F482996

General Info

Members Datasets Scaffolds Average Seq Length
838 682 305 264

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0011955|Ga0495610_0011955_728_1645
Length 305
Sequence MGKAVFGPPFLFCASVQRLQPCHISIFHDNSAVQILGSHTMFFRRTVLASLTAAMLSPLAAFAGSLPDLGGKTVVVVTENAYPPLQFVDPKSGQQIGWEYDAMNEIAKRLNFKVEYQNTSWDAMIQAVSDGQYNIGMTGITIKDDRKQKVDFSDPYMRSQQFMLVRGDEKRFTDAKSFGAFNDGLIGAQPGTSPFYTAVYEILDGNEQNPRIKLFETFGATVQALKTGDVDLVLTDSVAAKGYVDSSNGGLKVVGEPLGTEDFGFIFPKGSDLVAPVNAAIADLKADGTFDALNKKWFLDYKMGQ

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
34 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
35 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
36 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
37 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
38 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
39 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
40 2516143018 Ensifer sp. BR816 Isolate Nodule
41 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
42 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
43 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
44 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
45 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
46 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
47 2519899620 Rhizobium sp. Pop5 Isolate Nodule
48 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
61 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
62 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
63 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
64 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
65 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
66 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
69 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
70 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
71 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
72 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
73 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
74 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
75 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
76 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
77 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
78 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
79 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
80 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
81 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
82 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
83 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
84 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
85 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
86 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
87 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
88 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
89 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
90 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
91 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
92 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
93 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
94 2643221557 Ensifer sp. Root558 Isolate Unclassified
95 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
96 2643221580 Devosia sp. Root635 Isolate Unclassified
97 2643221599 Rhizobium sp. Root708 Isolate Unclassified
98 2643221607 Rhizobium sp. Root73 Isolate Unclassified
99 2643221610 Ensifer sp. Root74 Isolate Unclassified
100 2643221618 Ensifer sp. Root231 Isolate Unclassified
101 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
102 2643221626 Ensifer sp. Root31 Isolate Unclassified
103 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
104 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
105 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
106 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
107 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
108 2643221655 Ensifer sp. Root1252 Isolate Unclassified
109 2643221659 Ensifer sp. Root127 Isolate Unclassified
110 2643221668 Ensifer sp. Root423 Isolate Unclassified
111 2643221675 Ensifer sp. Root1298 Isolate Unclassified
112 2643221680 Ensifer sp. Root1312 Isolate Unclassified
113 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
114 2643221688 Rhizobium sp. Root482 Isolate Unclassified
115 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
116 2643221698 Ensifer sp. Root142 Isolate Unclassified
117 2643221712 Ensifer sp. Root258 Isolate Unclassified
118 2643221718 Rhizobium sp. Root268 Isolate Unclassified
119 2643221719 Rhizobium sp. Root274 Isolate Unclassified
120 2643221723 Ensifer sp. Root278 Isolate Unclassified
121 2643221726 Ensifer sp. Root954 Isolate Unclassified
122 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
123 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
124 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
125 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
126 2718217882 Rhizobium sp. N741 Isolate Nodule
127 2718217927 Rhizobium sp. N324 Isolate Nodule
128 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
129 2718218009 Rhizobium sp. N561 Isolate Nodule
130 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
131 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
132 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
133 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
134 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
135 2718218363 Rhizobium sp. N113 Isolate Nodule
136 2718218365 Rhizobium sp. N731 Isolate Nodule
137 2718218366 Rhizobium sp. N621 Isolate Nodule
138 2718218423 Rhizobium sp. N941 Isolate Nodule
139 2721755514 Rhizobium sp. N6212 Isolate Nodule
140 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
141 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
142 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
143 2721755809 Rhizobium sp. N541 Isolate Nodule
144 2721755810 Rhizobium sp. N871 Isolate Nodule
145 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
146 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
147 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
148 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
149 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
150 2728369365 Rhizobium sp. N1341 Isolate Nodule
151 2728369397 Rhizobium sp. N1314 Isolate Nodule
152 2738541293 Rhizobium sp. GV031 Isolate Unclassified
153 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
154 2738543024 Aminobacter sp. AP02 Isolate Unclassified
155 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
156 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
157 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
158 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
159 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
160 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
161 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
162 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
163 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
164 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
165 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
166 2791355256 Rhizobium sp. M10 Isolate Nodule
167 2791355260 Rhizobium sp. L9 Isolate Nodule
168 2791355261 Rhizobium sp. J15 Isolate Nodule
169 2791355262 Rhizobium sp. M1 Isolate Nodule
170 2791355264 Rhizobium sp. S9 Isolate Nodule
171 2791355265 Rhizobium sp. H4 Isolate Nodule
172 2791355266 Rhizobium sp. L43 Isolate Nodule
173 2791355267 Rhizobium sp. L18 Isolate Nodule
174 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
175 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
176 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
177 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
178 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
179 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
180 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
181 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
182 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
183 2802429633 Rhizobium anhuiense J3 Isolate Nodule
184 2802429634 Rhizobium anhuiense S10 Isolate Nodule
185 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
186 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
187 2802429637 Rhizobium anhuiense C15 Isolate Nodule
188 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
189 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
190 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
191 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
192 2838048938 Rhizobium pisi 27/80 Isolate Nodule
193 2838061910 Rhizobium phaseoli L15 Isolate Nodule
194 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
195 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
196 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
197 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
198 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
199 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
200 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
201 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
202 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
203 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
204 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
205 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
206 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
207 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
208 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
209 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
210 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
211 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
212 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
213 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
214 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
215 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
216 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
217 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
218 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
219 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
220 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
221 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
222 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
223 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
224 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
225 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
226 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
227 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
228 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
229 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
230 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
231 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
232 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
233 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
234 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
235 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
236 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
237 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
238 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
239 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
240 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
241 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
242 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
243 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
244 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
245 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
246 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
247 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
248 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
249 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
250 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
251 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
252 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
253 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
254 2844163670 Ensifer sp. 1H6 Isolate Unclassified
255 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
256 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
257 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
258 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
259 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
260 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
261 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
262 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
263 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
264 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
265 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
266 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
267 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
268 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
269 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
270 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
271 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
272 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
273 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
274 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
275 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
276 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
277 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
278 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
279 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
280 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
281 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
282 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
283 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
284 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
285 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
286 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
287 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
288 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
289 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
290 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
291 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
292 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
293 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
294 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
295 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
296 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
297 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
298 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
299 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
300 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
301 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
302 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
303 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
304 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
305 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
306 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
307 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
308 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
309 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
310 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
311 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
312 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
313 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
314 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
315 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
316 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
317 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
318 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
319 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
320 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
321 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
322 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
323 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
324 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
325 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
326 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
327 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
328 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
329 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
330 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
331 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
332 2933599457 Rhizobium phaseoli M3 Isolate Nodule
333 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
334 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
335 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
336 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
337 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
338 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
339 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
340 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
341 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
342 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
343 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
344 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
345 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
346 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
347 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
348 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
349 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
350 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
351 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
352 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
353 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
354 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
355 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
356 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
357 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
358 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
359 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
360 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
361 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
362 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
363 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
364 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
365 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
366 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
367 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
368 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
369 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
370 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
371 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
372 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
373 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
374 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
375 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
376 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
377 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
378 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
379 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
380 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
381 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
382 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
383 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
384 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
385 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
386 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
387 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
388 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
389 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
390 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
391 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
392 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
393 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
394 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
395 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
396 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
397 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
398 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
399 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
400 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
401 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
402 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
403 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
404 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
405 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
406 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
407 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
408 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
409 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
410 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
411 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
412 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
413 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
414 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
415 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
416 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
417 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
418 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
419 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
420 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
421 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
422 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
423 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
424 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
425 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
426 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
427 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
428 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
429 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
430 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
431 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
432 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
433 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
434 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
435 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
436 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
437 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
438 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
439 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
440 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
441 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
442 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
443 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
444 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
445 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
446 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
447 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
448 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
449 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
450 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
451 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
452 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
453 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
454 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
455 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
456 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
457 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
458 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
459 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
460 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
461 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
462 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
463 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
464 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
465 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
466 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
467 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
468 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
469 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
470 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
471 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
472 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
473 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
474 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
475 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
476 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
477 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
478 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
479 2996887358 Rhizobium sp. R711 Isolate Nodule
480 2996893221 Rhizobium sp. R635 Isolate Nodule
481 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
482 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
483 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
484 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
485 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
486 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
487 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
488 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
489 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
490 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
491 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
492 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
493 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
494 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
495 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
496 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
497 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
498 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
499 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
500 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
501 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
502 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
503 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
504 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
505 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
506 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
507 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
508 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
509 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
510 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
511 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
512 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
513 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
514 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
515 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
516 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
517 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
518 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
519 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
520 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
521 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
522 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
523 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
524 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
525 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
526 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
527 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
528 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
529 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
530 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
531 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
532 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
533 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
534 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
535 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
536 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
537 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
538 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
539 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
540 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
541 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
542 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
543 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
548 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
550 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
551 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
553 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
554 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
555 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
556 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
557 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
558 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
559 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
560 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
561 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
562 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
563 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
564 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
565 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
566 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
567 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
568 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
569 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
570 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
571 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
572 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
573 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
574 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
575 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
576 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
577 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
578 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
579 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
580 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
581 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
582 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
583 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
584 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
585 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
586 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
587 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
588 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
589 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
590 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
591 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
592 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
593 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
594 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
595 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
596 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
597 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
598 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
599 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
600 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
601 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
602 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
603 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
610 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
611 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
612 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
615 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
616 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
617 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
618 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
619 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
621 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
622 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
623 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
624 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
625 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
626 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
627 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
628 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
629 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
630 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
631 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
632 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
633 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
634 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
635 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
636 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
637 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
638 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
639 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
640 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
641 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
642 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
643 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
644 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
645 8005258706 Rhizobium sp. R693 Isolate Nodule
646 8005275841 Rhizobium sp. N4311 Isolate Nodule
647 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
648 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
649 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
650 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
651 8005321885 Rhizobium sp. R72 Isolate Nodule
652 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
653 8005382845 Rhizobium sp. R634 Isolate Nodule
654 8005395548 Rhizobium sp. R339 Isolate Nodule
655 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
656 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
657 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
658 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
659 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
660 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
661 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
662 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
663 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
664 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
665 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
666 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
667 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
668 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
669 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
670 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
671 8018176218 Rhizobium sp. N122 Isolate Nodule
672 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
673 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
674 8024501048 Rhizobium sp. H4 Isolate Nodule
675 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
676 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
677 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
678 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
679 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
680 8056382006 Rhizobium croatiense 13T Isolate Nodule
681 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
682 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.4
Metatranscriptomes 0
Isolates 63.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.26
Nodule 49.64
Rhizoplane 1.19
Rhizosphere 16.59
Stem 0
Stem Tuber 0
Unclassified 14.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000116 3300002739 Bacteria 18332
2 JGI25152J39213_1002074 3300002773 Bacteria 7887
3 JGI25152J39213_1002660 3300002773 Bacteria 6604
4 JGI25152J39213_1004780 3300002773 Bacteria 4157
5 JGI25152J39213_1005991 3300002773 Bacteria 3410
6 JGI25150J39212_1000037 3300002774 Bacteria 88885
7 JGI25150J39212_1006040 3300002774 Bacteria 2538
8 JGI25159J45721_1003134 3300002987 Bacteria 5952
9 JGI25151J46595_10000220 3300003187 Bacteria 67327
10 JGI25151J46595_10002488 3300003187 Bacteria 11010
11 JGI25151J46595_10006712 3300003187 Bacteria 5738
12 JGI25151J46595_10014115 3300003187 Bacteria 3573
13 JGI25151J46595_10016522 3300003187 Bacteria 3225
14 JGI25153J46596_10004090 3300003215 Bacteria 7933
15 JGI25153J46596_10007213 3300003215 Bacteria 5507
16 JGI25153J46596_10022145 3300003215 Bacteria 2351
17 JGI25153J46596_10036449 3300003215 Bacteria 1576
18 JGI25160J50197_1000027 3300003354 Bacteria 182809
19 JGI25160J50197_1000108 3300003354 Bacteria 77944
20 JGI25160J50197_1002336 3300003354 Bacteria 8877
21 JGI25160J50197_1004011 3300003354 Bacteria 6423
22 JGI25160J50197_1021541 3300003354 Bacteria 1913
23 JGI25161J50226_1000112 3300003374 Bacteria 63152
24 JGI25161J50226_1000327 3300003374 Bacteria 25949
25 JGI25161J50226_1000501 3300003374 Bacteria 17353
26 Ga0055526_1002678 3300003771 Bacteria 11896
27 Ga0055526_1011992 3300003771 Bacteria 3834
28 Ga0055526_1013569 3300003771 Bacteria 3432
29 Ga0055526_1018677 3300003771 Bacteria 2573
30 Ga0055526_1030183 3300003771 Bacteria 1588
31 Ga0055524_1004989 3300003775 Bacteria 6011
32 Ga0055524_1007541 3300003775 Bacteria 4602
33 Ga0055524_1017101 3300003775 Bacteria 2570
34 Ga0055524_1029614 3300003775 Bacteria 1614
35 Ga0055524_1035522 3300003775 Bacteria 1358
36 Ga0055536_1000999 3300003781 Bacteria 17954
37 Ga0055528_1000099 3300003790 Bacteria 68463
38 Ga0055528_1007426 3300003790 Bacteria 4849
39 Ga0055528_1016778 3300003790 Bacteria 2569
40 Ga0055528_1016941 3300003790 Bacteria 2549
41 Ga0055528_1025021 3300003790 Bacteria 1769
42 Ga0055540_1001518 3300003792 Bacteria 13685
43 Ga0055531_10006403 3300003794 Bacteria 6694
44 Ga0055543_1000030 3300004625 Bacteria 130849
45 Ga0055543_1000062 3300004625 Bacteria 98034
46 Ga0055543_1000080 3300004625 Bacteria 84865
47 Ga0055543_1000683 3300004625 Bacteria 17717
48 Ga0065165_1000122 3300005262 Bacteria 132524
49 Ga0065165_1002470 3300005262 Bacteria 15554
50 Ga0065165_1005804 3300005262 Bacteria 6736
51 Ga0065165_1021888 3300005262 Bacteria 2208
52 Ga0070682_100131782 3300005337 Bacteria 1693
53 Ga0070668_100213088 3300005347 Bacteria 1590
54 Ga0070669_100134573 3300005353 Bacteria 1900
55 Ga0070714_100610209 3300005435 Bacteria 1048
56 Ga0068853_100203017 3300005539 Bacteria 1804
57 Ga0070665_100036587 3300005548 Bacteria 4937
58 Ga0070665_100110964 3300005548 Bacteria 2745
59 Ga0081540_1096704 3300005983 Bacteria 1284
60 Ga0081539_10000437 3300005985 Bacteria 88848
61 Ga0075365_10014754 3300006038 Bacteria 4706
62 Ga0075365_10022020 3300006038 Bacteria 3985
63 Ga0075365_10036700 3300006038 Bacteria 3177
64 Ga0075365_10065525 3300006038 Bacteria 2435
65 Ga0075362_10031088 3300006177 Bacteria 2309
66 Ga0075367_10000317 3300006178 Bacteria 17069
67 Ga0075367_10028826 3300006178 Bacteria 3170
68 Ga0075369_10002260 3300006186 Bacteria 6838
69 Ga0075369_10003953 3300006186 Bacteria 5434
70 Ga0075369_10018325 3300006186 Bacteria 2849
71 Ga0075366_10007998 3300006195 Bacteria 5858
72 Ga0075366_10281865 3300006195 Bacteria 1016
73 Ga0075370_10008448 3300006353 Bacteria 5300
74 Ga0105238_10021951 3300009551 Bacteria 6503
75 Ga0123342_1005742 3300009766 Bacteria 17739
76 Ga0157369_10219682 3300013105 Bacteria 1989
77 Ga0171463_1004 3300013249 Bacteria 437207
78 Ga0183363_1019 3300015690 Bacteria 61083
79 Ga0163161_10641046 3300017792 Bacteria 879
80 Ga0214544_1000079 3300021320 Bacteria 121742
81 Ga0214542_1000064 3300021321 Bacteria 127681
82 Ga0214543_1000015 3300021327 Bacteria 305679
83 Ga0214543_1000063 3300021327 Bacteria 127694
84 Ga0228711_1000004 3300022739 Bacteria 250146
85 Ga0228710_1000002 3300022740 Bacteria 287279
86 Ga0209436_100018 3300025208 Bacteria 113499
87 Ga0209436_100540 3300025208 Bacteria 16420
88 Ga0207425_1000034 3300025245 Bacteria 227886
89 Ga0207425_1003134 3300025245 Bacteria 5429
90 Ga0207425_1006854 3300025245 Bacteria 3074
91 Ga0209129_1000118 3300025258 Bacteria 139972
92 Ga0209129_1000253 3300025258 Bacteria 55709
93 Ga0209129_1001394 3300025258 Bacteria 13509
94 Ga0209129_1004326 3300025258 Bacteria 5612
95 Ga0209129_1004708 3300025258 Bacteria 5183
96 Ga0209129_1005410 3300025258 Bacteria 4535
97 Ga0209233_1000118 3300025261 Bacteria 236172
98 Ga0209673_1000033 3300025273 Bacteria 335369
99 Ga0209673_1000050 3300025273 Bacteria 285287
100 Ga0209673_1000052 3300025273 Bacteria 279795
101 Ga0209673_1004592 3300025273 Bacteria 7322
102 Ga0209673_1012521 3300025273 Bacteria 3410
103 Ga0209130_1000009 3300025284 Bacteria 498952
104 Ga0209130_1000027 3300025284 Bacteria 327700
105 Ga0209130_1000108 3300025284 Bacteria 133733
106 Ga0209130_1009914 3300025284 Bacteria 2668
107 Ga0209675_1013892 3300025291 Bacteria 2485
108 Ga0209676_1000406 3300025292 Bacteria 77603
109 Ga0209676_1013267 3300025292 Bacteria 3180
110 Ga0209025_1000042 3300025294 Bacteria 370577
111 Ga0209025_1000241 3300025294 Bacteria 128329
112 Ga0209025_1000335 3300025294 Bacteria 103615
113 Ga0209025_1000533 3300025294 Bacteria 72404
114 Ga0209025_1002567 3300025294 Bacteria 18887
115 Ga0209025_1006540 3300025294 Bacteria 8995
116 Ga0209025_1013261 3300025294 Bacteria 5196
117 Ga0209025_1016446 3300025294 Bacteria 4362
118 Ga0209025_1034149 3300025294 Bacteria 2331
119 Ga0209025_1036512 3300025294 Bacteria 2199
120 Ga0209025_1049902 3300025294 Bacteria 1678
121 Ga0209564_1000111 3300025295 Bacteria 212210
122 Ga0209564_1001330 3300025295 Bacteria 26421
123 Ga0209564_1002296 3300025295 Bacteria 15576
124 Ga0209564_1006715 3300025295 Bacteria 6114
125 Ga0209564_1008393 3300025295 Bacteria 5102
126 Ga0209758_1000415 3300025297 Bacteria 72404
127 Ga0209758_1000896 3300025297 Bacteria 40464
128 Ga0209758_1001085 3300025297 Bacteria 35309
129 Ga0209758_1001086 3300025297 Bacteria 35300
130 Ga0209758_1001936 3300025297 Bacteria 22483
131 Ga0209758_1002583 3300025297 Bacteria 18175
132 Ga0209758_1028435 3300025297 Bacteria 2365
133 Ga0209050_1000572 3300025298 Bacteria 59716
134 Ga0209050_1012928 3300025298 Bacteria 3774
135 Ga0209256_1000773 3300025299 Bacteria 41485
136 Ga0209256_1001743 3300025299 Bacteria 20757
137 Ga0209256_1003248 3300025299 Bacteria 11690
138 Ga0209256_1003365 3300025299 Bacteria 11320
139 Ga0209256_1003400 3300025299 Bacteria 11219
140 Ga0209256_1018539 3300025299 Bacteria 2255
141 Ga0209256_1056246 3300025299 Bacteria 931
142 Ga0207426_1000041 3300025302 Bacteria 433536
143 Ga0207426_1000072 3300025302 Bacteria 327700
144 Ga0207426_1000082 3300025302 Bacteria 298939
145 Ga0207426_1000348 3300025302 Bacteria 85294
146 Ga0207426_1001232 3300025302 Bacteria 22539
147 Ga0209051_1000276 3300025303 Bacteria 84192
148 Ga0209051_1004620 3300025303 Bacteria 8387
149 Ga0209051_1005303 3300025303 Bacteria 7589
150 Ga0209051_1006579 3300025303 Bacteria 6520
151 Ga0209051_1009103 3300025303 Bacteria 5157
152 Ga0209051_1052278 3300025303 Bacteria 1351
153 Ga0209257_1002707 3300025304 Bacteria 16894
154 Ga0209257_1015856 3300025304 Bacteria 3095
155 Ga0209257_1038047 3300025304 Bacteria 1461
156 Ga0209257_1056454 3300025304 Bacteria 1084
157 Ga0207696_1050324 3300025711 Bacteria 1193
158 Ga0207671_10181999 3300025914 Bacteria 1636
159 Ga0207681_10170660 3300025923 Bacteria 1648
160 Ga0207711_10430652 3300025941 Bacteria 1227
161 Ga0207639_10032663 3300026041 Bacteria 3833
162 Ga0207674_10140735 3300026116 Bacteria 2372
163 Ga0209281_1000030 3300027111 Bacteria 425931
164 Ga0209281_1000144 3300027111 Bacteria 172471
165 Ga0209282_1000004 3300027666 Bacteria 425931
166 Ga0268266_10041961 3300028379 Bacteria 3906
167 Ga0307515_10004852 3300028794 Bacteria 27508
168 Ga0307515_10016477 3300028794 Bacteria 13524
169 Ga0307515_10046110 3300028794 Bacteria 6674
170 Ga0307513_10015506 3300031456 Bacteria 9237
171 Ga0307408_100300646 3300031548 Bacteria 1344
172 Ga0307405_10008039 3300031731 Bacteria 5320
173 Ga0307405_10427802 3300031731 Bacteria 1044
174 Ga0307405_10444833 3300031731 Bacteria 1026
175 Ga0307410_10634941 3300031852 Bacteria 894
176 Ga0307406_10083526 3300031901 Bacteria 2130
177 Ga0307406_10312496 3300031901 Bacteria 1212
178 Ga0307412_10005736 3300031911 Bacteria 6978
179 Ga0315914_1000001 3300031967 Bacteria 416633
180 Ga0307414_10020503 3300032004 Bacteria 4121
181 Ga0315913_1000004 3300033430 Bacteria 192741
182 Ga0315915_1000002 3300033464 Bacteria 425854
183 Ga0395899_0119551 3300037312 Bacteria 1889
184 Ga0395905_0043406 3300037471 Bacteria 4218
185 Ga0395905_0611702 3300037471 Bacteria 992
186 Ga0439436_0007896 3300041404 Bacteria 3269
187 Ga0439436_0011975 3300041404 Bacteria 2633
188 Ga0439465_0016957 3300041413 Bacteria 2273
189 Ga0439465_0026848 3300041413 Bacteria 1822
190 Ga0439465_0070100 3300041413 Bacteria 1174
191 Ga0451793_0969719 3300041452 Bacteria 1015
192 Ga0451798_0568173 3300041458 Bacteria 2888
193 Ga0451835_0384467 3300041492 Bacteria 1872
194 Ga0451837_1373485 3300041494 Bacteria 1840
195 Ga0451843_1206718 3300041509 Bacteria 2672
196 Ga0451855_0379872 3300041511 Bacteria 3237
197 Ga0451855_1098397 3300041511 Bacteria 5936
198 Ga0450920_004471 3300042122 Bacteria 2458
199 Ga0439434_0044592 3300042435 Bacteria 1367
200 Ga0453684_0010894 3300044712 Bacteria 15397
201 Ga0451576_0014874 3300045051 Bacteria 8646
202 Ga0495638_0006475 3300046460 Bacteria 8514
203 Ga0495638_0023906 3300046460 Bacteria 3991
204 Ga0495585_0073526 3300046492 Bacteria 1861
205 Ga0495607_0040411 3300046501 Bacteria 2777
206 Ga0495606_0113796 3300046507 Bacteria 1628
207 Ga0495610_0011955 3300046512 Bacteria 5263
208 Ga0495610_0049789 3300046512 Bacteria 2049
209 Ga0495610_0056328 3300046512 Bacteria 1890
210 Ga0495620_0076939 3300046515 Bacteria 1355
211 Ga0495632_0006155 3300046519 Bacteria 7773
212 Ga0495643_0006495 3300046522 Bacteria 7693
213 Ga0495643_0079013 3300046522 Bacteria 1716
214 Ga0495668_0129856 3300046616 Bacteria 1379
215 Ga0495625_0066025 3300046660 Bacteria 2549
216 Ga0495670_0120460 3300046691 Bacteria 1362
217 Ga0495649_0063067 3300046694 Bacteria 1992
218 Ga0495660_0122995 3300046810 Bacteria 1310
219 Ga0495681_0119032 3300047470 Bacteria 1135
220 Ga0495686_0045926 3300047472 Bacteria 2762
221 Ga0495615_0006146 3300048090 Bacteria 2206
222 Ga0496106_0065953 3300048909 Bacteria 2756
223 Ga0496116_0005573 3300048919 Bacteria 11611
224 Ga0496116_0039438 3300048919 Bacteria 3266
225 Ga0496116_0055483 3300048919 Bacteria 2602
226 Ga0496116_0062249 3300048919 Bacteria 2410
227 Ga0496117_0005347 3300048920 Bacteria 13534
228 Ga0496117_0184377 3300048920 Bacteria 1196
229 Ga0496118_0062412 3300048921 Bacteria 2751
230 Ga0496121_0026756 3300048924 Bacteria 5420
231 Ga0496121_0037832 3300048924 Bacteria 4280
232 Ga0496121_0056879 3300048924 Bacteria 3245
233 Ga0496121_0073205 3300048924 Bacteria 2747
234 Ga0496121_0075319 3300048924 Bacteria 2696
235 Ga0496122_0000984 3300048925 Bacteria 50862
236 Ga0496122_0007522 3300048925 Bacteria 12072
237 Ga0496122_0051249 3300048925 Bacteria 3138
238 Ga0496122_0065256 3300048925 Bacteria 2641
239 Ga0496122_0095266 3300048925 Bacteria 2012
240 Ga0496123_0000290 3300048926 Bacteria 98053
241 Ga0496123_0029681 3300048926 Bacteria 4017
242 Ga0496123_0060665 3300048926 Bacteria 2437
243 Ga0496123_0102445 3300048926 Bacteria 1661
244 Ga0496124_0014171 3300048927 Bacteria 7724
245 Ga0496124_0036175 3300048927 Bacteria 4310
246 Ga0496124_0069034 3300048927 Bacteria 2935
247 Ga0496124_0087958 3300048927 Bacteria 2540
248 Ga0496124_0252478 3300048927 Bacteria 1303
249 Ga0496125_0007081 3300048928 Bacteria 11973
250 Ga0496125_0043126 3300048928 Bacteria 3834
251 Ga0496126_0001347 3300048929 Bacteria 38995
252 Ga0501031_0000022 3300049568 Bacteria 92471
253 Ga0501031_0056657 3300049568 Bacteria 2553
254 Ga0501032_0000063 3300049569 Bacteria 92497
255 Ga0501033_0000073 3300049570 Bacteria 94880
256 Ga0501033_0015770 3300049570 Bacteria 5728
257 Ga0501034_0000276 3300049571 Bacteria 92497
258 Ga0501034_0013832 3300049571 Bacteria 8306
259 Ga0501034_0021121 3300049571 Bacteria 6642
260 Ga0501034_0118266 3300049571 Bacteria 2637
261 Ga0501034_0293216 3300049571 Bacteria 1564
262 Ga0501036_0000030 3300049572 Bacteria 92497
263 Ga0501036_0378099 3300049572 Bacteria 1182
264 Ga0501037_0000075 3300049573 Bacteria 92499
265 Ga0501037_0014494 3300049573 Bacteria 5800
266 Ga0501037_0046195 3300049573 Bacteria 3194
267 Ga0501038_0000058 3300049574 Bacteria 92497
268 Ga0501038_0190092 3300049574 Bacteria 1652
269 Ga0501039_0000054 3300049575 Bacteria 92497
270 Ga0501040_0017164 3300049576 Bacteria 4804
271 Ga0501040_0075093 3300049576 Bacteria 2336
272 Ga0501042_0026607 3300049578 Bacteria 4064
273 Ga0501043_0001296 3300049579 Bacteria 21934
274 Ga0501043_0100843 3300049579 Bacteria 2269
275 Ga0501047_0001489 3300049581 Bacteria 22827
276 Ga0501047_0073759 3300049581 Bacteria 3285
277 Ga0501047_0158719 3300049581 Bacteria 2134
278 Ga0501047_0183270 3300049581 Bacteria 1960
279 Ga0501069_0127753 3300049585 Bacteria 1455
280 Ga0501071_0437265 3300049587 Bacteria 1001
281 Ga0501073_0136355 3300049589 Bacteria 1701
282 Ga0501083_0206329 3300049744 Bacteria 1281
283 Ga0501035_0000126 3300049822 Bacteria 92497
284 Ga0501044_0000131 3300049823 Bacteria 92497
285 Ga0501044_0015879 3300049823 Bacteria 8104
286 Ga0501044_0090842 3300049823 Bacteria 3080
287 nmdc:mga03683_15806_c1 3300050489 Bacteria 2824
288 nmdc:mga0yw44_40693_c1 3300050492 Bacteria 2763
289 nmdc:mga0k408_270063_c1 3300050493 Bacteria 1015
290 nmdc:mga0k408_54773_c1 3300050493 Bacteria 2312
291 nmdc:mga07m45_18041_c1 3300050496 Bacteria 3801
292 nmdc:mga0sz30_26139_c1 3300050516 Bacteria 2391
293 Ga0500578_0125816 3300053086 Bacteria 1609
294 Ga0500643_003112 3300053087 Bacteria 8145
295 Ga0500569_030273 3300053109 Bacteria 1513
296 Ga0500607_133288 3300053121 Bacteria 1181
297 Ga0500658_0000735 3300053134 Bacteria 13496
298 Ga0500616_0004669 3300053153 Bacteria 9655
299 Ga0500616_0014226 3300053153 Bacteria 4579
300 Ga0500616_0015830 3300053153 Bacteria 4305
301 Ga0500616_0139567 3300053153 Bacteria 1134
302 Ga0500622_0008199 3300053156 Bacteria 5866
303 Ga0500627_0087185 3300053158 Bacteria 1395
304 Ga0500634_0004706 3300053161 Bacteria 6366
305 Ga0501082_0240195 3300060353 Bacteria 1576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0023906 Ga0495638_0023906_3232_3981 249
2 3300048927 Ga0496124_0252478 Ga0496124_0252478_538_1287 249
3 3300025299 Ga0209256_1056246 Ga0209256_10562462 256
4 3300041509 Ga0451843_1206718 Ga0451843_1206718_885_1655 256
5 3300044712 Ga0453684_0010894 Ga0453684_0010894_3129_3923 257
6 iso_pu_bacteria 2937843397 2937843832 257
7 iso_pu_bacteria 2558860983 2561467110 259
8 iso_pu_bacteria 2889790730 2889791502 259
9 iso_pu_bacteria 2889914905 2889917247 259
10 iso_pu_bacteria 2894652903 2894653786 259
11 iso_pu_bacteria 2995392953 2995395270 259
12 3300045051 Ga0451576_0014874 Ga0451576_0014874_3444_4226 260
13 3300049568 Ga0501031_0056657 Ga0501031_0056657_1065_1850 260
14 3300049573 Ga0501037_0014494 Ga0501037_0014494_4663_5448 260
15 3300049576 Ga0501040_0075093 Ga0501040_0075093_1467_2252 260
16 3300049578 Ga0501042_0026607 Ga0501042_0026607_288_1073 260
17 3300049581 Ga0501047_0073759 Ga0501047_0073759_1647_2432 260
18 3300050493 nmdc:mga0k408_270063_c1 nmdc:mga0k408_270063_c1_16_798 260
19 iso_pu_bacteria 2511231027 2511391807 260
20 iso_pu_bacteria 2513237351 2514586660 260
21 iso_pu_bacteria 2585427634 2586002373 260
22 iso_pu_bacteria 2643221551 2643777247 260
23 iso_pu_bacteria 2643221555 2643795695 260
24 iso_pu_bacteria 2643221580 2643911132 260
25 iso_pu_bacteria 2765235802 2765465700 260
26 iso_pu_bacteria 2767802442 2770198347 260
27 iso_pu_bacteria 2775506902 2776269597 260
28 iso_pu_bacteria 2775506904 2776282528 260
29 iso_pu_bacteria 2839993093 2839993343 260
30 iso_pu_bacteria 2840764183 2840766344 260
31 iso_pu_bacteria 2842871566 2842873960 260
32 iso_pu_bacteria 2854896431 2854901715 260
33 iso_pu_bacteria 2854916844 2854919487 260
34 iso_pu_bacteria 2904578770 2904580008 260
35 iso_pu_bacteria 2919119836 2919120321 260
36 iso_pu_bacteria 2989771324 2989771551 260
37 iso_pu_bacteria 3002141150 3002141664 260
38 3300031548 Ga0307408_100300646 Ga0307408_1003006461 261
39 3300031731 Ga0307405_10444833 Ga0307405_104448331 261
40 3300031852 Ga0307410_10634941 Ga0307410_106349411 261
41 3300041413 Ga0439465_0070100 Ga0439465_0070100_45_854 261
42 3300049587 Ga0501071_0437265 Ga0501071_0437265_79_864 261
43 iso_pu_bacteria 2508501122 2509109599 261
44 iso_pu_bacteria 2508501127 2509143193 261
45 iso_pu_bacteria 2509276019 2509378077 261
46 iso_pu_bacteria 2510065019 2510135246 261
47 iso_pu_bacteria 2510065057 2510306733 261
48 iso_pu_bacteria 2510461069 2510840479 261
49 iso_pu_bacteria 2510461076 2510896701 261
50 iso_pu_bacteria 2510917022 2511133885 261
51 iso_pu_bacteria 2510917026 2511172964 261
52 iso_pu_bacteria 2510917028 2511184000 261
53 iso_pu_bacteria 2510917030 2511194602 261
54 iso_pu_bacteria 2511231052 2511498502 261
55 iso_pu_bacteria 2512047086 2512534644 261
56 iso_pu_bacteria 2512875026 2512973548 261
57 iso_pu_bacteria 2513237084 2513571630 261
58 iso_pu_bacteria 2513237085 2513578664 261
59 iso_pu_bacteria 2513237086 2513583664 261
60 iso_pu_bacteria 2513237088 2513596830 261
61 iso_pu_bacteria 2513237089 2513601933 261
62 iso_pu_bacteria 2513237090 2513614174 261
63 iso_pu_bacteria 2513237091 2513615737 261
64 iso_pu_bacteria 2513237093 2513630151 261
65 iso_pu_bacteria 2513237103 2513711350 261
66 iso_pu_bacteria 2513237138 2513867482 261
67 iso_pu_bacteria 2513237140 2513884966 261
68 iso_pu_bacteria 2513237143 2513905176 261
69 iso_pu_bacteria 2513237144 2513912379 261
70 iso_pu_bacteria 2513237146 2513928434 261
71 iso_pu_bacteria 2513237159 2513998492 261
72 iso_pu_bacteria 2513237160 2514003467 261
73 iso_pu_bacteria 2513237162 2514019401 261
74 iso_pu_bacteria 2515075009 2515114404 261
75 iso_pu_bacteria 2515154107 2515611077 261
76 iso_pu_bacteria 2515154113 2515635408 261
77 iso_pu_bacteria 2515154114 2515643184 261
78 iso_pu_bacteria 2515154116 2515657648 261
79 iso_pu_bacteria 2515154134 2515741589 261
80 iso_pu_bacteria 2516143018 2516205544 261
81 iso_pu_bacteria 2516653046 2516894783 261
82 iso_pu_bacteria 2516653077 2517038055 261
83 iso_pu_bacteria 2516653085 2517078319 261
84 iso_pu_bacteria 2517093000 2517097078 261
85 iso_pu_bacteria 2517287029 2517408538 261
86 iso_pu_bacteria 2517487022 2517571448 261
87 iso_pu_bacteria 2519899620 2520379693 261
88 iso_pu_bacteria 2524023207 2524450406 261
89 iso_pu_bacteria 2529292951 2530647350 261
90 iso_pu_bacteria 2534681796 2535519025 261
91 iso_pu_bacteria 2551306084 2551676637 261
92 iso_pu_bacteria 2551306084 2551680261 261
93 iso_pu_bacteria 2551306085 2551685091 261
94 iso_pu_bacteria 2551306086 2551694493 261
95 iso_pu_bacteria 2551306087 2551697716 261
96 iso_pu_bacteria 2551306089 2551708371 261
97 iso_pu_bacteria 2551306090 2551717621 261
98 iso_pu_bacteria 2551306091 2551731622 261
99 iso_pu_bacteria 2551306092 2551736206 261
100 iso_pu_bacteria 2551306093 2551746067 261
101 iso_pu_bacteria 2558860100 2558867423 261
102 iso_pu_bacteria 2582581283 2585166728 261
103 iso_pu_bacteria 2582581294 2585201736 261
104 iso_pu_bacteria 2582581298 2585223924 261
105 iso_pu_bacteria 2582581299 2585228736 261
106 iso_pu_bacteria 2582581304 2585257586 261
107 iso_pu_bacteria 2582581306 2585266935 261
108 iso_pu_bacteria 2582581307 2585271675 261
109 iso_pu_bacteria 2582581865 2585387976 261
110 iso_pu_bacteria 2582581866 2585396067 261
111 iso_pu_bacteria 2582581867 2585399751 261
112 iso_pu_bacteria 2585427526 2585526043 261
113 iso_pu_bacteria 2585427528 2585540779 261
114 iso_pu_bacteria 2585427529 2585549147 261
115 iso_pu_bacteria 2585427531 2585563085 261
116 iso_pu_bacteria 2585427590 2585820838 261
117 iso_pu_bacteria 2585427593 2585839049 261
118 iso_pu_bacteria 2585427594 2585844882 261
119 iso_pu_bacteria 2585427608 2585902861 261
120 iso_pu_bacteria 2585427609 2585907302 261
121 iso_pu_bacteria 2585427633 2585997788 261
122 iso_pu_bacteria 2585428125 2587982704 261
123 iso_pu_bacteria 2597489875 2597811926 261
124 iso_pu_bacteria 2599185156 2599335096 261
125 iso_pu_bacteria 2599185170 2599420144 261
126 iso_pu_bacteria 2599185301 2599936988 261
127 iso_pu_bacteria 2599185352 2600193376 261
128 iso_pu_bacteria 2600254933 2600373233 261
129 iso_pu_bacteria 2615840624 2616296314 261
130 iso_pu_bacteria 2643221550 2643771528 261
131 iso_pu_bacteria 2643221557 2643808074 261
132 iso_pu_bacteria 2643221564 2643836728 261
133 iso_pu_bacteria 2643221599 2644002474 261
134 iso_pu_bacteria 2643221607 2644052042 261
135 iso_pu_bacteria 2643221610 2644068737 261
136 iso_pu_bacteria 2643221618 2644110143 261
137 iso_pu_bacteria 2643221623 2644131583 261
138 iso_pu_bacteria 2643221626 2644150419 261
139 iso_pu_bacteria 2643221634 2644194819 261
140 iso_pu_bacteria 2643221636 2644201401 261
141 iso_pu_bacteria 2643221637 2644209458 261
142 iso_pu_bacteria 2643221643 2644240501 261
143 iso_pu_bacteria 2643221653 2644299793 261
144 iso_pu_bacteria 2643221655 2644313023 261
145 iso_pu_bacteria 2643221659 2644336571 261
146 iso_pu_bacteria 2643221668 2644379508 261
147 iso_pu_bacteria 2643221675 2644419807 261
148 iso_pu_bacteria 2643221680 2644453164 261
149 iso_pu_bacteria 2643221686 2644484494 261
150 iso_pu_bacteria 2643221688 2644493086 261
151 iso_pu_bacteria 2643221689 2644499284 261
152 iso_pu_bacteria 2643221698 2644546218 261
153 iso_pu_bacteria 2643221712 2644618753 261
154 iso_pu_bacteria 2643221718 2644652986 261
155 iso_pu_bacteria 2643221719 2644658020 261
156 iso_pu_bacteria 2643221723 2644677102 261
157 iso_pu_bacteria 2643221726 2644688808 261
158 iso_pu_bacteria 2657244999 2657682384 261
159 iso_pu_bacteria 2690316117 2692319968 261
160 iso_pu_bacteria 2693429783 2694631597 261
161 iso_pu_bacteria 2693429784 2694638349 261
162 iso_pu_bacteria 2718217882 2719182964 261
163 iso_pu_bacteria 2718217927 2719387677 261
164 iso_pu_bacteria 2718217997 2719667309 261
165 iso_pu_bacteria 2718218009 2719733681 261
166 iso_pu_bacteria 2718218199 2720493729 261
167 iso_pu_bacteria 2718218232 2720615182 261
168 iso_pu_bacteria 2718218233 2720621977 261
169 iso_pu_bacteria 2718218235 2720633327 261
170 iso_pu_bacteria 2718218269 2720777025 261
171 iso_pu_bacteria 2718218363 2721149076 261
172 iso_pu_bacteria 2718218365 2721160474 261
173 iso_pu_bacteria 2718218366 2721165889 261
174 iso_pu_bacteria 2718218423 2721401311 261
175 iso_pu_bacteria 2721755514 2722842059 261
176 iso_pu_bacteria 2721755556 2723028623 261
177 iso_pu_bacteria 2721755684 2723562227 261
178 iso_pu_bacteria 2721755685 2723568930 261
179 iso_pu_bacteria 2721755809 2724040125 261
180 iso_pu_bacteria 2721755810 2724046437 261
181 iso_pu_bacteria 2721755819 2724091632 261
182 iso_pu_bacteria 2721755822 2724106195 261
183 iso_pu_bacteria 2721755823 2724112001 261
184 iso_pu_bacteria 2724679232 2725947538 261
185 iso_pu_bacteria 2728369352 2730109559 261
186 iso_pu_bacteria 2728369365 2730166199 261
187 iso_pu_bacteria 2728369397 2730300106 261
188 iso_pu_bacteria 2738541293 2738805940 261
189 iso_pu_bacteria 2738541333 2739037276 261
190 iso_pu_bacteria 2738543024 2739306062 261
191 iso_pu_bacteria 2751185821 2753462471 261
192 iso_pu_bacteria 2765235942 2766064267 261
193 iso_pu_bacteria 2775507049 2776915590 261
194 iso_pu_bacteria 2791355082 2792582266 261
195 iso_pu_bacteria 2791355091 2792621929 261
196 iso_pu_bacteria 2791355092 2792628814 261
197 iso_pu_bacteria 2791355094 2792640000 261
198 iso_pu_bacteria 2791355256 2793295627 261
199 iso_pu_bacteria 2791355260 2793320721 261
200 iso_pu_bacteria 2791355261 2793327284 261
201 iso_pu_bacteria 2791355262 2793332238 261
202 iso_pu_bacteria 2791355264 2793346601 261
203 iso_pu_bacteria 2791355265 2793353860 261
204 iso_pu_bacteria 2791355266 2793359395 261
205 iso_pu_bacteria 2791355267 2793365905 261
206 iso_pu_bacteria 2802428858 2802717184 261
207 iso_pu_bacteria 2802428859 2802724827 261
208 iso_pu_bacteria 2802428860 2802729578 261
209 iso_pu_bacteria 2802428861 2802736924 261
210 iso_pu_bacteria 2802428862 2802743329 261
211 iso_pu_bacteria 2802428863 2802749545 261
212 iso_pu_bacteria 2802429268 2804753723 261
213 iso_pu_bacteria 2802429605 2805926216 261
214 iso_pu_bacteria 2802429606 2805933942 261
215 iso_pu_bacteria 2802429633 2806047367 261
216 iso_pu_bacteria 2802429634 2806054222 261
217 iso_pu_bacteria 2802429635 2806060194 261
218 iso_pu_bacteria 2802429636 2806068805 261
219 iso_pu_bacteria 2802429637 2806076411 261
220 iso_pu_bacteria 2818991272 2819244578 261
221 iso_pu_bacteria 2838016132 2838018331 261
222 iso_pu_bacteria 2838022645 2838024014 261
223 iso_pu_bacteria 2838035591 2838040351 261
224 iso_pu_bacteria 2838048938 2838050807 261
225 iso_pu_bacteria 2838061910 2838062573 261
226 iso_pu_bacteria 2838068647 2838072124 261
227 iso_pu_bacteria 2838074704 2838078192 261
228 iso_pu_bacteria 2838661181 2838667766 261
229 iso_pu_bacteria 2838668709 2838672165 261
230 iso_pu_bacteria 2838680041 2838683878 261
231 iso_pu_bacteria 2838686498 2838690282 261
232 iso_pu_bacteria 2838694306 2838698406 261
233 iso_pu_bacteria 2838701080 2838704965 261
234 iso_pu_bacteria 2838707686 2838711521 261
235 iso_pu_bacteria 2838729681 2838732057 261
236 iso_pu_bacteria 2838742623 2838744953 261
237 iso_pu_bacteria 2841734538 2841736712 261
238 iso_pu_bacteria 2841851746 2841856011 261
239 iso_pu_bacteria 2841864319 2841867759 261
240 iso_pu_bacteria 2842077413 2842081322 261
241 iso_pu_bacteria 2842110456 2842116854 261
242 iso_pu_bacteria 2842118031 2842121901 261
243 iso_pu_bacteria 2842146304 2842148799 261
244 iso_pu_bacteria 2842156927 2842161181 261
245 iso_pu_bacteria 2842163707 2842166693 261
246 iso_pu_bacteria 2842180545 2842184797 261
247 iso_pu_bacteria 2842192696 2842194881 261
248 iso_pu_bacteria 2842198810 2842201607 261
249 iso_pu_bacteria 2842205361 2842207420 261
250 iso_pu_bacteria 2842217011 2842221780 261
251 iso_pu_bacteria 2842229732 2842232379 261
252 iso_pu_bacteria 2842237096 2842240915 261
253 iso_pu_bacteria 2842243621 2842246795 261
254 iso_pu_bacteria 2842250916 2842254646 261
255 iso_pu_bacteria 2842257432 2842261104 261
256 iso_pu_bacteria 2842264693 2842269639 261
257 iso_pu_bacteria 2842271015 2842274302 261
258 iso_pu_bacteria 2842278818 2842280869 261
259 iso_pu_bacteria 2842285085 2842288519 261
260 iso_pu_bacteria 2842291075 2842294979 261
261 iso_pu_bacteria 2842304105 2842305855 261
262 iso_pu_bacteria 2842311132 2842311411 261
263 iso_pu_bacteria 2842317721 2842321112 261
264 iso_pu_bacteria 2842363717 2842366272 261
265 iso_pu_bacteria 2842370503 2842375003 261
266 iso_pu_bacteria 2842377471 2842381378 261
267 iso_pu_bacteria 2842384541 2842388448 261
268 iso_pu_bacteria 2842395702 2842395944 261
269 iso_pu_bacteria 2842402390 2842406135 261
270 iso_pu_bacteria 2842409023 2842412720 261
271 iso_pu_bacteria 2842415677 2842419401 261
272 iso_pu_bacteria 2842422224 2842425756 261
273 iso_pu_bacteria 2842428310 2842433599 261
274 iso_pu_bacteria 2842434925 2842439927 261
275 iso_pu_bacteria 2842441272 2842446556 261
276 iso_pu_bacteria 2842447887 2842448780 261
277 iso_pu_bacteria 2842462802 2842467935 261
278 iso_pu_bacteria 2842469257 2842474536 261
279 iso_pu_bacteria 2842489311 2842491165 261
280 iso_pu_bacteria 2842495871 2842498502 261
281 iso_pu_bacteria 2842509118 2842511704 261
282 iso_pu_bacteria 2842521101 2842524479 261
283 iso_pu_bacteria 2844163670 2844166231 261
284 iso_pu_bacteria 2844454524 2844457019 261
285 iso_pu_bacteria 2847417321 2847420809 261
286 iso_pu_bacteria 2848992105 2848995634 261
287 iso_pu_bacteria 2850079185 2850082662 261
288 iso_pu_bacteria 2855825444 2855827413 261
289 iso_pu_bacteria 2855839649 2855842789 261
290 iso_pu_bacteria 2855872281 2855878172 261
291 iso_pu_bacteria 2856342000 2856342589 261
292 iso_pu_bacteria 2857516855 2857519574 261
293 iso_pu_bacteria 2858800743 2858802127 261
294 iso_pu_bacteria 2871474448 2871479461 261
295 iso_pu_bacteria 2876377896 2876383026 261
296 iso_pu_bacteria 2876392853 2876399234 261
297 iso_pu_bacteria 2878738818 2878742100 261
298 iso_pu_bacteria 2881161766 2881165333 261
299 iso_pu_bacteria 2885305155 2885307189 261
300 iso_pu_bacteria 2885326080 2885332456 261
301 iso_pu_bacteria 2885334103 2885339500 261
302 iso_pu_bacteria 2888343758 2888344699 261
303 iso_pu_bacteria 2891373044 2891373893 261
304 iso_pu_bacteria 2896384573 2896390221 261
305 iso_pu_bacteria 2904659560 2904665761 261
306 iso_pu_bacteria 2913295892 2913300265 261
307 iso_pu_bacteria 2915980308 2915982397 261
308 iso_pu_bacteria 2915986958 2915988808 261
309 iso_pu_bacteria 2915993759 2915999350 261
310 iso_pu_bacteria 2916000859 2916003799 261
311 iso_pu_bacteria 2916007675 2916010617 261
312 iso_pu_bacteria 2916014648 2916018169 261
313 iso_pu_bacteria 2916021584 2916023845 261
314 iso_pu_bacteria 2916028427 2916031048 261
315 iso_pu_bacteria 2916035215 2916040412 261
316 iso_pu_bacteria 2916041962 2916045392 261
317 iso_pu_bacteria 2916048683 2916050728 261
318 iso_pu_bacteria 2916055098 2916056775 261
319 iso_pu_bacteria 2916061851 2916064983 261
320 iso_pu_bacteria 2916068649 2916070887 261
321 iso_pu_bacteria 2916076590 2916080591 261
322 iso_pu_bacteria 2919100787 2919105387 261
323 iso_pu_bacteria 2920760137 2920760347 261
324 iso_pu_bacteria 2920822456 2920825923 261
325 iso_pu_bacteria 2921201388 2921207981 261
326 iso_pu_bacteria 2921208531 2921209891 261
327 iso_pu_bacteria 2921237296 2921239794 261
328 iso_pu_bacteria 2921244191 2921249053 261
329 iso_pu_bacteria 2921250672 2921252907 261
330 iso_pu_bacteria 2921257292 2921260215 261
331 iso_pu_bacteria 2921263974 2921266324 261
332 iso_pu_bacteria 2921282425 2921286979 261
333 iso_pu_bacteria 2921289301 2921295951 261
334 iso_pu_bacteria 2923556063 2923559488 261
335 iso_pu_bacteria 2924144063 2924149524 261
336 iso_pu_bacteria 2924150972 2924157575 261
337 iso_pu_bacteria 2924158325 2924163215 261
338 iso_pu_bacteria 2924165586 2924167750 261
339 iso_pu_bacteria 2924172951 2924174222 261
340 iso_pu_bacteria 2924179722 2924181871 261
341 iso_pu_bacteria 2924186466 2924187828 261
342 iso_pu_bacteria 2924193448 2924193570 261
343 iso_pu_bacteria 2924200457 2924201754 261
344 iso_pu_bacteria 2924207177 2924207705 261
345 iso_pu_bacteria 2924214083 2924219351 261
346 iso_pu_bacteria 2924221636 2924223455 261
347 iso_pu_bacteria 2924228884 2924234121 261
348 iso_pu_bacteria 2924754689 2924758891 261
349 iso_pu_bacteria 2924762789 2924768560 261
350 iso_pu_bacteria 2924776078 2924779784 261
351 iso_pu_bacteria 2933016740 2933017667 261
352 iso_pu_bacteria 2933570622 2933572360 261
353 iso_pu_bacteria 2933586486 2933593141 261
354 iso_pu_bacteria 2933599457 2933603023 261
355 iso_pu_bacteria 2935894831 2935897943 261
356 iso_pu_bacteria 2935901341 2935903635 261
357 iso_pu_bacteria 2936367885 2936369889 261
358 iso_pu_bacteria 2936375103 2936379074 261
359 iso_pu_bacteria 2936996657 2936998937 261
360 iso_pu_bacteria 2937002841 2937006639 261
361 iso_pu_bacteria 2937009748 2937015547 261
362 iso_pu_bacteria 2937016420 2937017806 261
363 iso_pu_bacteria 2937023124 2937023262 261
364 iso_pu_bacteria 2937029754 2937031827 261
365 iso_pu_bacteria 2937036028 2937036242 261
366 iso_pu_bacteria 2937042894 2937048413 261
367 iso_pu_bacteria 2937049772 2937053424 261
368 iso_pu_bacteria 2937056579 2937059809 261
369 iso_pu_bacteria 2937063883 2937068192 261
370 iso_pu_bacteria 2937071275 2937077377 261
371 iso_pu_bacteria 2937078374 2937082078 261
372 iso_pu_bacteria 2937084907 2937090016 261
373 iso_pu_bacteria 2937091812 2937098066 261
374 iso_pu_bacteria 2937098957 2937101294 261
375 iso_pu_bacteria 2937106411 2937109109 261
376 iso_pu_bacteria 2937113482 2937114159 261
377 iso_pu_bacteria 2937119839 2937120159 261
378 iso_pu_bacteria 2937126314 2937128625 261
379 iso_pu_bacteria 2938014810 2938020378 261
380 iso_pu_bacteria 2941499720 2941501343 261
381 iso_pu_bacteria 2957375807 2957381797 261
382 iso_pu_bacteria 2957382221 2957384574 261
383 iso_pu_bacteria 2957388812 2957395280 261
384 iso_pu_bacteria 2957395598 2957396080 261
385 iso_pu_bacteria 2957402308 2957405148 261
386 iso_pu_bacteria 2957408893 2957411797 261
387 iso_pu_bacteria 2957415311 2957417554 261
388 iso_pu_bacteria 2957422303 2957423312 261
389 iso_pu_bacteria 2957430029 2957432000 261
390 iso_pu_bacteria 2957437181 2957443063 261
391 iso_pu_bacteria 2957443900 2957450320 261
392 iso_pu_bacteria 2957450854 2957454544 261
393 iso_pu_bacteria 2957457609 2957460915 261
394 iso_pu_bacteria 2957464669 2957470947 261
395 iso_pu_bacteria 2957471148 2957474141 261
396 iso_pu_bacteria 2957478035 2957479383 261
397 iso_pu_bacteria 2957484790 2957489713 261
398 iso_pu_bacteria 2957491536 2957494520 261
399 iso_pu_bacteria 2957498199 2957504952 261
400 iso_pu_bacteria 2957505466 2957512236 261
401 iso_pu_bacteria 2958071322 2958074307 261
402 iso_pu_bacteria 2960584000 2960586253 261
403 iso_pu_bacteria 2960591022 2960592266 261
404 iso_pu_bacteria 2960597568 2960597982 261
405 iso_pu_bacteria 2960603979 2960605037 261
406 iso_pu_bacteria 2960610863 2960613331 261
407 iso_pu_bacteria 2960617483 2960618331 261
408 iso_pu_bacteria 2960624210 2960629390 261
409 iso_pu_bacteria 2960631154 2960633782 261
410 iso_pu_bacteria 2960637947 2960643766 261
411 iso_pu_bacteria 2960645483 2960647544 261
412 iso_pu_bacteria 2960652885 2960654628 261
413 iso_pu_bacteria 2960660292 2960666858 261
414 iso_pu_bacteria 2960667422 2960673205 261
415 iso_pu_bacteria 2960674078 2960674593 261
416 iso_pu_bacteria 2960680706 2960682373 261
417 iso_pu_bacteria 2960687367 2960693291 261
418 iso_pu_bacteria 2960693952 2960698201 261
419 iso_pu_bacteria 2961114664 2961121104 261
420 iso_pu_bacteria 2964607997 2964610588 261
421 iso_pu_bacteria 2964615318 2964617052 261
422 iso_pu_bacteria 2964621998 2964627120 261
423 iso_pu_bacteria 2964628898 2964633260 261
424 iso_pu_bacteria 2964636051 2964641583 261
425 iso_pu_bacteria 2964643177 2964648825 261
426 iso_pu_bacteria 2964649959 2964655296 261
427 iso_pu_bacteria 2964656573 2964659616 261
428 iso_pu_bacteria 2964663802 2964669316 261
429 iso_pu_bacteria 2964670856 2964675384 261
430 iso_pu_bacteria 2964678106 2964680163 261
431 iso_pu_bacteria 2964685014 2964691750 261
432 iso_pu_bacteria 2964691889 2964695058 261
433 iso_pu_bacteria 2964698721 2964702458 261
434 iso_pu_bacteria 2964705432 2964705941 261
435 iso_pu_bacteria 2964712639 2964712745 261
436 iso_pu_bacteria 2964719344 2964719495 261
437 iso_pu_bacteria 2967664464 2967666804 261
438 iso_pu_bacteria 2967671571 2967678298 261
439 iso_pu_bacteria 2967678726 2967681739 261
440 iso_pu_bacteria 2967686174 2967690217 261
441 iso_pu_bacteria 2967693043 2967699315 261
442 iso_pu_bacteria 2967699805 2967705993 261
443 iso_pu_bacteria 2967706974 2967713279 261
444 iso_pu_bacteria 2967714385 2967719004 261
445 iso_pu_bacteria 2967721400 2967723877 261
446 iso_pu_bacteria 2967728569 2967730856 261
447 iso_pu_bacteria 2967735183 2967738379 261
448 iso_pu_bacteria 2967742019 2967748294 261
449 iso_pu_bacteria 2967748971 2967753974 261
450 iso_pu_bacteria 2967755722 2967757452 261
451 iso_pu_bacteria 2967762386 2967767889 261
452 iso_pu_bacteria 2967769361 2967775132 261
453 iso_pu_bacteria 2967775926 2967776577 261
454 iso_pu_bacteria 2968110612 2968117254 261
455 iso_pu_bacteria 2970019648 2970023609 261
456 iso_pu_bacteria 2970026789 2970029568 261
457 iso_pu_bacteria 2970033650 2970040546 261
458 iso_pu_bacteria 2970040964 2970044934 261
459 iso_pu_bacteria 2970047711 2970048753 261
460 iso_pu_bacteria 2970054988 2970058921 261
461 iso_pu_bacteria 2970061556 2970062060 261
462 iso_pu_bacteria 2970068827 2970070275 261
463 iso_pu_bacteria 2970076120 2970076804 261
464 iso_pu_bacteria 2970082768 2970084058 261
465 iso_pu_bacteria 2970088815 2970092828 261
466 iso_pu_bacteria 2970095765 2970099921 261
467 iso_pu_bacteria 2970102677 2970107003 261
468 iso_pu_bacteria 2970109326 2970113000 261
469 iso_pu_bacteria 2970116247 2970116854 261
470 iso_pu_bacteria 2970122695 2970124607 261
471 iso_pu_bacteria 2970129317 2970133606 261
472 iso_pu_bacteria 2970136068 2970142282 261
473 iso_pu_bacteria 2970143518 2970143571 261
474 iso_pu_bacteria 2970149975 2970152943 261
475 iso_pu_bacteria 2970156795 2970163147 261
476 iso_pu_bacteria 2970164137 2970170839 261
477 iso_pu_bacteria 2970170962 2970176078 261
478 iso_pu_bacteria 2970177841 2970181252 261
479 iso_pu_bacteria 2970184632 2970185480 261
480 iso_pu_bacteria 2970191845 2970197999 261
481 iso_pu_bacteria 2970540015 2970541979 261
482 iso_pu_bacteria 2977516862 2977519740 261
483 iso_pu_bacteria 2977523885 2977525187 261
484 iso_pu_bacteria 2977530762 2977535051 261
485 iso_pu_bacteria 2977537788 2977544555 261
486 iso_pu_bacteria 2977544691 2977550596 261
487 iso_pu_bacteria 2977551784 2977553173 261
488 iso_pu_bacteria 2977558990 2977565779 261
489 iso_pu_bacteria 2977565890 2977571226 261
490 iso_pu_bacteria 2977572785 2977573749 261
491 iso_pu_bacteria 2977579622 2977582950 261
492 iso_pu_bacteria 2987666974 2987673289 261
493 iso_pu_bacteria 2989349275 2989354942 261
494 iso_pu_bacteria 2989776772 2989780165 261
495 iso_pu_bacteria 2996310559 2996315241 261
496 iso_pu_bacteria 2996887358 2996890243 261
497 iso_pu_bacteria 2996893221 2996895281 261
498 iso_pu_bacteria 3003930520 3003930983 261
499 iso_pu_bacteria 3005409236 3005415799 261
500 iso_pu_bacteria 3005445848 3005449660 261
501 iso_pu_bacteria 3005452660 3005455948 261
502 iso_pu_bacteria 639633055 639650430 261
503 iso_pu_bacteria 643692032 643827405 261
504 iso_pu_bacteria 648276728 648737226 261
505 iso_pu_bacteria 8002285264 8002291826 261
506 iso_pu_bacteria 8003992118 8003995369 261
507 iso_pu_bacteria 8003999396 8004003111 261
508 iso_pu_bacteria 8004395343 8004397068 261
509 iso_pu_bacteria 8005246636 8005249308 261
510 iso_pu_bacteria 8005258706 8005262426 261
511 iso_pu_bacteria 8005275841 8005282432 261
512 iso_pu_bacteria 8005282627 8005286749 261
513 iso_pu_bacteria 8005289223 8005295083 261
514 iso_pu_bacteria 8005301065 8005305962 261
515 iso_pu_bacteria 8005307578 8005313698 261
516 iso_pu_bacteria 8005321885 8005324770 261
517 iso_pu_bacteria 8005376324 8005381568 261
518 iso_pu_bacteria 8005382845 8005387772 261
519 iso_pu_bacteria 8005395548 8005400808 261
520 iso_pu_bacteria 8005430974 8005431105 261
521 iso_pu_bacteria 8005460587 8005465096 261
522 iso_pu_bacteria 8005497431 8005497673 261
523 iso_pu_bacteria 8005542996 8005546674 261
524 iso_pu_bacteria 8005556819 8005561171 261
525 iso_pu_bacteria 8005563573 8005565796 261
526 iso_pu_bacteria 8005570704 8005571843 261
527 iso_pu_bacteria 8005619151 8005623407 261
528 iso_pu_bacteria 8005626139 8005631013 261
529 iso_pu_bacteria 8005658619 8005660816 261
530 iso_pu_bacteria 8005668836 8005669078 261
531 iso_pu_bacteria 8005688590 8005694339 261
532 iso_pu_bacteria 8005695170 8005695734 261
533 iso_pu_bacteria 8018127388 8018128910 261
534 iso_pu_bacteria 8018150411 8018153363 261
535 iso_pu_bacteria 8018163183 8018165090 261
536 iso_pu_bacteria 8018176218 8018177150 261
537 iso_pu_bacteria 8023680758 8023686538 261
538 iso_pu_bacteria 8024479707 8024484370 261
539 iso_pu_bacteria 8024501048 8024502010 261
540 iso_pu_bacteria 8046767195 8046767234 261
541 iso_pu_bacteria 8049293176 8049296321 261
542 iso_pu_bacteria 8054558443 8054561754 261
543 iso_pu_bacteria 8055617313 8055618248 261
544 iso_pu_bacteria 8056375014 8056380414 261
545 iso_pu_bacteria 8056382006 8056385245 261
546 iso_pu_bacteria 8057575449 8057581620 261
547 iso_pu_bacteria 8057874678 8057879287 261
548 3300049571 Ga0501034_0021121 Ga0501034_0021121_4858_5649 263
549 3300053087 Ga0500643_003112 Ga0500643_003112_413_1204 263
550 iso_pu_bacteria 2954011201 2954013829 263
551 3300006038 Ga0075365_10036700 Ga0075365_100367002 264
552 3300031901 Ga0307406_10312496 Ga0307406_103124962 264
553 3300032004 Ga0307414_10020503 Ga0307414_100205036 264
554 3300049568 Ga0501031_0000022 Ga0501031_0000022_54040_54837 264
555 3300049569 Ga0501032_0000063 Ga0501032_0000063_37633_38430 264
556 3300049570 Ga0501033_0000073 Ga0501033_0000073_56451_57248 264
557 3300049571 Ga0501034_0000276 Ga0501034_0000276_54068_54865 264
558 3300049571 Ga0501034_0118266 Ga0501034_0118266_1313_2107 264
559 3300049572 Ga0501036_0000030 Ga0501036_0000030_54068_54865 264
560 3300049573 Ga0501037_0000075 Ga0501037_0000075_37635_38432 264
561 3300049574 Ga0501038_0000058 Ga0501038_0000058_37633_38430 264
562 3300049575 Ga0501039_0000054 Ga0501039_0000054_37633_38430 264
563 3300049576 Ga0501040_0017164 Ga0501040_0017164_3310_4107 264
564 3300049579 Ga0501043_0001296 Ga0501043_0001296_10064_10861 264
565 3300049581 Ga0501047_0001489 Ga0501047_0001489_11111_11908 264
566 3300049822 Ga0501035_0000126 Ga0501035_0000126_54068_54865 264
567 3300049823 Ga0501044_0000131 Ga0501044_0000131_37633_38430 264
568 3300053121 Ga0500607_133288 Ga0500607_133288_205_1002 264
569 3300053161 Ga0500634_0004706 Ga0500634_0004706_3474_4271 264
570 3300002739 JGI25158J39367_1000116 JGI25158J39367_10001163 265
571 3300002773 JGI25152J39213_1002074 JGI25152J39213_10020743 265
572 3300002773 JGI25152J39213_1002660 JGI25152J39213_10026608 265
573 3300002773 JGI25152J39213_1004780 JGI25152J39213_10047803 265
574 3300002773 JGI25152J39213_1005991 JGI25152J39213_10059913 265
575 3300002774 JGI25150J39212_1000037 JGI25150J39212_100003711 265
576 3300002774 JGI25150J39212_1006040 JGI25150J39212_10060401 265
577 3300002987 JGI25159J45721_1003134 JGI25159J45721_10031347 265
578 3300003187 JGI25151J46595_10000220 JGI25151J46595_1000022064 265
579 3300003187 JGI25151J46595_10002488 JGI25151J46595_100024884 265
580 3300003187 JGI25151J46595_10006712 JGI25151J46595_100067126 265
581 3300003187 JGI25151J46595_10014115 JGI25151J46595_100141152 265
582 3300003187 JGI25151J46595_10016522 JGI25151J46595_100165224 265
583 3300003215 JGI25153J46596_10004090 JGI25153J46596_1000409011 265
584 3300003215 JGI25153J46596_10007213 JGI25153J46596_100072132 265
585 3300003215 JGI25153J46596_10022145 JGI25153J46596_100221452 265
586 3300003215 JGI25153J46596_10036449 JGI25153J46596_100364491 265
587 3300003354 JGI25160J50197_1000027 JGI25160J50197_100002777 265
588 3300003354 JGI25160J50197_1000108 JGI25160J50197_100010867 265
589 3300003354 JGI25160J50197_1002336 JGI25160J50197_10023362 265
590 3300003354 JGI25160J50197_1004011 JGI25160J50197_10040117 265
591 3300003354 JGI25160J50197_1021541 JGI25160J50197_10215412 265
592 3300003374 JGI25161J50226_1000112 JGI25161J50226_100011268 265
593 3300003374 JGI25161J50226_1000327 JGI25161J50226_100032720 265
594 3300003374 JGI25161J50226_1000501 JGI25161J50226_100050121 265
595 3300003771 Ga0055526_1002678 Ga0055526_10026785 265
596 3300003771 Ga0055526_1011992 Ga0055526_10119922 265
597 3300003771 Ga0055526_1013569 Ga0055526_10135693 265
598 3300003771 Ga0055526_1018677 Ga0055526_10186773 265
599 3300003771 Ga0055526_1030183 Ga0055526_10301832 265
600 3300003775 Ga0055524_1004989 Ga0055524_10049896 265
601 3300003775 Ga0055524_1007541 Ga0055524_10075413 265
602 3300003775 Ga0055524_1017101 Ga0055524_10171012 265
603 3300003775 Ga0055524_1029614 Ga0055524_10296142 265
604 3300003775 Ga0055524_1035522 Ga0055524_10355221 265
605 3300003781 Ga0055536_1000999 Ga0055536_100099911 265
606 3300003790 Ga0055528_1000099 Ga0055528_100009947 265
607 3300003790 Ga0055528_1007426 Ga0055528_10074263 265
608 3300003790 Ga0055528_1016778 Ga0055528_10167783 265
609 3300003790 Ga0055528_1016941 Ga0055528_10169413 265
610 3300003790 Ga0055528_1025021 Ga0055528_10250212 265
611 3300003792 Ga0055540_1001518 Ga0055540_100151814 265
612 3300003794 Ga0055531_10006403 Ga0055531_100064037 265
613 3300004625 Ga0055543_1000030 Ga0055543_100003085 265
614 3300004625 Ga0055543_1000062 Ga0055543_100006274 265
615 3300004625 Ga0055543_1000080 Ga0055543_100008019 265
616 3300004625 Ga0055543_1000683 Ga0055543_10006832 265
617 3300005262 Ga0065165_1000122 Ga0065165_1000122108 265
618 3300005262 Ga0065165_1002470 Ga0065165_100247013 265
619 3300005262 Ga0065165_1005804 Ga0065165_10058043 265
620 3300005262 Ga0065165_1021888 Ga0065165_10218883 265
621 3300005337 Ga0070682_100131782 Ga0070682_1001317822 265
622 3300005347 Ga0070668_100213088 Ga0070668_1002130882 265
623 3300005353 Ga0070669_100134573 Ga0070669_1001345732 265
624 3300005435 Ga0070714_100610209 Ga0070714_1006102091 265
625 3300005539 Ga0068853_100203017 Ga0068853_1002030172 265
626 3300005548 Ga0070665_100036587 Ga0070665_1000365873 265
627 3300005548 Ga0070665_100110964 Ga0070665_1001109642 265
628 3300005983 Ga0081540_1096704 Ga0081540_10967042 265
629 3300005985 Ga0081539_10000437 Ga0081539_1000043775 265
630 3300006038 Ga0075365_10014754 Ga0075365_100147543 265
631 3300006038 Ga0075365_10022020 Ga0075365_100220204 265
632 3300006038 Ga0075365_10065525 Ga0075365_100655254 265
633 3300006177 Ga0075362_10031088 Ga0075362_100310882 265
634 3300006178 Ga0075367_10000317 Ga0075367_1000031715 265
635 3300006178 Ga0075367_10028826 Ga0075367_100288264 265
636 3300006186 Ga0075369_10002260 Ga0075369_100022602 265
637 3300006186 Ga0075369_10003953 Ga0075369_100039532 265
638 3300006186 Ga0075369_10018325 Ga0075369_100183254 265
639 3300006195 Ga0075366_10007998 Ga0075366_100079982 265
640 3300006195 Ga0075366_10281865 Ga0075366_102818651 265
641 3300006353 Ga0075370_10008448 Ga0075370_100084487 265
642 3300009551 Ga0105238_10021951 Ga0105238_100219515 265
643 3300009766 Ga0123342_1005742 Ga0123342_100574211 265
644 3300013105 Ga0157369_10219682 Ga0157369_102196822 265
645 3300013249 Ga0171463_1004 Ga0171463_1004187 265
646 3300015690 Ga0183363_1019 Ga0183363_101946 265
647 3300017792 Ga0163161_10641046 Ga0163161_106410461 265
648 3300021320 Ga0214544_1000079 Ga0214544_100007990 265
649 3300021321 Ga0214542_1000064 Ga0214542_100006494 265
650 3300021327 Ga0214543_1000015 Ga0214543_1000015103 265
651 3300021327 Ga0214543_1000063 Ga0214543_100006318 265
652 3300022739 Ga0228711_1000004 Ga0228711_1000004131 265
653 3300022740 Ga0228710_1000002 Ga0228710_100000280 265
654 3300025208 Ga0209436_100018 Ga0209436_10001827 265
655 3300025208 Ga0209436_100540 Ga0209436_1005406 265
656 3300025245 Ga0207425_1000034 Ga0207425_100003411 265
657 3300025245 Ga0207425_1003134 Ga0207425_10031345 265
658 3300025245 Ga0207425_1006854 Ga0207425_10068544 265
659 3300025258 Ga0209129_1000118 Ga0209129_100011818 265
660 3300025258 Ga0209129_1000253 Ga0209129_100025311 265
661 3300025258 Ga0209129_1001394 Ga0209129_100139412 265
662 3300025258 Ga0209129_1004326 Ga0209129_10043265 265
663 3300025258 Ga0209129_1004708 Ga0209129_10047082 265
664 3300025258 Ga0209129_1005410 Ga0209129_10054102 265
665 3300025261 Ga0209233_1000118 Ga0209233_100011832 265
666 3300025273 Ga0209673_1000033 Ga0209673_1000033234 265
667 3300025273 Ga0209673_1000050 Ga0209673_100005018 265
668 3300025273 Ga0209673_1000052 Ga0209673_1000052153 265
669 3300025273 Ga0209673_1004592 Ga0209673_10045923 265
670 3300025273 Ga0209673_1012521 Ga0209673_10125214 265
671 3300025284 Ga0209130_1000009 Ga0209130_1000009265 265
672 3300025284 Ga0209130_1000027 Ga0209130_1000027212 265
673 3300025284 Ga0209130_1000108 Ga0209130_1000108112 265
674 3300025284 Ga0209130_1009914 Ga0209130_10099142 265
675 3300025291 Ga0209675_1013892 Ga0209675_10138923 265
676 3300025292 Ga0209676_1000406 Ga0209676_100040627 265
677 3300025292 Ga0209676_1013267 Ga0209676_10132674 265
678 3300025294 Ga0209025_1000042 Ga0209025_1000042302 265
679 3300025294 Ga0209025_1000241 Ga0209025_100024125 265
680 3300025294 Ga0209025_1000335 Ga0209025_100033518 265
681 3300025294 Ga0209025_1000533 Ga0209025_100053366 265
682 3300025294 Ga0209025_1002567 Ga0209025_100256710 265
683 3300025294 Ga0209025_1006540 Ga0209025_10065409 265
684 3300025294 Ga0209025_1013261 Ga0209025_10132611 265
685 3300025294 Ga0209025_1016446 Ga0209025_10164463 265
686 3300025294 Ga0209025_1034149 Ga0209025_10341493 265
687 3300025294 Ga0209025_1036512 Ga0209025_10365121 265
688 3300025294 Ga0209025_1049902 Ga0209025_10499021 265
689 3300025295 Ga0209564_1000111 Ga0209564_1000111193 265
690 3300025295 Ga0209564_1001330 Ga0209564_10013302 265
691 3300025295 Ga0209564_1002296 Ga0209564_100229615 265
692 3300025295 Ga0209564_1006715 Ga0209564_10067151 265
693 3300025295 Ga0209564_1008393 Ga0209564_10083932 265
694 3300025297 Ga0209758_1000415 Ga0209758_100041566 265
695 3300025297 Ga0209758_1000896 Ga0209758_10008962 265
696 3300025297 Ga0209758_1001085 Ga0209758_100108540 265
697 3300025297 Ga0209758_1001086 Ga0209758_100108639 265
698 3300025297 Ga0209758_1001936 Ga0209758_10019362 265
699 3300025297 Ga0209758_1002583 Ga0209758_10025832 265
700 3300025297 Ga0209758_1028435 Ga0209758_10284352 265
701 3300025298 Ga0209050_1000572 Ga0209050_10005723 265
702 3300025298 Ga0209050_1012928 Ga0209050_10129285 265
703 3300025299 Ga0209256_1000773 Ga0209256_10007738 265
704 3300025299 Ga0209256_1001743 Ga0209256_100174317 265
705 3300025299 Ga0209256_1003248 Ga0209256_10032482 265
706 3300025299 Ga0209256_1003365 Ga0209256_100336510 265
707 3300025299 Ga0209256_1003400 Ga0209256_10034004 265
708 3300025299 Ga0209256_1018539 Ga0209256_10185392 265
709 3300025302 Ga0207426_1000041 Ga0207426_1000041203 265
710 3300025302 Ga0207426_1000072 Ga0207426_1000072104 265
711 3300025302 Ga0207426_1000082 Ga0207426_1000082257 265
712 3300025302 Ga0207426_1000348 Ga0207426_100034857 265
713 3300025302 Ga0207426_1001232 Ga0207426_100123222 265
714 3300025303 Ga0209051_1000276 Ga0209051_100027618 265
715 3300025303 Ga0209051_1004620 Ga0209051_100462010 265
716 3300025303 Ga0209051_1005303 Ga0209051_10053032 265
717 3300025303 Ga0209051_1006579 Ga0209051_10065799 265
718 3300025303 Ga0209051_1009103 Ga0209051_10091034 265
719 3300025303 Ga0209051_1052278 Ga0209051_10522782 265
720 3300025304 Ga0209257_1002707 Ga0209257_10027074 265
721 3300025304 Ga0209257_1015856 Ga0209257_10158563 265
722 3300025304 Ga0209257_1038047 Ga0209257_10380472 265
723 3300025304 Ga0209257_1056454 Ga0209257_10564541 265
724 3300025711 Ga0207696_1050324 Ga0207696_10503241 265
725 3300025914 Ga0207671_10181999 Ga0207671_101819992 265
726 3300025923 Ga0207681_10170660 Ga0207681_101706602 265
727 3300025941 Ga0207711_10430652 Ga0207711_104306522 265
728 3300026041 Ga0207639_10032663 Ga0207639_100326634 265
729 3300026116 Ga0207674_10140735 Ga0207674_101407354 265
730 3300027111 Ga0209281_1000030 Ga0209281_1000030180 265
731 3300027111 Ga0209281_1000144 Ga0209281_1000144122 265
732 3300027666 Ga0209282_1000004 Ga0209282_1000004180 265
733 3300028379 Ga0268266_10041961 Ga0268266_100419614 265
734 3300028794 Ga0307515_10004852 Ga0307515_1000485224 265
735 3300028794 Ga0307515_10016477 Ga0307515_100164772 265
736 3300028794 Ga0307515_10046110 Ga0307515_100461104 265
737 3300031456 Ga0307513_10015506 Ga0307513_1001550610 265
738 3300031731 Ga0307405_10008039 Ga0307405_100080396 265
739 3300031731 Ga0307405_10427802 Ga0307405_104278021 265
740 3300031901 Ga0307406_10083526 Ga0307406_100835264 265
741 3300031911 Ga0307412_10005736 Ga0307412_100057369 265
742 3300031967 Ga0315914_1000001 Ga0315914_1000001203 265
743 3300033430 Ga0315913_1000004 Ga0315913_100000496 265
744 3300033464 Ga0315915_1000002 Ga0315915_1000002181 265
745 3300037312 Ga0395899_0119551 Ga0395899_0119551_47_844 265
746 3300037471 Ga0395905_0043406 Ga0395905_0043406_2513_3310 265
747 3300037471 Ga0395905_0611702 Ga0395905_0611702_24_821 265
748 3300041404 Ga0439436_0007896 Ga0439436_0007896_1911_2720 265
749 3300041404 Ga0439436_0011975 Ga0439436_0011975_773_1570 265
750 3300041413 Ga0439465_0016957 Ga0439465_0016957_1238_2035 265
751 3300041413 Ga0439465_0026848 Ga0439465_0026848_34_831 265
752 3300041452 Ga0451793_0969719 Ga0451793_0969719_176_973 265
753 3300041458 Ga0451798_0568173 Ga0451798_0568173_1629_2426 265
754 3300041492 Ga0451835_0384467 Ga0451835_0384467_190_987 265
755 3300041494 Ga0451837_1373485 Ga0451837_1373485_936_1733 265
756 3300041511 Ga0451855_0379872 Ga0451855_0379872_1960_2757 265
757 3300041511 Ga0451855_1098397 Ga0451855_1098397_393_1190 265
758 3300042122 Ga0450920_004471 Ga0450920_004471_209_1006 265
759 3300042435 Ga0439434_0044592 Ga0439434_0044592_327_1124 265
760 3300046460 Ga0495638_0006475 Ga0495638_0006475_1238_2035 265
761 3300046492 Ga0495585_0073526 Ga0495585_0073526_132_929 265
762 3300046501 Ga0495607_0040411 Ga0495607_0040411_513_1310 265
763 3300046507 Ga0495606_0113796 Ga0495606_0113796_401_1198 265
764 3300046512 Ga0495610_0011955 Ga0495610_0011955_728_1645 265
765 3300046512 Ga0495610_0049789 Ga0495610_0049789_1120_1917 265
766 3300046512 Ga0495610_0056328 Ga0495610_0056328_522_1319 265
767 3300046515 Ga0495620_0076939 Ga0495620_0076939_485_1282 265
768 3300046519 Ga0495632_0006155 Ga0495632_0006155_1441_2238 265
769 3300046522 Ga0495643_0006495 Ga0495643_0006495_272_1069 265
770 3300046522 Ga0495643_0079013 Ga0495643_0079013_260_1057 265
771 3300046616 Ga0495668_0129856 Ga0495668_0129856_327_1124 265
772 3300046660 Ga0495625_0066025 Ga0495625_0066025_1350_2147 265
773 3300046691 Ga0495670_0120460 Ga0495670_0120460_384_1181 265
774 3300046694 Ga0495649_0063067 Ga0495649_0063067_350_1252 265
775 3300046810 Ga0495660_0122995 Ga0495660_0122995_306_1103 265
776 3300047470 Ga0495681_0119032 Ga0495681_0119032_177_974 265
777 3300047472 Ga0495686_0045926 Ga0495686_0045926_504_1301 265
778 3300048090 Ga0495615_0006146 Ga0495615_0006146_1102_1899 265
779 3300048909 Ga0496106_0065953 Ga0496106_0065953_1430_2227 265
780 3300048919 Ga0496116_0005573 Ga0496116_0005573_9316_10113 265
781 3300048919 Ga0496116_0039438 Ga0496116_0039438_1619_2416 265
782 3300048919 Ga0496116_0055483 Ga0496116_0055483_440_1237 265
783 3300048919 Ga0496116_0062249 Ga0496116_0062249_1169_2086 265
784 3300048920 Ga0496117_0005347 Ga0496117_0005347_12491_13288 265
785 3300048920 Ga0496117_0184377 Ga0496117_0184377_113_910 265
786 3300048921 Ga0496118_0062412 Ga0496118_0062412_513_1310 265
787 3300048924 Ga0496121_0026756 Ga0496121_0026756_3329_4126 265
788 3300048924 Ga0496121_0037832 Ga0496121_0037832_1463_2260 265
789 3300048924 Ga0496121_0056879 Ga0496121_0056879_850_1647 265
790 3300048924 Ga0496121_0073205 Ga0496121_0073205_508_1305 265
791 3300048924 Ga0496121_0075319 Ga0496121_0075319_999_1796 265
792 3300048925 Ga0496122_0000984 Ga0496122_0000984_39464_40261 265
793 3300048925 Ga0496122_0007522 Ga0496122_0007522_1461_2258 265
794 3300048925 Ga0496122_0051249 Ga0496122_0051249_799_1596 265
795 3300048925 Ga0496122_0065256 Ga0496122_0065256_1384_2181 265
796 3300048925 Ga0496122_0095266 Ga0496122_0095266_334_1251 265
797 3300048926 Ga0496123_0000290 Ga0496123_0000290_25742_26539 265
798 3300048926 Ga0496123_0029681 Ga0496123_0029681_1226_2023 265
799 3300048926 Ga0496123_0060665 Ga0496123_0060665_1263_2060 265
800 3300048926 Ga0496123_0102445 Ga0496123_0102445_386_1183 265
801 3300048927 Ga0496124_0014171 Ga0496124_0014171_5585_6382 265
802 3300048927 Ga0496124_0036175 Ga0496124_0036175_1602_2399 265
803 3300048927 Ga0496124_0069034 Ga0496124_0069034_1727_2524 265
804 3300048927 Ga0496124_0087958 Ga0496124_0087958_620_1417 265
805 3300048928 Ga0496125_0007081 Ga0496125_0007081_751_1548 265
806 3300048928 Ga0496125_0043126 Ga0496125_0043126_1879_2676 265
807 3300048929 Ga0496126_0001347 Ga0496126_0001347_4487_5284 265
808 3300049570 Ga0501033_0015770 Ga0501033_0015770_4329_5126 265
809 3300049571 Ga0501034_0013832 Ga0501034_0013832_161_958 265
810 3300049571 Ga0501034_0293216 Ga0501034_0293216_543_1340 265
811 3300049572 Ga0501036_0378099 Ga0501036_0378099_290_1087 265
812 3300049573 Ga0501037_0046195 Ga0501037_0046195_1535_2332 265
813 3300049574 Ga0501038_0190092 Ga0501038_0190092_589_1389 265
814 3300049579 Ga0501043_0100843 Ga0501043_0100843_839_1639 265
815 3300049581 Ga0501047_0158719 Ga0501047_0158719_295_1092 265
816 3300049581 Ga0501047_0183270 Ga0501047_0183270_284_1081 265
817 3300049585 Ga0501069_0127753 Ga0501069_0127753_460_1260 265
818 3300049589 Ga0501073_0136355 Ga0501073_0136355_64_864 265
819 3300049744 Ga0501083_0206329 Ga0501083_0206329_188_985 265
820 3300049823 Ga0501044_0015879 Ga0501044_0015879_5825_6625 265
821 3300049823 Ga0501044_0090842 Ga0501044_0090842_1299_2096 265
822 3300050489 nmdc:mga03683_15806_c1 nmdc:mga03683_15806_c1_1604_2401 265
823 3300050492 nmdc:mga0yw44_40693_c1 nmdc:mga0yw44_40693_c1_527_1324 265
824 3300050493 nmdc:mga0k408_54773_c1 nmdc:mga0k408_54773_c1_518_1315 265
825 3300050496 nmdc:mga07m45_18041_c1 nmdc:mga07m45_18041_c1_2542_3339 265
826 3300050516 nmdc:mga0sz30_26139_c1 nmdc:mga0sz30_26139_c1_1088_1885 265
827 3300053086 Ga0500578_0125816 Ga0500578_0125816_208_1005 265
828 3300053109 Ga0500569_030273 Ga0500569_030273_401_1198 265
829 3300053134 Ga0500658_0000735 Ga0500658_0000735_11609_12406 265
830 3300053153 Ga0500616_0004669 Ga0500616_0004669_3177_3974 265
831 3300053153 Ga0500616_0014226 Ga0500616_0014226_1849_2646 265
832 3300053153 Ga0500616_0015830 Ga0500616_0015830_1577_2374 265
833 3300053153 Ga0500616_0139567 Ga0500616_0139567_142_939 265
834 3300053156 Ga0500622_0008199 Ga0500622_0008199_3685_4482 265
835 3300053158 Ga0500627_0087185 Ga0500627_0087185_261_1058 265
836 3300060353 Ga0501082_0240195 Ga0501082_0240195_280_1077 265
837 iso_pu_bacteria 2937836603 2937839238 265
838 iso_pu_bacteria 8004633249 8004634540 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

74

300

0.97

PF10613

Lig_chan-Glu_bd

Ligated ion channel L-glutamate- and glycine-binding site

72

169

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnj-assembly2.cif.gz_B domain-stabilized glutamine-binding protein 0.931 34 258
2q2c-assembly3.cif.gz_C crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus 0.9216 32 258
8hnj-assembly2.cif.gz_B domain-stabilized glutamine-binding protein 0.9188 34 258
5t0w-assembly2.cif.gz_B crystal structure of the ancestral amino acid-binding protein anccdt-1, a precursor of cyclohexadienyl dehydratase 0.9135 33 258
8eyz-assembly3.cif.gz_C engineered glutamine binding protein bound to gln and a cobaloxime ligand 0.9114 34 258
ID Description Score Start End Superfamily
3vvfB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9299 31 258 3.40.190.10
2q2aA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9299 34 258 3.40.190.10
af_P0AEQ3_22_243_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9234 30 258 3.40.1190.20
3zsfB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9195 30 258 3.40.190.10
af_P0AEU0_25_107_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9158 32 114 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4S0Z178-F1-model_v4 deleted 0.9583 129 253
AF-A0A4S0Z178-F1-model_v4 deleted 0.9437 129 253
AF-A0A1R4HUV9-F1-model_v4 Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2) 0.9297 32 258 GO:0015276
GO:0016020
GO:0030313
AF-A0A7C4N9G4-F1-model_v4 Basic amino acid ABC transporter substrate-binding protein 0.916 57 260 GO:0015276
GO:0016020
GO:0030313
AF-A0A843J618-F1-model_v4 deleted 0.9115 33 257

Feature Viewer

pLDDT pTM Quality
87.59 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map