F482985

General Info

Members Datasets Scaffolds Average Seq Length
838 445 1676 80

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_11670850|Ga0207704_116708502
Length 93
Sequence MRANGGYRICDRWNKTQQLQALIQSHLPCEHITLEGDGRHWYATIVSAEFEGKRAIQRHQRVYATLGAKMHTDEVHALSMKTYTPAEWAAVEK

Samples

Sample ID Description Type Environment
1 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
76 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
92 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
93 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
94 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
176 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
187 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
188 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
189 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
190 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
191 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
218 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
224 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
225 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
226 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
227 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
228 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
229 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
241 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
246 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
247 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
248 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
249 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
250 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
251 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
252 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
253 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
254 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
255 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
256 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
257 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
258 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
259 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
260 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
261 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
262 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
263 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
264 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
265 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
266 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
267 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
268 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
292 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
296 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
350 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
351 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
352 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
353 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
354 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
355 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
369 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
370 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
371 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
372 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
373 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
374 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
375 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
376 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
379 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
380 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
381 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
382 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
383 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
384 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
387 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
388 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
389 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
390 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
391 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
392 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
393 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
394 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
395 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
397 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
398 2547132374 Acidovorax radicis N35 Isolate Unclassified
399 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
400 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
401 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
402 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
403 2643221570 Acidovorax sp. Root568 Isolate Unclassified
404 2643221596 Acidovorax sp. Root70 Isolate Unclassified
405 2643221609 Acidovorax sp. Root217 Isolate Unclassified
406 2643221611 Acidovorax sp. Root219 Isolate Unclassified
407 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
408 2643221652 Acidovorax sp. Root402 Isolate Unclassified
409 2643221658 Variovorax sp. Root411 Isolate Unclassified
410 2643221672 Variovorax sp. Root434 Isolate Unclassified
411 2643221683 Variovorax sp. Root473 Isolate Unclassified
412 2643221717 Acidovorax sp. Root267 Isolate Unclassified
413 2738541277 Variovorax sp. GV051 Isolate Unclassified
414 2738541307 Variovorax sp. GV008 Isolate Unclassified
415 2738543012 Acidovorax sp. CF301 Isolate Unclassified
416 2738543019 Variovorax sp. GV040 Isolate Unclassified
417 2816332133 Acidovorax radicis 2721A Isolate Unclassified
418 2818991446 Variovorax sp. 1180 Isolate Unclassified
419 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
420 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
421 2842677519 Variovorax sp. R-72495 Isolate Unclassified
422 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
423 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
424 2885198086 Variovorax sp. 679 Isolate Unclassified
425 2885211737 Variovorax sp. 553 Isolate Unclassified
426 2899924645 Variovorax sp. 369 Isolate Unclassified
427 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
428 2904456579 Variovorax sp. 2002 Isolate Unclassified
429 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
430 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
431 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
432 2928037797 Variovorax sp. 1126 Isolate Unclassified
433 2928044640 Variovorax sp. 1128 Isolate Unclassified
434 2928051484 Variovorax sp. 1133 Isolate Unclassified
435 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
436 2928070936 Variovorax gossypii 1167 Isolate Unclassified
437 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
438 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
439 2929520902 Variovorax beijingensis 502 Isolate Unclassified
440 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
441 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
442 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
443 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
444 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
445 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.44
Metatranscriptomes 0.72
Isolates 5.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.66
Nodule 0.6
Rhizoplane 4.42
Rhizosphere 61.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207704_11670850 3300025938 Bacteria 547
2 JGI24740J21852_10004290 3300001979 Bacteria 6145
3 JGI24739J22299_10008905 3300001989 Bacteria 3742
4 JGI24739J22299_10009598 3300001989 Bacteria 3603
5 JGI25158J39367_1004285 3300002739 Bacteria 2147
6 JGI25159J45721_1029844 3300002987 Bacteria 893
7 JGI25151J46595_10003000 3300003187 Bacteria 9602
8 JGI25151J46595_10028625 3300003187 Bacteria 2216
9 JGI25151J46595_10071196 3300003187 Bacteria 1052
10 JGI25153J46596_10009310 3300003215 Bacteria 4586
11 rootH1_10079751 3300003323 Bacteria 1474
12 JGI25160J50197_1010452 3300003354 Bacteria 3357
13 Ga0006562J51391_1089139 3300003578 Bacteria 2360
14 Ga0006562J51391_1089141 3300003578 Bacteria 1140
15 Ga0055527_1014119 3300003760 Bacteria 884
16 Ga0055535_1000966 3300003761 Bacteria 18756
17 Ga0055542_1000080 3300003762 Bacteria 129634
18 Ga0055537_1000150 3300003773 Bacteria 52097
19 Ga0055537_1003599 3300003773 Bacteria 4720
20 Ga0055524_1064407 3300003775 Bacteria 740
21 Ga0055536_1006807 3300003781 Bacteria 5232
22 Ga0055536_1027523 3300003781 Bacteria 1569
23 Ga0055536_1035061 3300003781 Bacteria 1260
24 Ga0055534_1000016 3300003784 Bacteria 144444
25 Ga0055534_1017802 3300003784 Bacteria 1248
26 Ga0055528_1000894 3300003790 Bacteria 20125
27 Ga0055528_1021050 3300003790 Bacteria 2086
28 Ga0055528_1043582 3300003790 Bacteria 975
29 Ga0055528_1094440 3300003790 Bacteria 510
30 Ga0055530_10003550 3300003791 Bacteria 8789
31 Ga0055530_10005191 3300003791 Bacteria 6327
32 Ga0055530_10061295 3300003791 Bacteria 838
33 Ga0055540_1019292 3300003792 Bacteria 1839
34 Ga0055540_1021120 3300003792 Bacteria 1700
35 Ga0055540_1023163 3300003792 Bacteria 1569
36 Ga0055540_1043939 3300003792 Bacteria 951
37 Ga0055531_10001826 3300003794 Bacteria 15080
38 Ga0055531_10004420 3300003794 Bacteria 8574
39 Ga0065714_10004675 3300005288 Bacteria 8108
40 Ga0065714_10080808 3300005288 Bacteria 2412
41 Ga0065714_10479621 3300005288 Bacteria 535
42 Ga0065704_10185663 3300005289 Bacteria 1214
43 Ga0065704_10296250 3300005289 Bacteria 894
44 Ga0065704_10364268 3300005289 Bacteria 793
45 Ga0065704_10444071 3300005289 Bacteria 710
46 Ga0070658_10139715 3300005327 Bacteria 2023
47 Ga0070658_10269609 3300005327 Bacteria 1447
48 Ga0070658_10817630 3300005327 Bacteria 810
49 Ga0068869_100022576 3300005334 Bacteria 4337
50 Ga0068869_100593224 3300005334 Bacteria 935
51 Ga0070666_10270584 3300005335 Bacteria 1206
52 Ga0068868_100159375 3300005338 Bacteria 1863
53 Ga0070660_100010089 3300005339 Bacteria 6665
54 Ga0070660_100782922 3300005339 Bacteria 802
55 Ga0070661_100647509 3300005344 Bacteria 857
56 Ga0070661_101085177 3300005344 Bacteria 666
57 Ga0070668_100766997 3300005347 Bacteria 855
58 Ga0070669_100287905 3300005353 Bacteria 1318
59 Ga0070674_100181127 3300005356 Bacteria 1614
60 Ga0070674_100524611 3300005356 Bacteria 990
61 Ga0070674_100629391 3300005356 Bacteria 910
62 Ga0070674_101776554 3300005356 Bacteria 559
63 Ga0070673_100945336 3300005364 Bacteria 801
64 Ga0070673_101209985 3300005364 Bacteria 708
65 Ga0070688_101789278 3300005365 Bacteria 504
66 Ga0070659_100183936 3300005366 Bacteria 1715
67 Ga0070667_100179365 3300005367 Bacteria 1873
68 Ga0070714_100904660 3300005435 Bacteria 857
69 Ga0070663_102137943 3300005455 Bacteria 505
70 Ga0070678_100243295 3300005456 Bacteria 1505
71 Ga0070678_100630753 3300005456 Bacteria 959
72 Ga0070678_101979127 3300005456 Bacteria 551
73 Ga0070662_100039907 3300005457 Bacteria 3341
74 Ga0068867_101691058 3300005459 Bacteria 593
75 Ga0070685_10929949 3300005466 Bacteria 649
76 Ga0070679_100054548 3300005530 Bacteria 3979
77 Ga0068853_100147073 3300005539 Bacteria 2118
78 Ga0068853_101617070 3300005539 Bacteria 628
79 Ga0070665_100010145 3300005548 Bacteria 9525
80 Ga0070665_101595040 3300005548 Bacteria 660
81 Ga0070665_101802463 3300005548 Bacteria 618
82 Ga0068855_100119841 3300005563 Bacteria 3012
83 Ga0068855_100241413 3300005563 Bacteria 2019
84 Ga0068855_101141513 3300005563 Bacteria 813
85 Ga0070664_100040580 3300005564 Bacteria 3925
86 Ga0068857_100073208 3300005577 Bacteria 3052
87 Ga0068857_100157874 3300005577 Bacteria 2057
88 Ga0068857_100927464 3300005577 Bacteria 836
89 Ga0068857_101816737 3300005577 Bacteria 597
90 Ga0068856_100206139 3300005614 Bacteria 1981
91 Ga0068856_100391387 3300005614 Bacteria 1410
92 Ga0068856_101525123 3300005614 Bacteria 682
93 Ga0068852_100107707 3300005616 Bacteria 2528
94 Ga0068852_101034290 3300005616 Bacteria 840
95 Ga0068859_101314464 3300005617 Bacteria 797
96 Ga0068864_101278132 3300005618 Bacteria 734
97 Ga0068866_11377083 3300005718 Bacteria 515
98 Ga0068861_102635540 3300005719 Bacteria 507
99 Ga0068851_10002741 3300005834 Bacteria 7758
100 Ga0068870_11118470 3300005840 Bacteria 567
101 Ga0068863_100134033 3300005841 Bacteria 2366
102 Ga0068858_101685273 3300005842 Bacteria 626
103 Ga0068862_100298255 3300005844 Bacteria 1482
104 Ga0075365_10022096 3300006038 Bacteria 3980
105 Ga0075365_10071228 3300006038 Bacteria 2340
106 Ga0075365_10930983 3300006038 Bacteria 613
107 Ga0075368_10251250 3300006042 Bacteria 756
108 Ga0075363_100007907 3300006048 Bacteria 4923
109 Ga0075363_100258058 3300006048 Bacteria 1005
110 Ga0075363_100816840 3300006048 Bacteria 568
111 Ga0075363_100876610 3300006048 Bacteria 549
112 Ga0075363_100897483 3300006048 Bacteria 543
113 Ga0075364_10020170 3300006051 Bacteria 4191
114 Ga0075364_10081814 3300006051 Bacteria 2135
115 Ga0075364_10210045 3300006051 Bacteria 1320
116 Ga0075364_10227248 3300006051 Bacteria 1267
117 Ga0075364_10970552 3300006051 Bacteria 578
118 Ga0075432_10002614 3300006058 Bacteria 6016
119 Ga0075432_10072540 3300006058 Bacteria 1239
120 Ga0075362_10037995 3300006177 Bacteria 2113
121 Ga0075362_10038214 3300006177 Bacteria 2108
122 Ga0075362_10056377 3300006177 Bacteria 1768
123 Ga0075362_10135941 3300006177 Bacteria 1172
124 Ga0075362_10179908 3300006177 Bacteria 1024
125 Ga0075362_10183140 3300006177 Bacteria 1015
126 Ga0075367_10136738 3300006178 Bacteria 1516
127 Ga0075367_10255335 3300006178 Bacteria 1100
128 Ga0075367_10440384 3300006178 Bacteria 825
129 Ga0075369_10082983 3300006186 Bacteria 1423
130 Ga0075369_10225578 3300006186 Bacteria 867
131 Ga0075366_10016366 3300006195 Bacteria 4262
132 Ga0075366_10025817 3300006195 Bacteria 3435
133 Ga0075366_10045854 3300006195 Bacteria 2590
134 Ga0075366_10077444 3300006195 Bacteria 1984
135 Ga0075366_10084748 3300006195 Bacteria 1895
136 Ga0075366_10116986 3300006195 Bacteria 1605
137 Ga0075366_10462917 3300006195 Bacteria 783
138 Ga0075366_10877728 3300006195 Bacteria 558
139 Ga0097621_100169928 3300006237 Bacteria 1879
140 Ga0097621_101014025 3300006237 Bacteria 777
141 Ga0075370_10001499 3300006353 Bacteria 10187
142 Ga0075370_10002475 3300006353 Bacteria 8564
143 Ga0075370_10004243 3300006353 Bacteria 6935
144 Ga0075370_10088484 3300006353 Bacteria 1785
145 Ga0075370_10094291 3300006353 Bacteria 1728
146 Ga0075370_10226115 3300006353 Bacteria 1106
147 Ga0075370_10247279 3300006353 Bacteria 1057
148 Ga0075370_10258840 3300006353 Bacteria 1032
149 Ga0075370_10311167 3300006353 Bacteria 937
150 Ga0075370_10590513 3300006353 Bacteria 673
151 Ga0075370_10866468 3300006353 Bacteria 551
152 Ga0068871_100023433 3300006358 Bacteria 4776
153 Ga0068871_100737242 3300006358 Bacteria 905
154 Ga0068871_101324974 3300006358 Bacteria 677
155 Ga0068865_100498852 3300006881 Bacteria 1014
156 Ga0068865_100848700 3300006881 Bacteria 791
157 Ga0068865_101090828 3300006881 Bacteria 703
158 Ga0075436_101513180 3300006914 Bacteria 510
159 Ga0097620_101314383 3300006931 Bacteria 797
160 Ga0079104_1021469 3300006946 Bacteria 1757
161 Ga0099826_10000101 3300006948 Bacteria 40408
162 Ga0105251_10646693 3300009011 Bacteria 505
163 Ga0105244_10010520 3300009036 Bacteria 5606
164 Ga0105244_10117797 3300009036 Bacteria 1288
165 Ga0105244_10126774 3300009036 Bacteria 1233
166 Ga0105250_10009366 3300009092 Bacteria 4128
167 Ga0105240_10006365 3300009093 Bacteria 17386
168 Ga0105240_10254488 3300009093 Bacteria 2029
169 Ga0105240_11010638 3300009093 Bacteria 889
170 Ga0105245_10872035 3300009098 Bacteria 941
171 Ga0105243_10003361 3300009148 Bacteria 12978
172 Ga0105243_10260122 3300009148 Bacteria 1553
173 Ga0105243_11061208 3300009148 Bacteria 816
174 Ga0105241_10419025 3300009174 Bacteria 1178
175 Ga0105242_10000553 3300009176 Bacteria 29613
176 Ga0105242_10201925 3300009176 Bacteria 1766
177 Ga0105242_10689738 3300009176 Bacteria 998
178 Ga0105242_10707822 3300009176 Bacteria 986
179 Ga0105248_10166463 3300009177 Bacteria 2485
180 Ga0105248_11054050 3300009177 Bacteria 919
181 Ga0105248_11159186 3300009177 Bacteria 874
182 Ga0105237_11331089 3300009545 Bacteria 724
183 Ga0105237_11629785 3300009545 Bacteria 652
184 Ga0105238_10017091 3300009551 Bacteria 7363
185 Ga0105238_10543900 3300009551 Bacteria 1165
186 Ga0105238_11705029 3300009551 Bacteria 661
187 Ga0105238_11867165 3300009551 Bacteria 633
188 Ga0105249_12090763 3300009553 Bacteria 639
189 Ga0105239_10200838 3300010375 Bacteria 2233
190 Ga0105239_11114608 3300010375 Bacteria 909
191 Ga0105246_10130197 3300011119 Bacteria 1878
192 Ga0105246_10352106 3300011119 Bacteria 1207
193 Ga0105246_11000133 3300011119 Bacteria 757
194 Ga0105246_11534058 3300011119 Bacteria 627
195 Ga0105246_11799169 3300011119 Bacteria 585
196 Ga0157319_1014482 3300012497 Bacteria 693
197 Ga0157347_1002744 3300012502 Bacteria 1532
198 Ga0157347_1026183 3300012502 Bacteria 709
199 Ga0157339_1032486 3300012505 Bacteria 618
200 Ga0157326_1012389 3300012513 Bacteria 973
201 Ga0157373_10094943 3300013100 Bacteria 2099
202 Ga0157373_10626851 3300013100 Bacteria 784
203 Ga0157373_10850502 3300013100 Bacteria 675
204 Ga0157371_10059656 3300013102 Bacteria 2704
205 Ga0157371_10960774 3300013102 Bacteria 650
206 Ga0157370_10011514 3300013104 Bacteria 9242
207 Ga0157370_10072910 3300013104 Bacteria 3240
208 Ga0157370_10485367 3300013104 Bacteria 1135
209 Ga0157370_11952806 3300013104 Bacteria 526
210 Ga0157369_10013149 3300013105 Bacteria 9367
211 Ga0157369_12189830 3300013105 Bacteria 560
212 Ga0157374_10585406 3300013296 Bacteria 1125
213 Ga0157378_11576671 3300013297 Bacteria 702
214 Ga0163162_10362486 3300013306 Bacteria 1582
215 Ga0163162_10698347 3300013306 Bacteria 1136
216 Ga0163162_10817893 3300013306 Bacteria 1048
217 Ga0163162_12441603 3300013306 Bacteria 601
218 Ga0157372_10576067 3300013307 Bacteria 1312
219 Ga0157375_11511848 3300013308 Bacteria 793
220 Ga0157375_11772195 3300013308 Bacteria 732
221 Ga0163163_11594957 3300014325 Bacteria 714
222 Ga0157380_10114627 3300014326 Bacteria 2272
223 Ga0157380_10967518 3300014326 Bacteria 882
224 Ga0157380_12835996 3300014326 Bacteria 551
225 Ga0182008_10001633 3300014497 Bacteria 14849
226 Ga0182008_10058827 3300014497 Bacteria 1896
227 Ga0182008_10075865 3300014497 Bacteria 1654
228 Ga0182008_10141243 3300014497 Bacteria 1205
229 Ga0182008_10565055 3300014497 Bacteria 634
230 Ga0182008_10688862 3300014497 Bacteria 583
231 Ga0157377_11375600 3300014745 Bacteria 555
232 Ga0157379_10208061 3300014968 Bacteria 1770
233 Ga0157376_10344535 3300014969 Bacteria 1424
234 Ga0157376_10709139 3300014969 Bacteria 1012
235 Ga0157376_10825833 3300014969 Bacteria 941
236 Ga0182006_1010501 3300015261 Bacteria 4114
237 Ga0182006_1025900 3300015261 Bacteria 2406
238 Ga0182006_1150238 3300015261 Bacteria 790
239 Ga0182006_1176170 3300015261 Bacteria 714
240 Ga0182006_1233599 3300015261 Bacteria 605
241 Ga0182007_10000853 3300015262 Bacteria 16919
242 Ga0182007_10003809 3300015262 Bacteria 7024
243 Ga0182007_10343066 3300015262 Bacteria 559
244 Ga0182005_1052265 3300015265 Bacteria 1112
245 Ga0182005_1072204 3300015265 Bacteria 948
246 Ga0182005_1078107 3300015265 Bacteria 912
247 Ga0163161_10001891 3300017792 Bacteria 15283
248 Ga0163161_10007216 3300017792 Bacteria 7680
249 Ga0163161_10008493 3300017792 Bacteria 7114
250 Ga0163161_10042751 3300017792 Bacteria 3261
251 Ga0163161_10122988 3300017792 Bacteria 1951
252 Ga0209436_123904 3300025208 Bacteria 757
253 Ga0209672_100642 3300025228 Bacteria 17975
254 Ga0209147_100995 3300025229 Bacteria 12281
255 Ga0209258_100093 3300025242 Bacteria 223559
256 Ga0207425_1000989 3300025245 Bacteria 13329
257 Ga0207425_1009140 3300025245 Bacteria 2484
258 Ga0209148_1000007 3300025254 Bacteria 1592273
259 Ga0209129_1000024 3300025258 Bacteria 417268
260 Ga0209129_1006303 3300025258 Bacteria 3884
261 Ga0209129_1010886 3300025258 Bacteria 2222
262 Ga0209565_1000098 3300025263 Bacteria 132021
263 Ga0209565_1000633 3300025263 Bacteria 22947
264 Ga0209565_1042110 3300025263 Bacteria 847
265 Ga0209673_1000058 3300025273 Bacteria 269028
266 Ga0209673_1001034 3300025273 Bacteria 32757
267 Ga0209673_1039935 3300025273 Bacteria 1348
268 Ga0209673_1041386 3300025273 Bacteria 1308
269 Ga0209673_1052393 3300025273 Bacteria 1071
270 Ga0209130_1000654 3300025284 Bacteria 31825
271 Ga0209130_1001114 3300025284 Bacteria 19756
272 Ga0209675_1000010 3300025291 Bacteria 541927
273 Ga0209675_1000151 3300025291 Bacteria 91172
274 Ga0209675_1003092 3300025291 Bacteria 8132
275 Ga0209675_1007033 3300025291 Bacteria 4388
276 Ga0209676_1000028 3300025292 Bacteria 559745
277 Ga0209676_1001046 3300025292 Bacteria 31878
278 Ga0209676_1003308 3300025292 Bacteria 10090
279 Ga0209676_1025199 3300025292 Bacteria 1912
280 Ga0209676_1027854 3300025292 Bacteria 1771
281 Ga0209676_1064029 3300025292 Bacteria 901
282 Ga0209025_1000685 3300025294 Bacteria 58093
283 Ga0209025_1001904 3300025294 Bacteria 24327
284 Ga0209025_1005469 3300025294 Bacteria 10341
285 Ga0209025_1078148 3300025294 Bacteria 1137
286 Ga0209564_1000209 3300025295 Bacteria 133651
287 Ga0209564_1002281 3300025295 Bacteria 15652
288 Ga0209758_1001224 3300025297 Bacteria 32124
289 Ga0209758_1037536 3300025297 Bacteria 1871
290 Ga0209050_1000072 3300025298 Bacteria 293619
291 Ga0209050_1000927 3300025298 Bacteria 38487
292 Ga0209050_1004050 3300025298 Bacteria 10280
293 Ga0209050_1008317 3300025298 Bacteria 5579
294 Ga0209256_1000088 3300025299 Bacteria 217236
295 Ga0209256_1023010 3300025299 Bacteria 1870
296 Ga0209256_1025808 3300025299 Bacteria 1705
297 Ga0207426_1000038 3300025302 Bacteria 441522
298 Ga0207426_1000053 3300025302 Bacteria 384818
299 Ga0209051_1000015 3300025303 Bacteria 546798
300 Ga0209051_1000056 3300025303 Bacteria 271616
301 Ga0209051_1000196 3300025303 Bacteria 107028
302 Ga0209051_1000392 3300025303 Bacteria 61223
303 Ga0209051_1000424 3300025303 Bacteria 57966
304 Ga0209051_1000545 3300025303 Bacteria 46076
305 Ga0209257_1000305 3300025304 Bacteria 107001
306 Ga0209257_1002205 3300025304 Bacteria 20116
307 Ga0209257_1004602 3300025304 Bacteria 10500
308 Ga0209257_1009796 3300025304 Bacteria 5020
309 Ga0209257_1059782 3300025304 Bacteria 1039
310 Ga0207656_10012795 3300025321 Bacteria 3194
311 Ga0207655_1006555 3300025728 Bacteria 7689
312 Ga0207655_1222623 3300025728 Bacteria 549
313 Ga0207682_10318236 3300025893 Bacteria 731
314 Ga0207688_10900022 3300025901 Bacteria 560
315 Ga0207680_10255063 3300025903 Bacteria 1212
316 Ga0207705_10022490 3300025909 Bacteria 4496
317 Ga0207705_10074648 3300025909 Bacteria 2462
318 Ga0207705_10472555 3300025909 Bacteria 973
319 Ga0207654_10240763 3300025911 Bacteria 1209
320 Ga0207695_10060685 3300025913 Bacteria 3913
321 Ga0207671_10088086 3300025914 Bacteria 2335
322 Ga0207671_10806075 3300025914 Bacteria 745
323 Ga0207660_10181378 3300025917 Bacteria 1635
324 Ga0207657_10014060 3300025919 Bacteria 7832
325 Ga0207657_10282786 3300025919 Bacteria 1317
326 Ga0207649_10704367 3300025920 Bacteria 783
327 Ga0207649_10810040 3300025920 Bacteria 731
328 Ga0207652_10088927 3300025921 Bacteria 2711
329 Ga0207652_10161675 3300025921 Bacteria 2008
330 Ga0207694_10022934 3300025924 Bacteria 4736
331 Ga0207694_10250337 3300025924 Bacteria 1449
332 Ga0207694_10767923 3300025924 Bacteria 814
333 Ga0207650_10312000 3300025925 Bacteria 1287
334 Ga0207659_10732672 3300025926 Bacteria 847
335 Ga0207659_11340761 3300025926 Bacteria 614
336 Ga0207687_10015912 3300025927 Bacteria 4935
337 Ga0207664_10600294 3300025929 Bacteria 988
338 Ga0207690_10127659 3300025932 Bacteria 1856
339 Ga0207690_11043904 3300025932 Bacteria 680
340 Ga0207706_10075902 3300025933 Bacteria 2956
341 Ga0207706_10275666 3300025933 Bacteria 1467
342 Ga0207686_10001796 3300025934 Bacteria 11922
343 Ga0207686_10224147 3300025934 Bacteria 1359
344 Ga0207686_10579039 3300025934 Bacteria 881
345 Ga0207709_10000958 3300025935 Bacteria 21596
346 Ga0207709_10001025 3300025935 Bacteria 20674
347 Ga0207709_10001291 3300025935 Bacteria 17879
348 Ga0207709_10002267 3300025935 Bacteria 12201
349 Ga0207709_10002735 3300025935 Bacteria 10877
350 Ga0207709_10203263 3300025935 Bacteria 1416
351 Ga0207669_10822658 3300025937 Bacteria 771
352 Ga0207704_10521793 3300025938 Bacteria 961
353 Ga0207704_10843252 3300025938 Bacteria 768
354 Ga0207691_10759872 3300025940 Bacteria 816
355 Ga0207691_11492302 3300025940 Bacteria 553
356 Ga0207711_10494626 3300025941 Bacteria 1140
357 Ga0207711_12098101 3300025941 Bacteria 508
358 Ga0207689_10065726 3300025942 Bacteria 2983
359 Ga0207689_10081640 3300025942 Bacteria 2657
360 Ga0207689_10482507 3300025942 Bacteria 1038
361 Ga0207689_10670999 3300025942 Bacteria 874
362 Ga0207679_10066316 3300025945 Bacteria 2705
363 Ga0207667_10341672 3300025949 Bacteria 1528
364 Ga0207667_10374716 3300025949 Bacteria 1450
365 Ga0207667_10674686 3300025949 Bacteria 1037
366 Ga0207667_11952205 3300025949 Bacteria 548
367 Ga0207651_10255794 3300025960 Bacteria 1435
368 Ga0207651_10421668 3300025960 Bacteria 1139
369 Ga0207668_10248284 3300025972 Bacteria 1444
370 Ga0207668_12032824 3300025972 Bacteria 518
371 Ga0207640_10178836 3300025981 Bacteria 1588
372 Ga0207640_10754190 3300025981 Bacteria 839
373 Ga0207658_10267667 3300025986 Bacteria 1459
374 Ga0207658_10747812 3300025986 Bacteria 885
375 Ga0207658_11007527 3300025986 Bacteria 760
376 Ga0207677_10181460 3300026023 Bacteria 1656
377 Ga0207677_10493446 3300026023 Bacteria 1057
378 Ga0207639_10010944 3300026041 Bacteria 6291
379 Ga0207639_11073821 3300026041 Bacteria 755
380 Ga0207639_11245984 3300026041 Bacteria 698
381 Ga0207678_10395257 3300026067 Bacteria 1196
382 Ga0207702_10246572 3300026078 Bacteria 1676
383 Ga0207702_11035726 3300026078 Bacteria 814
384 Ga0207641_10024357 3300026088 Bacteria 4989
385 Ga0207648_10874461 3300026089 Bacteria 839
386 Ga0207648_11344358 3300026089 Bacteria 671
387 Ga0207674_10202033 3300026116 Bacteria 1937
388 Ga0207674_10486044 3300026116 Bacteria 1193
389 Ga0207674_10713668 3300026116 Bacteria 968
390 Ga0207683_10180083 3300026121 Bacteria 1916
391 Ga0207683_10332354 3300026121 Bacteria 1393
392 Ga0207698_10296757 3300026142 Bacteria 1502
393 Ga0207698_11526489 3300026142 Bacteria 683
394 Ga0209281_1033796 3300027111 Bacteria 897
395 Ga0209282_1001024 3300027666 Bacteria 14706
396 Ga0209813_10141295 3300027866 Bacteria 855
397 Ga0209974_10085254 3300027876 Bacteria 1091
398 Ga0207428_10127051 3300027907 Bacteria 1952
399 Ga0268266_10218330 3300028379 Bacteria 1751
400 Ga0268265_10386394 3300028380 Bacteria 1289
401 Ga0268264_12398864 3300028381 Bacteria 533
402 Ga0307515_10000084 3300028794 Bacteria 221434
403 Ga0307515_10072156 3300028794 Bacteria 4666
404 Ga0307515_10483798 3300028794 Bacteria 850
405 Ga0307515_10538684 3300028794 Bacteria 777
406 Ga0307512_10121381 3300030522 Bacteria 1677
407 Ga0316177_1148101 3300030731 Bacteria 3719
408 Ga0314311_1237239 3300030733 Bacteria 1505
409 Ga0316178_1016090 3300030735 Bacteria 1219
410 Ga0316180_1033885 3300030736 Bacteria 1336
411 Ga0316183_1122753 3300030742 Bacteria 1765
412 Ga0316181_1085526 3300030744 Bacteria 1950
413 Ga0316182_1238099 3300030745 Bacteria 1133
414 Ga0316182_1399987 3300030745 Bacteria 2746
415 Ga0265327_10148026 3300031251 Bacteria 1092
416 Ga0307513_10026225 3300031456 Bacteria 6725
417 Ga0307513_10519366 3300031456 Bacteria 906
418 Ga0307408_100073371 3300031548 Bacteria 2536
419 Ga0307408_100080304 3300031548 Bacteria 2435
420 Ga0307408_100161448 3300031548 Bacteria 1780
421 Ga0307408_100266625 3300031548 Bacteria 1420
422 Ga0307408_100280671 3300031548 Bacteria 1387
423 Ga0307408_100316751 3300031548 Bacteria 1312
424 Ga0307408_100464861 3300031548 Bacteria 1100
425 Ga0307408_100480893 3300031548 Bacteria 1083
426 Ga0307408_100546985 3300031548 Bacteria 1021
427 Ga0307408_101249100 3300031548 Bacteria 694
428 Ga0307408_101845938 3300031548 Bacteria 578
429 Ga0307408_102262748 3300031548 Bacteria 526
430 Ga0307514_10000954 3300031649 Bacteria 43472
431 Ga0307514_10138226 3300031649 Bacteria 1662
432 Ga0265314_10007074 3300031711 Bacteria 9791
433 Ga0307405_10022681 3300031731 Bacteria 3553
434 Ga0307405_10203872 3300031731 Bacteria 1438
435 Ga0307405_10313310 3300031731 Bacteria 1195
436 Ga0307405_10474225 3300031731 Bacteria 997
437 Ga0307413_10138982 3300031824 Bacteria 1675
438 Ga0307413_10454530 3300031824 Bacteria 1017
439 Ga0307413_10903079 3300031824 Bacteria 750
440 Ga0307410_10510404 3300031852 Bacteria 990
441 Ga0307410_10530941 3300031852 Bacteria 972
442 Ga0307410_11552995 3300031852 Bacteria 584
443 Ga0307406_10001705 3300031901 Bacteria 12082
444 Ga0307406_10029763 3300031901 Bacteria 3309
445 Ga0307406_10444781 3300031901 Bacteria 1038
446 Ga0307406_10880524 3300031901 Bacteria 761
447 Ga0307406_10985024 3300031901 Bacteria 722
448 Ga0307406_11055058 3300031901 Bacteria 700
449 Ga0307407_10127011 3300031903 Bacteria 1625
450 Ga0307407_10219229 3300031903 Bacteria 1285
451 Ga0307412_10009231 3300031911 Bacteria 5653
452 Ga0307412_10018497 3300031911 Bacteria 4194
453 Ga0307412_10040329 3300031911 Bacteria 3020
454 Ga0307412_10069765 3300031911 Bacteria 2393
455 Ga0307412_10164512 3300031911 Bacteria 1652
456 Ga0307412_10239149 3300031911 Bacteria 1403
457 Ga0307412_10434341 3300031911 Bacteria 1077
458 Ga0307412_10818926 3300031911 Bacteria 810
459 Ga0307412_10882358 3300031911 Bacteria 782
460 Ga0307412_11066941 3300031911 Bacteria 717
461 Ga0307412_11218498 3300031911 Bacteria 674
462 Ga0307409_100360040 3300031995 Bacteria 1376
463 Ga0307409_101306064 3300031995 Bacteria 751
464 Ga0307416_100090654 3300032002 Bacteria 2622
465 Ga0307416_100648391 3300032002 Bacteria 1140
466 Ga0307416_100665749 3300032002 Bacteria 1127
467 Ga0307416_100692627 3300032002 Bacteria 1107
468 Ga0307416_101187508 3300032002 Bacteria 868
469 Ga0307416_101387557 3300032002 Bacteria 808
470 Ga0307416_102124172 3300032002 Bacteria 663
471 Ga0307416_103302620 3300032002 Bacteria 540
472 Ga0307414_10068974 3300032004 Bacteria 2539
473 Ga0307414_10091564 3300032004 Bacteria 2260
474 Ga0307414_10593157 3300032004 Bacteria 993
475 Ga0307414_10877261 3300032004 Bacteria 822
476 Ga0307414_12203709 3300032004 Bacteria 514
477 Ga0307411_10024402 3300032005 Bacteria 3604
478 Ga0307411_10178581 3300032005 Bacteria 1609
479 Ga0307411_10311964 3300032005 Bacteria 1266
480 Ga0307411_10454826 3300032005 Bacteria 1072
481 Ga0307411_10974878 3300032005 Bacteria 757
482 Ga0307411_11479876 3300032005 Bacteria 623
483 Ga0307411_12260670 3300032005 Bacteria 510
484 Ga0307415_101084036 3300032126 Bacteria 749
485 Ga0373943_0428727 3300035170 Bacteria 766
486 Ga0373931_0089159 3300035691 Bacteria 1716
487 Ga0395899_0104110 3300037312 Bacteria 2046
488 Ga0395900_0161473 3300037418 Bacteria 2285
489 Ga0395898_0294881 3300037466 Bacteria 1547
490 Ga0395905_0050498 3300037471 Bacteria 3896
491 Ga0395905_0633031 3300037471 Bacteria 971
492 Ga0395901_0074087 3300038443 Bacteria 3552
493 Ga0395901_0435328 3300038443 Bacteria 1343
494 Ga0395901_1223270 3300038443 Bacteria 716
495 Ga0436361_0070738 3300039447 Bacteria 27213
496 Ga0439436_0001048 3300041404 Bacteria 7765
497 Ga0439436_0049230 3300041404 Bacteria 1194
498 Ga0439436_0265955 3300041404 Bacteria 500
499 Ga0439438_081388 3300041405 Bacteria 794
500 Ga0439439_0000268 3300041406 Bacteria 8200
501 Ga0439439_0039004 3300041406 Bacteria 1227
502 Ga0439447_023051 3300041407 Bacteria 1625
503 Ga0439461_0006198 3300041410 Bacteria 2077
504 Ga0439461_0051778 3300041410 Bacteria 912
505 Ga0439461_0077677 3300041410 Bacteria 779
506 Ga0439461_0101819 3300041410 Bacteria 700
507 Ga0439466_0004086 3300041411 Bacteria 5638
508 Ga0439466_0051658 3300041411 Bacteria 1345
509 Ga0439466_0106718 3300041411 Bacteria 870
510 Ga0439466_0238257 3300041411 Bacteria 551
511 Ga0439465_0003993 3300041413 Bacteria 4808
512 Ga0439465_0023149 3300041413 Bacteria 1954
513 Ga0451787_019627 3300041441 Bacteria 828
514 Ga0451789_0111381 3300041443 Bacteria 523
515 Ga0451791_1495823 3300041451 Bacteria 572
516 Ga0451793_0435770 3300041452 Bacteria 960
517 Ga0451793_1075355 3300041452 Bacteria 1045
518 Ga0451793_1159892 3300041452 Bacteria 628
519 Ga0451797_0157609 3300041453 Bacteria 578
520 Ga0451795_1558984 3300041456 Bacteria 531
521 Ga0451798_0238516 3300041458 Bacteria 585
522 Ga0451800_1458506 3300041459 Bacteria 631
523 Ga0451802_0624242 3300041460 Bacteria 863
524 Ga0451807_0286398 3300041486 Bacteria 846
525 Ga0451807_1888789 3300041486 Bacteria 510
526 Ga0451833_0083665 3300041491 Bacteria 559
527 Ga0451837_0663527 3300041494 Bacteria 596
528 Ga0451841_0595886 3300041498 Bacteria 901
529 Ga0451849_1011591 3300041505 Bacteria 562
530 Ga0451853_1220038 3300041512 Bacteria 535
531 Ga0439431_0000483 3300041997 Bacteria 8459
532 Ga0439431_0022187 3300041997 Bacteria 1529
533 Ga0439433_0002772 3300041999 Bacteria 3733
534 Ga0439433_0007775 3300041999 Bacteria 2317
535 Ga0439437_038995 3300042000 Bacteria 613
536 Ga0439437_044912 3300042000 Bacteria 578
537 Ga0439442_026084 3300042002 Bacteria 1216
538 Ga0439442_035387 3300042002 Bacteria 1044
539 Ga0439445_0255926 3300042004 Bacteria 523
540 Ga0439432_001040 3300042006 Bacteria 10528
541 Ga0439432_096329 3300042006 Bacteria 887
542 Ga0439432_213823 3300042006 Bacteria 557
543 Ga0439449_0019219 3300042007 Bacteria 2561
544 Ga0439449_0130775 3300042007 Bacteria 933
545 Ga0439452_003891 3300042010 Bacteria 5118
546 Ga0439452_006902 3300042010 Bacteria 3517
547 Ga0439454_012408 3300042011 Bacteria 1156
548 Ga0439457_012603 3300042014 Bacteria 1905
549 Ga0439457_046768 3300042014 Bacteria 968
550 Ga0439457_065680 3300042014 Bacteria 824
551 Ga0439462_0001318 3300042015 Bacteria 5467
552 Ga0439462_0079804 3300042015 Bacteria 893
553 Ga0450911_030684 3300042115 Bacteria 697
554 Ga0450912_032470 3300042116 Bacteria 545
555 Ga0450919_015142 3300042121 Bacteria 871
556 Ga0450920_033381 3300042122 Bacteria 1017
557 Ga0450921_005413 3300042123 Bacteria 964
558 Ga0450922_022460 3300042124 Bacteria 657
559 Ga0450923_005097 3300042125 Bacteria 2103
560 Ga0450888_039612 3300042126 Bacteria 652
561 Ga0450890_078893 3300042127 Bacteria 535
562 Ga0450894_041805 3300042131 Bacteria 659
563 Ga0450896_015628 3300042133 Bacteria 1087
564 Ga0450896_036011 3300042133 Bacteria 761
565 Ga0450898_006200 3300042134 Bacteria 1829
566 Ga0450898_018085 3300042134 Bacteria 1218
567 Ga0450900_033416 3300042136 Bacteria 753
568 Ga0450906_005730 3300042145 Bacteria 2536
569 Ga0450910_010111 3300042147 Bacteria 1340
570 Ga0450910_054393 3300042147 Bacteria 666
571 Ga0439446_0005262 3300042156 Bacteria 3322
572 Ga0439446_0048173 3300042156 Bacteria 1269
573 Ga0439446_0124007 3300042156 Bacteria 833
574 Ga0439446_0139013 3300042156 Bacteria 792
575 Ga0439446_0182861 3300042156 Bacteria 701
576 Ga0450908_004957 3300042184 Bacteria 2557
577 Ga0450908_005518 3300042184 Bacteria 2424
578 Ga0439434_0004240 3300042435 Bacteria 4188
579 Ga0439434_0006113 3300042435 Bacteria 3511
580 Ga0439434_0024175 3300042435 Bacteria 1832
581 Ga0450918_007011 3300042531 Bacteria 2002
582 Ga0450893_0001626 3300042532 Bacteria 3452
583 Ga0450893_0027591 3300042532 Bacteria 1001
584 Ga0450893_0064141 3300042532 Bacteria 706
585 Ga0450893_0112883 3300042532 Bacteria 562
586 Ga0451577_0007910 3300042876 Bacteria 10388
587 Ga0451577_0129918 3300042876 Bacteria 2259
588 Ga0453683_0009185 3300044673 Bacteria 6605
589 Ga0466965_0050739 3300044683 Bacteria 2057
590 Ga0453684_0026869 3300044712 Bacteria 8292
591 Ga0453684_0763732 3300044712 Bacteria 1045
592 Ga0453684_1589321 3300044712 Bacteria 671
593 Ga0466971_0401815 3300044719 Bacteria 668
594 Ga0466957_0394886 3300044842 Bacteria 945
595 Ga0466960_0024961 3300044901 Bacteria 2701
596 Ga0451576_0018182 3300045051 Bacteria 7710
597 Ga0451576_0788109 3300045051 Bacteria 998
598 Ga0466967_0959779 3300045976 Bacteria 851
599 Ga0495627_001913 3300046453 Bacteria 10880
600 Ga0495627_084868 3300046453 Bacteria 914
601 Ga0495629_0801468 3300046459 Bacteria 621
602 Ga0495638_0119583 3300046460 Bacteria 1558
603 Ga0495651_0382814 3300046462 Bacteria 922
604 Ga0495653_0500140 3300046463 Bacteria 758
605 Ga0495653_0969763 3300046463 Bacteria 504
606 Ga0495650_0113844 3300046471 Bacteria 1002
607 Ga0495639_0023242 3300046475 Bacteria 2723
608 Ga0495610_0024818 3300046512 Bacteria 3229
609 Ga0495610_0212363 3300046512 Bacteria 786
610 Ga0495616_0010183 3300046513 Bacteria 5456
611 Ga0495620_0002466 3300046515 Bacteria 10724
612 Ga0495620_0218188 3300046515 Bacteria 730
613 Ga0495628_0750912 3300046516 Bacteria 686
614 Ga0495630_0489811 3300046517 Bacteria 943
615 Ga0495631_0003037 3300046518 Bacteria 9274
616 Ga0495637_0003474 3300046520 Bacteria 8367
617 Ga0495663_0153113 3300046525 Bacteria 788
618 Ga0495642_0240402 3300046528 Bacteria 791
619 Ga0495652_0731076 3300046529 Bacteria 664
620 Ga0495654_0011433 3300046530 Bacteria 4802
621 Ga0495621_0013869 3300046539 Bacteria 2541
622 Ga0495621_0019672 3300046539 Bacteria 2207
623 Ga0495621_0302859 3300046539 Bacteria 663
624 Ga0495622_0104723 3300046557 Bacteria 1296
625 Ga0495633_0270865 3300046558 Bacteria 773
626 Ga0495656_0000746 3300046615 Bacteria 10523
627 Ga0495634_0699015 3300046642 Bacteria 583
628 Ga0495625_0005468 3300046660 Bacteria 11573
629 Ga0495625_0069851 3300046660 Bacteria 2467
630 Ga0495625_0238885 3300046660 Bacteria 1183
631 Ga0495661_0328406 3300046665 Bacteria 758
632 Ga0495661_0420979 3300046665 Bacteria 647
633 Ga0495588_0102512 3300046674 Bacteria 1504
634 Ga0495588_0373218 3300046674 Bacteria 749
635 Ga0495658_0063297 3300046683 Bacteria 2128
636 Ga0495658_1072531 3300046683 Bacteria 514
637 Ga0495669_0657056 3300046684 Bacteria 510
638 Ga0495624_0128461 3300046690 Bacteria 1555
639 Ga0495624_0344680 3300046690 Bacteria 896
640 Ga0495670_0212498 3300046691 Bacteria 1026
641 Ga0495670_0255194 3300046691 Bacteria 935
642 Ga0495670_0393707 3300046691 Bacteria 748
643 Ga0495670_0529958 3300046691 Bacteria 640
644 Ga0495671_0009329 3300046692 Bacteria 5482
645 Ga0495581_0353461 3300047315 Bacteria 858
646 Ga0495604_1012317 3300047317 Bacteria 514
647 Ga0495676_0102050 3300047321 Bacteria 2120
648 Ga0495677_0467489 3300047445 Bacteria 500
649 Ga0495681_0345125 3300047470 Bacteria 567
650 Ga0495686_0214275 3300047472 Bacteria 1099
651 Ga0495593_0012263 3300047673 Bacteria 4898
652 Ga0495602_0384296 3300048088 Bacteria 1005
653 Ga0495614_0051869 3300048089 Bacteria 1758
654 Ga0495614_0262777 3300048089 Bacteria 792
655 Ga0495615_0096335 3300048090 Bacteria 831
656 Ga0495615_0120639 3300048090 Bacteria 758
657 Ga0496100_0009165 3300048903 Bacteria 5553
658 Ga0496101_0004382 3300048904 Bacteria 8872
659 Ga0496101_0005001 3300048904 Bacteria 8419
660 Ga0496102_0006127 3300048905 Bacteria 10246
661 Ga0496103_0210241 3300048906 Bacteria 1251
662 Ga0496104_0029955 3300048907 Bacteria 5053
663 Ga0496105_0004053 3300048908 Bacteria 10967
664 Ga0496106_0009081 3300048909 Bacteria 7347
665 Ga0496107_0054704 3300048910 Bacteria 2881
666 Ga0496107_0175066 3300048910 Bacteria 1593
667 Ga0496108_0571847 3300048911 Bacteria 985
668 Ga0496109_0227502 3300048912 Bacteria 1754
669 Ga0496109_0594722 3300048912 Bacteria 1042
670 Ga0496110_0446642 3300048913 Bacteria 1178
671 Ga0496111_0071605 3300048914 Bacteria 2523
672 Ga0496111_0812564 3300048914 Bacteria 676
673 Ga0496112_0325183 3300048915 Bacteria 1482
674 Ga0496113_0518479 3300048916 Bacteria 957
675 Ga0496114_1021945 3300048917 Bacteria 710
676 Ga0496114_1132328 3300048917 Bacteria 668
677 Ga0496115_0941435 3300048918 Bacteria 664
678 Ga0496116_0039510 3300048919 Bacteria 3262
679 Ga0496117_0023000 3300048920 Bacteria 4983
680 Ga0496117_0043622 3300048920 Bacteria 3258
681 Ga0496118_0006363 3300048921 Bacteria 13016
682 Ga0496118_0019829 3300048921 Bacteria 5994
683 Ga0496119_0082193 3300048922 Bacteria 1853
684 Ga0496119_0175820 3300048922 Bacteria 1127
685 Ga0496121_0052610 3300048924 Bacteria 3417
686 Ga0496121_0121176 3300048924 Bacteria 1975
687 Ga0496122_0582460 3300048925 Bacteria 527
688 Ga0496123_0377373 3300048926 Bacteria 651
689 Ga0496124_0176704 3300048927 Bacteria 1647
690 Ga0496124_0544698 3300048927 Bacteria 767
691 Ga0496125_0046359 3300048928 Bacteria 3647
692 Ga0496125_0053320 3300048928 Bacteria 3316
693 Ga0496125_0617063 3300048928 Bacteria 589
694 Ga0501315_012151 3300049531 Bacteria 1061
695 Ga0501317_049401 3300049533 Bacteria 664
696 Ga0501323_015594 3300049539 Bacteria 961
697 Ga0501323_067597 3300049539 Bacteria 567
698 Ga0501037_0145399 3300049573 Bacteria 1696
699 Ga0501046_0281209 3300049580 Bacteria 1219
700 Ga0501223_144669 3300049663 Bacteria 513
701 Ga0501233_289805 3300049668 Bacteria 503
702 Ga0501243_142071 3300049675 Bacteria 508
703 Ga0501249_050489 3300049679 Bacteria 954
704 Ga0501225_0046999 3300049705 Bacteria 1197
705 Ga0501280_027411 3300049776 Bacteria 876
706 nmdc:mga03683_105991_c1 3300050489 Bacteria 1239
707 nmdc:mga03683_162337_c1 3300050489 Bacteria 1013
708 nmdc:mga03683_197312_c2 3300050489 Bacteria 520
709 nmdc:mga03683_343496_c1 3300050489 Bacteria 705
710 nmdc:mga03683_345433_c1 3300050489 Bacteria 704
711 nmdc:mga03683_456182_c1 3300050489 Bacteria 615
712 nmdc:mga03683_468576_c1 3300050489 Bacteria 607
713 nmdc:mga03683_73810_c1 3300050489 Bacteria 1463
714 nmdc:mga03n38_116333_c1 3300050490 Bacteria 1309
715 nmdc:mga03n38_258017_c1 3300050490 Bacteria 923
716 nmdc:mga03n38_330806_c1 3300050490 Bacteria 825
717 nmdc:mga03n38_430839_c1 3300050490 Bacteria 731
718 nmdc:mga03n38_500810_c1 3300050490 Bacteria 682
719 nmdc:mga00v17_315474_c1 3300050491 Bacteria 1016
720 nmdc:mga00v17_42986_c1 3300050491 Bacteria 2720
721 nmdc:mga00v17_565297_c1 3300050491 Bacteria 735
722 nmdc:mga00v17_585738_c1 3300050491 Bacteria 720
723 nmdc:mga00v17_636184_c1 3300050491 Bacteria 686
724 nmdc:mga00v17_767875_c1 3300050491 Bacteria 615
725 nmdc:mga0yw44_138048_c1 3300050492 Bacteria 1583
726 nmdc:mga0yw44_658365_c1 3300050492 Bacteria 712
727 nmdc:mga0k408_111441_c1 3300050493 Bacteria 1617
728 nmdc:mga0k408_231329_c1 3300050493 Bacteria 1103
729 nmdc:mga0k408_26362_c1 3300050493 Bacteria 3295
730 nmdc:mga0k408_305574_c1 3300050493 Bacteria 949
731 nmdc:mga0k408_6011_c1 3300050493 Bacteria 6476
732 nmdc:mga0k408_81457_c1 3300050493 Bacteria 1895
733 nmdc:mga0k408_89457_c1 3300050493 Bacteria 1808
734 nmdc:mga06z11_154388_c1 3300050494 Bacteria 834
735 nmdc:mga06z11_72127_c1 3300050494 Bacteria 1830
736 nmdc:mga04h51_283906_c1 3300050495 Bacteria 671
737 nmdc:mga07m45_206558_c1 3300050496 Bacteria 1142
738 nmdc:mga07m45_25369_c1 3300050496 Bacteria 3251
739 nmdc:mga07m45_277484_c1 3300050496 Bacteria 975
740 nmdc:mga07m45_289043_c1 3300050496 Bacteria 954
741 nmdc:mga07m45_36823_c1 3300050496 Bacteria 2727
742 nmdc:mga07m45_383745_c1 3300050496 Bacteria 816
743 nmdc:mga07m45_5257_c1 3300050496 Bacteria 6430
744 nmdc:mga07m45_532405_c1 3300050496 Bacteria 680
745 nmdc:mga07m45_5339_c1 3300050496 Bacteria 6394
746 nmdc:mga07m45_56345_c1 3300050496 Bacteria 2222
747 nmdc:mga07m45_758688_c1 3300050496 Bacteria 557
748 nmdc:mga07m45_768095_c1 3300050496 Bacteria 553
749 nmdc:mga0sz30_271917_c1 3300050516 Bacteria 755
750 nmdc:mga0sz30_388442_c1 3300050516 Bacteria 625
751 Ga0495612_0168246 3300053078 Bacteria 959
752 Ga0500610_0056696 3300053079 Bacteria 2044
753 Ga0495655_0148787 3300053083 Bacteria 735
754 Ga0500643_019521 3300053087 Bacteria 2229
755 Ga0500651_0000347 3300053093 Bacteria 26028
756 Ga0500566_0114122 3300053094 Bacteria 1465
757 Ga0500555_159784 3300053103 Bacteria 550
758 Ga0500562_006293 3300053108 Bacteria 2995
759 Ga0500562_144760 3300053108 Bacteria 647
760 Ga0500571_001746 3300053110 Bacteria 10443
761 Ga0500572_175521 3300053111 Bacteria 702
762 Ga0500593_018569 3300053117 Bacteria 3034
763 Ga0500593_118317 3300053117 Bacteria 1078
764 Ga0500594_0033579 3300053118 Bacteria 1365
765 Ga0500607_006984 3300053121 Bacteria 7040
766 Ga0500607_197701 3300053121 Bacteria 868
767 Ga0500608_017372 3300053122 Bacteria 3267
768 Ga0500608_358475 3300053122 Bacteria 513
769 Ga0500628_111204 3300053129 Bacteria 735
770 Ga0500655_055511 3300053133 Bacteria 793
771 Ga0500658_0000560 3300053134 Bacteria 15661
772 Ga0500658_0000589 3300053134 Bacteria 15190
773 Ga0500564_131856 3300053138 Bacteria 1080
774 Ga0500568_0006650 3300053139 Bacteria 5780
775 Ga0500577_0220196 3300053142 Bacteria 821
776 Ga0500586_158012 3300053145 Bacteria 770
777 Ga0500616_0021860 3300053153 Bacteria 3578
778 Ga0500624_015969 3300053157 Bacteria 1154
779 Ga0500627_0044221 3300053158 Bacteria 1922
780 Ga0500634_0257925 3300053161 Bacteria 719
781 Ga0500634_0325631 3300053161 Bacteria 597
782 Ga0500638_051737 3300053162 Bacteria 1985
783 Ga0500636_0352800 3300053177 Bacteria 701
784 Ga0500625_202069 3300053729 Bacteria 663
785 Ga0500645_198453 3300053730 Bacteria 542
786 Ga0500565_017652 3300053734 Bacteria 824
787 Ga0500596_018659 3300053735 Bacteria 1041
788 Ga0590075_049907 3300059424 Bacteria 1073
789 Ga0590077_137847 3300059426 Bacteria 581
790 2513230074 2513020051 Bacteria 6053213
791 2548499081 2547132374 Bacteria 5530232
792 2599620577 2599185214 Bacteria 8209958
793 2599673876 2599185226 Bacteria 8233575
794 2599678807 2599185227 Bacteria 8246414
795 2599690088 2599185229 Bacteria 8216126
796 2643867715 2643221570 Bacteria 5103772
797 2643991578 2643221596 Bacteria 5006805
798 2644062256 2643221609 Bacteria 6756331
799 2644071443 2643221611 Bacteria 6820941
800 2644162160 2643221628 Bacteria 5745828
801 2644293324 2643221652 Bacteria 5140275
802 2644324283 2643221658 Bacteria 6064537
803 2644396124 2643221672 Bacteria 6322190
804 2644464964 2643221683 Bacteria 5749203
805 2644648538 2643221717 Bacteria 5676132
806 2738720472 2738541277 Bacteria 7458140
807 2738884043 2738541307 Bacteria 8606193
808 2739245866 2738543012 Bacteria 7115078
809 2739279671 2738543019 Bacteria 7459457
810 2816470560 2816332133 Bacteria 7249298
811 2819601154 2818991446 Bacteria 7757362
812 2831271532 2831265667 Bacteria 7184833
813 2838055433 2838054893 Bacteria 7451788
814 2842680582 2842677519 Bacteria 5615038
815 2842718659 2842718218 Bacteria 4560148
816 2881103401 2881101125 Bacteria 4590519
817 2885201034 2885198086 Bacteria 7212419
818 2885214183 2885211737 Bacteria 7212420
819 2899927499 2899924645 Bacteria 7487985
820 2904450772 2904449895 Bacteria 6927402
821 2904459728 2904456579 Bacteria 6819253
822 2904547995 2904541872 Bacteria 8915136
823 2919462697 2919462493 Bacteria 5817112
824 2919707086 2919704043 Bacteria 5560311
825 2928042588 2928037797 Bacteria 7273642
826 2928048985 2928044640 Bacteria 7271509
827 2928051535 2928051484 Bacteria 7773759
828 2928068746 2928064002 Bacteria 7419480
829 2928073256 2928070936 Bacteria 8062541
830 2928087017 2928084124 Bacteria 7159212
831 2929161610 2929160207 Bacteria 9075316
832 2929521490 2929520902 Bacteria 6765052
833 2945913949 2945909444 Bacteria 7065066
834 2945949504 2945945610 Bacteria 5951079
835 2945973548 2945972063 Bacteria 6086495
836 2945990653 2945984333 Bacteria 7358892
837 2954770838 2954767861 Bacteria 5535784
838 2990713976 2990710928 Bacteria 5002431
839 Ga0207704_11670850
840 JGI24740J21852_10004290
841 JGI24739J22299_10008905
842 JGI24739J22299_10009598
843 JGI25158J39367_1004285
844 JGI25159J45721_1029844
845 JGI25151J46595_10003000
846 JGI25151J46595_10028625
847 JGI25151J46595_10071196
848 JGI25153J46596_10009310
849 rootH1_10079751
850 JGI25160J50197_1010452
851 Ga0006562J51391_1089139
852 Ga0006562J51391_1089141
853 Ga0055527_1014119
854 Ga0055535_1000966
855 Ga0055542_1000080
856 Ga0055537_1000150
857 Ga0055537_1003599
858 Ga0055524_1064407
859 Ga0055536_1006807
860 Ga0055536_1027523
861 Ga0055536_1035061
862 Ga0055534_1000016
863 Ga0055534_1017802
864 Ga0055528_1000894
865 Ga0055528_1021050
866 Ga0055528_1043582
867 Ga0055528_1094440
868 Ga0055530_10003550
869 Ga0055530_10005191
870 Ga0055530_10061295
871 Ga0055540_1019292
872 Ga0055540_1021120
873 Ga0055540_1023163
874 Ga0055540_1043939
875 Ga0055531_10001826
876 Ga0055531_10004420
877 Ga0065714_10004675
878 Ga0065714_10080808
879 Ga0065714_10479621
880 Ga0065704_10185663
881 Ga0065704_10296250
882 Ga0065704_10364268
883 Ga0065704_10444071
884 Ga0070658_10139715
885 Ga0070658_10269609
886 Ga0070658_10817630
887 Ga0068869_100022576
888 Ga0068869_100593224
889 Ga0070666_10270584
890 Ga0068868_100159375
891 Ga0070660_100010089
892 Ga0070660_100782922
893 Ga0070661_100647509
894 Ga0070661_101085177
895 Ga0070668_100766997
896 Ga0070669_100287905
897 Ga0070674_100181127
898 Ga0070674_100524611
899 Ga0070674_100629391
900 Ga0070674_101776554
901 Ga0070673_100945336
902 Ga0070673_101209985
903 Ga0070688_101789278
904 Ga0070659_100183936
905 Ga0070667_100179365
906 Ga0070714_100904660
907 Ga0070663_102137943
908 Ga0070678_100243295
909 Ga0070678_100630753
910 Ga0070678_101979127
911 Ga0070662_100039907
912 Ga0068867_101691058
913 Ga0070685_10929949
914 Ga0070679_100054548
915 Ga0068853_100147073
916 Ga0068853_101617070
917 Ga0070665_100010145
918 Ga0070665_101595040
919 Ga0070665_101802463
920 Ga0068855_100119841
921 Ga0068855_100241413
922 Ga0068855_101141513
923 Ga0070664_100040580
924 Ga0068857_100073208
925 Ga0068857_100157874
926 Ga0068857_100927464
927 Ga0068857_101816737
928 Ga0068856_100206139
929 Ga0068856_100391387
930 Ga0068856_101525123
931 Ga0068852_100107707
932 Ga0068852_101034290
933 Ga0068859_101314464
934 Ga0068864_101278132
935 Ga0068866_11377083
936 Ga0068861_102635540
937 Ga0068851_10002741
938 Ga0068870_11118470
939 Ga0068863_100134033
940 Ga0068858_101685273
941 Ga0068862_100298255
942 Ga0075365_10022096
943 Ga0075365_10071228
944 Ga0075365_10930983
945 Ga0075368_10251250
946 Ga0075363_100007907
947 Ga0075363_100258058
948 Ga0075363_100816840
949 Ga0075363_100876610
950 Ga0075363_100897483
951 Ga0075364_10020170
952 Ga0075364_10081814
953 Ga0075364_10210045
954 Ga0075364_10227248
955 Ga0075364_10970552
956 Ga0075432_10002614
957 Ga0075432_10072540
958 Ga0075362_10037995
959 Ga0075362_10038214
960 Ga0075362_10056377
961 Ga0075362_10135941
962 Ga0075362_10179908
963 Ga0075362_10183140
964 Ga0075367_10136738
965 Ga0075367_10255335
966 Ga0075367_10440384
967 Ga0075369_10082983
968 Ga0075369_10225578
969 Ga0075366_10016366
970 Ga0075366_10025817
971 Ga0075366_10045854
972 Ga0075366_10077444
973 Ga0075366_10084748
974 Ga0075366_10116986
975 Ga0075366_10462917
976 Ga0075366_10877728
977 Ga0097621_100169928
978 Ga0097621_101014025
979 Ga0075370_10001499
980 Ga0075370_10002475
981 Ga0075370_10004243
982 Ga0075370_10088484
983 Ga0075370_10094291
984 Ga0075370_10226115
985 Ga0075370_10247279
986 Ga0075370_10258840
987 Ga0075370_10311167
988 Ga0075370_10590513
989 Ga0075370_10866468
990 Ga0068871_100023433
991 Ga0068871_100737242
992 Ga0068871_101324974
993 Ga0068865_100498852
994 Ga0068865_100848700
995 Ga0068865_101090828
996 Ga0075436_101513180
997 Ga0097620_101314383
998 Ga0079104_1021469
999 Ga0099826_10000101
1000 Ga0105251_10646693
1001 Ga0105244_10010520
1002 Ga0105244_10117797
1003 Ga0105244_10126774
1004 Ga0105250_10009366
1005 Ga0105240_10006365
1006 Ga0105240_10254488
1007 Ga0105240_11010638
1008 Ga0105245_10872035
1009 Ga0105243_10003361
1010 Ga0105243_10260122
1011 Ga0105243_11061208
1012 Ga0105241_10419025
1013 Ga0105242_10000553
1014 Ga0105242_10201925
1015 Ga0105242_10689738
1016 Ga0105242_10707822
1017 Ga0105248_10166463
1018 Ga0105248_11054050
1019 Ga0105248_11159186
1020 Ga0105237_11331089
1021 Ga0105237_11629785
1022 Ga0105238_10017091
1023 Ga0105238_10543900
1024 Ga0105238_11705029
1025 Ga0105238_11867165
1026 Ga0105249_12090763
1027 Ga0105239_10200838
1028 Ga0105239_11114608
1029 Ga0105246_10130197
1030 Ga0105246_10352106
1031 Ga0105246_11000133
1032 Ga0105246_11534058
1033 Ga0105246_11799169
1034 Ga0157319_1014482
1035 Ga0157347_1002744
1036 Ga0157347_1026183
1037 Ga0157339_1032486
1038 Ga0157326_1012389
1039 Ga0157373_10094943
1040 Ga0157373_10626851
1041 Ga0157373_10850502
1042 Ga0157371_10059656
1043 Ga0157371_10960774
1044 Ga0157370_10011514
1045 Ga0157370_10072910
1046 Ga0157370_10485367
1047 Ga0157370_11952806
1048 Ga0157369_10013149
1049 Ga0157369_12189830
1050 Ga0157374_10585406
1051 Ga0157378_11576671
1052 Ga0163162_10362486
1053 Ga0163162_10698347
1054 Ga0163162_10817893
1055 Ga0163162_12441603
1056 Ga0157372_10576067
1057 Ga0157375_11511848
1058 Ga0157375_11772195
1059 Ga0163163_11594957
1060 Ga0157380_10114627
1061 Ga0157380_10967518
1062 Ga0157380_12835996
1063 Ga0182008_10001633
1064 Ga0182008_10058827
1065 Ga0182008_10075865
1066 Ga0182008_10141243
1067 Ga0182008_10565055
1068 Ga0182008_10688862
1069 Ga0157377_11375600
1070 Ga0157379_10208061
1071 Ga0157376_10344535
1072 Ga0157376_10709139
1073 Ga0157376_10825833
1074 Ga0182006_1010501
1075 Ga0182006_1025900
1076 Ga0182006_1150238
1077 Ga0182006_1176170
1078 Ga0182006_1233599
1079 Ga0182007_10000853
1080 Ga0182007_10003809
1081 Ga0182007_10343066
1082 Ga0182005_1052265
1083 Ga0182005_1072204
1084 Ga0182005_1078107
1085 Ga0163161_10001891
1086 Ga0163161_10007216
1087 Ga0163161_10008493
1088 Ga0163161_10042751
1089 Ga0163161_10122988
1090 Ga0209436_123904
1091 Ga0209672_100642
1092 Ga0209147_100995
1093 Ga0209258_100093
1094 Ga0207425_1000989
1095 Ga0207425_1009140
1096 Ga0209148_1000007
1097 Ga0209129_1000024
1098 Ga0209129_1006303
1099 Ga0209129_1010886
1100 Ga0209565_1000098
1101 Ga0209565_1000633
1102 Ga0209565_1042110
1103 Ga0209673_1000058
1104 Ga0209673_1001034
1105 Ga0209673_1039935
1106 Ga0209673_1041386
1107 Ga0209673_1052393
1108 Ga0209130_1000654
1109 Ga0209130_1001114
1110 Ga0209675_1000010
1111 Ga0209675_1000151
1112 Ga0209675_1003092
1113 Ga0209675_1007033
1114 Ga0209676_1000028
1115 Ga0209676_1001046
1116 Ga0209676_1003308
1117 Ga0209676_1025199
1118 Ga0209676_1027854
1119 Ga0209676_1064029
1120 Ga0209025_1000685
1121 Ga0209025_1001904
1122 Ga0209025_1005469
1123 Ga0209025_1078148
1124 Ga0209564_1000209
1125 Ga0209564_1002281
1126 Ga0209758_1001224
1127 Ga0209758_1037536
1128 Ga0209050_1000072
1129 Ga0209050_1000927
1130 Ga0209050_1004050
1131 Ga0209050_1008317
1132 Ga0209256_1000088
1133 Ga0209256_1023010
1134 Ga0209256_1025808
1135 Ga0207426_1000038
1136 Ga0207426_1000053
1137 Ga0209051_1000015
1138 Ga0209051_1000056
1139 Ga0209051_1000196
1140 Ga0209051_1000392
1141 Ga0209051_1000424
1142 Ga0209051_1000545
1143 Ga0209257_1000305
1144 Ga0209257_1002205
1145 Ga0209257_1004602
1146 Ga0209257_1009796
1147 Ga0209257_1059782
1148 Ga0207656_10012795
1149 Ga0207655_1006555
1150 Ga0207655_1222623
1151 Ga0207682_10318236
1152 Ga0207688_10900022
1153 Ga0207680_10255063
1154 Ga0207705_10022490
1155 Ga0207705_10074648
1156 Ga0207705_10472555
1157 Ga0207654_10240763
1158 Ga0207695_10060685
1159 Ga0207671_10088086
1160 Ga0207671_10806075
1161 Ga0207660_10181378
1162 Ga0207657_10014060
1163 Ga0207657_10282786
1164 Ga0207649_10704367
1165 Ga0207649_10810040
1166 Ga0207652_10088927
1167 Ga0207652_10161675
1168 Ga0207694_10022934
1169 Ga0207694_10250337
1170 Ga0207694_10767923
1171 Ga0207650_10312000
1172 Ga0207659_10732672
1173 Ga0207659_11340761
1174 Ga0207687_10015912
1175 Ga0207664_10600294
1176 Ga0207690_10127659
1177 Ga0207690_11043904
1178 Ga0207706_10075902
1179 Ga0207706_10275666
1180 Ga0207686_10001796
1181 Ga0207686_10224147
1182 Ga0207686_10579039
1183 Ga0207709_10000958
1184 Ga0207709_10001025
1185 Ga0207709_10001291
1186 Ga0207709_10002267
1187 Ga0207709_10002735
1188 Ga0207709_10203263
1189 Ga0207669_10822658
1190 Ga0207704_10521793
1191 Ga0207704_10843252
1192 Ga0207691_10759872
1193 Ga0207691_11492302
1194 Ga0207711_10494626
1195 Ga0207711_12098101
1196 Ga0207689_10065726
1197 Ga0207689_10081640
1198 Ga0207689_10482507
1199 Ga0207689_10670999
1200 Ga0207679_10066316
1201 Ga0207667_10341672
1202 Ga0207667_10374716
1203 Ga0207667_10674686
1204 Ga0207667_11952205
1205 Ga0207651_10255794
1206 Ga0207651_10421668
1207 Ga0207668_10248284
1208 Ga0207668_12032824
1209 Ga0207640_10178836
1210 Ga0207640_10754190
1211 Ga0207658_10267667
1212 Ga0207658_10747812
1213 Ga0207658_11007527
1214 Ga0207677_10181460
1215 Ga0207677_10493446
1216 Ga0207639_10010944
1217 Ga0207639_11073821
1218 Ga0207639_11245984
1219 Ga0207678_10395257
1220 Ga0207702_10246572
1221 Ga0207702_11035726
1222 Ga0207641_10024357
1223 Ga0207648_10874461
1224 Ga0207648_11344358
1225 Ga0207674_10202033
1226 Ga0207674_10486044
1227 Ga0207674_10713668
1228 Ga0207683_10180083
1229 Ga0207683_10332354
1230 Ga0207698_10296757
1231 Ga0207698_11526489
1232 Ga0209281_1033796
1233 Ga0209282_1001024
1234 Ga0209813_10141295
1235 Ga0209974_10085254
1236 Ga0207428_10127051
1237 Ga0268266_10218330
1238 Ga0268265_10386394
1239 Ga0268264_12398864
1240 Ga0307515_10000084
1241 Ga0307515_10072156
1242 Ga0307515_10483798
1243 Ga0307515_10538684
1244 Ga0307512_10121381
1245 Ga0316177_1148101
1246 Ga0314311_1237239
1247 Ga0316178_1016090
1248 Ga0316180_1033885
1249 Ga0316183_1122753
1250 Ga0316181_1085526
1251 Ga0316182_1238099
1252 Ga0316182_1399987
1253 Ga0265327_10148026
1254 Ga0307513_10026225
1255 Ga0307513_10519366
1256 Ga0307408_100073371
1257 Ga0307408_100080304
1258 Ga0307408_100161448
1259 Ga0307408_100266625
1260 Ga0307408_100280671
1261 Ga0307408_100316751
1262 Ga0307408_100464861
1263 Ga0307408_100480893
1264 Ga0307408_100546985
1265 Ga0307408_101249100
1266 Ga0307408_101845938
1267 Ga0307408_102262748
1268 Ga0307514_10000954
1269 Ga0307514_10138226
1270 Ga0265314_10007074
1271 Ga0307405_10022681
1272 Ga0307405_10203872
1273 Ga0307405_10313310
1274 Ga0307405_10474225
1275 Ga0307413_10138982
1276 Ga0307413_10454530
1277 Ga0307413_10903079
1278 Ga0307410_10510404
1279 Ga0307410_10530941
1280 Ga0307410_11552995
1281 Ga0307406_10001705
1282 Ga0307406_10029763
1283 Ga0307406_10444781
1284 Ga0307406_10880524
1285 Ga0307406_10985024
1286 Ga0307406_11055058
1287 Ga0307407_10127011
1288 Ga0307407_10219229
1289 Ga0307412_10009231
1290 Ga0307412_10018497
1291 Ga0307412_10040329
1292 Ga0307412_10069765
1293 Ga0307412_10164512
1294 Ga0307412_10239149
1295 Ga0307412_10434341
1296 Ga0307412_10818926
1297 Ga0307412_10882358
1298 Ga0307412_11066941
1299 Ga0307412_11218498
1300 Ga0307409_100360040
1301 Ga0307409_101306064
1302 Ga0307416_100090654
1303 Ga0307416_100648391
1304 Ga0307416_100665749
1305 Ga0307416_100692627
1306 Ga0307416_101187508
1307 Ga0307416_101387557
1308 Ga0307416_102124172
1309 Ga0307416_103302620
1310 Ga0307414_10068974
1311 Ga0307414_10091564
1312 Ga0307414_10593157
1313 Ga0307414_10877261
1314 Ga0307414_12203709
1315 Ga0307411_10024402
1316 Ga0307411_10178581
1317 Ga0307411_10311964
1318 Ga0307411_10454826
1319 Ga0307411_10974878
1320 Ga0307411_11479876
1321 Ga0307411_12260670
1322 Ga0307415_101084036
1323 Ga0373943_0428727
1324 Ga0373931_0089159
1325 Ga0395899_0104110
1326 Ga0395900_0161473
1327 Ga0395898_0294881
1328 Ga0395905_0050498
1329 Ga0395905_0633031
1330 Ga0395901_0074087
1331 Ga0395901_0435328
1332 Ga0395901_1223270
1333 Ga0436361_0070738
1334 Ga0439436_0001048
1335 Ga0439436_0049230
1336 Ga0439436_0265955
1337 Ga0439438_081388
1338 Ga0439439_0000268
1339 Ga0439439_0039004
1340 Ga0439447_023051
1341 Ga0439461_0006198
1342 Ga0439461_0051778
1343 Ga0439461_0077677
1344 Ga0439461_0101819
1345 Ga0439466_0004086
1346 Ga0439466_0051658
1347 Ga0439466_0106718
1348 Ga0439466_0238257
1349 Ga0439465_0003993
1350 Ga0439465_0023149
1351 Ga0451787_019627
1352 Ga0451789_0111381
1353 Ga0451791_1495823
1354 Ga0451793_0435770
1355 Ga0451793_1075355
1356 Ga0451793_1159892
1357 Ga0451797_0157609
1358 Ga0451795_1558984
1359 Ga0451798_0238516
1360 Ga0451800_1458506
1361 Ga0451802_0624242
1362 Ga0451807_0286398
1363 Ga0451807_1888789
1364 Ga0451833_0083665
1365 Ga0451837_0663527
1366 Ga0451841_0595886
1367 Ga0451849_1011591
1368 Ga0451853_1220038
1369 Ga0439431_0000483
1370 Ga0439431_0022187
1371 Ga0439433_0002772
1372 Ga0439433_0007775
1373 Ga0439437_038995
1374 Ga0439437_044912
1375 Ga0439442_026084
1376 Ga0439442_035387
1377 Ga0439445_0255926
1378 Ga0439432_001040
1379 Ga0439432_096329
1380 Ga0439432_213823
1381 Ga0439449_0019219
1382 Ga0439449_0130775
1383 Ga0439452_003891
1384 Ga0439452_006902
1385 Ga0439454_012408
1386 Ga0439457_012603
1387 Ga0439457_046768
1388 Ga0439457_065680
1389 Ga0439462_0001318
1390 Ga0439462_0079804
1391 Ga0450911_030684
1392 Ga0450912_032470
1393 Ga0450919_015142
1394 Ga0450920_033381
1395 Ga0450921_005413
1396 Ga0450922_022460
1397 Ga0450923_005097
1398 Ga0450888_039612
1399 Ga0450890_078893
1400 Ga0450894_041805
1401 Ga0450896_015628
1402 Ga0450896_036011
1403 Ga0450898_006200
1404 Ga0450898_018085
1405 Ga0450900_033416
1406 Ga0450906_005730
1407 Ga0450910_010111
1408 Ga0450910_054393
1409 Ga0439446_0005262
1410 Ga0439446_0048173
1411 Ga0439446_0124007
1412 Ga0439446_0139013
1413 Ga0439446_0182861
1414 Ga0450908_004957
1415 Ga0450908_005518
1416 Ga0439434_0004240
1417 Ga0439434_0006113
1418 Ga0439434_0024175
1419 Ga0450918_007011
1420 Ga0450893_0001626
1421 Ga0450893_0027591
1422 Ga0450893_0064141
1423 Ga0450893_0112883
1424 Ga0451577_0007910
1425 Ga0451577_0129918
1426 Ga0453683_0009185
1427 Ga0466965_0050739
1428 Ga0453684_0026869
1429 Ga0453684_0763732
1430 Ga0453684_1589321
1431 Ga0466971_0401815
1432 Ga0466957_0394886
1433 Ga0466960_0024961
1434 Ga0451576_0018182
1435 Ga0451576_0788109
1436 Ga0466967_0959779
1437 Ga0495627_001913
1438 Ga0495627_084868
1439 Ga0495629_0801468
1440 Ga0495638_0119583
1441 Ga0495651_0382814
1442 Ga0495653_0500140
1443 Ga0495653_0969763
1444 Ga0495650_0113844
1445 Ga0495639_0023242
1446 Ga0495610_0024818
1447 Ga0495610_0212363
1448 Ga0495616_0010183
1449 Ga0495620_0002466
1450 Ga0495620_0218188
1451 Ga0495628_0750912
1452 Ga0495630_0489811
1453 Ga0495631_0003037
1454 Ga0495637_0003474
1455 Ga0495663_0153113
1456 Ga0495642_0240402
1457 Ga0495652_0731076
1458 Ga0495654_0011433
1459 Ga0495621_0013869
1460 Ga0495621_0019672
1461 Ga0495621_0302859
1462 Ga0495622_0104723
1463 Ga0495633_0270865
1464 Ga0495656_0000746
1465 Ga0495634_0699015
1466 Ga0495625_0005468
1467 Ga0495625_0069851
1468 Ga0495625_0238885
1469 Ga0495661_0328406
1470 Ga0495661_0420979
1471 Ga0495588_0102512
1472 Ga0495588_0373218
1473 Ga0495658_0063297
1474 Ga0495658_1072531
1475 Ga0495669_0657056
1476 Ga0495624_0128461
1477 Ga0495624_0344680
1478 Ga0495670_0212498
1479 Ga0495670_0255194
1480 Ga0495670_0393707
1481 Ga0495670_0529958
1482 Ga0495671_0009329
1483 Ga0495581_0353461
1484 Ga0495604_1012317
1485 Ga0495676_0102050
1486 Ga0495677_0467489
1487 Ga0495681_0345125
1488 Ga0495686_0214275
1489 Ga0495593_0012263
1490 Ga0495602_0384296
1491 Ga0495614_0051869
1492 Ga0495614_0262777
1493 Ga0495615_0096335
1494 Ga0495615_0120639
1495 Ga0496100_0009165
1496 Ga0496101_0004382
1497 Ga0496101_0005001
1498 Ga0496102_0006127
1499 Ga0496103_0210241
1500 Ga0496104_0029955
1501 Ga0496105_0004053
1502 Ga0496106_0009081
1503 Ga0496107_0054704
1504 Ga0496107_0175066
1505 Ga0496108_0571847
1506 Ga0496109_0227502
1507 Ga0496109_0594722
1508 Ga0496110_0446642
1509 Ga0496111_0071605
1510 Ga0496111_0812564
1511 Ga0496112_0325183
1512 Ga0496113_0518479
1513 Ga0496114_1021945
1514 Ga0496114_1132328
1515 Ga0496115_0941435
1516 Ga0496116_0039510
1517 Ga0496117_0023000
1518 Ga0496117_0043622
1519 Ga0496118_0006363
1520 Ga0496118_0019829
1521 Ga0496119_0082193
1522 Ga0496119_0175820
1523 Ga0496121_0052610
1524 Ga0496121_0121176
1525 Ga0496122_0582460
1526 Ga0496123_0377373
1527 Ga0496124_0176704
1528 Ga0496124_0544698
1529 Ga0496125_0046359
1530 Ga0496125_0053320
1531 Ga0496125_0617063
1532 Ga0501315_012151
1533 Ga0501317_049401
1534 Ga0501323_015594
1535 Ga0501323_067597
1536 Ga0501037_0145399
1537 Ga0501046_0281209
1538 Ga0501223_144669
1539 Ga0501233_289805
1540 Ga0501243_142071
1541 Ga0501249_050489
1542 Ga0501225_0046999
1543 Ga0501280_027411
1544 nmdc:mga03683_105991_c1
1545 nmdc:mga03683_162337_c1
1546 nmdc:mga03683_197312_c2
1547 nmdc:mga03683_343496_c1
1548 nmdc:mga03683_345433_c1
1549 nmdc:mga03683_456182_c1
1550 nmdc:mga03683_468576_c1
1551 nmdc:mga03683_73810_c1
1552 nmdc:mga03n38_116333_c1
1553 nmdc:mga03n38_258017_c1
1554 nmdc:mga03n38_330806_c1
1555 nmdc:mga03n38_430839_c1
1556 nmdc:mga03n38_500810_c1
1557 nmdc:mga00v17_315474_c1
1558 nmdc:mga00v17_42986_c1
1559 nmdc:mga00v17_565297_c1
1560 nmdc:mga00v17_585738_c1
1561 nmdc:mga00v17_636184_c1
1562 nmdc:mga00v17_767875_c1
1563 nmdc:mga0yw44_138048_c1
1564 nmdc:mga0yw44_658365_c1
1565 nmdc:mga0k408_111441_c1
1566 nmdc:mga0k408_231329_c1
1567 nmdc:mga0k408_26362_c1
1568 nmdc:mga0k408_305574_c1
1569 nmdc:mga0k408_6011_c1
1570 nmdc:mga0k408_81457_c1
1571 nmdc:mga0k408_89457_c1
1572 nmdc:mga06z11_154388_c1
1573 nmdc:mga06z11_72127_c1
1574 nmdc:mga04h51_283906_c1
1575 nmdc:mga07m45_206558_c1
1576 nmdc:mga07m45_25369_c1
1577 nmdc:mga07m45_277484_c1
1578 nmdc:mga07m45_289043_c1
1579 nmdc:mga07m45_36823_c1
1580 nmdc:mga07m45_383745_c1
1581 nmdc:mga07m45_5257_c1
1582 nmdc:mga07m45_532405_c1
1583 nmdc:mga07m45_5339_c1
1584 nmdc:mga07m45_56345_c1
1585 nmdc:mga07m45_758688_c1
1586 nmdc:mga07m45_768095_c1
1587 nmdc:mga0sz30_271917_c1
1588 nmdc:mga0sz30_388442_c1
1589 Ga0495612_0168246
1590 Ga0500610_0056696
1591 Ga0495655_0148787
1592 Ga0500643_019521
1593 Ga0500651_0000347
1594 Ga0500566_0114122
1595 Ga0500555_159784
1596 Ga0500562_006293
1597 Ga0500562_144760
1598 Ga0500571_001746
1599 Ga0500572_175521
1600 Ga0500593_018569
1601 Ga0500593_118317
1602 Ga0500594_0033579
1603 Ga0500607_006984
1604 Ga0500607_197701
1605 Ga0500608_017372
1606 Ga0500608_358475
1607 Ga0500628_111204
1608 Ga0500655_055511
1609 Ga0500658_0000560
1610 Ga0500658_0000589
1611 Ga0500564_131856
1612 Ga0500568_0006650
1613 Ga0500577_0220196
1614 Ga0500586_158012
1615 Ga0500616_0021860
1616 Ga0500624_015969
1617 Ga0500627_0044221
1618 Ga0500634_0257925
1619 Ga0500634_0325631
1620 Ga0500638_051737
1621 Ga0500636_0352800
1622 Ga0500625_202069
1623 Ga0500645_198453
1624 Ga0500565_017652
1625 Ga0500596_018659
1626 Ga0590075_049907
1627 Ga0590077_137847
1628 2513230074
1629 2548499081
1630 2599620577
1631 2599673876
1632 2599678807
1633 2599690088
1634 2643867715
1635 2643991578
1636 2644062256
1637 2644071443
1638 2644162160
1639 2644293324
1640 2644324283
1641 2644396124
1642 2644464964
1643 2644648538
1644 2738720472
1645 2738884043
1646 2739245866
1647 2739279671
1648 2816470560
1649 2819601154
1650 2831271532
1651 2838055433
1652 2842680582
1653 2842718659
1654 2881103401
1655 2885201034
1656 2885214183
1657 2899927499
1658 2904450772
1659 2904459728
1660 2904547995
1661 2919462697
1662 2919707086
1663 2928042588
1664 2928048985
1665 2928051535
1666 2928068746
1667 2928073256
1668 2928087017
1669 2929161610
1670 2929521490
1671 2945913949
1672 2945949504
1673 2945973548
1674 2945990653
1675 2954770838
1676 2990713976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

14

87

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.9082 1 76
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9015 3 74
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8978 3 74
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8854 1 80
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8819 1 75
ID Description Score Start End Superfamily
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9497 1 77 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9228 3 77 3.10.20.90
af_Q4DAW3_3_74_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9134 2 69 3.30.300.90
af_Q12238_9_101_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9116 4 74 3.30.300.90
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9083 4 74 3.30.300.90
ID Description Score Start End GO Terms
AF-L8XX10-F1-model_v4 BolA family transcriptional regulator 0.9845 1 78
AF-A0A6A5L5I3-F1-model_v4 deleted 0.9832 1 76
AF-A0A7V5V488-F1-model_v4 BolA/IbaG family iron-sulfur metabolism protein 0.9743 1 78 GO:0005829
GO:0006351
AF-A0A1F3ZBD0-F1-model_v4 BolA family transcriptional regulator 0.9679 1 77
AF-A0A4P7BH98-F1-model_v4 deleted 0.9646 1 79

Map