 | 3300005539 | Bacteria | 8989 |
| 164 | Ga0068853_100016077 | 3300005539 | Bacteria | 6154 |
| 165 | Ga0068853_100043798 | 3300005539 | Bacteria | 3829 |
| 166 | Ga0068853_100272269 | 3300005539 | Bacteria | 1559 |
| 167 | Ga0068853_100278189 | 3300005539 | Bacteria | 1543 |
| 168 | Ga0070672_100012803 | 3300005543 | Bacteria | 5906 |
| 169 | Ga0070672_100047767 | 3300005543 | Bacteria | 3323 |
| 170 | Ga0070672_100082362 | 3300005543 | Bacteria | 2581 |
| 171 | Ga0070672_100150860 | 3300005543 | Bacteria | 1923 |
| 172 | Ga0070672_100181029 | 3300005543 | Bacteria | 1756 |
| 173 | Ga0070686_100000281 | 3300005544 | Bacteria | 34343 |
| 174 | Ga0070686_100053895 | 3300005544 | Bacteria | 2571 |
| 175 | Ga0070695_100027094 | 3300005545 | Bacteria | 3548 |
| 176 | Ga0070696_100045559 | 3300005546 | Bacteria | 3039 |
| 177 | Ga0070665_100003880 | 3300005548 | Bacteria | 15795 |
| 178 | Ga0070665_100004751 | 3300005548 | Bacteria | 14142 |
| 179 | Ga0070665_100011278 | 3300005548 | Bacteria | 9039 |
| 180 | Ga0070665_100015253 | 3300005548 | Bacteria | 7715 |
| 181 | Ga0070665_100018136 | 3300005548 | Bacteria | 7061 |
| 182 | Ga0070665_100174154 | 3300005548 | Bacteria | 2152 |
| 183 | Ga0068855_100000408 | 3300005563 | Bacteria | 53275 |
| 184 | Ga0068855_100006972 | 3300005563 | Bacteria | 13716 |
| 185 | Ga0068855_100036336 | 3300005563 | Bacteria | 5864 |
| 186 | Ga0068855_100099684 | 3300005563 | Bacteria | 3346 |
| 187 | Ga0068855_100100029 | 3300005563 | Bacteria | 3339 |
| 188 | Ga0068855_100108130 | 3300005563 | Bacteria | 3194 |
| 189 | Ga0068855_100144125 | 3300005563 | Bacteria | 2713 |
| 190 | Ga0068855_100350056 | 3300005563 | Bacteria | 1627 |
| 191 | Ga0068855_100466778 | 3300005563 | Bacteria | 1375 |
| 192 | Ga0070664_100000933 | 3300005564 | Bacteria | 22833 |
| 193 | Ga0070664_100001273 | 3300005564 | Bacteria | 20170 |
| 194 | Ga0070664_100003183 | 3300005564 | Bacteria | 13263 |
| 195 | Ga0070664_100025114 | 3300005564 | Bacteria | 4936 |
| 196 | Ga0070664_100052610 | 3300005564 | Bacteria | 3449 |
| 197 | Ga0070664_100054090 | 3300005564 | Bacteria | 3405 |
| 198 | Ga0070664_100065205 | 3300005564 | Bacteria | 3107 |
| 199 | Ga0068857_100005434 | 3300005577 | Bacteria | 10864 |
| 200 | Ga0068857_100032781 | 3300005577 | Bacteria | 4592 |
| 201 | Ga0068857_100033106 | 3300005577 | Bacteria | 4570 |
| 202 | Ga0068857_100035069 | 3300005577 | Bacteria | 4441 |
| 203 | Ga0068857_100148158 | 3300005577 | Bacteria | 2125 |
| 204 | Ga0068857_100171145 | 3300005577 | Bacteria | 1974 |
| 205 | Ga0068857_100213457 | 3300005577 | Bacteria | 1761 |
| 206 | Ga0068857_100391771 | 3300005577 | Bacteria | 1292 |
| 207 | Ga0068854_100005000 | 3300005578 | Bacteria | 8360 |
| 208 | Ga0068854_100006255 | 3300005578 | Bacteria | 7564 |
| 209 | Ga0068854_100016820 | 3300005578 | Bacteria | 4882 |
| 210 | Ga0068854_100048190 | 3300005578 | Bacteria | 3039 |
| 211 | Ga0068854_100056441 | 3300005578 | Bacteria | 2830 |
| 212 | Ga0068856_100000085 | 3300005614 | Bacteria | 87665 |
| 213 | Ga0068856_100030461 | 3300005614 | Bacteria | 5274 |
| 214 | Ga0068856_100031930 | 3300005614 | Bacteria | 5153 |
| 215 | Ga0068856_100090096 | 3300005614 | Bacteria | 3051 |
| 216 | Ga0068856_100116671 | 3300005614 | Bacteria | 2670 |
| 217 | Ga0068856_100144965 | 3300005614 | Bacteria | 2382 |
| 218 | Ga0068856_100181733 | 3300005614 | Bacteria | 2116 |
| 219 | Ga0068852_100001072 | 3300005616 | Bacteria | 18069 |
| 220 | Ga0068852_100001549 | 3300005616 | Bacteria | 15604 |
| 221 | Ga0068852_100001798 | 3300005616 | Bacteria | 14550 |
| 222 | Ga0068852_100018575 | 3300005616 | Bacteria | 5480 |
| 223 | Ga0068852_100025907 | 3300005616 | Bacteria | 4759 |
| 224 | Ga0068852_100027253 | 3300005616 | Bacteria | 4656 |
| 225 | Ga0068852_100028205 | 3300005616 | Bacteria | 4590 |
| 226 | Ga0068859_100016908 | 3300005617 | Bacteria | 7322 |
| 227 | Ga0068859_100097212 | 3300005617 | Bacteria | 2998 |
| 228 | Ga0068859_100108682 | 3300005617 | Bacteria | 2835 |
| 229 | Ga0068859_100301527 | 3300005617 | Bacteria | 1695 |
| 230 | Ga0068864_100008279 | 3300005618 | Bacteria | 8577 |
| 231 | Ga0068864_100039352 | 3300005618 | Bacteria | 4042 |
| 232 | Ga0068864_100049860 | 3300005618 | Bacteria | 3602 |
| 233 | Ga0068864_100073084 | 3300005618 | Bacteria | 2990 |
| 234 | Ga0068861_100034590 | 3300005719 | Bacteria | 3737 |
| 235 | Ga0068851_10044841 | 3300005834 | Bacteria | 2234 |
| 236 | Ga0068851_10060532 | 3300005834 | Bacteria | 1939 |
| 237 | Ga0068870_10156654 | 3300005840 | Bacteria | 1347 |
| 238 | Ga0068863_100002819 | 3300005841 | Bacteria | 17213 |
| 239 | Ga0068863_100007439 | 3300005841 | Bacteria | 10717 |
| 240 | Ga0068863_100180412 | 3300005841 | Bacteria | 2026 |
| 241 | Ga0068858_100003796 | 3300005842 | Bacteria | 14940 |
| 242 | Ga0068858_100029127 | 3300005842 | Bacteria | 5126 |
| 243 | Ga0068858_100039770 | 3300005842 | Bacteria | 4360 |
| 244 | Ga0068860_100008637 | 3300005843 | Bacteria | 10152 |
| 245 | Ga0068860_100146327 | 3300005843 | Bacteria | 2274 |
| 246 | Ga0070717_10011863 | 3300006028 | Bacteria | 6630 |
| 247 | Ga0070717_10021920 | 3300006028 | Bacteria | 5040 |
| 248 | Ga0070716_100036695 | 3300006173 | Bacteria | 2704 |
| 249 | Ga0070716_100164059 | 3300006173 | Bacteria | 1443 |
| 250 | Ga0097621_100175142 | 3300006237 | Bacteria | 1851 |
| 251 | Ga0068871_100012040 | 3300006358 | Bacteria | 6366 |
| 252 | Ga0068871_100084649 | 3300006358 | Bacteria | 2632 |
| 253 | Ga0075431_100120466 | 3300006847 | Bacteria | 2707 |
| 254 | Ga0075429_100220344 | 3300006880 | Bacteria | 1662 |
| 255 | Ga0068865_100003264 | 3300006881 | Bacteria | 9710 |
| 256 | Ga0068865_100062802 | 3300006881 | Bacteria | 2608 |
| 257 | Ga0097620_100016909 | 3300006931 | Bacteria | 7322 |
| 258 | Ga0097620_100097212 | 3300006931 | Bacteria | 2998 |
| 259 | Ga0097620_100108684 | 3300006931 | Bacteria | 2835 |
| 260 | Ga0097620_100301536 | 3300006931 | Bacteria | 1695 |
| 261 | Ga0105240_10024566 | 3300009093 | Bacteria | 7942 |
| 262 | Ga0105240_10036008 | 3300009093 | Bacteria | 6373 |
| 263 | Ga0105240_10044793 | 3300009093 | Bacteria | 5617 |
| 264 | Ga0111539_10017870 | 3300009094 | Bacteria | 8782 |
| 265 | Ga0105245_10002347 | 3300009098 | Bacteria | 17117 |
| 266 | Ga0105245_10020115 | 3300009098 | Bacteria | 5851 |
| 267 | Ga0105243_10081004 | 3300009148 | Bacteria | 2650 |
| 268 | Ga0105241_10096072 | 3300009174 | Bacteria | 2347 |
| 269 | Ga0105248_10000059 | 3300009177 | Bacteria | 137176 |
| 270 | Ga0105248_10000268 | 3300009177 | Bacteria | 61070 |
| 271 | Ga0105248_10002245 | 3300009177 | Bacteria | 21383 |
| 272 | Ga0105248_10002563 | 3300009177 | Bacteria | 20234 |
| 273 | Ga0105248_10003138 | 3300009177 | Bacteria | 18284 |
| 274 | Ga0105248_10003624 | 3300009177 | Bacteria | 17137 |
| 275 | Ga0105248_10060278 | 3300009177 | Bacteria | 4260 |
| 276 | Ga0105248_10197090 | 3300009177 | Bacteria | 2269 |
| 277 | Ga0105248_10223559 | 3300009177 | Bacteria | 2119 |
| 278 | Ga0105248_10430073 | 3300009177 | Bacteria | 1487 |
| 279 | Ga0105237_10019163 | 3300009545 | Bacteria | 7069 |
| 280 | Ga0105237_10023803 | 3300009545 | Bacteria | 6269 |
| 281 | Ga0105238_10007012 | 3300009551 | Bacteria | 11270 |
| 282 | Ga0105238_10059870 | 3300009551 | Bacteria | 3814 |
| 283 | Ga0105238_10197792 | 3300009551 | Bacteria | 1986 |
| 284 | Ga0105249_10036981 | 3300009553 | Bacteria | 4429 |
| 285 | Ga0105239_10137250 | 3300010375 | Bacteria | 2723 |
| 286 | Ga0105239_10296507 | 3300010375 | Bacteria | 1821 |
| 287 | Ga0157373_10010181 | 3300013100 | Bacteria | 6925 |
| 288 | Ga0157373_10021754 | 3300013100 | Bacteria | 4654 |
| 289 | Ga0157373_10053459 | 3300013100 | Bacteria | 2872 |
| 290 | Ga0157373_10078625 | 3300013100 | Bacteria | 2326 |
| 291 | Ga0157373_10086074 | 3300013100 | Bacteria | 2215 |
| 292 | Ga0157371_10000867 | 3300013102 | Bacteria | 34332 |
| 293 | Ga0157371_10001960 | 3300013102 | Bacteria | 20442 |
| 294 | Ga0157371_10014338 | 3300013102 | Bacteria | 5985 |
| 295 | Ga0157371_10034117 | 3300013102 | Bacteria | 3652 |
| 296 | Ga0157371_10040453 | 3300013102 | Bacteria | 3329 |
| 297 | Ga0157371_10174535 | 3300013102 | Bacteria | 1536 |
| 298 | Ga0157370_10000630 | 3300013104 | Bacteria | 43948 |
| 299 | Ga0157370_10013534 | 3300013104 | Bacteria | 8400 |
| 300 | Ga0157370_10018538 | 3300013104 | Bacteria | 6997 |
| 301 | Ga0157370_10047396 | 3300013104 | Bacteria | 4120 |
| 302 | Ga0157370_10242700 | 3300013104 | Bacteria | 1667 |
| 303 | Ga0157369_10007451 | 3300013105 | Bacteria | 12603 |
| 304 | Ga0157369_10014853 | 3300013105 | Bacteria | 8789 |
| 305 | Ga0157369_10015742 | 3300013105 | Bacteria | 8521 |
| 306 | Ga0157369_10023345 | 3300013105 | Bacteria | 6890 |
| 307 | Ga0157369_10063082 | 3300013105 | Bacteria | 3993 |
| 308 | Ga0157369_10081837 | 3300013105 | Bacteria | 3455 |
| 309 | Ga0157369_10129649 | 3300013105 | Bacteria | 2673 |
| 310 | Ga0157369_10135688 | 3300013105 | Bacteria | 2605 |
| 311 | Ga0157369_10163360 | 3300013105 | Bacteria | 2349 |
| 312 | Ga0157374_10004825 | 3300013296 | Bacteria | 11314 |
| 313 | Ga0157374_10075159 | 3300013296 | Bacteria | 3193 |
| 314 | Ga0157374_10462045 | 3300013296 | Bacteria | 1271 |
| 315 | Ga0157378_10024998 | 3300013297 | Bacteria | 5260 |
| 316 | Ga0163162_10619920 | 3300013306 | Bacteria | 1207 |
| 317 | Ga0157372_10016133 | 3300013307 | Bacteria | 8015 |
| 318 | Ga0157372_10039241 | 3300013307 | Bacteria | 5226 |
| 319 | Ga0157372_10148324 | 3300013307 | Bacteria | 2705 |
| 320 | Ga0157375_10023649 | 3300013308 | Bacteria | 5673 |
| 321 | Ga0157375_10104424 | 3300013308 | Bacteria | 2922 |
| 322 | Ga0157375_10538091 | 3300013308 | Bacteria | 1331 |
| 323 | Ga0157380_10026688 | 3300014326 | Bacteria | 4387 |
| 324 | Ga0157380_10044724 | 3300014326 | Bacteria | 3471 |
| 325 | Ga0157379_10003799 | 3300014968 | Bacteria | 12865 |
| 326 | Ga0157376_10057055 | 3300014969 | Bacteria | 3265 |
| 327 | Ga0163161_10027464 | 3300017792 | Bacteria | 4037 |
| 328 | Ga0163161_10173180 | 3300017792 | Bacteria | 1651 |
| 329 | Ga0163161_10362251 | 3300017792 | Bacteria | 1155 |
| 330 | Ga0206353_10967685 | 3300020082 | Bacteria | 2064 |
| 331 | Ga0213876_10000766 | 3300021384 | Bacteria | 22166 |
| 332 | Ga0213876_10015041 | 3300021384 | Bacteria | 4101 |
| 333 | Ga0207697_10002577 | 3300025315 | Bacteria | 9335 |
| 334 | Ga0207697_10050035 | 3300025315 | Bacteria | 1725 |
| 335 | Ga0207697_10060294 | 3300025315 | Bacteria | 1578 |
| 336 | Ga0207656_10037955 | 3300025321 | Bacteria | 2030 |
| 337 | Ga0207682_10000618 | 3300025893 | Bacteria | 16543 |
| 338 | Ga0207682_10002976 | 3300025893 | Bacteria | 7434 |
| 339 | Ga0207682_10007641 | 3300025893 | Bacteria | 4302 |
| 340 | Ga0207682_10008265 | 3300025893 | Bacteria | 4122 |
| 341 | Ga0207688_10000353 | 3300025901 | Bacteria | 21377 |
| 342 | Ga0207688_10034421 | 3300025901 | Bacteria | 2805 |
| 343 | Ga0207688_10042578 | 3300025901 | Bacteria | 2528 |
| 344 | Ga0207680_10000491 | 3300025903 | Bacteria | 18757 |
| 345 | Ga0207647_10001007 | 3300025904 | Bacteria | 21881 |
| 346 | Ga0207647_10002939 | 3300025904 | Bacteria | 12824 |
| 347 | Ga0207647_10008274 | 3300025904 | Bacteria | 7469 |
| 348 | Ga0207647_10012532 | 3300025904 | Bacteria | 5899 |
| 349 | Ga0207647_10017866 | 3300025904 | Bacteria | 4812 |
| 350 | Ga0207647_10020274 | 3300025904 | Bacteria | 4459 |
| 351 | Ga0207647_10031649 | 3300025904 | Bacteria | 3403 |
| 352 | Ga0207647_10075380 | 3300025904 | Bacteria | 2030 |
| 353 | Ga0207645_10000464 | 3300025907 | Bacteria | 33570 |
| 354 | Ga0207645_10004867 | 3300025907 | Bacteria | 9849 |
| 355 | Ga0207645_10066560 | 3300025907 | Bacteria | 2303 |
| 356 | Ga0207645_10077355 | 3300025907 | Bacteria | 2132 |
| 357 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 358 | Ga0207705_10000166 | 3300025909 | Bacteria | 71368 |
| 359 | Ga0207705_10000269 | 3300025909 | Bacteria | 49725 |
| 360 | Ga0207705_10009323 | 3300025909 | Bacteria | 7138 |
| 361 | Ga0207705_10017955 | 3300025909 | Bacteria | 5060 |
| 362 | Ga0207705_10020370 | 3300025909 | Bacteria | 4741 |
| 363 | Ga0207705_10050240 | 3300025909 | Bacteria | 3002 |
| 364 | Ga0207707_10095419 | 3300025912 | Bacteria | 2599 |
| 365 | Ga0207695_10004498 | 3300025913 | Bacteria | 18977 |
| 366 | Ga0207695_10162063 | 3300025913 | Bacteria | 2167 |
| 367 | Ga0207671_10012746 | 3300025914 | Bacteria | 6743 |
| 368 | Ga0207660_10000272 | 3300025917 | Bacteria | 34016 |
| 369 | Ga0207660_10000483 | 3300025917 | Bacteria | 26540 |
| 370 | Ga0207660_10007968 | 3300025917 | Bacteria | 6849 |
| 371 | Ga0207662_10021965 | 3300025918 | Bacteria | 3654 |
| 372 | Ga0207662_10073579 | 3300025918 | Bacteria | 2073 |
| 373 | Ga0207657_10000015 | 3300025919 | Bacteria | 175776 |
| 374 | Ga0207657_10000862 | 3300025919 | Bacteria | 31986 |
| 375 | Ga0207657_10002065 | 3300025919 | Bacteria | 21729 |
| 376 | Ga0207657_10006334 | 3300025919 | Bacteria | 12295 |
| 377 | Ga0207657_10008888 | 3300025919 | Bacteria | 10161 |
| 378 | Ga0207657_10014072 | 3300025919 | Bacteria | 7828 |
| 379 | Ga0207657_10020592 | 3300025919 | Bacteria | 6229 |
| 380 | Ga0207657_10032256 | 3300025919 | Bacteria | 4736 |
| 381 | Ga0207657_10042250 | 3300025919 | Bacteria | 4024 |
| 382 | Ga0207657_10043489 | 3300025919 | Bacteria | 3956 |
| 383 | Ga0207657_10054530 | 3300025919 | Bacteria | 3457 |
| 384 | Ga0207657_10071307 | 3300025919 | Bacteria | 2942 |
| 385 | Ga0207649_10000150 | 3300025920 | Bacteria | 56988 |
| 386 | Ga0207649_10003368 | 3300025920 | Bacteria | 8744 |
| 387 | Ga0207649_10017068 | 3300025920 | Bacteria | 4109 |
| 388 | Ga0207649_10034685 | 3300025920 | Bacteria | 3025 |
| 389 | Ga0207649_10132304 | 3300025920 | Bacteria | 1696 |
| 390 | Ga0207652_10006880 | 3300025921 | Bacteria | 9161 |
| 391 | Ga0207652_10134424 | 3300025921 | Bacteria | 2208 |
| 392 | Ga0207652_10265625 | 3300025921 | Bacteria | 1548 |
| 393 | Ga0207681_10000713 | 3300025923 | Bacteria | 21863 |
| 394 | Ga0207681_10013179 | 3300025923 | Bacteria | 5111 |
| 395 | Ga0207681_10038332 | 3300025923 | Bacteria | 3175 |
| 396 | Ga0207681_10046614 | 3300025923 | Bacteria | 2916 |
| 397 | Ga0207681_10051432 | 3300025923 | Bacteria | 2791 |
| 398 | Ga0207681_10174191 | 3300025923 | Bacteria | 1633 |
| 399 | Ga0207694_10005366 | 3300025924 | Bacteria | 9869 |
| 400 | Ga0207694_10009876 | 3300025924 | Bacteria | 7204 |
| 401 | Ga0207694_10142870 | 3300025924 | Bacteria | 1925 |
| 402 | Ga0207650_10003435 | 3300025925 | Bacteria | 10893 |
| 403 | Ga0207650_10007991 | 3300025925 | Bacteria | 7211 |
| 404 | Ga0207650_10023960 | 3300025925 | Bacteria | 4334 |
| 405 | Ga0207650_10085064 | 3300025925 | Bacteria | 2405 |
| 406 | Ga0207659_10006496 | 3300025926 | Bacteria | 7166 |
| 407 | Ga0207659_10045467 | 3300025926 | Bacteria | 3095 |
| 408 | Ga0207659_10053347 | 3300025926 | Bacteria | 2883 |
| 409 | Ga0207687_10027837 | 3300025927 | Bacteria | 3794 |
| 410 | Ga0207687_10050052 | 3300025927 | Bacteria | 2907 |
| 411 | Ga0207700_10061386 | 3300025928 | Bacteria | 2850 |
| 412 | Ga0207664_10143597 | 3300025929 | Bacteria | 2022 |
| 413 | Ga0207664_10194887 | 3300025929 | Bacteria | 1746 |
| 414 | Ga0207644_10000186 | 3300025931 | Bacteria | 44897 |
| 415 | Ga0207644_10000429 | 3300025931 | Bacteria | 27281 |
| 416 | Ga0207644_10000978 | 3300025931 | Bacteria | 18260 |
| 417 | Ga0207644_10004275 | 3300025931 | Bacteria | 9267 |
| 418 | Ga0207644_10012706 | 3300025931 | Bacteria | 5598 |
| 419 | Ga0207644_10014933 | 3300025931 | Bacteria | 5207 |
| 420 | Ga0207644_10067814 | 3300025931 | Bacteria | 2601 |
| 421 | Ga0207644_10088526 | 3300025931 | Bacteria | 2303 |
| 422 | Ga0207644_10123907 | 3300025931 | Bacteria | 1970 |
| 423 | Ga0207644_10162067 | 3300025931 | Bacteria | 1739 |
| 424 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 425 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 426 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 427 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 428 | Ga0207690_10000032 | 3300025932 | Bacteria | 152479 |
| 429 | Ga0207690_10003727 | 3300025932 | Bacteria | 9053 |
| 430 | Ga0207690_10003789 | 3300025932 | Bacteria | 8948 |
| 431 | Ga0207690_10025920 | 3300025932 | Bacteria | 3688 |
| 432 | Ga0207690_10031572 | 3300025932 | Bacteria | 3391 |
| 433 | Ga0207690_10086421 | 3300025932 | Bacteria | 2204 |
| 434 | Ga0207690_10117364 | 3300025932 | Bacteria | 1926 |
| 435 | Ga0207706_10000032 | 3300025933 | Bacteria | 142723 |
| 436 | Ga0207706_10002227 | 3300025933 | Bacteria | 18932 |
| 437 | Ga0207706_10004100 | 3300025933 | Bacteria | 13767 |
| 438 | Ga0207706_10009395 | 3300025933 | Bacteria | 8975 |
| 439 | Ga0207706_10034743 | 3300025933 | Bacteria | 4486 |
| 440 | Ga0207706_10037895 | 3300025933 | Bacteria | 4278 |
| 441 | Ga0207706_10067864 | 3300025933 | Bacteria | 3139 |
| 442 | Ga0207706_10074611 | 3300025933 | Bacteria | 2982 |
| 443 | Ga0207706_10078617 | 3300025933 | Bacteria | 2901 |
| 444 | Ga0207706_10151471 | 3300025933 | Bacteria | 2040 |
| 445 | Ga0207706_10388226 | 3300025933 | Bacteria | 1211 |
| 446 | Ga0207706_10394643 | 3300025933 | Bacteria | 1200 |
| 447 | Ga0207709_10030946 | 3300025935 | Bacteria | 3119 |
| 448 | Ga0207669_10014765 | 3300025937 | Bacteria | 3922 |
| 449 | Ga0207669_10020695 | 3300025937 | Bacteria | 3456 |
| 450 | Ga0207669_10121148 | 3300025937 | Bacteria | 1776 |
| 451 | Ga0207669_10136034 | 3300025937 | Bacteria | 1697 |
| 452 | Ga0207704_10014745 | 3300025938 | Bacteria | 3958 |
| 453 | Ga0207665_10228107 | 3300025939 | Bacteria | 1368 |
| 454 | Ga0207691_10000696 | 3300025940 | Bacteria | 33255 |
| 455 | Ga0207691_10002986 | 3300025940 | Bacteria | 16500 |
| 456 | Ga0207691_10031645 | 3300025940 | Bacteria | 4936 |
| 457 | Ga0207691_10048439 | 3300025940 | Bacteria | 3896 |
| 458 | Ga0207691_10141594 | 3300025940 | Bacteria | 2119 |
| 459 | Ga0207691_10192635 | 3300025940 | Bacteria | 1777 |
| 460 | Ga0207691_10253498 | 3300025940 | Bacteria | 1518 |
| 461 | Ga0207711_10000333 | 3300025941 | Bacteria | 50088 |
| 462 | Ga0207711_10001301 | 3300025941 | Bacteria | 23628 |
| 463 | Ga0207711_10001758 | 3300025941 | Bacteria | 19856 |
| 464 | Ga0207711_10003110 | 3300025941 | Bacteria | 14468 |
| 465 | Ga0207711_10019305 | 3300025941 | Bacteria | 5677 |
| 466 | Ga0207711_10033336 | 3300025941 | Bacteria | 4357 |
| 467 | Ga0207711_10186953 | 3300025941 | Bacteria | 1886 |
| 468 | Ga0207711_10207423 | 3300025941 | Bacteria | 1790 |
| 469 | Ga0207711_10232826 | 3300025941 | Bacteria | 1687 |
| 470 | Ga0207711_10332734 | 3300025941 | Bacteria | 1405 |
| 471 | Ga0207689_10000922 | 3300025942 | Bacteria | 28234 |
| 472 | Ga0207661_10007813 | 3300025944 | Bacteria | 7617 |
| 473 | Ga0207661_10013509 | 3300025944 | Bacteria | 5964 |
| 474 | Ga0207661_10029081 | 3300025944 | Bacteria | 4241 |
| 475 | Ga0207661_10063088 | 3300025944 | Bacteria | 3000 |
| 476 | Ga0207661_10135829 | 3300025944 | Bacteria | 2112 |
| 477 | Ga0207661_10409064 | 3300025944 | Bacteria | 1231 |
| 478 | Ga0207679_10000271 | 3300025945 | Bacteria | 39235 |
| 479 | Ga0207679_10006632 | 3300025945 | Bacteria | 7325 |
| 480 | Ga0207679_10008597 | 3300025945 | Bacteria | 6508 |
| 481 | Ga0207679_10018814 | 3300025945 | Bacteria | 4634 |
| 482 | Ga0207679_10023716 | 3300025945 | Bacteria | 4199 |
| 483 | Ga0207679_10052273 | 3300025945 | Bacteria | 2996 |
| 484 | Ga0207667_10001086 | 3300025949 | Bacteria | 34513 |
| 485 | Ga0207667_10005405 | 3300025949 | Bacteria | 15575 |
| 486 | Ga0207667_10039316 | 3300025949 | Bacteria | 5043 |
| 487 | Ga0207667_10066787 | 3300025949 | Bacteria | 3748 |
| 488 | Ga0207667_10085119 | 3300025949 | Bacteria | 3273 |
| 489 | Ga0207667_10109644 | 3300025949 | Bacteria | 2847 |
| 490 | Ga0207667_10273904 | 3300025949 | Bacteria | 1725 |
| 491 | Ga0207651_10005971 | 3300025960 | Bacteria | 6308 |
| 492 | Ga0207651_10042810 | 3300025960 | Bacteria | 3017 |
| 493 | Ga0207651_10046829 | 3300025960 | Bacteria | 2911 |
| 494 | Ga0207651_10058013 | 3300025960 | Bacteria | 2673 |
| 495 | Ga0207712_10039848 | 3300025961 | Bacteria | 3221 |
| 496 | Ga0207668_10000074 | 3300025972 | Bacteria | 75726 |
| 497 | Ga0207668_10001206 | 3300025972 | Bacteria | 15350 |
| 498 | Ga0207668_10008981 | 3300025972 | Bacteria | 5977 |
| 499 | Ga0207668_10377614 | 3300025972 | Bacteria | 1192 |
| 500 | Ga0207640_10004342 | 3300025981 | Bacteria | 7678 |
| 501 | Ga0207640_10007193 | 3300025981 | Bacteria | 6135 |
| 502 | Ga0207640_10012843 | 3300025981 | Bacteria | 4785 |
| 503 | Ga0207640_10020576 | 3300025981 | Bacteria | 3919 |
| 504 | Ga0207640_10027466 | 3300025981 | Bacteria | 3468 |
| 505 | Ga0207658_10004146 | 3300025986 | Bacteria | 10101 |
| 506 | Ga0207658_10013250 | 3300025986 | Bacteria | 5631 |
| 507 | Ga0207658_10016022 | 3300025986 | Bacteria | 5149 |
| 508 | Ga0207677_10000110 | 3300026023 | Bacteria | 66525 |
| 509 | Ga0207677_10000665 | 3300026023 | Bacteria | 20426 |
| 510 | Ga0207703_10002818 | 3300026035 | Bacteria | 14828 |
| 511 | Ga0207703_10008965 | 3300026035 | Bacteria | 7880 |
| 512 | Ga0207703_10045413 | 3300026035 | Bacteria | 3534 |
| 513 | Ga0207639_10000095 | 3300026041 | Bacteria | 74687 |
| 514 | Ga0207639_10000661 | 3300026041 | Bacteria | 23756 |
| 515 | Ga0207639_10011224 | 3300026041 | Bacteria | 6215 |
| 516 | Ga0207639_10012232 | 3300026041 | Bacteria | 5973 |
| 517 | Ga0207639_10057519 | 3300026041 | Bacteria | 2986 |
| 518 | Ga0207639_10111002 | 3300026041 | Bacteria | 2235 |
| 519 | Ga0207639_10353317 | 3300026041 | Bacteria | 1313 |
| 520 | Ga0207678_10001882 | 3300026067 | Bacteria | 19133 |
| 521 | Ga0207678_10004279 | 3300026067 | Bacteria | 12801 |
| 522 | Ga0207678_10025609 | 3300026067 | Bacteria | 5149 |
| 523 | Ga0207702_10000072 | 3300026078 | Bacteria | 113840 |
| 524 | Ga0207702_10005603 | 3300026078 | Bacteria | 10960 |
| 525 | Ga0207702_10008027 | 3300026078 | Bacteria | 8932 |
| 526 | Ga0207702_10019200 | 3300026078 | Bacteria | 5654 |
| 527 | Ga0207702_10049862 | 3300026078 | Bacteria | 3533 |
| 528 | Ga0207702_10050695 | 3300026078 | Bacteria | 3505 |
| 529 | Ga0207702_10051375 | 3300026078 | Bacteria | 3483 |
| 530 | Ga0207702_10221104 | 3300026078 | Bacteria | 1765 |
| 531 | Ga0207641_10030799 | 3300026088 | Bacteria | 4446 |
| 532 | Ga0207641_10066452 | 3300026088 | Bacteria | 3086 |
| 533 | Ga0207641_10079457 | 3300026088 | Bacteria | 2843 |
| 534 | Ga0207641_10466840 | 3300026088 | Bacteria | 1222 |
| 535 | Ga0207648_10016106 | 3300026089 | Bacteria | 6847 |
| 536 | Ga0207648_10027330 | 3300026089 | Bacteria | 5066 |
| 537 | Ga0207648_10029788 | 3300026089 | Bacteria | 4840 |
| 538 | Ga0207648_10099389 | 3300026089 | Bacteria | 2548 |
| 539 | Ga0207648_10102278 | 3300026089 | Bacteria | 2511 |
| 540 | Ga0207648_10183064 | 3300026089 | Bacteria | 1855 |
| 541 | Ga0207676_10012470 | 3300026095 | Bacteria | 6092 |
| 542 | Ga0207676_10013720 | 3300026095 | Bacteria | 5819 |
| 543 | Ga0207676_10031163 | 3300026095 | Bacteria | 4009 |
| 544 | Ga0207676_10031484 | 3300026095 | Bacteria | 3990 |
| 545 | Ga0207676_10034352 | 3300026095 | Bacteria | 3839 |
| 546 | Ga0207676_10067008 | 3300026095 | Bacteria | 2866 |
| 547 | Ga0207674_10003435 | 3300026116 | Bacteria | 19394 |
| 548 | Ga0207674_10003595 | 3300026116 | Bacteria | 18906 |
| 549 | Ga0207674_10005790 | 3300026116 | Bacteria | 14660 |
| 550 | Ga0207674_10007687 | 3300026116 | Bacteria | 12548 |
| 551 | Ga0207674_10014645 | 3300026116 | Bacteria | 8649 |
| 552 | Ga0207674_10016319 | 3300026116 | Bacteria | 8134 |
| 553 | Ga0207674_10016766 | 3300026116 | Bacteria | 8007 |
| 554 | Ga0207675_100023920 | 3300026118 | Bacteria | 5681 |
| 555 | Ga0207683_10104591 | 3300026121 | Bacteria | 2530 |
| 556 | Ga0207698_10002357 | 3300026142 | Bacteria | 11199 |
| 557 | Ga0207698_10002585 | 3300026142 | Bacteria | 10757 |
| 558 | Ga0207698_10004191 | 3300026142 | Bacteria | 8773 |
| 559 | Ga0207698_10007920 | 3300026142 | Bacteria | 6692 |
| 560 | Ga0207698_10011887 | 3300026142 | Bacteria | 5669 |
| 561 | Ga0207698_10031333 | 3300026142 | Bacteria | 3836 |
| 562 | Ga0207698_10047191 | 3300026142 | Bacteria | 3260 |
| 563 | Ga0207698_10135635 | 3300026142 | Bacteria | 2111 |
| 564 | Ga0207698_10168566 | 3300026142 | Bacteria | 1925 |
| 565 | Ga0209983_1017325 | 3300027665 | Bacteria | 1490 |
| 566 | Ga0209974_10002037 | 3300027876 | Bacteria | 7383 |
| 567 | Ga0268266_10000133 | 3300028379 | Bacteria | 143210 |
| 568 | Ga0268266_10036354 | 3300028379 | Bacteria | 4191 |
| 569 | Ga0268266_10049953 | 3300028379 | Bacteria | 3587 |
| 570 | Ga0268266_10061388 | 3300028379 | Bacteria | 3242 |
| 571 | Ga0268265_10164497 | 3300028380 | Bacteria | 1889 |
| 572 | Ga0268264_10012327 | 3300028381 | Bacteria | 7036 |
| 573 | Ga0268264_10073390 | 3300028381 | Bacteria | 2904 |
| 574 | Ga0268264_10097169 | 3300028381 | Bacteria | 2552 |
| 575 | Ga0268264_10318367 | 3300028381 | Bacteria | 1470 |
| 576 | Ga0307513_10313456 | 3300031456 | Bacteria | 1330 |
| 577 | Ga0307408_100039824 | 3300031548 | Bacteria | 3324 |
| 578 | Ga0307408_100050803 | 3300031548 | Bacteria | 2983 |
| 579 | Ga0307408_100076126 | 3300031548 | Bacteria | 2495 |
| 580 | Ga0307408_100092220 | 3300031548 | Bacteria | 2289 |
| 581 | Ga0307408_100135591 | 3300031548 | Bacteria | 1926 |
| 582 | Ga0307408_100167573 | 3300031548 | Bacteria | 1751 |
| 583 | Ga0307405_10030264 | 3300031731 | Bacteria | 3173 |
| 584 | Ga0307405_10059792 | 3300031731 | Bacteria | 2402 |
| 585 | Ga0307405_10060355 | 3300031731 | Bacteria | 2392 |
| 586 | Ga0307405_10065088 | 3300031731 | Bacteria | 2319 |
| 587 | Ga0307405_10125127 | 3300031731 | Bacteria | 1766 |
| 588 | Ga0307413_10004841 | 3300031824 | Bacteria | 5918 |
| 589 | Ga0307413_10017212 | 3300031824 | Bacteria | 3759 |
| 590 | Ga0307413_10139219 | 3300031824 | Bacteria | 1674 |
| 591 | Ga0307413_10198134 | 3300031824 | Bacteria | 1448 |
| 592 | Ga0307413_10258099 | 3300031824 | Bacteria | 1297 |
| 593 | Ga0307410_10003533 | 3300031852 | Bacteria | 7861 |
| 594 | Ga0307410_10006803 | 3300031852 | Bacteria | 6205 |
| 595 | Ga0307410_10014238 | 3300031852 | Bacteria | 4673 |
| 596 | Ga0307410_10018812 | 3300031852 | Bacteria | 4184 |
| 597 | Ga0307410_10019226 | 3300031852 | Bacteria | 4150 |
| 598 | Ga0307410_10022840 | 3300031852 | Bacteria | 3875 |
| 599 | Ga0307410_10025406 | 3300031852 | Bacteria | 3716 |
| 600 | Ga0307410_10044056 | 3300031852 | Bacteria | 2961 |
| 601 | Ga0307410_10065183 | 3300031852 | Bacteria | 2505 |
| 602 | Ga0307410_10194414 | 3300031852 | Bacteria | 1544 |
| 603 | Ga0307410_10198683 | 3300031852 | Bacteria | 1529 |
| 604 | Ga0307406_10010822 | 3300031901 | Bacteria | 5155 |
| 605 | Ga0307406_10115375 | 3300031901 | Bacteria | 1857 |
| 606 | Ga0307406_10195710 | 3300031901 | Bacteria | 1484 |
| 607 | Ga0307407_10003942 | 3300031903 | Bacteria | 6196 |
| 608 | Ga0307407_10017056 | 3300031903 | Bacteria | 3633 |
| 609 | Ga0307407_10043525 | 3300031903 | Bacteria | 2524 |
| 610 | Ga0307407_10065388 | 3300031903 | Bacteria | 2141 |
| 611 | Ga0307407_10068797 | 3300031903 | Bacteria | 2099 |
| 612 | Ga0307407_10151325 | 3300031903 | Bacteria | 1508 |
| 613 | Ga0307412_10003002 | 3300031911 | Bacteria | 9337 |
| 614 | Ga0307412_10003426 | 3300031911 | Bacteria | 8812 |
| 615 | Ga0307412_10013547 | 3300031911 | Bacteria | 4784 |
| 616 | Ga0307412_10025870 | 3300031911 | Bacteria | 3640 |
| 617 | Ga0307412_10028875 | 3300031911 | Bacteria | 3476 |
| 618 | Ga0307412_10051568 | 3300031911 | Bacteria | 2719 |
| 619 | Ga0307412_10067928 | 3300031911 | Bacteria | 2422 |
| 620 | Ga0307412_10162338 | 3300031911 | Bacteria | 1662 |
| 621 | Ga0307409_100000853 | 3300031995 | Bacteria | 14062 |
| 622 | Ga0307409_100026203 | 3300031995 | Bacteria | 4107 |
| 623 | Ga0307409_100045824 | 3300031995 | Bacteria | 3305 |
| 624 | Ga0307409_100056766 | 3300031995 | Bacteria | 3029 |
| 625 | Ga0307409_100056820 | 3300031995 | Bacteria | 3028 |
| 626 | Ga0307409_100070560 | 3300031995 | Bacteria | 2773 |
| 627 | Ga0307409_100093169 | 3300031995 | Bacteria | 2474 |
| 628 | Ga0307409_100105858 | 3300031995 | Bacteria | 2346 |
| 629 | Ga0307409_100195976 | 3300031995 | Bacteria | 1803 |
| 630 | Ga0307409_100224721 | 3300031995 | Bacteria | 1697 |
| 631 | Ga0307409_100298907 | 3300031995 | Bacteria | 1496 |
| 632 | Ga0307416_100009956 | 3300032002 | Bacteria | 6255 |
| 633 | Ga0307416_100028750 | 3300032002 | Bacteria | 4140 |
| 634 | Ga0307416_100034916 | 3300032002 | Bacteria | 3833 |
| 635 | Ga0307416_100082875 | 3300032002 | Bacteria | 2718 |
| 636 | Ga0307416_100085512 | 3300032002 | Bacteria | 2684 |
| 637 | Ga0307416_100163238 | 3300032002 | Bacteria | 2062 |
| 638 | Ga0307416_100193499 | 3300032002 | Bacteria | 1921 |
| 639 | Ga0307416_100313979 | 3300032002 | Bacteria | 1565 |
| 640 | Ga0307416_100384885 | 3300032002 | Bacteria | 1434 |
| 641 | Ga0307414_10020007 | 3300032004 | Bacteria | 4162 |
| 642 | Ga0307414_10032939 | 3300032004 | Bacteria | 3418 |
| 643 | Ga0307414_10034633 | 3300032004 | Bacteria | 3351 |
| 644 | Ga0307414_10040228 | 3300032004 | Bacteria | 3156 |
| 645 | Ga0307414_10048311 | 3300032004 | Bacteria | 2935 |
| 646 | Ga0307414_10074171 | 3300032004 | Bacteria | 2464 |
| 647 | Ga0307414_10088110 | 3300032004 | Bacteria | 2296 |
| 648 | Ga0307411_10000438 | 3300032005 | Bacteria | 14246 |
| 649 | Ga0307411_10007464 | 3300032005 | Bacteria | 5572 |
| 650 | Ga0307411_10008826 | 3300032005 | Bacteria | 5250 |
| 651 | Ga0307411_10015075 | 3300032005 | Bacteria | 4326 |
| 652 | Ga0307411_10015229 | 3300032005 | Bacteria | 4312 |
| 653 | Ga0307411_10015257 | 3300032005 | Bacteria | 4308 |
| 654 | Ga0307411_10017044 | 3300032005 | Bacteria | 4126 |
| 655 | Ga0307411_10054145 | 3300032005 | Bacteria | 2633 |
| 656 | Ga0307411_10149153 | 3300032005 | Bacteria | 1735 |
| 657 | Ga0307415_100020185 | 3300032126 | Bacteria | 4063 |
| 658 | Ga0307415_100022229 | 3300032126 | Bacteria | 3910 |
| 659 | Ga0307415_100040844 | 3300032126 | Bacteria | 3076 |
| 660 | Ga0307415_100047081 | 3300032126 | Bacteria | 2901 |
| 661 | Ga0307415_100062998 | 3300032126 | Bacteria | 2575 |
| 662 | Ga0307415_100076220 | 3300032126 | Bacteria | 2377 |
| 663 | Ga0307415_100141828 | 3300032126 | Bacteria | 1836 |
| 664 | Ga0307415_100201068 | 3300032126 | Bacteria | 1581 |
| 665 | Ga0307415_100294902 | 3300032126 | Bacteria | 1340 |
| 666 | Ga0373943_0001267 | 3300035170 | Bacteria | 11301 |
| 667 | Ga0373946_0007684 | 3300035171 | Bacteria | 3950 |
| 668 | Ga0373961_0029717 | 3300035241 | Bacteria | 1515 |
| 669 | Ga0373931_0182250 | 3300035691 | Bacteria | 1244 |
| 670 | Ga0373935_0217354 | 3300035692 | Bacteria | 1326 |
| 671 | Ga0373925_0019638 | 3300037068 | Bacteria | 4917 |
| 672 | Ga0395899_0000514 | 3300037312 | Bacteria | 42939 |
| 673 | Ga0395899_0000916 | 3300037312 | Bacteria | 27731 |
| 674 | Ga0395899_0013637 | 3300037312 | Bacteria | 6212 |
| 675 | Ga0395899_0041447 | 3300037312 | Bacteria | 3440 |
| 676 | Ga0395899_0080835 | 3300037312 | Bacteria | 2365 |
| 677 | Ga0395899_0097265 | 3300037312 | Bacteria | 2128 |
| 678 | Ga0395899_0177017 | 3300037312 | Bacteria | 1499 |
| 679 | Ga0395900_0000136 | 3300037418 | Bacteria | 123664 |
| 680 | Ga0395900_0000572 | 3300037418 | Bacteria | 50991 |
| 681 | Ga0395900_0001285 | 3300037418 | Bacteria | 30628 |
| 682 | Ga0395900_0001307 | 3300037418 | Bacteria | 30308 |
| 683 | Ga0395900_0004798 | 3300037418 | Bacteria | 14244 |
| 684 | Ga0395900_0011354 | 3300037418 | Bacteria | 9112 |
| 685 | Ga0395900_0012338 | 3300037418 | Bacteria | 8742 |
| 686 | Ga0395900_0020301 | 3300037418 | Bacteria | 6782 |
| 687 | Ga0395900_0024262 | 3300037418 | Bacteria | 6209 |
| 688 | Ga0395900_0028065 | 3300037418 | Bacteria | 5763 |
| 689 | Ga0395900_0042917 | 3300037418 | Bacteria | 4659 |
| 690 | Ga0395900_0051956 | 3300037418 | Bacteria | 4221 |
| 691 | Ga0395900_0055218 | 3300037418 | Bacteria | 4090 |
| 692 | Ga0395900_0082421 | 3300037418 | Bacteria | 3304 |
| 693 | Ga0395900_0088183 | 3300037418 | Bacteria | 3189 |
| 694 | Ga0395900_0115015 | 3300037418 | Bacteria | 2761 |
| 695 | Ga0395900_0125264 | 3300037418 | Bacteria | 2635 |
| 696 | Ga0395900_0149964 | 3300037418 | Bacteria | 2382 |
| 697 | Ga0395900_0173137 | 3300037418 | Bacteria | 2196 |
| 698 | Ga0395900_0191437 | 3300037418 | Bacteria | 2074 |
| 699 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 700 | Ga0395898_0001920 | 3300037466 | Bacteria | 26462 |
| 701 | Ga0395898_0038495 | 3300037466 | Bacteria | 4739 |
| 702 | Ga0395898_0043258 | 3300037466 | Bacteria | 4439 |
| 703 | Ga0395898_0087425 | 3300037466 | Bacteria | 3002 |
| 704 | Ga0395898_0099032 | 3300037466 | Bacteria | 2799 |
| 705 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 706 | Ga0395905_0000165 | 3300037471 | Bacteria | 109385 |
| 707 | Ga0395905_0000935 | 3300037471 | Bacteria | 37721 |
| 708 | Ga0395905_0001547 | 3300037471 | Bacteria | 27515 |
| 709 | Ga0395905_0002420 | 3300037471 | Bacteria | 20704 |
| 710 | Ga0395905_0007739 | 3300037471 | Bacteria | 10657 |
| 711 | Ga0395905_0008316 | 3300037471 | Bacteria | 10237 |
| 712 | Ga0395905_0013070 | 3300037471 | Bacteria | 7972 |
| 713 | Ga0395905_0016186 | 3300037471 | Bacteria | 7087 |
| 714 | Ga0395905_0016440 | 3300037471 | Bacteria | 7033 |
| 715 | Ga0395905_0024821 | 3300037471 | Bacteria | 5657 |
| 716 | Ga0395905_0047505 | 3300037471 | Bacteria | 4023 |
| 717 | Ga0395905_0062635 | 3300037471 | Bacteria | 3479 |
| 718 | Ga0395905_0068478 | 3300037471 | Bacteria | 3324 |
| 719 | Ga0395905_0069931 | 3300037471 | Bacteria | 3288 |
| 720 | Ga0395905_0072145 | 3300037471 | Bacteria | 3237 |
| 721 | Ga0395905_0118030 | 3300037471 | Bacteria | 2494 |
| 722 | Ga0395905_0127761 | 3300037471 | Bacteria | 2390 |
| 723 | Ga0395905_0135479 | 3300037471 | Bacteria | 2316 |
| 724 | Ga0395905_0270998 | 3300037471 | Bacteria | 1583 |
| 725 | Ga0395905_0316465 | 3300037471 | Bacteria | 1450 |
| 726 | Ga0395901_0000030 | 3300038443 | Bacteria | 241916 |
| 727 | Ga0395901_0000671 | 3300038443 | Bacteria | 39338 |
| 728 | Ga0395901_0002889 | 3300038443 | Bacteria | 17335 |
| 729 | Ga0395901_0005419 | 3300038443 | Bacteria | 12911 |
| 730 | Ga0395901_0009853 | 3300038443 | Bacteria | 9685 |
| 731 | Ga0395901_0011593 | 3300038443 | Bacteria | 8930 |
| 732 | Ga0395901_0012931 | 3300038443 | Bacteria | 8468 |
| 733 | Ga0395901_0039046 | 3300038443 | Bacteria | 4911 |
| 734 | Ga0395901_0068165 | 3300038443 | Bacteria | 3706 |
| 735 | Ga0395901_0084557 | 3300038443 | Bacteria | 3316 |
| 736 | Ga0395901_0136053 | 3300038443 | Bacteria | 2582 |
| 737 | Ga0395901_0159653 | 3300038443 | Bacteria | 2368 |
| 738 | Ga0395901_0280401 | 3300038443 | Bacteria | 1731 |
| 739 | Ga0395901_0320629 | 3300038443 | Bacteria | 1603 |
| 740 | Ga0395901_0363686 | 3300038443 | Bacteria | 1491 |
| 741 | Ga0395901_0389380 | 3300038443 | Bacteria | 1433 |
| 742 | Ga0436365_1581748 | 3300039437 | Bacteria | 13505 |
| 743 | Ga0436365_1596642 | 3300039437 | Bacteria | 39428 |
| 744 | Ga0436363_1186896 | 3300039450 | Bacteria | 2628 |
| 745 | Ga0439465_0027691 | 3300041413 | Bacteria | 1796 |
| 746 | Ga0439465_0033881 | 3300041413 | Bacteria | 1634 |
| 747 | Ga0439432_006611 | 3300042006 | Bacteria | 4131 |
| 748 | Ga0439432_020245 | 3300042006 | Bacteria | 2214 |
| 749 | Ga0439449_0021127 | 3300042007 | Bacteria | 2438 |
| 750 | Ga0450907_013532 | 3300042146 | Bacteria | 1360 |
| 751 | Ga0439464_0005662 | 3300042439 | Bacteria | 3237 |
| 752 | Ga0466966_0000027 | 3300044684 | Bacteria | 106520 |
| 753 | Ga0466966_0032999 | 3300044684 | Bacteria | 3351 |
| 754 | Ga0466966_0053518 | 3300044684 | Bacteria | 2560 |
| 755 | Ga0466961_0063667 | 3300044693 | Bacteria | 2343 |
| 756 | Ga0466963_0035819 | 3300044694 | Bacteria | 3233 |
| 757 | Ga0466971_0049819 | 3300044719 | Bacteria | 1884 |
| 758 | Ga0466971_0061440 | 3300044719 | Bacteria | 1699 |
| 759 | Ga0466971_0080287 | 3300044719 | Bacteria | 1487 |
| 760 | Ga0466957_0022667 | 3300044842 | Bacteria | 3706 |
| 761 | Ga0466957_0022746 | 3300044842 | Bacteria | 3700 |
| 762 | Ga0466960_0039890 | 3300044901 | Bacteria | 2217 |
| 763 | Ga0466959_0016931 | 3300045049 | Bacteria | 5335 |
| 764 | Ga0466958_0011841 | 3300045836 | Bacteria | 4925 |
| 765 | Ga0466958_0013184 | 3300045836 | Bacteria | 4701 |
| 766 | Ga0466958_0015535 | 3300045836 | Bacteria | 4365 |
| 767 | Ga0466958_0016227 | 3300045836 | Bacteria | 4285 |
| 768 | Ga0466967_0030963 | 3300045976 | Bacteria | 4497 |
| 769 | Ga0466967_0102205 | 3300045976 | Bacteria | 2622 |
| 770 | Ga0466967_0107540 | 3300045976 | Bacteria | 2558 |
| 771 | Ga0466967_0111026 | 3300045976 | Bacteria | 2519 |
| 772 | Ga0466967_0141752 | 3300045976 | Bacteria | 2239 |
| 773 | Ga0466967_0236392 | 3300045976 | Bacteria | 1741 |
| 774 | Ga0466967_0449403 | 3300045976 | Bacteria | 1259 |
| 775 | Ga0495598_0000254 | 3300046537 | Bacteria | 9602 |
| 776 | Ga0495598_0006177 | 3300046537 | Bacteria | 2694 |
| 777 | Ga0495621_0000031 | 3300046539 | Bacteria | 27353 |
| 778 | Ga0495621_0000041 | 3300046539 | Bacteria | 25070 |
| 779 | Ga0495621_0064693 | 3300046539 | Bacteria | 1335 |
| 780 | Ga0495621_0085394 | 3300046539 | Bacteria | 1182 |
| 781 | Ga0495633_0007844 | 3300046558 | Bacteria | 6093 |
| 782 | Ga0495668_0016929 | 3300046616 | Bacteria | 4234 |
| 783 | Ga0495668_0091433 | 3300046616 | Bacteria | 1667 |
| 784 | Ga0495669_0000579 | 3300046684 | Bacteria | 16267 |
| 785 | Ga0495669_0003272 | 3300046684 | Bacteria | 6666 |
| 786 | Ga0495669_0004514 | 3300046684 | Bacteria | 5754 |
| 787 | Ga0495669_0006673 | 3300046684 | Bacteria | 4829 |
| 788 | Ga0495670_0000562 | 3300046691 | Bacteria | 17692 |
| 789 | Ga0495670_0113885 | 3300046691 | Bacteria | 1401 |
| 790 | Ga0495677_0002739 | 3300047445 | Bacteria | 6886 |
| 791 | Ga0495677_0020234 | 3300047445 | Bacteria | 2413 |
| 792 | Ga0496101_0076094 | 3300048904 | Bacteria | 2472 |
| 793 | Ga0496101_0108528 | 3300048904 | Bacteria | 2087 |
| 794 | Ga0496101_0131616 | 3300048904 | Bacteria | 1900 |
| 795 | Ga0496102_0111220 | 3300048905 | Bacteria | 2553 |
| 796 | Ga0496102_0140762 | 3300048905 | Bacteria | 2262 |
| 797 | Ga0496103_0042261 | 3300048906 | Bacteria | 2804 |
| 798 | Ga0496103_0163150 | 3300048906 | Bacteria | 1430 |
| 799 | Ga0496105_0344796 | 3300048908 | Bacteria | 1190 |
| 800 | Ga0496107_0014902 | 3300048910 | Bacteria | 5443 |
| 801 | Ga0496108_0003382 | 3300048911 | Bacteria | 12807 |
| 802 | Ga0496108_0012589 | 3300048911 | Bacteria | 6892 |
| 803 | Ga0496108_0056116 | 3300048911 | Bacteria | 3308 |
| 804 | Ga0496109_0045656 | 3300048912 | Bacteria | 3976 |
| 805 | Ga0496109_0065317 | 3300048912 | Bacteria | 3331 |
| 806 | Ga0496110_0002532 | 3300048913 | Bacteria | 13737 |
| 807 | Ga0496110_0006432 | 3300048913 | Bacteria | 9303 |
| 808 | Ga0496110_0038130 | 3300048913 | Bacteria | 4180 |
| 809 | Ga0496110_0114900 | 3300048913 | Bacteria | 2422 |
| 810 | Ga0496111_0015186 | 3300048914 | Bacteria | 5279 |
| 811 | Ga0496111_0115215 | 3300048914 | Bacteria | 1981 |
| 812 | Ga0496112_0001644 | 3300048915 | Bacteria | 17341 |
| 813 | Ga0496112_0009205 | 3300048915 | Bacteria | 8876 |
| 814 | Ga0496112_0112693 | 3300048915 | Bacteria | 2690 |
| 815 | Ga0496112_0292382 | 3300048915 | Bacteria | 1575 |
| 816 | Ga0496113_0001833 | 3300048916 | Bacteria | 12097 |
| 817 | Ga0496113_0028102 | 3300048916 | Bacteria | 4041 |
| 818 | Ga0501292_000004 | 3300049515 | Bacteria | 159565 |
| 819 | Ga0501294_000705 | 3300049517 | Bacteria | 3714 |
| 820 | Ga0501206_001403 | 3300049653 | Bacteria | 3013 |
| 821 | Ga0501227_003256 | 3300049665 | Bacteria | 3522 |
| 822 | Ga0501257_000138 | 3300049686 | Bacteria | 16649 |
| 823 | Ga0501259_000200 | 3300049688 | Bacteria | 9181 |
| 824 | Ga0501261_000035 | 3300049690 | Bacteria | 27543 |
| 825 | Ga0501225_0006134 | 3300049705 | Bacteria | 3510 |
| 826 | Ga0501279_000048 | 3300049775 | Bacteria | 23447 |
| 827 | Ga0501280_000023 | 3300049776 | Bacteria | 50265 |
| 828 | Ga0501281_00441 | 3300049777 | Bacteria | 4037 |
| 829 | Ga0501282_000019 | 3300049778 | Bacteria | 23818 |
| 830 | Ga0501204_007240 | 3300049850 | Bacteria | 1246 |
| 831 | nmdc:mga09592_278777_c1 | 3300050508 | Bacteria | 1450 |
| 832 | nmdc:mga06r32_10173_c1 | 3300050510 | Bacteria | 8491 |
| 833 | Ga0500643_000093 | 3300053087 | Bacteria | 93451 |
| 834 | Ga0500643_003456 | 3300053087 | Bacteria | 7607 |
| 835 | Ga0500616_0002890 | 3300053153 | Bacteria | 13763 |
| 836 | Ga0466962_0006952 | 3300061719 | Bacteria | 5425 |
| 837 | Ga0466962_0009911 | 3300061719 | Bacteria | 4570 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006358 | Ga0068871_100012040 | Ga0068871_1000120407 | 283 |
| 2 | 3300025315 | Ga0207697_10050035 | Ga0207697_100500352 | 285 |
| 3 | 3300045976 | Ga0466967_0449403 | Ga0466967_0449403_114_1163 | 286 |
| 4 | 3300005436 | Ga0070713_100086864 | Ga0070713_1000868642 | 287 |
| 5 | 3300006028 | Ga0070717_10011863 | Ga0070717_100118634 | 287 |
| 6 | 3300006173 | Ga0070716_100036695 | Ga0070716_1000366952 | 287 |
| 7 | 3300025928 | Ga0207700_10061386 | Ga0207700_100613864 | 287 |
| 8 | 3300014326 | Ga0157380_10044724 | Ga0157380_100447244 | 288 |
| 9 | 3300037312 | Ga0395899_0080835 | Ga0395899_0080835_206_1255 | 288 |
| 10 | 3300037471 | Ga0395905_0135479 | Ga0395905_0135479_355_1404 | 288 |
| 11 | 3300053087 | Ga0500643_003456 | Ga0500643_003456_3531_4580 | 288 |
| 12 | 3300005290 | Ga0065712_10010017 | Ga0065712_100100172 | 289 |
| 13 | 3300005328 | Ga0070676_10035989 | Ga0070676_100359892 | 289 |
| 14 | 3300005331 | Ga0070670_100016348 | Ga0070670_1000163489 | 289 |
| 15 | 3300005353 | Ga0070669_100000937 | Ga0070669_10000093718 | 289 |
| 16 | 3300005354 | Ga0070675_100001185 | Ga0070675_1000011857 | 289 |
| 17 | 3300005364 | Ga0070673_100016722 | Ga0070673_1000167222 | 289 |
| 18 | 3300005459 | Ga0068867_100019242 | Ga0068867_1000192425 | 289 |
| 19 | 3300005719 | Ga0068861_100034590 | Ga0068861_1000345901 | 289 |
| 20 | 3300013104 | Ga0157370_10000630 | Ga0157370_1000063043 | 289 |
| 21 | 3300025893 | Ga0207682_10008265 | Ga0207682_100082655 | 289 |
| 22 | 3300025960 | Ga0207651_10046829 | Ga0207651_100468293 | 289 |
| 23 | 3300026089 | Ga0207648_10016106 | Ga0207648_100161065 | 289 |
| 24 | 3300026095 | Ga0207676_10031163 | Ga0207676_100311632 | 289 |
| 25 | 3300035691 | Ga0373931_0182250 | Ga0373931_0182250_150_1199 | 289 |
| 26 | 3300045836 | Ga0466958_0016227 | Ga0466958_0016227_3074_4120 | 289 |
| 27 | 3300046539 | Ga0495621_0085394 | Ga0495621_0085394_95_1144 | 289 |
| 28 | 3300037418 | Ga0395900_0115015 | Ga0395900_0115015_18_1067 | 290 |
| 29 | 3300037471 | Ga0395905_0062635 | Ga0395905_0062635_2330_3379 | 290 |
| 30 | 3300005356 | Ga0070674_100009591 | Ga0070674_1000095915 | 292 |
| 31 | 3300025937 | Ga0207669_10014765 | Ga0207669_100147652 | 292 |
| 32 | 3300006847 | Ga0075431_100120466 | Ga0075431_1001204663 | 293 |
| 33 | 3300046616 | Ga0495668_0016929 | Ga0495668_0016929_2952_4001 | 293 |
| 34 | 3300050510 | nmdc:mga06r32_10173_c1 | nmdc:mga06r32_10173_c1_5828_6877 | 293 |
| 35 | 3300005336 | Ga0070680_100001350 | Ga0070680_10000135018 | 294 |
| 36 | 3300025917 | Ga0207660_10000272 | Ga0207660_1000027212 | 294 |
| 37 | 3300025921 | Ga0207652_10134424 | Ga0207652_101344242 | 294 |
| 38 | 3300005328 | Ga0070676_10013539 | Ga0070676_100135393 | 295 |
| 39 | 3300005339 | Ga0070660_100028221 | Ga0070660_1000282212 | 295 |
| 40 | 3300005344 | Ga0070661_100024211 | Ga0070661_1000242116 | 295 |
| 41 | 3300005347 | Ga0070668_100000910 | Ga0070668_10000091012 | 295 |
| 42 | 3300005364 | Ga0070673_100050239 | Ga0070673_1000502393 | 295 |
| 43 | 3300005543 | Ga0070672_100150860 | Ga0070672_1001508603 | 295 |
| 44 | 3300005614 | Ga0068856_100181733 | Ga0068856_1001817332 | 295 |
| 45 | 3300005616 | Ga0068852_100027253 | Ga0068852_1000272532 | 295 |
| 46 | 3300006881 | Ga0068865_100062802 | Ga0068865_1000628024 | 295 |
| 47 | 3300013105 | Ga0157369_10135688 | Ga0157369_101356882 | 295 |
| 48 | 3300013296 | Ga0157374_10462045 | Ga0157374_104620452 | 295 |
| 49 | 3300025907 | Ga0207645_10000464 | Ga0207645_100004649 | 295 |
| 50 | 3300025919 | Ga0207657_10071307 | Ga0207657_100713072 | 295 |
| 51 | 3300025923 | Ga0207681_10013179 | Ga0207681_100131795 | 295 |
| 52 | 3300025940 | Ga0207691_10253498 | Ga0207691_102534982 | 295 |
| 53 | 3300025960 | Ga0207651_10005971 | Ga0207651_100059711 | 295 |
| 54 | 3300025972 | Ga0207668_10000074 | Ga0207668_100000749 | 295 |
| 55 | 3300026089 | Ga0207648_10029788 | Ga0207648_100297885 | 295 |
| 56 | 3300031903 | Ga0307407_10151325 | Ga0307407_101513252 | 295 |
| 57 | 3300005347 | Ga0070668_100146793 | Ga0070668_1001467932 | 296 |
| 58 | 3300005466 | Ga0070685_10214598 | Ga0070685_102145981 | 296 |
| 59 | 3300005543 | Ga0070672_100047767 | Ga0070672_1000477674 | 296 |
| 60 | 3300005840 | Ga0068870_10156654 | Ga0068870_101566542 | 296 |
| 61 | 3300009553 | Ga0105249_10036981 | Ga0105249_100369815 | 296 |
| 62 | 3300013100 | Ga0157373_10078625 | Ga0157373_100786252 | 296 |
| 63 | 3300013308 | Ga0157375_10538091 | Ga0157375_105380912 | 296 |
| 64 | 3300025901 | Ga0207688_10034421 | Ga0207688_100344215 | 296 |
| 65 | 3300025923 | Ga0207681_10000713 | Ga0207681_1000071321 | 296 |
| 66 | 3300025925 | Ga0207650_10085064 | Ga0207650_100850642 | 296 |
| 67 | 3300025933 | Ga0207706_10009395 | Ga0207706_1000939510 | 296 |
| 68 | 3300025940 | Ga0207691_10000696 | Ga0207691_1000069614 | 296 |
| 69 | 3300025961 | Ga0207712_10039848 | Ga0207712_100398485 | 296 |
| 70 | 3300025972 | Ga0207668_10001206 | Ga0207668_100012062 | 296 |
| 71 | 3300026067 | Ga0207678_10025609 | Ga0207678_100256095 | 296 |
| 72 | 3300026088 | Ga0207641_10466840 | Ga0207641_104668401 | 296 |
| 73 | 3300026118 | Ga0207675_100023920 | Ga0207675_1000239201 | 296 |
| 74 | 3300049850 | Ga0501204_007240 | Ga0501204_007240_101_1141 | 296 |
| 75 | 3300005355 | Ga0070671_100001894 | Ga0070671_10000189416 | 297 |
| 76 | 3300005457 | Ga0070662_100008681 | Ga0070662_1000086815 | 297 |
| 77 | 3300025931 | Ga0207644_10000978 | Ga0207644_1000097819 | 297 |
| 78 | 3300025933 | Ga0207706_10074611 | Ga0207706_100746112 | 297 |
| 79 | 3300026121 | Ga0207683_10104591 | Ga0207683_101045913 | 297 |
| 80 | 3300048904 | Ga0496101_0108528 | Ga0496101_0108528_817_1866 | 297 |
| 81 | 3300037471 | Ga0395905_0047505 | Ga0395905_0047505_1954_3003 | 298 |
| 82 | 3300038443 | Ga0395901_0159653 | Ga0395901_0159653_206_1255 | 298 |
| 83 | 3300009098 | Ga0105245_10020115 | Ga0105245_100201156 | 299 |
| 84 | 3300025927 | Ga0207687_10050052 | Ga0207687_100500523 | 299 |
| 85 | 3300031548 | Ga0307408_100039824 | Ga0307408_1000398245 | 299 |
| 86 | 3300031731 | Ga0307405_10060355 | Ga0307405_100603552 | 299 |
| 87 | 3300031852 | Ga0307410_10194414 | Ga0307410_101944143 | 299 |
| 88 | 3300032002 | Ga0307416_100085512 | Ga0307416_1000855122 | 299 |
| 89 | 3300032005 | Ga0307411_10149153 | Ga0307411_101491533 | 299 |
| 90 | 3300041413 | Ga0439465_0027691 | Ga0439465_0027691_501_1550 | 299 |
| 91 | 3300042007 | Ga0439449_0021127 | Ga0439449_0021127_844_1893 | 299 |
| 92 | 3300049705 | Ga0501225_0006134 | Ga0501225_0006134_1276_2325 | 299 |
| 93 | 3300005327 | Ga0070658_10031474 | Ga0070658_100314745 | 300 |
| 94 | 3300044684 | Ga0466966_0032999 | Ga0466966_0032999_2157_3203 | 301 |
| 95 | 3300005339 | Ga0070660_100033897 | Ga0070660_1000338975 | 303 |
| 96 | 3300005539 | Ga0068853_100016077 | Ga0068853_1000160775 | 303 |
| 97 | 3300005578 | Ga0068854_100048190 | Ga0068854_1000481906 | 303 |
| 98 | 3300013102 | Ga0157371_10174535 | Ga0157371_101745352 | 303 |
| 99 | 3300025919 | Ga0207657_10043489 | Ga0207657_100434893 | 303 |
| 100 | 3300025919 | Ga0207657_10054530 | Ga0207657_100545303 | 303 |
| 101 | 3300025920 | Ga0207649_10017068 | Ga0207649_100170688 | 303 |
| 102 | 3300025933 | Ga0207706_10388226 | Ga0207706_103882262 | 303 |
| 103 | 3300025949 | Ga0207667_10273904 | Ga0207667_102739043 | 303 |
| 104 | 3300026078 | Ga0207702_10008027 | Ga0207702_1000802711 | 303 |
| 105 | 3300026142 | Ga0207698_10011887 | Ga0207698_100118878 | 303 |
| 106 | 3300031731 | Ga0307405_10125127 | Ga0307405_101251272 | 303 |
| 107 | 3300031901 | Ga0307406_10195710 | Ga0307406_101957102 | 303 |
| 108 | 3300031911 | Ga0307412_10067928 | Ga0307412_100679283 | 303 |
| 109 | 3300032002 | Ga0307416_100034916 | Ga0307416_1000349165 | 303 |
| 110 | 3300037418 | Ga0395900_0088183 | Ga0395900_0088183_1918_2967 | 303 |
| 111 | 3300045976 | Ga0466967_0141752 | Ga0466967_0141752_140_1189 | 303 |
| 112 | 3300053153 | Ga0500616_0002890 | Ga0500616_0002890_84_1133 | 303 |
| 113 | 3300005329 | Ga0070683_100014521 | Ga0070683_1000145215 | 304 |
| 114 | 3300005535 | Ga0070684_100013064 | Ga0070684_1000130642 | 304 |
| 115 | 3300005564 | Ga0070664_100054090 | Ga0070664_1000540905 | 304 |
| 116 | 3300005577 | Ga0068857_100035069 | Ga0068857_1000350692 | 304 |
| 117 | 3300025944 | Ga0207661_10007813 | Ga0207661_100078135 | 304 |
| 118 | 3300025945 | Ga0207679_10018814 | Ga0207679_100188147 | 304 |
| 119 | 3300026116 | Ga0207674_10016766 | Ga0207674_100167662 | 304 |
| 120 | 3300005331 | Ga0070670_100030156 | Ga0070670_1000301568 | 306 |
| 121 | 3300005338 | Ga0068868_100001563 | Ga0068868_1000015632 | 306 |
| 122 | 3300005344 | Ga0070661_100011135 | Ga0070661_1000111358 | 306 |
| 123 | 3300005366 | Ga0070659_100000001 | Ga0070659_100000001533 | 306 |
| 124 | 3300005366 | Ga0070659_100054904 | Ga0070659_1000549044 | 306 |
| 125 | 3300005543 | Ga0070672_100082362 | Ga0070672_1000823622 | 306 |
| 126 | 3300005564 | Ga0070664_100001273 | Ga0070664_10000127310 | 306 |
| 127 | 3300005618 | Ga0068864_100073084 | Ga0068864_1000730845 | 306 |
| 128 | 3300013105 | Ga0157369_10014853 | Ga0157369_100148536 | 306 |
| 129 | 3300025901 | Ga0207688_10042578 | Ga0207688_100425784 | 306 |
| 130 | 3300025920 | Ga0207649_10034685 | Ga0207649_100346855 | 306 |
| 131 | 3300025926 | Ga0207659_10045467 | Ga0207659_100454672 | 306 |
| 132 | 3300025932 | Ga0207690_10000001 | Ga0207690_10000001147 | 306 |
| 133 | 3300025932 | Ga0207690_10000002 | Ga0207690_10000002147 | 306 |
| 134 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003147 | 306 |
| 135 | 3300025932 | Ga0207690_10000004 | Ga0207690_10000004147 | 306 |
| 136 | 3300025932 | Ga0207690_10086421 | Ga0207690_100864212 | 306 |
| 137 | 3300025945 | Ga0207679_10006632 | Ga0207679_100066328 | 306 |
| 138 | 3300026023 | Ga0207677_10000110 | Ga0207677_1000011010 | 306 |
| 139 | 3300026095 | Ga0207676_10034352 | Ga0207676_100343524 | 306 |
| 140 | 3300035170 | Ga0373943_0001267 | Ga0373943_0001267_2856_3905 | 306 |
| 141 | 3300035171 | Ga0373946_0007684 | Ga0373946_0007684_2797_3846 | 306 |
| 142 | 3300035692 | Ga0373935_0217354 | Ga0373935_0217354_191_1240 | 306 |
| 143 | 3300037068 | Ga0373925_0019638 | Ga0373925_0019638_2695_3744 | 306 |
| 144 | 3300037471 | Ga0395905_0013070 | Ga0395905_0013070_3000_4049 | 306 |
| 145 | 3300042146 | Ga0450907_013532 | Ga0450907_013532_59_1108 | 306 |
| 146 | 3300046691 | Ga0495670_0113885 | Ga0495670_0113885_38_1087 | 306 |
| 147 | 3300005327 | Ga0070658_10020672 | Ga0070658_100206725 | 307 |
| 148 | 3300005366 | Ga0070659_100069514 | Ga0070659_1000695145 | 307 |
| 149 | 3300025981 | Ga0207640_10020576 | Ga0207640_100205767 | 307 |
| 150 | 3300037312 | Ga0395899_0097265 | Ga0395899_0097265_977_2026 | 307 |
| 151 | 3300037418 | Ga0395900_0028065 | Ga0395900_0028065_396_1445 | 307 |
| 152 | 3300037471 | Ga0395905_0002420 | Ga0395905_0002420_9051_10100 | 307 |
| 153 | 3300038443 | Ga0395901_0002889 | Ga0395901_0002889_7852_8901 | 307 |
| 154 | 3300046684 | Ga0495669_0004514 | Ga0495669_0004514_825_1874 | 307 |
| 155 | 3300005435 | Ga0070714_100069564 | Ga0070714_1000695643 | 308 |
| 156 | 3300005436 | Ga0070713_100148263 | Ga0070713_1001482632 | 308 |
| 157 | 3300025929 | Ga0207664_10143597 | Ga0207664_101435973 | 308 |
| 158 | 3300037418 | Ga0395900_0001307 | Ga0395900_0001307_6596_7645 | 308 |
| 159 | 3300037466 | Ga0395898_0038495 | Ga0395898_0038495_2841_3890 | 308 |
| 160 | 3300037471 | Ga0395905_0000935 | Ga0395905_0000935_9369_10418 | 308 |
| 161 | 3300038443 | Ga0395901_0009853 | Ga0395901_0009853_2450_3499 | 308 |
| 162 | 3300045976 | Ga0466967_0102205 | Ga0466967_0102205_678_1727 | 308 |
| 163 | 3300037418 | Ga0395900_0082421 | Ga0395900_0082421_99_1148 | 309 |
| 164 | 3300037466 | Ga0395898_0043258 | Ga0395898_0043258_416_1465 | 309 |
| 165 | 3300038443 | Ga0395901_0136053 | Ga0395901_0136053_417_1466 | 309 |
| 166 | 3300037418 | Ga0395900_0173137 | Ga0395900_0173137_342_1391 | 310 |
| 167 | 3300005614 | Ga0068856_100031930 | Ga0068856_1000319303 | 311 |
| 168 | 3300013105 | Ga0157369_10015742 | Ga0157369_100157429 | 311 |
| 169 | 3300026078 | Ga0207702_10019200 | Ga0207702_100192005 | 311 |
| 170 | 3300037471 | Ga0395905_0016440 | Ga0395905_0016440_66_1115 | 311 |
| 171 | 3300038443 | Ga0395901_0084557 | Ga0395901_0084557_117_1166 | 311 |
| 172 | 3300005336 | Ga0070680_100005439 | Ga0070680_1000054395 | 312 |
| 173 | 3300005364 | Ga0070673_100167857 | Ga0070673_1001678573 | 312 |
| 174 | 3300005458 | Ga0070681_10173349 | Ga0070681_101733492 | 312 |
| 175 | 3300005530 | Ga0070679_100103498 | Ga0070679_1001034982 | 312 |
| 176 | 3300005578 | Ga0068854_100005000 | Ga0068854_1000050006 | 312 |
| 177 | 3300009093 | Ga0105240_10024566 | Ga0105240_100245662 | 312 |
| 178 | 3300013100 | Ga0157373_10010181 | Ga0157373_100101816 | 312 |
| 179 | 3300025913 | Ga0207695_10162063 | Ga0207695_101620634 | 312 |
| 180 | 3300025949 | Ga0207667_10066787 | Ga0207667_100667872 | 312 |
| 181 | 3300025981 | Ga0207640_10004342 | Ga0207640_100043428 | 312 |
| 182 | 3300026142 | Ga0207698_10002585 | Ga0207698_100025858 | 312 |
| 183 | 3300032002 | Ga0307416_100163238 | Ga0307416_1001632384 | 312 |
| 184 | 3300005329 | Ga0070683_100034542 | Ga0070683_1000345427 | 313 |
| 185 | 3300005457 | Ga0070662_100060965 | Ga0070662_1000609654 | 313 |
| 186 | 3300005530 | Ga0070679_100148260 | Ga0070679_1001482602 | 313 |
| 187 | 3300009093 | Ga0105240_10044793 | Ga0105240_100447935 | 313 |
| 188 | 3300009551 | Ga0105238_10007012 | Ga0105238_100070128 | 313 |
| 189 | 3300013105 | Ga0157369_10081837 | Ga0157369_100818375 | 313 |
| 190 | 3300013307 | Ga0157372_10016133 | Ga0157372_100161337 | 313 |
| 191 | 3300014326 | Ga0157380_10026688 | Ga0157380_100266885 | 313 |
| 192 | 3300025315 | Ga0207697_10060294 | Ga0207697_100602942 | 313 |
| 193 | 3300025919 | Ga0207657_10000862 | Ga0207657_1000086230 | 313 |
| 194 | 3300025921 | Ga0207652_10265625 | Ga0207652_102656252 | 313 |
| 195 | 3300025924 | Ga0207694_10009876 | Ga0207694_100098768 | 313 |
| 196 | 3300025944 | Ga0207661_10013509 | Ga0207661_100135093 | 313 |
| 197 | 3300026142 | Ga0207698_10004191 | Ga0207698_100041916 | 313 |
| 198 | 3300031852 | Ga0307410_10022840 | Ga0307410_100228407 | 313 |
| 199 | 3300037418 | Ga0395900_0024262 | Ga0395900_0024262_1659_2708 | 313 |
| 200 | 3300037466 | Ga0395898_0099032 | Ga0395898_0099032_1163_2212 | 313 |
| 201 | 3300005353 | Ga0070669_100033628 | Ga0070669_1000336282 | 315 |
| 202 | 3300005617 | Ga0068859_100301527 | Ga0068859_1003015273 | 315 |
| 203 | 3300006931 | Ga0097620_100301536 | Ga0097620_1003015363 | 315 |
| 204 | 3300009177 | Ga0105248_10430073 | Ga0105248_104300732 | 315 |
| 205 | 3300013105 | Ga0157369_10023345 | Ga0157369_100233456 | 315 |
| 206 | 3300025941 | Ga0207711_10207423 | Ga0207711_102074233 | 315 |
| 207 | 3300028381 | Ga0268264_10012327 | Ga0268264_100123277 | 315 |
| 208 | 3300037471 | Ga0395905_0316465 | Ga0395905_0316465_270_1319 | 315 |
| 209 | 3300047445 | Ga0495677_0020234 | Ga0495677_0020234_1250_2296 | 315 |
| 210 | 3300025904 | Ga0207647_10020274 | Ga0207647_100202745 | 316 |
| 211 | 3300037471 | Ga0395905_0270998 | Ga0395905_0270998_132_1181 | 316 |
| 212 | 3300045976 | Ga0466967_0111026 | Ga0466967_0111026_722_1771 | 316 |
| 213 | 3300046684 | Ga0495669_0000579 | Ga0495669_0000579_11063_12112 | 316 |
| 214 | 3300006237 | Ga0097621_100175142 | Ga0097621_1001751422 | 318 |
| 215 | 3300006358 | Ga0068871_100084649 | Ga0068871_1000846493 | 318 |
| 216 | 3300025933 | Ga0207706_10004100 | Ga0207706_1000410014 | 318 |
| 217 | 3300026116 | Ga0207674_10007687 | Ga0207674_1000768712 | 318 |
| 218 | 3300037471 | Ga0395905_0069931 | Ga0395905_0069931_1584_2633 | 318 |
| 219 | 3300038443 | Ga0395901_0389380 | Ga0395901_0389380_392_1423 | 318 |
| 220 | 3300005336 | Ga0070680_100000455 | Ga0070680_1000004557 | 319 |
| 221 | 3300013104 | Ga0157370_10018538 | Ga0157370_100185382 | 319 |
| 222 | 3300025917 | Ga0207660_10000483 | Ga0207660_1000048310 | 319 |
| 223 | 3300026078 | Ga0207702_10221104 | Ga0207702_102211042 | 319 |
| 224 | 3300005330 | Ga0070690_100013058 | Ga0070690_1000130585 | 320 |
| 225 | 3300005335 | Ga0070666_10000731 | Ga0070666_100007315 | 320 |
| 226 | 3300005338 | Ga0068868_100002334 | Ga0068868_1000023347 | 320 |
| 227 | 3300005343 | Ga0070687_100028974 | Ga0070687_1000289743 | 320 |
| 228 | 3300005355 | Ga0070671_100005756 | Ga0070671_10000575610 | 320 |
| 229 | 3300005355 | Ga0070671_100032862 | Ga0070671_1000328624 | 320 |
| 230 | 3300005356 | Ga0070674_100027796 | Ga0070674_1000277963 | 320 |
| 231 | 3300005364 | Ga0070673_100040011 | Ga0070673_1000400113 | 320 |
| 232 | 3300005367 | Ga0070667_100001536 | Ga0070667_10000153620 | 320 |
| 233 | 3300005457 | Ga0070662_100057048 | Ga0070662_1000570482 | 320 |
| 234 | 3300005842 | Ga0068858_100003796 | Ga0068858_1000037967 | 320 |
| 235 | 3300005843 | Ga0068860_100146327 | Ga0068860_1001463273 | 320 |
| 236 | 3300009148 | Ga0105243_10081004 | Ga0105243_100810042 | 320 |
| 237 | 3300009177 | Ga0105248_10000268 | Ga0105248_1000026826 | 320 |
| 238 | 3300025918 | Ga0207662_10021965 | Ga0207662_100219656 | 320 |
| 239 | 3300025931 | Ga0207644_10000186 | Ga0207644_1000018625 | 320 |
| 240 | 3300025931 | Ga0207644_10014933 | Ga0207644_100149337 | 320 |
| 241 | 3300025933 | Ga0207706_10037895 | Ga0207706_100378952 | 320 |
| 242 | 3300025935 | Ga0207709_10030946 | Ga0207709_100309464 | 320 |
| 243 | 3300025940 | Ga0207691_10141594 | Ga0207691_101415944 | 320 |
| 244 | 3300025941 | Ga0207711_10000333 | Ga0207711_1000033344 | 320 |
| 245 | 3300025986 | Ga0207658_10004146 | Ga0207658_100041468 | 320 |
| 246 | 3300026023 | Ga0207677_10000665 | Ga0207677_1000066511 | 320 |
| 247 | 3300026035 | Ga0207703_10002818 | Ga0207703_100028187 | 320 |
| 248 | 3300026089 | Ga0207648_10183064 | Ga0207648_101830642 | 320 |
| 249 | 3300028381 | Ga0268264_10073390 | Ga0268264_100733903 | 320 |
| 250 | 3300048915 | Ga0496112_0292382 | Ga0496112_0292382_332_1381 | 320 |
| 251 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001265 | 321 |
| 252 | 3300005327 | Ga0070658_10001369 | Ga0070658_1000136913 | 321 |
| 253 | 3300005328 | Ga0070676_10197552 | Ga0070676_101975522 | 321 |
| 254 | 3300005333 | Ga0070677_10000735 | Ga0070677_100007355 | 321 |
| 255 | 3300005339 | Ga0070660_100000196 | Ga0070660_10000019628 | 321 |
| 256 | 3300005339 | Ga0070660_100000441 | Ga0070660_1000004413 | 321 |
| 257 | 3300005344 | Ga0070661_100273782 | Ga0070661_1002737821 | 321 |
| 258 | 3300005353 | Ga0070669_100046775 | Ga0070669_1000467753 | 321 |
| 259 | 3300005354 | Ga0070675_100007982 | Ga0070675_1000079829 | 321 |
| 260 | 3300005457 | Ga0070662_100003210 | Ga0070662_1000032105 | 321 |
| 261 | 3300005543 | Ga0070672_100012803 | Ga0070672_1000128035 | 321 |
| 262 | 3300005563 | Ga0068855_100000408 | Ga0068855_10000040828 | 321 |
| 263 | 3300013102 | Ga0157371_10001960 | Ga0157371_1000196017 | 321 |
| 264 | 3300013104 | Ga0157370_10242700 | Ga0157370_102427002 | 321 |
| 265 | 3300025893 | Ga0207682_10002976 | Ga0207682_100029765 | 321 |
| 266 | 3300025907 | Ga0207645_10077355 | Ga0207645_100773553 | 321 |
| 267 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021613 | 321 |
| 268 | 3300025909 | Ga0207705_10000166 | Ga0207705_1000016628 | 321 |
| 269 | 3300025909 | Ga0207705_10050240 | Ga0207705_100502402 | 321 |
| 270 | 3300025919 | Ga0207657_10002065 | Ga0207657_1000206514 | 321 |
| 271 | 3300025919 | Ga0207657_10006334 | Ga0207657_100063343 | 321 |
| 272 | 3300025923 | Ga0207681_10046614 | Ga0207681_100466145 | 321 |
| 273 | 3300025933 | Ga0207706_10034743 | Ga0207706_100347435 | 321 |
| 274 | 3300025949 | Ga0207667_10001086 | Ga0207667_100010868 | 321 |
| 275 | 3300031731 | Ga0307405_10059792 | Ga0307405_100597922 | 321 |
| 276 | 3300031852 | Ga0307410_10019226 | Ga0307410_100192262 | 321 |
| 277 | 3300031852 | Ga0307410_10198683 | Ga0307410_101986833 | 321 |
| 278 | 3300031903 | Ga0307407_10043525 | Ga0307407_100435252 | 321 |
| 279 | 3300031911 | Ga0307412_10003002 | Ga0307412_100030025 | 321 |
| 280 | 3300031995 | Ga0307409_100026203 | Ga0307409_1000262032 | 321 |
| 281 | 3300031995 | Ga0307409_100093169 | Ga0307409_1000931694 | 321 |
| 282 | 3300032002 | Ga0307416_100313979 | Ga0307416_1003139793 | 321 |
| 283 | 3300032004 | Ga0307414_10048311 | Ga0307414_100483115 | 321 |
| 284 | 3300032005 | Ga0307411_10000438 | Ga0307411_100004389 | 321 |
| 285 | 3300037418 | Ga0395900_0149964 | Ga0395900_0149964_1305_2351 | 321 |
| 286 | 3300046539 | Ga0495621_0064693 | Ga0495621_0064693_226_1272 | 321 |
| 287 | 3300001904 | JGI24736J21556_1007340 | JGI24736J21556_10073402 | 322 |
| 288 | 3300001915 | JGI24741J21665_1007685 | JGI24741J21665_10076854 | 322 |
| 289 | 3300001979 | JGI24740J21852_10003460 | JGI24740J21852_100034605 | 322 |
| 290 | 3300001979 | JGI24740J21852_10003889 | JGI24740J21852_100038894 | 322 |
| 291 | 3300001989 | JGI24739J22299_10000218 | JGI24739J22299_1000021819 | 322 |
| 292 | 3300001989 | JGI24739J22299_10001372 | JGI24739J22299_1000137210 | 322 |
| 293 | 3300001989 | JGI24739J22299_10014854 | JGI24739J22299_100148546 | 322 |
| 294 | 3300001990 | JGI24737J22298_10006943 | JGI24737J22298_100069432 | 322 |
| 295 | 3300001990 | JGI24737J22298_10021448 | JGI24737J22298_100214483 | 322 |
| 296 | 3300002067 | JGI24735J21928_10009988 | JGI24735J21928_100099882 | 322 |
| 297 | 3300002067 | JGI24735J21928_10011025 | JGI24735J21928_100110254 | 322 |
| 298 | 3300002075 | JGI24738J21930_10007099 | JGI24738J21930_100070995 | 322 |
| 299 | 3300002075 | JGI24738J21930_10009853 | JGI24738J21930_100098533 | 322 |
| 300 | 3300005327 | Ga0070658_10000426 | Ga0070658_1000042613 | 322 |
| 301 | 3300005327 | Ga0070658_10015608 | Ga0070658_100156086 | 322 |
| 302 | 3300005327 | Ga0070658_10047146 | Ga0070658_100471462 | 322 |
| 303 | 3300005327 | Ga0070658_10058028 | Ga0070658_100580285 | 322 |
| 304 | 3300005327 | Ga0070658_10058443 | Ga0070658_100584433 | 322 |
| 305 | 3300005327 | Ga0070658_10094141 | Ga0070658_100941414 | 322 |
| 306 | 3300005328 | Ga0070676_10030697 | Ga0070676_100306975 | 322 |
| 307 | 3300005329 | Ga0070683_100042584 | Ga0070683_1000425845 | 322 |
| 308 | 3300005329 | Ga0070683_100053839 | Ga0070683_1000538395 | 322 |
| 309 | 3300005329 | Ga0070683_100058792 | Ga0070683_1000587923 | 322 |
| 310 | 3300005330 | Ga0070690_100009606 | Ga0070690_1000096067 | 322 |
| 311 | 3300005331 | Ga0070670_100000600 | Ga0070670_10000060028 | 322 |
| 312 | 3300005331 | Ga0070670_100020985 | Ga0070670_1000209855 | 322 |
| 313 | 3300005331 | Ga0070670_100024180 | Ga0070670_1000241807 | 322 |
| 314 | 3300005331 | Ga0070670_100084867 | Ga0070670_1000848675 | 322 |
| 315 | 3300005331 | Ga0070670_100157626 | Ga0070670_1001576262 | 322 |
| 316 | 3300005333 | Ga0070677_10000470 | Ga0070677_1000047010 | 322 |
| 317 | 3300005333 | Ga0070677_10007431 | Ga0070677_100074313 | 322 |
| 318 | 3300005335 | Ga0070666_10000527 | Ga0070666_1000052722 | 322 |
| 319 | 3300005335 | Ga0070666_10002935 | Ga0070666_100029352 | 322 |
| 320 | 3300005335 | Ga0070666_10004646 | Ga0070666_100046468 | 322 |
| 321 | 3300005336 | Ga0070680_100008690 | Ga0070680_1000086908 | 322 |
| 322 | 3300005336 | Ga0070680_100027597 | Ga0070680_1000275976 | 322 |
| 323 | 3300005336 | Ga0070680_100145463 | Ga0070680_1001454632 | 322 |
| 324 | 3300005337 | Ga0070682_100011412 | Ga0070682_1000114127 | 322 |
| 325 | 3300005338 | Ga0068868_100008603 | Ga0068868_1000086032 | 322 |
| 326 | 3300005339 | Ga0070660_100000055 | Ga0070660_10000005515 | 322 |
| 327 | 3300005339 | Ga0070660_100003142 | Ga0070660_10000314214 | 322 |
| 328 | 3300005339 | Ga0070660_100005952 | Ga0070660_1000059523 | 322 |
| 329 | 3300005339 | Ga0070660_100068737 | Ga0070660_1000687374 | 322 |
| 330 | 3300005341 | Ga0070691_10005536 | Ga0070691_100055365 | 322 |
| 331 | 3300005344 | Ga0070661_100000112 | Ga0070661_10000011256 | 322 |
| 332 | 3300005344 | Ga0070661_100028151 | Ga0070661_1000281514 | 322 |
| 333 | 3300005344 | Ga0070661_100034264 | Ga0070661_1000342642 | 322 |
| 334 | 3300005347 | Ga0070668_100006467 | Ga0070668_1000064679 | 322 |
| 335 | 3300005353 | Ga0070669_100006302 | Ga0070669_10000630210 | 322 |
| 336 | 3300005354 | Ga0070675_100009299 | Ga0070675_1000092996 | 322 |
| 337 | 3300005355 | Ga0070671_100000190 | Ga0070671_10000019021 | 322 |
| 338 | 3300005355 | Ga0070671_100008115 | Ga0070671_1000081155 | 322 |
| 339 | 3300005355 | Ga0070671_100012610 | Ga0070671_1000126108 | 322 |
| 340 | 3300005355 | Ga0070671_100022674 | Ga0070671_1000226747 | 322 |
| 341 | 3300005355 | Ga0070671_100037062 | Ga0070671_1000370622 | 322 |
| 342 | 3300005356 | Ga0070674_100038592 | Ga0070674_1000385925 | 322 |
| 343 | 3300005356 | Ga0070674_100039714 | Ga0070674_1000397142 | 322 |
| 344 | 3300005356 | Ga0070674_100081424 | Ga0070674_1000814243 | 322 |
| 345 | 3300005364 | Ga0070673_100004514 | Ga0070673_10000451410 | 322 |
| 346 | 3300005364 | Ga0070673_100040329 | Ga0070673_1000403295 | 322 |
| 347 | 3300005366 | Ga0070659_100000295 | Ga0070659_10000029513 | 322 |
| 348 | 3300005366 | Ga0070659_100005980 | Ga0070659_1000059805 | 322 |
| 349 | 3300005366 | Ga0070659_100031126 | Ga0070659_1000311265 | 322 |
| 350 | 3300005366 | Ga0070659_100035310 | Ga0070659_1000353105 | 322 |
| 351 | 3300005366 | Ga0070659_100188507 | Ga0070659_1001885072 | 322 |
| 352 | 3300005367 | Ga0070667_100007857 | Ga0070667_1000078575 | 322 |
| 353 | 3300005367 | Ga0070667_100012023 | Ga0070667_1000120234 | 322 |
| 354 | 3300005367 | Ga0070667_100024176 | Ga0070667_1000241764 | 322 |
| 355 | 3300005367 | Ga0070667_100047454 | Ga0070667_1000474542 | 322 |
| 356 | 3300005367 | Ga0070667_100127810 | Ga0070667_1001278101 | 322 |
| 357 | 3300005367 | Ga0070667_100139951 | Ga0070667_1001399513 | 322 |
| 358 | 3300005367 | Ga0070667_100229598 | Ga0070667_1002295982 | 322 |
| 359 | 3300005434 | Ga0070709_10010514 | Ga0070709_100105144 | 322 |
| 360 | 3300005435 | Ga0070714_100025773 | Ga0070714_1000257737 | 322 |
| 361 | 3300005435 | Ga0070714_100111912 | Ga0070714_1001119124 | 322 |
| 362 | 3300005435 | Ga0070714_100289642 | Ga0070714_1002896422 | 322 |
| 363 | 3300005436 | Ga0070713_100010126 | Ga0070713_1000101265 | 322 |
| 364 | 3300005444 | Ga0070694_100033313 | Ga0070694_1000333135 | 322 |
| 365 | 3300005455 | Ga0070663_100000130 | Ga0070663_10000013033 | 322 |
| 366 | 3300005455 | Ga0070663_100010112 | Ga0070663_1000101124 | 322 |
| 367 | 3300005455 | Ga0070663_100064756 | Ga0070663_1000647564 | 322 |
| 368 | 3300005456 | Ga0070678_100058163 | Ga0070678_1000581632 | 322 |
| 369 | 3300005456 | Ga0070678_100078439 | Ga0070678_1000784391 | 322 |
| 370 | 3300005457 | Ga0070662_100000115 | Ga0070662_10000011529 | 322 |
| 371 | 3300005457 | Ga0070662_100001246 | Ga0070662_1000012469 | 322 |
| 372 | 3300005457 | Ga0070662_100007707 | Ga0070662_1000077076 | 322 |
| 373 | 3300005457 | Ga0070662_100159844 | Ga0070662_1001598442 | 322 |
| 374 | 3300005457 | Ga0070662_100185634 | Ga0070662_1001856342 | 322 |
| 375 | 3300005458 | Ga0070681_10020816 | Ga0070681_100208164 | 322 |
| 376 | 3300005458 | Ga0070681_10293180 | Ga0070681_102931802 | 322 |
| 377 | 3300005459 | Ga0068867_100017080 | Ga0068867_1000170803 | 322 |
| 378 | 3300005459 | Ga0068867_100020911 | Ga0068867_1000209117 | 322 |
| 379 | 3300005459 | Ga0068867_100228984 | Ga0068867_1002289842 | 322 |
| 380 | 3300005530 | Ga0070679_100085003 | Ga0070679_1000850033 | 322 |
| 381 | 3300005530 | Ga0070679_100088611 | Ga0070679_1000886112 | 322 |
| 382 | 3300005535 | Ga0070684_100004039 | Ga0070684_10000403913 | 322 |
| 383 | 3300005535 | Ga0070684_100005057 | Ga0070684_10000505712 | 322 |
| 384 | 3300005535 | Ga0070684_100170801 | Ga0070684_1001708012 | 322 |
| 385 | 3300005535 | Ga0070684_100197560 | Ga0070684_1001975603 | 322 |
| 386 | 3300005539 | Ga0068853_100001932 | Ga0068853_1000019325 | 322 |
| 387 | 3300005539 | Ga0068853_100004667 | Ga0068853_10000466710 | 322 |
| 388 | 3300005539 | Ga0068853_100007042 | Ga0068853_1000070428 | 322 |
| 389 | 3300005539 | Ga0068853_100043798 | Ga0068853_1000437984 | 322 |
| 390 | 3300005539 | Ga0068853_100272269 | Ga0068853_1002722692 | 322 |
| 391 | 3300005539 | Ga0068853_100278189 | Ga0068853_1002781892 | 322 |
| 392 | 3300005543 | Ga0070672_100181029 | Ga0070672_1001810292 | 322 |
| 393 | 3300005544 | Ga0070686_100000281 | Ga0070686_10000028118 | 322 |
| 394 | 3300005544 | Ga0070686_100053895 | Ga0070686_1000538953 | 322 |
| 395 | 3300005545 | Ga0070695_100027094 | Ga0070695_1000270942 | 322 |
| 396 | 3300005546 | Ga0070696_100045559 | Ga0070696_1000455593 | 322 |
| 397 | 3300005548 | Ga0070665_100003880 | Ga0070665_1000038805 | 322 |
| 398 | 3300005548 | Ga0070665_100004751 | Ga0070665_1000047518 | 322 |
| 399 | 3300005548 | Ga0070665_100011278 | Ga0070665_1000112781 | 322 |
| 400 | 3300005548 | Ga0070665_100015253 | Ga0070665_1000152535 | 322 |
| 401 | 3300005548 | Ga0070665_100018136 | Ga0070665_1000181367 | 322 |
| 402 | 3300005548 | Ga0070665_100174154 | Ga0070665_1001741542 | 322 |
| 403 | 3300005563 | Ga0068855_100006972 | Ga0068855_1000069729 | 322 |
| 404 | 3300005563 | Ga0068855_100036336 | Ga0068855_1000363367 | 322 |
| 405 | 3300005563 | Ga0068855_100099684 | Ga0068855_1000996842 | 322 |
| 406 | 3300005563 | Ga0068855_100100029 | Ga0068855_1001000296 | 322 |
| 407 | 3300005563 | Ga0068855_100108130 | Ga0068855_1001081301 | 322 |
| 408 | 3300005563 | Ga0068855_100144125 | Ga0068855_1001441255 | 322 |
| 409 | 3300005563 | Ga0068855_100350056 | Ga0068855_1003500562 | 322 |
| 410 | 3300005563 | Ga0068855_100466778 | Ga0068855_1004667782 | 322 |
| 411 | 3300005564 | Ga0070664_100000933 | Ga0070664_10000093314 | 322 |
| 412 | 3300005564 | Ga0070664_100003183 | Ga0070664_1000031839 | 322 |
| 413 | 3300005564 | Ga0070664_100025114 | Ga0070664_1000251145 | 322 |
| 414 | 3300005564 | Ga0070664_100052610 | Ga0070664_1000526104 | 322 |
| 415 | 3300005564 | Ga0070664_100065205 | Ga0070664_1000652052 | 322 |
| 416 | 3300005577 | Ga0068857_100005434 | Ga0068857_1000054345 | 322 |
| 417 | 3300005577 | Ga0068857_100032781 | Ga0068857_1000327815 | 322 |
| 418 | 3300005577 | Ga0068857_100033106 | Ga0068857_1000331064 | 322 |
| 419 | 3300005577 | Ga0068857_100148158 | Ga0068857_1001481582 | 322 |
| 420 | 3300005577 | Ga0068857_100171145 | Ga0068857_1001711453 | 322 |
| 421 | 3300005577 | Ga0068857_100213457 | Ga0068857_1002134572 | 322 |
| 422 | 3300005577 | Ga0068857_100391771 | Ga0068857_1003917711 | 322 |
| 423 | 3300005578 | Ga0068854_100006255 | Ga0068854_1000062555 | 322 |
| 424 | 3300005578 | Ga0068854_100016820 | Ga0068854_1000168205 | 322 |
| 425 | 3300005578 | Ga0068854_100056441 | Ga0068854_1000564414 | 322 |
| 426 | 3300005614 | Ga0068856_100000085 | Ga0068856_10000008533 | 322 |
| 427 | 3300005614 | Ga0068856_100030461 | Ga0068856_1000304617 | 322 |
| 428 | 3300005614 | Ga0068856_100090096 | Ga0068856_1000900965 | 322 |
| 429 | 3300005614 | Ga0068856_100116671 | Ga0068856_1001166715 | 322 |
| 430 | 3300005614 | Ga0068856_100144965 | Ga0068856_1001449654 | 322 |
| 431 | 3300005616 | Ga0068852_100001072 | Ga0068852_10000107210 | 322 |
| 432 | 3300005616 | Ga0068852_100001549 | Ga0068852_1000015498 | 322 |
| 433 | 3300005616 | Ga0068852_100001798 | Ga0068852_1000017986 | 322 |
| 434 | 3300005616 | Ga0068852_100018575 | Ga0068852_1000185752 | 322 |
| 435 | 3300005616 | Ga0068852_100025907 | Ga0068852_1000259077 | 322 |
| 436 | 3300005616 | Ga0068852_100028205 | Ga0068852_1000282052 | 322 |
| 437 | 3300005617 | Ga0068859_100016908 | Ga0068859_1000169087 | 322 |
| 438 | 3300005617 | Ga0068859_100097212 | Ga0068859_1000972123 | 322 |
| 439 | 3300005617 | Ga0068859_100108682 | Ga0068859_1001086822 | 322 |
| 440 | 3300005618 | Ga0068864_100008279 | Ga0068864_1000082798 | 322 |
| 441 | 3300005618 | Ga0068864_100039352 | Ga0068864_1000393524 | 322 |
| 442 | 3300005618 | Ga0068864_100049860 | Ga0068864_1000498605 | 322 |
| 443 | 3300005834 | Ga0068851_10044841 | Ga0068851_100448413 | 322 |
| 444 | 3300005834 | Ga0068851_10060532 | Ga0068851_100605322 | 322 |
| 445 | 3300005841 | Ga0068863_100002819 | Ga0068863_10000281913 | 322 |
| 446 | 3300005841 | Ga0068863_100007439 | Ga0068863_1000074399 | 322 |
| 447 | 3300005841 | Ga0068863_100180412 | Ga0068863_1001804122 | 322 |
| 448 | 3300005842 | Ga0068858_100029127 | Ga0068858_1000291277 | 322 |
| 449 | 3300005842 | Ga0068858_100039770 | Ga0068858_1000397704 | 322 |
| 450 | 3300005843 | Ga0068860_100008637 | Ga0068860_10000863710 | 322 |
| 451 | 3300006028 | Ga0070717_10021920 | Ga0070717_100219207 | 322 |
| 452 | 3300006173 | Ga0070716_100164059 | Ga0070716_1001640592 | 322 |
| 453 | 3300006880 | Ga0075429_100220344 | Ga0075429_1002203442 | 322 |
| 454 | 3300006881 | Ga0068865_100003264 | Ga0068865_1000032644 | 322 |
| 455 | 3300006931 | Ga0097620_100016909 | Ga0097620_1000169097 | 322 |
| 456 | 3300006931 | Ga0097620_100097212 | Ga0097620_1000972123 | 322 |
| 457 | 3300006931 | Ga0097620_100108684 | Ga0097620_1001086842 | 322 |
| 458 | 3300009093 | Ga0105240_10036008 | Ga0105240_100360082 | 322 |
| 459 | 3300009094 | Ga0111539_10017870 | Ga0111539_100178706 | 322 |
| 460 | 3300009098 | Ga0105245_10002347 | Ga0105245_100023479 | 322 |
| 461 | 3300009174 | Ga0105241_10096072 | Ga0105241_100960722 | 322 |
| 462 | 3300009177 | Ga0105248_10000059 | Ga0105248_10000059144 | 322 |
| 463 | 3300009177 | Ga0105248_10002245 | Ga0105248_1000224512 | 322 |
| 464 | 3300009177 | Ga0105248_10002563 | Ga0105248_100025637 | 322 |
| 465 | 3300009177 | Ga0105248_10003138 | Ga0105248_1000313815 | 322 |
| 466 | 3300009177 | Ga0105248_10003624 | Ga0105248_100036245 | 322 |
| 467 | 3300009177 | Ga0105248_10060278 | Ga0105248_100602783 | 322 |
| 468 | 3300009177 | Ga0105248_10197090 | Ga0105248_101970902 | 322 |
| 469 | 3300009177 | Ga0105248_10223559 | Ga0105248_102235593 | 322 |
| 470 | 3300009545 | Ga0105237_10019163 | Ga0105237_100191633 | 322 |
| 471 | 3300009545 | Ga0105237_10023803 | Ga0105237_100238034 | 322 |
| 472 | 3300009551 | Ga0105238_10059870 | Ga0105238_100598705 | 322 |
| 473 | 3300009551 | Ga0105238_10197792 | Ga0105238_101977921 | 322 |
| 474 | 3300010375 | Ga0105239_10137250 | Ga0105239_101372505 | 322 |
| 475 | 3300010375 | Ga0105239_10296507 | Ga0105239_102965072 | 322 |
| 476 | 3300013100 | Ga0157373_10021754 | Ga0157373_100217543 | 322 |
| 477 | 3300013100 | Ga0157373_10053459 | Ga0157373_100534592 | 322 |
| 478 | 3300013100 | Ga0157373_10086074 | Ga0157373_100860741 | 322 |
| 479 | 3300013102 | Ga0157371_10000867 | Ga0157371_1000086723 | 322 |
| 480 | 3300013102 | Ga0157371_10014338 | Ga0157371_100143386 | 322 |
| 481 | 3300013102 | Ga0157371_10034117 | Ga0157371_100341176 | 322 |
| 482 | 3300013102 | Ga0157371_10040453 | Ga0157371_100404533 | 322 |
| 483 | 3300013104 | Ga0157370_10013534 | Ga0157370_100135347 | 322 |
| 484 | 3300013104 | Ga0157370_10047396 | Ga0157370_100473965 | 322 |
| 485 | 3300013105 | Ga0157369_10007451 | Ga0157369_100074512 | 322 |
| 486 | 3300013105 | Ga0157369_10063082 | Ga0157369_100630826 | 322 |
| 487 | 3300013105 | Ga0157369_10129649 | Ga0157369_101296492 | 322 |
| 488 | 3300013105 | Ga0157369_10163360 | Ga0157369_101633601 | 322 |
| 489 | 3300013296 | Ga0157374_10004825 | Ga0157374_100048258 | 322 |
| 490 | 3300013296 | Ga0157374_10075159 | Ga0157374_100751594 | 322 |
| 491 | 3300013297 | Ga0157378_10024998 | Ga0157378_100249987 | 322 |
| 492 | 3300013306 | Ga0163162_10619920 | Ga0163162_106199202 | 322 |
| 493 | 3300013307 | Ga0157372_10039241 | Ga0157372_100392412 | 322 |
| 494 | 3300013307 | Ga0157372_10148324 | Ga0157372_101483245 | 322 |
| 495 | 3300013308 | Ga0157375_10023649 | Ga0157375_100236495 | 322 |
| 496 | 3300013308 | Ga0157375_10104424 | Ga0157375_101044245 | 322 |
| 497 | 3300014968 | Ga0157379_10003799 | Ga0157379_1000379911 | 322 |
| 498 | 3300014969 | Ga0157376_10057055 | Ga0157376_100570552 | 322 |
| 499 | 3300017792 | Ga0163161_10027464 | Ga0163161_100274646 | 322 |
| 500 | 3300017792 | Ga0163161_10173180 | Ga0163161_101731803 | 322 |
| 501 | 3300017792 | Ga0163161_10362251 | Ga0163161_103622511 | 322 |
| 502 | 3300020082 | Ga0206353_10967685 | Ga0206353_109676853 | 322 |
| 503 | 3300021384 | Ga0213876_10000766 | Ga0213876_1000076625 | 322 |
| 504 | 3300021384 | Ga0213876_10015041 | Ga0213876_100150415 | 322 |
| 505 | 3300025315 | Ga0207697_10002577 | Ga0207697_100025777 | 322 |
| 506 | 3300025321 | Ga0207656_10037955 | Ga0207656_100379553 | 322 |
| 507 | 3300025893 | Ga0207682_10000618 | Ga0207682_1000061810 | 322 |
| 508 | 3300025893 | Ga0207682_10007641 | Ga0207682_100076416 | 322 |
| 509 | 3300025901 | Ga0207688_10000353 | Ga0207688_1000035315 | 322 |
| 510 | 3300025903 | Ga0207680_10000491 | Ga0207680_1000049115 | 322 |
| 511 | 3300025904 | Ga0207647_10001007 | Ga0207647_1000100725 | 322 |
| 512 | 3300025904 | Ga0207647_10002939 | Ga0207647_1000293910 | 322 |
| 513 | 3300025904 | Ga0207647_10008274 | Ga0207647_100082748 | 322 |
| 514 | 3300025904 | Ga0207647_10012532 | Ga0207647_100125327 | 322 |
| 515 | 3300025904 | Ga0207647_10017866 | Ga0207647_100178666 | 322 |
| 516 | 3300025904 | Ga0207647_10031649 | Ga0207647_100316494 | 322 |
| 517 | 3300025904 | Ga0207647_10075380 | Ga0207647_100753803 | 322 |
| 518 | 3300025907 | Ga0207645_10004867 | Ga0207645_100048675 | 322 |
| 519 | 3300025907 | Ga0207645_10066560 | Ga0207645_100665602 | 322 |
| 520 | 3300025909 | Ga0207705_10000269 | Ga0207705_1000026950 | 322 |
| 521 | 3300025909 | Ga0207705_10009323 | Ga0207705_100093236 | 322 |
| 522 | 3300025909 | Ga0207705_10017955 | Ga0207705_100179555 | 322 |
| 523 | 3300025909 | Ga0207705_10020370 | Ga0207705_100203703 | 322 |
| 524 | 3300025912 | Ga0207707_10095419 | Ga0207707_100954194 | 322 |
| 525 | 3300025913 | Ga0207695_10004498 | Ga0207695_100044989 | 322 |
| 526 | 3300025914 | Ga0207671_10012746 | Ga0207671_100127469 | 322 |
| 527 | 3300025917 | Ga0207660_10007968 | Ga0207660_100079683 | 322 |
| 528 | 3300025918 | Ga0207662_10073579 | Ga0207662_100735792 | 322 |
| 529 | 3300025919 | Ga0207657_10000015 | Ga0207657_1000001589 | 322 |
| 530 | 3300025919 | Ga0207657_10008888 | Ga0207657_100088888 | 322 |
| 531 | 3300025919 | Ga0207657_10014072 | Ga0207657_100140729 | 322 |
| 532 | 3300025919 | Ga0207657_10020592 | Ga0207657_100205926 | 322 |
| 533 | 3300025919 | Ga0207657_10032256 | Ga0207657_100322565 | 322 |
| 534 | 3300025919 | Ga0207657_10042250 | Ga0207657_100422502 | 322 |
| 535 | 3300025920 | Ga0207649_10000150 | Ga0207649_1000015041 | 322 |
| 536 | 3300025920 | Ga0207649_10003368 | Ga0207649_100033686 | 322 |
| 537 | 3300025920 | Ga0207649_10132304 | Ga0207649_101323043 | 322 |
| 538 | 3300025921 | Ga0207652_10006880 | Ga0207652_100068808 | 322 |
| 539 | 3300025923 | Ga0207681_10038332 | Ga0207681_100383325 | 322 |
| 540 | 3300025923 | Ga0207681_10051432 | Ga0207681_100514323 | 322 |
| 541 | 3300025923 | Ga0207681_10174191 | Ga0207681_101741912 | 322 |
| 542 | 3300025924 | Ga0207694_10005366 | Ga0207694_100053662 | 322 |
| 543 | 3300025924 | Ga0207694_10142870 | Ga0207694_101428703 | 322 |
| 544 | 3300025925 | Ga0207650_10003435 | Ga0207650_100034359 | 322 |
| 545 | 3300025925 | Ga0207650_10007991 | Ga0207650_100079915 | 322 |
| 546 | 3300025925 | Ga0207650_10023960 | Ga0207650_100239605 | 322 |
| 547 | 3300025926 | Ga0207659_10006496 | Ga0207659_100064967 | 322 |
| 548 | 3300025926 | Ga0207659_10053347 | Ga0207659_100533472 | 322 |
| 549 | 3300025927 | Ga0207687_10027837 | Ga0207687_100278375 | 322 |
| 550 | 3300025929 | Ga0207664_10194887 | Ga0207664_101948873 | 322 |
| 551 | 3300025931 | Ga0207644_10000429 | Ga0207644_1000042919 | 322 |
| 552 | 3300025931 | Ga0207644_10004275 | Ga0207644_1000427510 | 322 |
| 553 | 3300025931 | Ga0207644_10012706 | Ga0207644_100127065 | 322 |
| 554 | 3300025931 | Ga0207644_10067814 | Ga0207644_100678143 | 322 |
| 555 | 3300025931 | Ga0207644_10088526 | Ga0207644_100885262 | 322 |
| 556 | 3300025931 | Ga0207644_10123907 | Ga0207644_101239074 | 322 |
| 557 | 3300025931 | Ga0207644_10162067 | Ga0207644_101620672 | 322 |
| 558 | 3300025932 | Ga0207690_10000032 | Ga0207690_10000032107 | 322 |
| 559 | 3300025932 | Ga0207690_10003727 | Ga0207690_100037276 | 322 |
| 560 | 3300025932 | Ga0207690_10003789 | Ga0207690_100037897 | 322 |
| 561 | 3300025932 | Ga0207690_10025920 | Ga0207690_100259203 | 322 |
| 562 | 3300025932 | Ga0207690_10031572 | Ga0207690_100315722 | 322 |
| 563 | 3300025932 | Ga0207690_10117364 | Ga0207690_101173642 | 322 |
| 564 | 3300025933 | Ga0207706_10000032 | Ga0207706_1000003253 | 322 |
| 565 | 3300025933 | Ga0207706_10002227 | Ga0207706_100022279 | 322 |
| 566 | 3300025933 | Ga0207706_10067864 | Ga0207706_100678641 | 322 |
| 567 | 3300025933 | Ga0207706_10078617 | Ga0207706_100786172 | 322 |
| 568 | 3300025933 | Ga0207706_10151471 | Ga0207706_101514712 | 322 |
| 569 | 3300025933 | Ga0207706_10394643 | Ga0207706_103946432 | 322 |
| 570 | 3300025937 | Ga0207669_10020695 | Ga0207669_100206952 | 322 |
| 571 | 3300025937 | Ga0207669_10121148 | Ga0207669_101211483 | 322 |
| 572 | 3300025937 | Ga0207669_10136034 | Ga0207669_101360342 | 322 |
| 573 | 3300025938 | Ga0207704_10014745 | Ga0207704_100147452 | 322 |
| 574 | 3300025939 | Ga0207665_10228107 | Ga0207665_102281072 | 322 |
| 575 | 3300025940 | Ga0207691_10002986 | Ga0207691_1000298612 | 322 |
| 576 | 3300025940 | Ga0207691_10031645 | Ga0207691_100316455 | 322 |
| 577 | 3300025940 | Ga0207691_10048439 | Ga0207691_100484395 | 322 |
| 578 | 3300025940 | Ga0207691_10192635 | Ga0207691_101926352 | 322 |
| 579 | 3300025941 | Ga0207711_10001301 | Ga0207711_1000130122 | 322 |
| 580 | 3300025941 | Ga0207711_10001758 | Ga0207711_100017587 | 322 |
| 581 | 3300025941 | Ga0207711_10003110 | Ga0207711_1000311010 | 322 |
| 582 | 3300025941 | Ga0207711_10019305 | Ga0207711_100193055 | 322 |
| 583 | 3300025941 | Ga0207711_10033336 | Ga0207711_100333362 | 322 |
| 584 | 3300025941 | Ga0207711_10186953 | Ga0207711_101869532 | 322 |
| 585 | 3300025941 | Ga0207711_10232826 | Ga0207711_102328262 | 322 |
| 586 | 3300025941 | Ga0207711_10332734 | Ga0207711_103327342 | 322 |
| 587 | 3300025942 | Ga0207689_10000922 | Ga0207689_1000092215 | 322 |
| 588 | 3300025944 | Ga0207661_10029081 | Ga0207661_100290812 | 322 |
| 589 | 3300025944 | Ga0207661_10063088 | Ga0207661_100630885 | 322 |
| 590 | 3300025944 | Ga0207661_10135829 | Ga0207661_101358292 | 322 |
| 591 | 3300025944 | Ga0207661_10409064 | Ga0207661_104090642 | 322 |
| 592 | 3300025945 | Ga0207679_10000271 | Ga0207679_1000027120 | 322 |
| 593 | 3300025945 | Ga0207679_10008597 | Ga0207679_100085972 | 322 |
| 594 | 3300025945 | Ga0207679_10023716 | Ga0207679_100237162 | 322 |
| 595 | 3300025945 | Ga0207679_10052273 | Ga0207679_100522734 | 322 |
| 596 | 3300025949 | Ga0207667_10005405 | Ga0207667_100054057 | 322 |
| 597 | 3300025949 | Ga0207667_10039316 | Ga0207667_100393165 | 322 |
| 598 | 3300025949 | Ga0207667_10085119 | Ga0207667_100851194 | 322 |
| 599 | 3300025949 | Ga0207667_10109644 | Ga0207667_101096444 | 322 |
| 600 | 3300025960 | Ga0207651_10042810 | Ga0207651_100428102 | 322 |
| 601 | 3300025960 | Ga0207651_10058013 | Ga0207651_100580134 | 322 |
| 602 | 3300025972 | Ga0207668_10008981 | Ga0207668_100089812 | 322 |
| 603 | 3300025972 | Ga0207668_10377614 | Ga0207668_103776141 | 322 |
| 604 | 3300025981 | Ga0207640_10007193 | Ga0207640_100071935 | 322 |
| 605 | 3300025981 | Ga0207640_10012843 | Ga0207640_100128438 | 322 |
| 606 | 3300025981 | Ga0207640_10027466 | Ga0207640_100274663 | 322 |
| 607 | 3300025986 | Ga0207658_10013250 | Ga0207658_100132505 | 322 |
| 608 | 3300025986 | Ga0207658_10016022 | Ga0207658_100160223 | 322 |
| 609 | 3300026035 | Ga0207703_10008965 | Ga0207703_100089654 | 322 |
| 610 | 3300026035 | Ga0207703_10045413 | Ga0207703_100454134 | 322 |
| 611 | 3300026041 | Ga0207639_10000095 | Ga0207639_1000009533 | 322 |
| 612 | 3300026041 | Ga0207639_10000661 | Ga0207639_1000066120 | 322 |
| 613 | 3300026041 | Ga0207639_10011224 | Ga0207639_100112246 | 322 |
| 614 | 3300026041 | Ga0207639_10012232 | Ga0207639_100122324 | 322 |
| 615 | 3300026041 | Ga0207639_10057519 | Ga0207639_100575195 | 322 |
| 616 | 3300026041 | Ga0207639_10111002 | Ga0207639_101110022 | 322 |
| 617 | 3300026041 | Ga0207639_10353317 | Ga0207639_103533172 | 322 |
| 618 | 3300026067 | Ga0207678_10001882 | Ga0207678_1000188211 | 322 |
| 619 | 3300026067 | Ga0207678_10004279 | Ga0207678_1000427912 | 322 |
| 620 | 3300026078 | Ga0207702_10000072 | Ga0207702_1000007282 | 322 |
| 621 | 3300026078 | Ga0207702_10005603 | Ga0207702_100056038 | 322 |
| 622 | 3300026078 | Ga0207702_10049862 | Ga0207702_100498625 | 322 |
| 623 | 3300026078 | Ga0207702_10050695 | Ga0207702_100506953 | 322 |
| 624 | 3300026078 | Ga0207702_10051375 | Ga0207702_100513756 | 322 |
| 625 | 3300026088 | Ga0207641_10030799 | Ga0207641_100307995 | 322 |
| 626 | 3300026088 | Ga0207641_10066452 | Ga0207641_100664526 | 322 |
| 627 | 3300026088 | Ga0207641_10079457 | Ga0207641_100794574 | 322 |
| 628 | 3300026089 | Ga0207648_10027330 | Ga0207648_100273308 | 322 |
| 629 | 3300026089 | Ga0207648_10099389 | Ga0207648_100993892 | 322 |
| 630 | 3300026089 | Ga0207648_10102278 | Ga0207648_101022784 | 322 |
| 631 | 3300026095 | Ga0207676_10012470 | Ga0207676_100124705 | 322 |
| 632 | 3300026095 | Ga0207676_10013720 | Ga0207676_100137206 | 322 |
| 633 | 3300026095 | Ga0207676_10031484 | Ga0207676_100314845 | 322 |
| 634 | 3300026095 | Ga0207676_10067008 | Ga0207676_100670083 | 322 |
| 635 | 3300026116 | Ga0207674_10003435 | Ga0207674_1000343514 | 322 |
| 636 | 3300026116 | Ga0207674_10003595 | Ga0207674_100035953 | 322 |
| 637 | 3300026116 | Ga0207674_10005790 | Ga0207674_100057909 | 322 |
| 638 | 3300026116 | Ga0207674_10014645 | Ga0207674_100146457 | 322 |
| 639 | 3300026116 | Ga0207674_10016319 | Ga0207674_100163197 | 322 |
| 640 | 3300026142 | Ga0207698_10002357 | Ga0207698_100023579 | 322 |
| 641 | 3300026142 | Ga0207698_10007920 | Ga0207698_100079207 | 322 |
| 642 | 3300026142 | Ga0207698_10031333 | Ga0207698_100313334 | 322 |
| 643 | 3300026142 | Ga0207698_10047191 | Ga0207698_100471912 | 322 |
| 644 | 3300026142 | Ga0207698_10135635 | Ga0207698_101356353 | 322 |
| 645 | 3300026142 | Ga0207698_10168566 | Ga0207698_101685662 | 322 |
| 646 | 3300027665 | Ga0209983_1017325 | Ga0209983_10173253 | 322 |
| 647 | 3300027876 | Ga0209974_10002037 | Ga0209974_100020375 | 322 |
| 648 | 3300028379 | Ga0268266_10000133 | Ga0268266_1000013342 | 322 |
| 649 | 3300028379 | Ga0268266_10036354 | Ga0268266_100363544 | 322 |
| 650 | 3300028379 | Ga0268266_10049953 | Ga0268266_100499531 | 322 |
| 651 | 3300028379 | Ga0268266_10061388 | Ga0268266_100613884 | 322 |
| 652 | 3300028380 | Ga0268265_10164497 | Ga0268265_101644973 | 322 |
| 653 | 3300028381 | Ga0268264_10097169 | Ga0268264_100971693 | 322 |
| 654 | 3300028381 | Ga0268264_10318367 | Ga0268264_103183672 | 322 |
| 655 | 3300031456 | Ga0307513_10313456 | Ga0307513_103134562 | 322 |
| 656 | 3300031548 | Ga0307408_100050803 | Ga0307408_1000508034 | 322 |
| 657 | 3300031548 | Ga0307408_100076126 | Ga0307408_1000761262 | 322 |
| 658 | 3300031548 | Ga0307408_100092220 | Ga0307408_1000922203 | 322 |
| 659 | 3300031548 | Ga0307408_100135591 | Ga0307408_1001355912 | 322 |
| 660 | 3300031548 | Ga0307408_100167573 | Ga0307408_1001675732 | 322 |
| 661 | 3300031731 | Ga0307405_10030264 | Ga0307405_100302644 | 322 |
| 662 | 3300031731 | Ga0307405_10065088 | Ga0307405_100650883 | 322 |
| 663 | 3300031824 | Ga0307413_10004841 | Ga0307413_100048414 | 322 |
| 664 | 3300031824 | Ga0307413_10017212 | Ga0307413_100172124 | 322 |
| 665 | 3300031824 | Ga0307413_10139219 | Ga0307413_101392193 | 322 |
| 666 | 3300031824 | Ga0307413_10198134 | Ga0307413_101981341 | 322 |
| 667 | 3300031824 | Ga0307413_10258099 | Ga0307413_102580991 | 322 |
| 668 | 3300031852 | Ga0307410_10003533 | Ga0307410_100035339 | 322 |
| 669 | 3300031852 | Ga0307410_10006803 | Ga0307410_100068033 | 322 |
| 670 | 3300031852 | Ga0307410_10014238 | Ga0307410_100142385 | 322 |
| 671 | 3300031852 | Ga0307410_10018812 | Ga0307410_100188126 | 322 |
| 672 | 3300031852 | Ga0307410_10025406 | Ga0307410_100254064 | 322 |
| 673 | 3300031852 | Ga0307410_10044056 | Ga0307410_100440565 | 322 |
| 674 | 3300031852 | Ga0307410_10065183 | Ga0307410_100651832 | 322 |
| 675 | 3300031901 | Ga0307406_10010822 | Ga0307406_100108227 | 322 |
| 676 | 3300031901 | Ga0307406_10115375 | Ga0307406_101153752 | 322 |
| 677 | 3300031903 | Ga0307407_10003942 | Ga0307407_100039428 | 322 |
| 678 | 3300031903 | Ga0307407_10017056 | Ga0307407_100170562 | 322 |
| 679 | 3300031903 | Ga0307407_10065388 | Ga0307407_100653882 | 322 |
| 680 | 3300031903 | Ga0307407_10068797 | Ga0307407_100687972 | 322 |
| 681 | 3300031911 | Ga0307412_10003426 | Ga0307412_100034268 | 322 |
| 682 | 3300031911 | Ga0307412_10013547 | Ga0307412_100135477 | 322 |
| 683 | 3300031911 | Ga0307412_10025870 | Ga0307412_100258705 | 322 |
| 684 | 3300031911 | Ga0307412_10028875 | Ga0307412_100288754 | 322 |
| 685 | 3300031911 | Ga0307412_10051568 | Ga0307412_100515683 | 322 |
| 686 | 3300031911 | Ga0307412_10162338 | Ga0307412_101623383 | 322 |
| 687 | 3300031995 | Ga0307409_100000853 | Ga0307409_1000008533 | 322 |
| 688 | 3300031995 | Ga0307409_100045824 | Ga0307409_1000458245 | 322 |
| 689 | 3300031995 | Ga0307409_100056766 | Ga0307409_1000567662 | 322 |
| 690 | 3300031995 | Ga0307409_100056820 | Ga0307409_1000568204 | 322 |
| 691 | 3300031995 | Ga0307409_100070560 | Ga0307409_1000705602 | 322 |
| 692 | 3300031995 | Ga0307409_100105858 | Ga0307409_1001058584 | 322 |
| 693 | 3300031995 | Ga0307409_100195976 | Ga0307409_1001959763 | 322 |
| 694 | 3300031995 | Ga0307409_100224721 | Ga0307409_1002247212 | 322 |
| 695 | 3300031995 | Ga0307409_100298907 | Ga0307409_1002989072 | 322 |
| 696 | 3300032002 | Ga0307416_100009956 | Ga0307416_1000099564 | 322 |
| 697 | 3300032002 | Ga0307416_100028750 | Ga0307416_1000287503 | 322 |
| 698 | 3300032002 | Ga0307416_100082875 | Ga0307416_1000828755 | 322 |
| 699 | 3300032002 | Ga0307416_100193499 | Ga0307416_1001934992 | 322 |
| 700 | 3300032002 | Ga0307416_100384885 | Ga0307416_1003848852 | 322 |
| 701 | 3300032004 | Ga0307414_10020007 | Ga0307414_100200074 | 322 |
| 702 | 3300032004 | Ga0307414_10032939 | Ga0307414_100329393 | 322 |
| 703 | 3300032004 | Ga0307414_10034633 | Ga0307414_100346332 | 322 |
| 704 | 3300032004 | Ga0307414_10040228 | Ga0307414_100402282 | 322 |
| 705 | 3300032004 | Ga0307414_10074171 | Ga0307414_100741714 | 322 |
| 706 | 3300032004 | Ga0307414_10088110 | Ga0307414_100881103 | 322 |
| 707 | 3300032005 | Ga0307411_10007464 | Ga0307411_100074645 | 322 |
| 708 | 3300032005 | Ga0307411_10008826 | Ga0307411_100088265 | 322 |
| 709 | 3300032005 | Ga0307411_10015075 | Ga0307411_100150755 | 322 |
| 710 | 3300032005 | Ga0307411_10015229 | Ga0307411_100152295 | 322 |
| 711 | 3300032005 | Ga0307411_10015257 | Ga0307411_100152571 | 322 |
| 712 | 3300032005 | Ga0307411_10017044 | Ga0307411_100170445 | 322 |
| 713 | 3300032005 | Ga0307411_10054145 | Ga0307411_100541452 | 322 |
| 714 | 3300032126 | Ga0307415_100020185 | Ga0307415_1000201853 | 322 |
| 715 | 3300032126 | Ga0307415_100022229 | Ga0307415_1000222296 | 322 |
| 716 | 3300032126 | Ga0307415_100040844 | Ga0307415_1000408442 | 322 |
| 717 | 3300032126 | Ga0307415_100047081 | Ga0307415_1000470813 | 322 |
| 718 | 3300032126 | Ga0307415_100062998 | Ga0307415_1000629984 | 322 |
| 719 | 3300032126 | Ga0307415_100076220 | Ga0307415_1000762202 | 322 |
| 720 | 3300032126 | Ga0307415_100141828 | Ga0307415_1001418281 | 322 |
| 721 | 3300032126 | Ga0307415_100201068 | Ga0307415_1002010682 | 322 |
| 722 | 3300032126 | Ga0307415_100294902 | Ga0307415_1002949021 | 322 |
| 723 | 3300035241 | Ga0373961_0029717 | Ga0373961_0029717_393_1442 | 322 |
| 724 | 3300037312 | Ga0395899_0000514 | Ga0395899_0000514_32604_33653 | 322 |
| 725 | 3300037312 | Ga0395899_0000916 | Ga0395899_0000916_23702_24751 | 322 |
| 726 | 3300037312 | Ga0395899_0013637 | Ga0395899_0013637_3697_4746 | 322 |
| 727 | 3300037312 | Ga0395899_0041447 | Ga0395899_0041447_1869_2918 | 322 |
| 728 | 3300037312 | Ga0395899_0177017 | Ga0395899_0177017_62_1111 | 322 |
| 729 | 3300037418 | Ga0395900_0000136 | Ga0395900_0000136_6590_7639 | 322 |
| 730 | 3300037418 | Ga0395900_0000572 | Ga0395900_0000572_46439_47488 | 322 |
| 731 | 3300037418 | Ga0395900_0001285 | Ga0395900_0001285_23823_24872 | 322 |
| 732 | 3300037418 | Ga0395900_0004798 | Ga0395900_0004798_12771_13820 | 322 |
| 733 | 3300037418 | Ga0395900_0011354 | Ga0395900_0011354_7879_8928 | 322 |
| 734 | 3300037418 | Ga0395900_0012338 | Ga0395900_0012338_3458_4507 | 322 |
| 735 | 3300037418 | Ga0395900_0020301 | Ga0395900_0020301_4239_5288 | 322 |
| 736 | 3300037418 | Ga0395900_0042917 | Ga0395900_0042917_2517_3566 | 322 |
| 737 | 3300037418 | Ga0395900_0051956 | Ga0395900_0051956_2385_3434 | 322 |
| 738 | 3300037418 | Ga0395900_0055218 | Ga0395900_0055218_312_1361 | 322 |
| 739 | 3300037418 | Ga0395900_0125264 | Ga0395900_0125264_525_1574 | 322 |
| 740 | 3300037418 | Ga0395900_0191437 | Ga0395900_0191437_36_1085 | 322 |
| 741 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_31614_32663 | 322 |
| 742 | 3300037466 | Ga0395898_0001920 | Ga0395898_0001920_20455_21504 | 322 |
| 743 | 3300037466 | Ga0395898_0087425 | Ga0395898_0087425_1326_2375 | 322 |
| 744 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_247866_248915 | 322 |
| 745 | 3300037471 | Ga0395905_0000165 | Ga0395905_0000165_86437_87486 | 322 |
| 746 | 3300037471 | Ga0395905_0001547 | Ga0395905_0001547_23486_24535 | 322 |
| 747 | 3300037471 | Ga0395905_0007739 | Ga0395905_0007739_7292_8341 | 322 |
| 748 | 3300037471 | Ga0395905_0008316 | Ga0395905_0008316_2617_3666 | 322 |
| 749 | 3300037471 | Ga0395905_0016186 | Ga0395905_0016186_1270_2319 | 322 |
| 750 | 3300037471 | Ga0395905_0024821 | Ga0395905_0024821_4179_5228 | 322 |
| 751 | 3300037471 | Ga0395905_0068478 | Ga0395905_0068478_515_1564 | 322 |
| 752 | 3300037471 | Ga0395905_0072145 | Ga0395905_0072145_1997_3046 | 322 |
| 753 | 3300037471 | Ga0395905_0118030 | Ga0395905_0118030_1198_2247 | 322 |
| 754 | 3300037471 | Ga0395905_0127761 | Ga0395905_0127761_690_1739 | 322 |
| 755 | 3300038443 | Ga0395901_0000030 | Ga0395901_0000030_147348_148397 | 322 |
| 756 | 3300038443 | Ga0395901_0000671 | Ga0395901_0000671_5757_6806 | 322 |
| 757 | 3300038443 | Ga0395901_0005419 | Ga0395901_0005419_10548_11597 | 322 |
| 758 | 3300038443 | Ga0395901_0011593 | Ga0395901_0011593_5515_6564 | 322 |
| 759 | 3300038443 | Ga0395901_0012931 | Ga0395901_0012931_7166_8215 | 322 |
| 760 | 3300038443 | Ga0395901_0039046 | Ga0395901_0039046_591_1640 | 322 |
| 761 | 3300038443 | Ga0395901_0068165 | Ga0395901_0068165_32_1081 | 322 |
| 762 | 3300038443 | Ga0395901_0280401 | Ga0395901_0280401_62_1111 | 322 |
| 763 | 3300038443 | Ga0395901_0320629 | Ga0395901_0320629_342_1391 | 322 |
| 764 | 3300038443 | Ga0395901_0363686 | Ga0395901_0363686_19_1068 | 322 |
| 765 | 3300039437 | Ga0436365_1581748 | Ga0436365_1581748_9872_10921 | 322 |
| 766 | 3300039437 | Ga0436365_1596642 | Ga0436365_1596642_14193_15242 | 322 |
| 767 | 3300039450 | Ga0436363_1186896 | Ga0436363_1186896_865_1914 | 322 |
| 768 | 3300041413 | Ga0439465_0033881 | Ga0439465_0033881_407_1456 | 322 |
| 769 | 3300042006 | Ga0439432_006611 | Ga0439432_006611_399_1448 | 322 |
| 770 | 3300042006 | Ga0439432_020245 | Ga0439432_020245_560_1609 | 322 |
| 771 | 3300042439 | Ga0439464_0005662 | Ga0439464_0005662_1703_2752 | 322 |
| 772 | 3300044684 | Ga0466966_0000027 | Ga0466966_0000027_13297_14346 | 322 |
| 773 | 3300044684 | Ga0466966_0053518 | Ga0466966_0053518_782_1831 | 322 |
| 774 | 3300044693 | Ga0466961_0063667 | Ga0466961_0063667_359_1408 | 322 |
| 775 | 3300044694 | Ga0466963_0035819 | Ga0466963_0035819_469_1518 | 322 |
| 776 | 3300044719 | Ga0466971_0049819 | Ga0466971_0049819_106_1155 | 322 |
| 777 | 3300044719 | Ga0466971_0061440 | Ga0466971_0061440_52_1101 | 322 |
| 778 | 3300044719 | Ga0466971_0080287 | Ga0466971_0080287_120_1169 | 322 |
| 779 | 3300044842 | Ga0466957_0022667 | Ga0466957_0022667_784_1833 | 322 |
| 780 | 3300044842 | Ga0466957_0022746 | Ga0466957_0022746_2069_3118 | 322 |
| 781 | 3300044901 | Ga0466960_0039890 | Ga0466960_0039890_349_1398 | 322 |
| 782 | 3300045049 | Ga0466959_0016931 | Ga0466959_0016931_1525_2574 | 322 |
| 783 | 3300045836 | Ga0466958_0011841 | Ga0466958_0011841_3350_4399 | 322 |
| 784 | 3300045836 | Ga0466958_0013184 | Ga0466958_0013184_458_1507 | 322 |
| 785 | 3300045836 | Ga0466958_0015535 | Ga0466958_0015535_525_1574 | 322 |
| 786 | 3300045976 | Ga0466967_0030963 | Ga0466967_0030963_3212_4261 | 322 |
| 787 | 3300045976 | Ga0466967_0107540 | Ga0466967_0107540_40_1089 | 322 |
| 788 | 3300045976 | Ga0466967_0236392 | Ga0466967_0236392_292_1341 | 322 |
| 789 | 3300046537 | Ga0495598_0000254 | Ga0495598_0000254_1100_2149 | 322 |
| 790 | 3300046537 | Ga0495598_0006177 | Ga0495598_0006177_372_1421 | 322 |
| 791 | 3300046539 | Ga0495621_0000031 | Ga0495621_0000031_11753_12802 | 322 |
| 792 | 3300046539 | Ga0495621_0000041 | Ga0495621_0000041_18296_19345 | 322 |
| 793 | 3300046558 | Ga0495633_0007844 | Ga0495633_0007844_4683_5732 | 322 |
| 794 | 3300046616 | Ga0495668_0091433 | Ga0495668_0091433_550_1599 | 322 |
| 795 | 3300046684 | Ga0495669_0003272 | Ga0495669_0003272_3587_4636 | 322 |
| 796 | 3300046684 | Ga0495669_0006673 | Ga0495669_0006673_2471_3520 | 322 |
| 797 | 3300046691 | Ga0495670_0000562 | Ga0495670_0000562_13725_14774 | 322 |
| 798 | 3300047445 | Ga0495677_0002739 | Ga0495677_0002739_4828_5877 | 322 |
| 799 | 3300048904 | Ga0496101_0076094 | Ga0496101_0076094_1197_2246 | 322 |
| 800 | 3300048904 | Ga0496101_0131616 | Ga0496101_0131616_417_1466 | 322 |
| 801 | 3300048905 | Ga0496102_0111220 | Ga0496102_0111220_1241_2290 | 322 |
| 802 | 3300048905 | Ga0496102_0140762 | Ga0496102_0140762_564_1613 | 322 |
| 803 | 3300048906 | Ga0496103_0042261 | Ga0496103_0042261_347_1396 | 322 |
| 804 | 3300048906 | Ga0496103_0163150 | Ga0496103_0163150_202_1251 | 322 |
| 805 | 3300048908 | Ga0496105_0344796 | Ga0496105_0344796_55_1104 | 322 |
| 806 | 3300048910 | Ga0496107_0014902 | Ga0496107_0014902_2997_4046 | 322 |
| 807 | 3300048911 | Ga0496108_0003382 | Ga0496108_0003382_1872_2921 | 322 |
| 808 | 3300048911 | Ga0496108_0012589 | Ga0496108_0012589_4807_5856 | 322 |
| 809 | 3300048911 | Ga0496108_0056116 | Ga0496108_0056116_419_1468 | 322 |
| 810 | 3300048912 | Ga0496109_0045656 | Ga0496109_0045656_1363_2412 | 322 |
| 811 | 3300048912 | Ga0496109_0065317 | Ga0496109_0065317_1515_2564 | 322 |
| 812 | 3300048913 | Ga0496110_0002532 | Ga0496110_0002532_8754_9803 | 322 |
| 813 | 3300048913 | Ga0496110_0006432 | Ga0496110_0006432_3340_4389 | 322 |
| 814 | 3300048913 | Ga0496110_0038130 | Ga0496110_0038130_618_1667 | 322 |
| 815 | 3300048913 | Ga0496110_0114900 | Ga0496110_0114900_923_1972 | 322 |
| 816 | 3300048914 | Ga0496111_0015186 | Ga0496111_0015186_4171_5220 | 322 |
| 817 | 3300048914 | Ga0496111_0115215 | Ga0496111_0115215_838_1887 | 322 |
| 818 | 3300048915 | Ga0496112_0001644 | Ga0496112_0001644_16201_17250 | 322 |
| 819 | 3300048915 | Ga0496112_0009205 | Ga0496112_0009205_6838_7887 | 322 |
| 820 | 3300048915 | Ga0496112_0112693 | Ga0496112_0112693_1265_2314 | 322 |
| 821 | 3300048916 | Ga0496113_0001833 | Ga0496113_0001833_7904_8953 | 322 |
| 822 | 3300048916 | Ga0496113_0028102 | Ga0496113_0028102_1545_2594 | 322 |
| 823 | 3300049515 | Ga0501292_000004 | Ga0501292_000004_18368_19417 | 322 |
| 824 | 3300049517 | Ga0501294_000705 | Ga0501294_000705_1470_2519 | 322 |
| 825 | 3300049653 | Ga0501206_001403 | Ga0501206_001403_894_1943 | 322 |
| 826 | 3300049665 | Ga0501227_003256 | Ga0501227_003256_173_1222 | 322 |
| 827 | 3300049686 | Ga0501257_000138 | Ga0501257_000138_6352_7401 | 322 |
| 828 | 3300049688 | Ga0501259_000200 | Ga0501259_000200_5165_6214 | 322 |
| 829 | 3300049690 | Ga0501261_000035 | Ga0501261_000035_5060_6109 | 322 |
| 830 | 3300049775 | Ga0501279_000048 | Ga0501279_000048_17042_18091 | 322 |
| 831 | 3300049776 | Ga0501280_000023 | Ga0501280_000023_23800_24849 | 322 |
| 832 | 3300049777 | Ga0501281_00441 | Ga0501281_00441_693_1742 | 322 |
| 833 | 3300049778 | Ga0501282_000019 | Ga0501282_000019_17402_18451 | 322 |
| 834 | 3300050508 | nmdc:mga09592_278777_c1 | nmdc:mga09592_278777_c1_333_1382 | 322 |
| 835 | 3300053087 | Ga0500643_000093 | Ga0500643_000093_55092_56141 | 322 |
| 836 | 3300061719 | Ga0466962_0006952 | Ga0466962_0006952_3816_4865 | 322 |
| 837 | 3300061719 | Ga0466962_0009911 | Ga0466962_0009911_935_1984 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gxd-assembly1.cif.gz_A | l-leucine dehydrogenase from exiguobacterium sibiricum | 0.9298 | 13 | 320 |
| 7vid-assembly1.cif.gz_A | the crystal structure of l-leucine dehydrogenase from pseudomonas aeruginosa | 0.9208 | 13 | 319 |
| 6acf-assembly1.cif.gz_A | structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em | 0.8929 | 13 | 319 |
| 1c1d-assembly1.cif.gz_A | l-phenylalanine dehydrogenase structure in ternary complex with nadh and l-phenylalanine | 0.8905 | 13 | 318 |
| 8gxd-assembly1.cif.gz_A | l-leucine dehydrogenase from exiguobacterium sibiricum | 0.8881 | 13 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6acfA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9515 | 13 | 131 | 3.40.50.10860 |
| 5b37A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9303 | 13 | 130 | 3.40.50.10860 |
| 1lehB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9058 | 145 | 311 | 3.40.50.720 |
| 1c1dA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8938 | 144 | 311 | 3.40.50.720 |
| af_I1JQG5_3_382_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8876 | 171 | 203 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3AUJ4-F1-model_v4 | Amino acid dehydrogenase | 0.9909 | 3 | 111 |
GO:0006520
GO:0016639 |
| AF-A0A838QI03-F1-model_v4 | Glu/Leu/Phe/Val dehydrogenase | 0.9845 | 1 | 220 |
GO:0006520
GO:0016639 |
| AF-A0A4Q5XW21-F1-model_v4 | Leucine dehydrogenase | 0.9761 | 13 | 123 |
GO:0006520
GO:0016639 |
| AF-A0A520D613-F1-model_v4 | deleted | 0.9761 | 1 | 83 |
|
| AF-A0A2V7YIS4-F1-model_v4 | Leucine dehydrogenase | 0.9759 | 13 | 136 |
GO:0006520
GO:0016639 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar