F482998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 838 | 466 | 805 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300046675|Ga0495657_0131828|Ga0495657_0131828_209_1342 |
| Length | 377 |
| Sequence | MSHAAEAIIEKLPSGTHSRPPVRVTRGTRGGATTLAAGSILVLTAATLPWWAPAEHASSWMRDFVEIACYFVFALMWNLLAGYGGMVSIGQQAYFGLGGYAMLVLANGVGVNPFLAVPLGALVAAAVAVPVSFVAFRLAGGYFAIGTWVIAEVFRLGVANISAVGGGSGTSLTALRGIEKATRETATYGLALACTVTAIMGVYLFLRSKRGLALLAIRDNELAAESQGVDVRGMKLAVYVVAALGAGLAGALYFLGNLRISPDAAFSVNWTAFAIFMVVIGGIGRIEGPLVGALIFWGLNKFLSDYGTWYLLGLGLLAIVVTIFFKQGLWGYAQQRWGWSLFPTQRRLAVHDAAVPKRSMPLKRPTDLELHPHAKHQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 7 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 8 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 9 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 10 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 11 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 12 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 13 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 14 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 15 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 16 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 17 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 18 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 19 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 20 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 21 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 22 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 23 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 24 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 25 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 26 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 27 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 28 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 29 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 30 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 31 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 32 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 33 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 34 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 35 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 39 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 40 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 42 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 57 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 163 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 240 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 242 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 255 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 256 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 257 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 265 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 266 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 267 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 282 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 283 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 284 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 285 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 286 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 287 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 288 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 289 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 290 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 291 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 292 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 293 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 294 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 295 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 296 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 297 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 298 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 299 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 300 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 301 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 302 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 303 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 304 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 305 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 306 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 387 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 388 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 389 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 390 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 391 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 392 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 393 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 394 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 395 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 396 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 397 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 398 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 401 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 422 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 423 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 425 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 426 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 437 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 440 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 441 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 442 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 444 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 446 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 447 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 448 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 449 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 450 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 451 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 453 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 454 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 455 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 457 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 459 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 460 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 461 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 463 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 466 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.94 |
| Metatranscriptomes | 0 |
| Isolates | 4.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.47 |
| Nodule | 0.12 |
| Rhizoplane | 3.34 |
| Rhizosphere | 72.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1003328 | 3300002774 | Bacteria | 3785 |
| 2 | JGI25159J45721_1008361 | 3300002987 | Bacteria | 2849 |
| 3 | JGI25151J46595_10006295 | 3300003187 | Bacteria | 5991 |
| 4 | JGI25153J46596_10007730 | 3300003215 | Bacteria | 5235 |
| 5 | JGI25153J46596_10012350 | 3300003215 | Bacteria | 3695 |
| 6 | rootH1_10003366 | 3300003316 | Bacteria | 5707 |
| 7 | rootH1_10003366 | 3300003323 | Bacteria | 132108 |
| 8 | rootH1_10019448 | 3300003316 | Bacteria | 3684 |
| 9 | rootH1_10035358 | 3300003323 | Bacteria | 3597 |
| 10 | JGI25160J50197_1008753 | 3300003354 | Bacteria | 3829 |
| 11 | JGI25161J50226_1004068 | 3300003374 | Bacteria | 3153 |
| 12 | JGI25404J52841_10002780 | 3300003659 | Bacteria | 3369 |
| 13 | Ga0055535_1001801 | 3300003761 | Bacteria | 9374 |
| 14 | Ga0055542_1000074 | 3300003762 | Bacteria | 141185 |
| 15 | Ga0055536_1005871 | 3300003781 | Bacteria | 5890 |
| 16 | Ga0055536_1006495 | 3300003781 | Bacteria | 5438 |
| 17 | Ga0055534_1002821 | 3300003784 | Bacteria | 5797 |
| 18 | Ga0055534_1004160 | 3300003784 | Bacteria | 4280 |
| 19 | Ga0055528_1013569 | 3300003790 | Bacteria | 3077 |
| 20 | Ga0055530_10000437 | 3300003791 | Bacteria | 37027 |
| 21 | Ga0055530_10011770 | 3300003791 | Bacteria | 3109 |
| 22 | Ga0055540_1001006 | 3300003792 | Bacteria | 18172 |
| 23 | Ga0055540_1005359 | 3300003792 | Bacteria | 5424 |
| 24 | Ga0055531_10007715 | 3300003794 | Bacteria | 5810 |
| 25 | Ga0065707_10097975 | 3300005295 | Bacteria | 3124 |
| 26 | Ga0070658_10022977 | 3300005327 | Bacteria | 5006 |
| 27 | Ga0070676_10045023 | 3300005328 | Bacteria | 2569 |
| 28 | Ga0070676_10060682 | 3300005328 | Bacteria | 2247 |
| 29 | Ga0070683_100225599 | 3300005329 | Bacteria | 1780 |
| 30 | Ga0070677_10012454 | 3300005333 | Bacteria | 2954 |
| 31 | Ga0068869_100010567 | 3300005334 | Bacteria | 6026 |
| 32 | Ga0068869_100094238 | 3300005334 | Bacteria | 2257 |
| 33 | Ga0070666_10004297 | 3300005335 | Bacteria | 8669 |
| 34 | Ga0070666_10050601 | 3300005335 | Bacteria | 2795 |
| 35 | Ga0070680_100004657 | 3300005336 | Bacteria | 10314 |
| 36 | Ga0070680_100063817 | 3300005336 | Bacteria | 3018 |
| 37 | Ga0070680_100284190 | 3300005336 | Bacteria | 1402 |
| 38 | Ga0068868_100017463 | 3300005338 | Bacteria | 5347 |
| 39 | Ga0068868_100048987 | 3300005338 | Bacteria | 3315 |
| 40 | Ga0070689_100037579 | 3300005340 | Bacteria | 3702 |
| 41 | Ga0070689_100078184 | 3300005340 | Bacteria | 2594 |
| 42 | Ga0070687_100002399 | 3300005343 | Bacteria | 6997 |
| 43 | Ga0070687_100142601 | 3300005343 | Bacteria | 1397 |
| 44 | Ga0070661_100131055 | 3300005344 | Bacteria | 1883 |
| 45 | Ga0070692_10032113 | 3300005345 | Bacteria | 2637 |
| 46 | Ga0070692_10054227 | 3300005345 | Bacteria | 2092 |
| 47 | Ga0070669_100002541 | 3300005353 | Bacteria | 13186 |
| 48 | Ga0070669_100011530 | 3300005353 | Bacteria | 6274 |
| 49 | Ga0070675_100004424 | 3300005354 | Bacteria | 10710 |
| 50 | Ga0070675_100007437 | 3300005354 | Bacteria | 8460 |
| 51 | Ga0070675_100037582 | 3300005354 | Bacteria | 3945 |
| 52 | Ga0070675_100049661 | 3300005354 | Bacteria | 3444 |
| 53 | Ga0070675_100137637 | 3300005354 | Bacteria | 2085 |
| 54 | Ga0070671_100005389 | 3300005355 | Bacteria | 10200 |
| 55 | Ga0070671_100058775 | 3300005355 | Bacteria | 3200 |
| 56 | Ga0070671_100109810 | 3300005355 | Bacteria | 2316 |
| 57 | Ga0070674_100031192 | 3300005356 | Bacteria | 3529 |
| 58 | Ga0070673_100003421 | 3300005364 | Bacteria | 9883 |
| 59 | Ga0070688_100075655 | 3300005365 | Bacteria | 2165 |
| 60 | Ga0070659_100107566 | 3300005366 | Bacteria | 2249 |
| 61 | Ga0070667_100005822 | 3300005367 | Bacteria | 10280 |
| 62 | Ga0070667_100012281 | 3300005367 | Bacteria | 7084 |
| 63 | Ga0070667_100045132 | 3300005367 | Bacteria | 3705 |
| 64 | Ga0070667_100072550 | 3300005367 | Bacteria | 2934 |
| 65 | Ga0070667_100365398 | 3300005367 | Bacteria | 1309 |
| 66 | Ga0070710_10085351 | 3300005437 | Bacteria | 1852 |
| 67 | Ga0070701_10001070 | 3300005438 | Bacteria | 10012 |
| 68 | Ga0070694_100036399 | 3300005444 | Bacteria | 3260 |
| 69 | Ga0070663_100311475 | 3300005455 | Bacteria | 1263 |
| 70 | Ga0070678_100004172 | 3300005456 | Bacteria | 8155 |
| 71 | Ga0070678_100009040 | 3300005456 | Bacteria | 6003 |
| 72 | Ga0070678_100031599 | 3300005456 | Bacteria | 3655 |
| 73 | Ga0070678_100033664 | 3300005456 | Bacteria | 3561 |
| 74 | Ga0070662_100015606 | 3300005457 | Bacteria | 5091 |
| 75 | Ga0070662_100320121 | 3300005457 | Bacteria | 1265 |
| 76 | Ga0070681_10008829 | 3300005458 | Bacteria | 9898 |
| 77 | Ga0070681_10154061 | 3300005458 | Bacteria | 2224 |
| 78 | Ga0068867_100000475 | 3300005459 | Bacteria | 26647 |
| 79 | Ga0068867_100032819 | 3300005459 | Bacteria | 3757 |
| 80 | Ga0068867_100042639 | 3300005459 | Bacteria | 3320 |
| 81 | Ga0068867_100072138 | 3300005459 | Bacteria | 2584 |
| 82 | Ga0070706_100003679 | 3300005467 | Bacteria | 15006 |
| 83 | Ga0070707_100267244 | 3300005468 | Bacteria | 1663 |
| 84 | Ga0070699_100082621 | 3300005518 | Bacteria | 2801 |
| 85 | Ga0070679_100123674 | 3300005530 | Bacteria | 2570 |
| 86 | Ga0070684_100071099 | 3300005535 | Bacteria | 3062 |
| 87 | Ga0070697_100088893 | 3300005536 | Bacteria | 2552 |
| 88 | Ga0068853_100436599 | 3300005539 | Bacteria | 1230 |
| 89 | Ga0070672_100043128 | 3300005543 | Bacteria | 3476 |
| 90 | Ga0070672_100256187 | 3300005543 | Bacteria | 1475 |
| 91 | Ga0070686_100000429 | 3300005544 | Bacteria | 26355 |
| 92 | Ga0070695_100033259 | 3300005545 | Bacteria | 3226 |
| 93 | Ga0070695_100157653 | 3300005545 | Bacteria | 1590 |
| 94 | Ga0070695_100324440 | 3300005545 | Bacteria | 1146 |
| 95 | Ga0070696_100061913 | 3300005546 | Bacteria | 2618 |
| 96 | Ga0070693_100011464 | 3300005547 | Bacteria | 4465 |
| 97 | Ga0070665_100546173 | 3300005548 | Bacteria | 1171 |
| 98 | Ga0070704_100030547 | 3300005549 | Bacteria | 3611 |
| 99 | Ga0068855_100065928 | 3300005563 | Bacteria | 4221 |
| 100 | Ga0068855_100101953 | 3300005563 | Bacteria | 3304 |
| 101 | Ga0068854_100026167 | 3300005578 | Bacteria | 4007 |
| 102 | Ga0068854_100285586 | 3300005578 | Bacteria | 1330 |
| 103 | Ga0070702_100005177 | 3300005615 | Bacteria | 6040 |
| 104 | Ga0068852_100022799 | 3300005616 | Bacteria | 5027 |
| 105 | Ga0068852_100053837 | 3300005616 | Bacteria | 3466 |
| 106 | Ga0068852_100063672 | 3300005616 | Bacteria | 3212 |
| 107 | Ga0068852_100559308 | 3300005616 | Bacteria | 1145 |
| 108 | Ga0068859_100009755 | 3300005617 | Bacteria | 9698 |
| 109 | Ga0068859_100024529 | 3300005617 | Bacteria | 6050 |
| 110 | Ga0068859_100040558 | 3300005617 | Bacteria | 4672 |
| 111 | Ga0068859_100120402 | 3300005617 | Bacteria | 2691 |
| 112 | Ga0068859_100146009 | 3300005617 | Bacteria | 2441 |
| 113 | Ga0068866_10001488 | 3300005718 | Bacteria | 9981 |
| 114 | Ga0068866_10003115 | 3300005718 | Bacteria | 6835 |
| 115 | Ga0068861_100005103 | 3300005719 | Bacteria | 8851 |
| 116 | Ga0068861_100024434 | 3300005719 | Bacteria | 4370 |
| 117 | Ga0068861_100031158 | 3300005719 | Bacteria | 3915 |
| 118 | Ga0068861_100291818 | 3300005719 | Bacteria | 1409 |
| 119 | Ga0068870_10156067 | 3300005840 | Bacteria | 1349 |
| 120 | Ga0068863_100019955 | 3300005841 | Bacteria | 6411 |
| 121 | Ga0068858_100002163 | 3300005842 | Bacteria | 19932 |
| 122 | Ga0068858_100021194 | 3300005842 | Bacteria | 6068 |
| 123 | Ga0068858_100024404 | 3300005842 | Bacteria | 5634 |
| 124 | Ga0068860_100003014 | 3300005843 | Bacteria | 17401 |
| 125 | Ga0068860_100005159 | 3300005843 | Bacteria | 13279 |
| 126 | Ga0068860_100017256 | 3300005843 | Bacteria | 7036 |
| 127 | Ga0068860_100079931 | 3300005843 | Bacteria | 3109 |
| 128 | Ga0068862_100012901 | 3300005844 | Bacteria | 6911 |
| 129 | Ga0068862_100013111 | 3300005844 | Bacteria | 6855 |
| 130 | Ga0068862_100014582 | 3300005844 | Bacteria | 6526 |
| 131 | Ga0068862_100386379 | 3300005844 | Bacteria | 1307 |
| 132 | Ga0081455_10000406 | 3300005937 | Bacteria | 56681 |
| 133 | Ga0081455_10114206 | 3300005937 | Bacteria | 2140 |
| 134 | Ga0081540_1000259 | 3300005983 | Bacteria | 55849 |
| 135 | Ga0081540_1081956 | 3300005983 | Bacteria | 1449 |
| 136 | Ga0081539_10048027 | 3300005985 | Bacteria | 2431 |
| 137 | Ga0075365_10046701 | 3300006038 | Bacteria | 2844 |
| 138 | Ga0075365_10197692 | 3300006038 | Bacteria | 1408 |
| 139 | Ga0075363_100016942 | 3300006048 | Bacteria | 3606 |
| 140 | Ga0075363_100018735 | 3300006048 | Bacteria | 3453 |
| 141 | Ga0075364_10009276 | 3300006051 | Bacteria | 5898 |
| 142 | Ga0075432_10003126 | 3300006058 | Bacteria | 5595 |
| 143 | Ga0075362_10037676 | 3300006177 | Bacteria | 2121 |
| 144 | Ga0075362_10042488 | 3300006177 | Bacteria | 2009 |
| 145 | Ga0075367_10005035 | 3300006178 | Bacteria | 6514 |
| 146 | Ga0075367_10160145 | 3300006178 | Bacteria | 1399 |
| 147 | Ga0075369_10039226 | 3300006186 | Bacteria | 2022 |
| 148 | Ga0075366_10015796 | 3300006195 | Bacteria | 4334 |
| 149 | Ga0075366_10027351 | 3300006195 | Bacteria | 3345 |
| 150 | Ga0075366_10040728 | 3300006195 | Bacteria | 2748 |
| 151 | Ga0075366_10042759 | 3300006195 | Bacteria | 2683 |
| 152 | Ga0075366_10209430 | 3300006195 | Bacteria | 1186 |
| 153 | Ga0097621_100001895 | 3300006237 | Bacteria | 14283 |
| 154 | Ga0097621_100008539 | 3300006237 | Bacteria | 7378 |
| 155 | Ga0097621_100219624 | 3300006237 | Bacteria | 1656 |
| 156 | Ga0075370_10000115 | 3300006353 | Bacteria | 26175 |
| 157 | Ga0075370_10001048 | 3300006353 | Bacteria | 11491 |
| 158 | Ga0075370_10004601 | 3300006353 | Bacteria | 6729 |
| 159 | Ga0075370_10011522 | 3300006353 | Bacteria | 4650 |
| 160 | Ga0075370_10037674 | 3300006353 | Bacteria | 2719 |
| 161 | Ga0075370_10058620 | 3300006353 | Bacteria | 2190 |
| 162 | Ga0075370_10077604 | 3300006353 | Bacteria | 1906 |
| 163 | Ga0068871_100002438 | 3300006358 | Bacteria | 12709 |
| 164 | Ga0068871_100015705 | 3300006358 | Bacteria | 5679 |
| 165 | Ga0075428_100141555 | 3300006844 | Bacteria | 2615 |
| 166 | Ga0075430_100000011 | 3300006846 | Bacteria | 99671 |
| 167 | Ga0075430_100007190 | 3300006846 | Bacteria | 9391 |
| 168 | Ga0075430_100185071 | 3300006846 | Bacteria | 1732 |
| 169 | Ga0075431_100001116 | 3300006847 | Bacteria | 24069 |
| 170 | Ga0075431_100011272 | 3300006847 | Bacteria | 9005 |
| 171 | Ga0075429_100185676 | 3300006880 | Bacteria | 1822 |
| 172 | Ga0068865_100003857 | 3300006881 | Bacteria | 8991 |
| 173 | Ga0068865_100008332 | 3300006881 | Bacteria | 6405 |
| 174 | Ga0068865_100013192 | 3300006881 | Bacteria | 5218 |
| 175 | Ga0068865_100133254 | 3300006881 | Bacteria | 1864 |
| 176 | Ga0075436_100016182 | 3300006914 | Bacteria | 5106 |
| 177 | Ga0097620_100009754 | 3300006931 | Bacteria | 9698 |
| 178 | Ga0097620_100024529 | 3300006931 | Bacteria | 6050 |
| 179 | Ga0097620_100040559 | 3300006931 | Bacteria | 4672 |
| 180 | Ga0097620_100120402 | 3300006931 | Bacteria | 2691 |
| 181 | Ga0097620_100146007 | 3300006931 | Bacteria | 2441 |
| 182 | Ga0075435_100010188 | 3300007076 | Bacteria | 6867 |
| 183 | Ga0105251_10031795 | 3300009011 | Bacteria | 2637 |
| 184 | Ga0105244_10010903 | 3300009036 | Bacteria | 5481 |
| 185 | Ga0105250_10029687 | 3300009092 | Bacteria | 2200 |
| 186 | Ga0105240_10004504 | 3300009093 | Bacteria | 21177 |
| 187 | Ga0105240_10069514 | 3300009093 | Bacteria | 4358 |
| 188 | Ga0111539_10020595 | 3300009094 | Bacteria | 8122 |
| 189 | Ga0105245_10006822 | 3300009098 | Bacteria | 10021 |
| 190 | Ga0105245_10323620 | 3300009098 | Bacteria | 1520 |
| 191 | Ga0114129_10002200 | 3300009147 | Bacteria | 26859 |
| 192 | Ga0114129_10037178 | 3300009147 | Bacteria | 6874 |
| 193 | Ga0105243_10000437 | 3300009148 | Bacteria | 43696 |
| 194 | Ga0105243_10015432 | 3300009148 | Bacteria | 5772 |
| 195 | Ga0105243_10137454 | 3300009148 | Bacteria | 2081 |
| 196 | Ga0105243_10442623 | 3300009148 | Bacteria | 1217 |
| 197 | Ga0105242_10021786 | 3300009176 | Bacteria | 5035 |
| 198 | Ga0105242_10091387 | 3300009176 | Bacteria | 2562 |
| 199 | Ga0105248_10002934 | 3300009177 | Bacteria | 18928 |
| 200 | Ga0105248_10085241 | 3300009177 | Bacteria | 3555 |
| 201 | Ga0105237_10001223 | 3300009545 | Bacteria | 34228 |
| 202 | Ga0105237_10036421 | 3300009545 | Bacteria | 4979 |
| 203 | Ga0105238_10000294 | 3300009551 | Bacteria | 55283 |
| 204 | Ga0105238_10003525 | 3300009551 | Bacteria | 15594 |
| 205 | Ga0105238_10073364 | 3300009551 | Bacteria | 3417 |
| 206 | Ga0105249_10015311 | 3300009553 | Bacteria | 6788 |
| 207 | Ga0105249_10053764 | 3300009553 | Bacteria | 3681 |
| 208 | Ga0105249_10085915 | 3300009553 | Bacteria | 2933 |
| 209 | Ga0105249_10110555 | 3300009553 | Bacteria | 2597 |
| 210 | Ga0105239_10001564 | 3300010375 | Bacteria | 30239 |
| 211 | Ga0105239_10002071 | 3300010375 | Bacteria | 25990 |
| 212 | Ga0105239_10031083 | 3300010375 | Bacteria | 5874 |
| 213 | Ga0105239_10243272 | 3300010375 | Bacteria | 2020 |
| 214 | Ga0105246_10036001 | 3300011119 | Bacteria | 3313 |
| 215 | Ga0105246_10101522 | 3300011119 | Bacteria | 2096 |
| 216 | Ga0157373_10060310 | 3300013100 | Bacteria | 2688 |
| 217 | Ga0157371_10116193 | 3300013102 | Bacteria | 1901 |
| 218 | Ga0157370_10011653 | 3300013104 | Bacteria | 9180 |
| 219 | Ga0157370_10097136 | 3300013104 | Bacteria | 2763 |
| 220 | Ga0157369_10097806 | 3300013105 | Bacteria | 3130 |
| 221 | Ga0157374_10263462 | 3300013296 | Bacteria | 1698 |
| 222 | Ga0157378_10004967 | 3300013297 | Bacteria | 11663 |
| 223 | Ga0157378_10047851 | 3300013297 | Bacteria | 3802 |
| 224 | Ga0163162_10000884 | 3300013306 | Bacteria | 27877 |
| 225 | Ga0163162_10010549 | 3300013306 | Bacteria | 8986 |
| 226 | Ga0163162_10014828 | 3300013306 | Bacteria | 7611 |
| 227 | Ga0163162_10033293 | 3300013306 | Bacteria | 5120 |
| 228 | Ga0163162_10132892 | 3300013306 | Bacteria | 2598 |
| 229 | Ga0163162_10154108 | 3300013306 | Bacteria | 2417 |
| 230 | Ga0163162_10215572 | 3300013306 | Bacteria | 2050 |
| 231 | Ga0163162_10307820 | 3300013306 | Bacteria | 1717 |
| 232 | Ga0163162_10626949 | 3300013306 | Bacteria | 1200 |
| 233 | Ga0157372_10062009 | 3300013307 | Bacteria | 4188 |
| 234 | Ga0157375_10012157 | 3300013308 | Bacteria | 7629 |
| 235 | Ga0157375_10014933 | 3300013308 | Bacteria | 6943 |
| 236 | Ga0157375_10235579 | 3300013308 | Bacteria | 1990 |
| 237 | Ga0163163_10005043 | 3300014325 | Bacteria | 11381 |
| 238 | Ga0163163_10047540 | 3300014325 | Bacteria | 4218 |
| 239 | Ga0157380_10000886 | 3300014326 | Bacteria | 18809 |
| 240 | Ga0157380_10377499 | 3300014326 | Bacteria | 1337 |
| 241 | Ga0182008_10002819 | 3300014497 | Bacteria | 10747 |
| 242 | Ga0182008_10083636 | 3300014497 | Bacteria | 1571 |
| 243 | Ga0157379_10018782 | 3300014968 | Bacteria | 6096 |
| 244 | Ga0157379_10023709 | 3300014968 | Bacteria | 5448 |
| 245 | Ga0157379_10041041 | 3300014968 | Bacteria | 4130 |
| 246 | Ga0157376_10023962 | 3300014969 | Bacteria | 4787 |
| 247 | Ga0182006_1007490 | 3300015261 | Bacteria | 4993 |
| 248 | Ga0182006_1035995 | 3300015261 | Bacteria | 1970 |
| 249 | Ga0182006_1081093 | 3300015261 | Bacteria | 1183 |
| 250 | Ga0182007_10002612 | 3300015262 | Bacteria | 8871 |
| 251 | Ga0182007_10004855 | 3300015262 | Bacteria | 6009 |
| 252 | Ga0182007_10005077 | 3300015262 | Bacteria | 5845 |
| 253 | Ga0182005_1033824 | 3300015265 | Bacteria | 1390 |
| 254 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 255 | Ga0163161_10003368 | 3300017792 | Bacteria | 11212 |
| 256 | Ga0163161_10019895 | 3300017792 | Bacteria | 4708 |
| 257 | Ga0163161_10110701 | 3300017792 | Bacteria | 2053 |
| 258 | Ga0163161_10151909 | 3300017792 | Bacteria | 1760 |
| 259 | Ga0213872_10077172 | 3300021361 | Bacteria | 1498 |
| 260 | Ga0209672_101000 | 3300025228 | Bacteria | 12370 |
| 261 | Ga0209147_100591 | 3300025229 | Bacteria | 20040 |
| 262 | Ga0209258_100176 | 3300025242 | Bacteria | 141261 |
| 263 | Ga0207425_1000133 | 3300025245 | Bacteria | 67802 |
| 264 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 265 | Ga0209129_1000186 | 3300025258 | Bacteria | 85793 |
| 266 | Ga0209565_1000190 | 3300025263 | Bacteria | 75207 |
| 267 | Ga0209673_1000209 | 3300025273 | Bacteria | 117670 |
| 268 | Ga0209673_1000393 | 3300025273 | Bacteria | 78531 |
| 269 | Ga0209130_1000433 | 3300025284 | Bacteria | 44915 |
| 270 | Ga0209130_1001281 | 3300025284 | Bacteria | 17402 |
| 271 | Ga0209130_1003401 | 3300025284 | Bacteria | 6802 |
| 272 | Ga0209675_1000300 | 3300025291 | Bacteria | 45407 |
| 273 | Ga0209675_1004306 | 3300025291 | Bacteria | 6387 |
| 274 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 275 | Ga0209676_1000433 | 3300025292 | Bacteria | 72480 |
| 276 | Ga0209676_1000937 | 3300025292 | Bacteria | 35920 |
| 277 | Ga0209676_1008814 | 3300025292 | Bacteria | 4440 |
| 278 | Ga0209025_1000324 | 3300025294 | Bacteria | 106257 |
| 279 | Ga0209025_1000947 | 3300025294 | Bacteria | 44024 |
| 280 | Ga0209025_1001026 | 3300025294 | Bacteria | 41040 |
| 281 | Ga0209025_1026811 | 3300025294 | Bacteria | 2878 |
| 282 | Ga0209564_1000417 | 3300025295 | Bacteria | 74808 |
| 283 | Ga0209564_1000423 | 3300025295 | Bacteria | 74528 |
| 284 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 285 | Ga0209758_1000302 | 3300025297 | Bacteria | 96619 |
| 286 | Ga0209758_1040992 | 3300025297 | Bacteria | 1738 |
| 287 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 288 | Ga0209050_1000912 | 3300025298 | Bacteria | 39073 |
| 289 | Ga0209050_1007525 | 3300025298 | Bacteria | 6076 |
| 290 | Ga0209050_1014765 | 3300025298 | Bacteria | 3336 |
| 291 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 292 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 293 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 294 | Ga0207426_1000161 | 3300025302 | Bacteria | 172765 |
| 295 | Ga0209051_1000207 | 3300025303 | Bacteria | 103683 |
| 296 | Ga0209051_1000813 | 3300025303 | Bacteria | 32442 |
| 297 | Ga0209051_1005757 | 3300025303 | Bacteria | 7150 |
| 298 | Ga0209051_1028852 | 3300025303 | Bacteria | 2183 |
| 299 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 300 | Ga0209257_1000249 | 3300025304 | Bacteria | 124522 |
| 301 | Ga0209257_1019042 | 3300025304 | Bacteria | 2605 |
| 302 | Ga0207655_1008233 | 3300025728 | Bacteria | 6644 |
| 303 | Ga0207682_10014967 | 3300025893 | Bacteria | 3021 |
| 304 | Ga0207642_10012683 | 3300025899 | Bacteria | 3051 |
| 305 | Ga0207642_10020102 | 3300025899 | Bacteria | 2600 |
| 306 | Ga0207642_10209556 | 3300025899 | Bacteria | 1082 |
| 307 | Ga0207680_10004267 | 3300025903 | Bacteria | 6774 |
| 308 | Ga0207699_10161523 | 3300025906 | Bacteria | 1491 |
| 309 | Ga0207645_10000882 | 3300025907 | Bacteria | 24904 |
| 310 | Ga0207645_10005563 | 3300025907 | Bacteria | 9123 |
| 311 | Ga0207645_10010476 | 3300025907 | Bacteria | 6364 |
| 312 | Ga0207643_10015529 | 3300025908 | Bacteria | 4145 |
| 313 | Ga0207705_10110408 | 3300025909 | Bacteria | 2031 |
| 314 | Ga0207707_10081739 | 3300025912 | Bacteria | 2820 |
| 315 | Ga0207707_10159721 | 3300025912 | Bacteria | 1971 |
| 316 | Ga0207695_10005377 | 3300025913 | Bacteria | 17023 |
| 317 | Ga0207695_10017312 | 3300025913 | Bacteria | 8390 |
| 318 | Ga0207695_10103905 | 3300025913 | Bacteria | 2832 |
| 319 | Ga0207671_10100648 | 3300025914 | Bacteria | 2189 |
| 320 | Ga0207671_10109566 | 3300025914 | Bacteria | 2100 |
| 321 | Ga0207671_10169317 | 3300025914 | Bacteria | 1696 |
| 322 | Ga0207660_10026584 | 3300025917 | Bacteria | 3942 |
| 323 | Ga0207660_10082919 | 3300025917 | Bacteria | 2359 |
| 324 | Ga0207662_10015308 | 3300025918 | Bacteria | 4316 |
| 325 | Ga0207662_10051643 | 3300025918 | Bacteria | 2446 |
| 326 | Ga0207657_10149032 | 3300025919 | Bacteria | 1907 |
| 327 | Ga0207652_10489255 | 3300025921 | Bacteria | 1108 |
| 328 | Ga0207646_10223926 | 3300025922 | Bacteria | 1699 |
| 329 | Ga0207681_10005854 | 3300025923 | Bacteria | 7536 |
| 330 | Ga0207681_10009809 | 3300025923 | Bacteria | 5856 |
| 331 | Ga0207694_10000920 | 3300025924 | Bacteria | 26083 |
| 332 | Ga0207694_10058823 | 3300025924 | Bacteria | 2989 |
| 333 | Ga0207650_10310611 | 3300025925 | Bacteria | 1289 |
| 334 | Ga0207659_10000751 | 3300025926 | Bacteria | 19207 |
| 335 | Ga0207659_10007262 | 3300025926 | Bacteria | 6806 |
| 336 | Ga0207687_10205662 | 3300025927 | Bacteria | 1541 |
| 337 | Ga0207644_10017644 | 3300025931 | Bacteria | 4825 |
| 338 | Ga0207644_10068093 | 3300025931 | Bacteria | 2596 |
| 339 | Ga0207644_10184009 | 3300025931 | Bacteria | 1639 |
| 340 | Ga0207690_10081960 | 3300025932 | Bacteria | 2256 |
| 341 | Ga0207706_10010371 | 3300025933 | Bacteria | 8510 |
| 342 | Ga0207706_10182167 | 3300025933 | Bacteria | 1845 |
| 343 | Ga0207686_10016638 | 3300025934 | Bacteria | 4128 |
| 344 | Ga0207709_10000571 | 3300025935 | Bacteria | 31043 |
| 345 | Ga0207709_10001937 | 3300025935 | Bacteria | 13608 |
| 346 | Ga0207709_10093078 | 3300025935 | Bacteria | 1975 |
| 347 | Ga0207670_10001410 | 3300025936 | Bacteria | 12623 |
| 348 | Ga0207670_10172299 | 3300025936 | Bacteria | 1624 |
| 349 | Ga0207669_10001860 | 3300025937 | Bacteria | 8951 |
| 350 | Ga0207669_10064754 | 3300025937 | Bacteria | 2264 |
| 351 | Ga0207704_10004612 | 3300025938 | Bacteria | 6318 |
| 352 | Ga0207704_10008403 | 3300025938 | Bacteria | 4935 |
| 353 | Ga0207704_10025720 | 3300025938 | Bacteria | 3217 |
| 354 | Ga0207691_10009795 | 3300025940 | Bacteria | 9200 |
| 355 | Ga0207691_10011487 | 3300025940 | Bacteria | 8499 |
| 356 | Ga0207691_10077839 | 3300025940 | Bacteria | 2986 |
| 357 | Ga0207711_10220860 | 3300025941 | Bacteria | 1733 |
| 358 | Ga0207689_10002269 | 3300025942 | Bacteria | 18022 |
| 359 | Ga0207689_10007463 | 3300025942 | Bacteria | 9586 |
| 360 | Ga0207689_10058298 | 3300025942 | Bacteria | 3176 |
| 361 | Ga0207689_10110595 | 3300025942 | Bacteria | 2258 |
| 362 | Ga0207661_10264895 | 3300025944 | Bacteria | 1532 |
| 363 | Ga0207667_10217770 | 3300025949 | Bacteria | 1956 |
| 364 | Ga0207667_10262410 | 3300025949 | Bacteria | 1766 |
| 365 | Ga0207651_10057741 | 3300025960 | Bacteria | 2678 |
| 366 | Ga0207651_10135542 | 3300025960 | Bacteria | 1893 |
| 367 | Ga0207651_10249464 | 3300025960 | Bacteria | 1451 |
| 368 | Ga0207712_10028698 | 3300025961 | Bacteria | 3724 |
| 369 | Ga0207668_10025649 | 3300025972 | Bacteria | 3817 |
| 370 | Ga0207668_10271355 | 3300025972 | Bacteria | 1387 |
| 371 | Ga0207640_10134607 | 3300025981 | Bacteria | 1792 |
| 372 | Ga0207658_10030132 | 3300025986 | Bacteria | 3839 |
| 373 | Ga0207658_10036789 | 3300025986 | Bacteria | 3512 |
| 374 | Ga0207658_10320579 | 3300025986 | Bacteria | 1341 |
| 375 | Ga0207677_10006613 | 3300026023 | Bacteria | 6359 |
| 376 | Ga0207677_10013065 | 3300026023 | Bacteria | 4798 |
| 377 | Ga0207703_10005464 | 3300026035 | Bacteria | 10219 |
| 378 | Ga0207639_10161576 | 3300026041 | Bacteria | 1888 |
| 379 | Ga0207678_10045341 | 3300026067 | Bacteria | 3802 |
| 380 | Ga0207678_10076256 | 3300026067 | Bacteria | 2872 |
| 381 | Ga0207678_10173601 | 3300026067 | Bacteria | 1840 |
| 382 | Ga0207708_10000875 | 3300026075 | Bacteria | 22680 |
| 383 | Ga0207708_10009916 | 3300026075 | Bacteria | 7072 |
| 384 | Ga0207641_10003968 | 3300026088 | Bacteria | 12923 |
| 385 | Ga0207648_10004621 | 3300026089 | Bacteria | 14105 |
| 386 | Ga0207648_10011939 | 3300026089 | Bacteria | 8154 |
| 387 | Ga0207648_10015693 | 3300026089 | Bacteria | 6951 |
| 388 | Ga0207648_10056300 | 3300026089 | Bacteria | 3432 |
| 389 | Ga0207676_10000082 | 3300026095 | Bacteria | 92500 |
| 390 | Ga0207676_10463357 | 3300026095 | Bacteria | 1197 |
| 391 | Ga0207674_10012581 | 3300026116 | Bacteria | 9456 |
| 392 | Ga0207675_100000138 | 3300026118 | Bacteria | 62372 |
| 393 | Ga0207675_100003260 | 3300026118 | Bacteria | 15894 |
| 394 | Ga0207675_100010824 | 3300026118 | Bacteria | 8546 |
| 395 | Ga0207675_100321612 | 3300026118 | Bacteria | 1510 |
| 396 | Ga0207675_100349877 | 3300026118 | Bacteria | 1448 |
| 397 | Ga0207683_10004159 | 3300026121 | Bacteria | 12528 |
| 398 | Ga0207683_10012408 | 3300026121 | Bacteria | 7271 |
| 399 | Ga0207683_10039123 | 3300026121 | Bacteria | 4137 |
| 400 | Ga0207683_10155180 | 3300026121 | Bacteria | 2067 |
| 401 | Ga0207698_10083895 | 3300026142 | Bacteria | 2581 |
| 402 | Ga0207698_10092796 | 3300026142 | Bacteria | 2476 |
| 403 | Ga0207698_10109804 | 3300026142 | Bacteria | 2309 |
| 404 | Ga0207428_10119803 | 3300027907 | Bacteria | 2019 |
| 405 | Ga0268266_10313305 | 3300028379 | Bacteria | 1467 |
| 406 | Ga0268265_10013132 | 3300028380 | Bacteria | 5626 |
| 407 | Ga0268265_10029770 | 3300028380 | Bacteria | 3925 |
| 408 | Ga0268265_10107598 | 3300028380 | Bacteria | 2268 |
| 409 | Ga0268265_10142511 | 3300028380 | Bacteria | 2008 |
| 410 | Ga0268265_10223766 | 3300028380 | Bacteria | 1648 |
| 411 | Ga0268264_10002750 | 3300028381 | Bacteria | 15365 |
| 412 | Ga0268264_10014308 | 3300028381 | Bacteria | 6524 |
| 413 | Ga0268264_10018708 | 3300028381 | Bacteria | 5664 |
| 414 | Ga0268264_10196170 | 3300028381 | Bacteria | 1843 |
| 415 | Ga0265318_10000365 | 3300028577 | Bacteria | 35710 |
| 416 | Ga0265336_10006700 | 3300028666 | Bacteria | 4131 |
| 417 | Ga0307515_10000672 | 3300028794 | Bacteria | 78835 |
| 418 | Ga0307515_10011668 | 3300028794 | Bacteria | 16643 |
| 419 | Ga0307515_10011772 | 3300028794 | Bacteria | 16555 |
| 420 | Ga0307515_10133373 | 3300028794 | Bacteria | 2718 |
| 421 | Ga0307515_10210250 | 3300028794 | Bacteria | 1792 |
| 422 | Ga0265338_10011296 | 3300028800 | Bacteria | 10334 |
| 423 | Ga0265338_10168694 | 3300028800 | Bacteria | 1681 |
| 424 | Ga0307512_10117876 | 3300030522 | Bacteria | 1719 |
| 425 | Ga0265330_10018646 | 3300031235 | Bacteria | 3185 |
| 426 | Ga0265332_10001198 | 3300031238 | Bacteria | 15028 |
| 427 | Ga0265328_10001746 | 3300031239 | Bacteria | 9943 |
| 428 | Ga0265328_10004323 | 3300031239 | Bacteria | 6175 |
| 429 | Ga0265320_10002741 | 3300031240 | Bacteria | 12184 |
| 430 | Ga0265320_10033662 | 3300031240 | Bacteria | 2613 |
| 431 | Ga0265329_10002241 | 3300031242 | Bacteria | 8909 |
| 432 | Ga0265329_10012809 | 3300031242 | Bacteria | 3006 |
| 433 | Ga0265339_10006993 | 3300031249 | Bacteria | 7334 |
| 434 | Ga0265339_10007126 | 3300031249 | Bacteria | 7259 |
| 435 | Ga0265327_10008996 | 3300031251 | Bacteria | 7312 |
| 436 | Ga0265316_10003245 | 3300031344 | Bacteria | 16520 |
| 437 | Ga0265316_10051868 | 3300031344 | Bacteria | 3221 |
| 438 | Ga0307513_10017350 | 3300031456 | Bacteria | 8633 |
| 439 | Ga0307513_10035367 | 3300031456 | Bacteria | 5589 |
| 440 | Ga0307513_10255963 | 3300031456 | Bacteria | 1544 |
| 441 | Ga0307509_10001630 | 3300031507 | Bacteria | 37623 |
| 442 | Ga0307509_10142221 | 3300031507 | Bacteria | 2332 |
| 443 | Ga0307408_100018996 | 3300031548 | Bacteria | 4622 |
| 444 | Ga0265313_10016983 | 3300031595 | Bacteria | 4160 |
| 445 | Ga0307508_10003341 | 3300031616 | Bacteria | 16294 |
| 446 | Ga0307508_10004594 | 3300031616 | Bacteria | 13432 |
| 447 | Ga0307508_10042418 | 3300031616 | Bacteria | 4081 |
| 448 | Ga0307508_10159910 | 3300031616 | Bacteria | 1856 |
| 449 | Ga0307514_10001174 | 3300031649 | Bacteria | 35389 |
| 450 | Ga0307514_10011999 | 3300031649 | Bacteria | 7211 |
| 451 | Ga0316575_10007066 | 3300031665 | Bacteria | 4061 |
| 452 | Ga0265314_10010702 | 3300031711 | Bacteria | 7633 |
| 453 | Ga0265314_10011751 | 3300031711 | Bacteria | 7201 |
| 454 | Ga0265314_10012805 | 3300031711 | Bacteria | 6815 |
| 455 | Ga0265314_10049078 | 3300031711 | Bacteria | 2958 |
| 456 | Ga0265314_10117616 | 3300031711 | Bacteria | 1679 |
| 457 | Ga0265342_10000093 | 3300031712 | Bacteria | 98424 |
| 458 | Ga0265342_10000914 | 3300031712 | Bacteria | 29315 |
| 459 | Ga0265342_10004065 | 3300031712 | Bacteria | 11667 |
| 460 | Ga0265342_10010019 | 3300031712 | Bacteria | 6617 |
| 461 | Ga0307516_10000237 | 3300031730 | Bacteria | 70929 |
| 462 | Ga0307516_10080696 | 3300031730 | Bacteria | 3097 |
| 463 | Ga0307516_10199404 | 3300031730 | Bacteria | 1722 |
| 464 | Ga0307405_10004235 | 3300031731 | Bacteria | 6750 |
| 465 | Ga0307405_10240543 | 3300031731 | Bacteria | 1340 |
| 466 | Ga0307412_10205249 | 3300031911 | Bacteria | 1499 |
| 467 | Ga0307409_100095209 | 3300031995 | Bacteria | 2453 |
| 468 | Ga0307416_100147849 | 3300032002 | Bacteria | 2149 |
| 469 | Ga0307416_100301375 | 3300032002 | Bacteria | 1593 |
| 470 | Ga0307411_10063674 | 3300032005 | Bacteria | 2465 |
| 471 | Ga0307411_10088323 | 3300032005 | Bacteria | 2156 |
| 472 | Ga0316583_10037014 | 3300032133 | Bacteria | 1729 |
| 473 | Ga0307507_10065050 | 3300033179 | Bacteria | 3358 |
| 474 | Ga0373930_0017659 | 3300034816 | Bacteria | 1363 |
| 475 | Ga0373958_0018784 | 3300034819 | Bacteria | 1257 |
| 476 | Ga0373941_0061248 | 3300035115 | Bacteria | 1225 |
| 477 | Ga0373941_0065509 | 3300035115 | Bacteria | 1193 |
| 478 | Ga0373956_0012298 | 3300035119 | Bacteria | 3546 |
| 479 | Ga0373946_0039065 | 3300035171 | Bacteria | 1936 |
| 480 | Ga0373955_0078270 | 3300035172 | Bacteria | 1863 |
| 481 | Ga0373955_0166743 | 3300035172 | Bacteria | 1302 |
| 482 | Ga0373942_0093131 | 3300035207 | Bacteria | 911 |
| 483 | Ga0373961_0026240 | 3300035241 | Bacteria | 1591 |
| 484 | Ga0373931_0003357 | 3300035691 | Bacteria | 7174 |
| 485 | Ga0373931_0008665 | 3300035691 | Bacteria | 4835 |
| 486 | Ga0373927_0044393 | 3300035695 | Unclassified | 2876 |
| 487 | Ga0373937_0031176 | 3300036401 | Bacteria | 4829 |
| 488 | Ga0373925_0017392 | 3300037068 | Bacteria | 5211 |
| 489 | Ga0395905_0009460 | 3300037471 | Bacteria | 9520 |
| 490 | Ga0395905_0011143 | 3300037471 | Bacteria | 8695 |
| 491 | Ga0395905_0105098 | 3300037471 | Bacteria | 2651 |
| 492 | Ga0436365_1193388 | 3300039437 | Bacteria | 1672 |
| 493 | Ga0439436_0006520 | 3300041404 | Bacteria | 3582 |
| 494 | Ga0439438_014435 | 3300041405 | Bacteria | 2351 |
| 495 | Ga0439439_0002593 | 3300041406 | Bacteria | 3865 |
| 496 | Ga0439461_0008949 | 3300041410 | Bacteria | 1806 |
| 497 | Ga0439466_0010788 | 3300041411 | Bacteria | 3392 |
| 498 | Ga0439466_0012675 | 3300041411 | Bacteria | 3099 |
| 499 | Ga0439465_0000527 | 3300041413 | Bacteria | 11451 |
| 500 | Ga0439431_0003203 | 3300041997 | Bacteria | 3597 |
| 501 | Ga0439431_0037935 | 3300041997 | Bacteria | 1218 |
| 502 | Ga0439433_0000015 | 3300041999 | Bacteria | 22784 |
| 503 | Ga0439437_003192 | 3300042000 | Bacteria | 1766 |
| 504 | Ga0439442_003355 | 3300042002 | Bacteria | 3165 |
| 505 | Ga0439432_004409 | 3300042006 | Bacteria | 5140 |
| 506 | Ga0439449_0000342 | 3300042007 | Bacteria | 16936 |
| 507 | Ga0439449_0048146 | 3300042007 | Bacteria | 1578 |
| 508 | Ga0439452_000945 | 3300042010 | Bacteria | 13044 |
| 509 | Ga0439457_001906 | 3300042014 | Bacteria | 6144 |
| 510 | Ga0439462_0002282 | 3300042015 | Bacteria | 4433 |
| 511 | Ga0439462_0005165 | 3300042015 | Bacteria | 3208 |
| 512 | Ga0450911_000225 | 3300042115 | Bacteria | 21810 |
| 513 | Ga0450923_009722 | 3300042125 | Bacteria | 1690 |
| 514 | Ga0450898_009755 | 3300042134 | Bacteria | 1541 |
| 515 | Ga0450903_015996 | 3300042138 | Bacteria | 1179 |
| 516 | Ga0439446_0004705 | 3300042156 | Bacteria | 3468 |
| 517 | Ga0439446_0048025 | 3300042156 | Bacteria | 1270 |
| 518 | Ga0439458_0023601 | 3300042157 | Bacteria | 1435 |
| 519 | Ga0439434_0000280 | 3300042435 | Bacteria | 14555 |
| 520 | Ga0439434_0008961 | 3300042435 | Bacteria | 2941 |
| 521 | Ga0439464_0020129 | 3300042439 | Bacteria | 1826 |
| 522 | Ga0450893_0002631 | 3300042532 | Bacteria | 2809 |
| 523 | Ga0439440_0013446 | 3300042993 | Bacteria | 1756 |
| 524 | Ga0495627_025961 | 3300046453 | Bacteria | 1894 |
| 525 | Ga0495592_0000211 | 3300046454 | Bacteria | 49780 |
| 526 | Ga0495592_0072949 | 3300046454 | Bacteria | 2497 |
| 527 | Ga0495603_0016366 | 3300046455 | Bacteria | 4486 |
| 528 | Ga0495603_0040452 | 3300046455 | Bacteria | 2790 |
| 529 | Ga0495629_0000030 | 3300046459 | Bacteria | 125026 |
| 530 | Ga0495629_0002103 | 3300046459 | Bacteria | 15450 |
| 531 | Ga0495629_0005426 | 3300046459 | Bacteria | 9506 |
| 532 | Ga0495629_0116832 | 3300046459 | Bacteria | 1859 |
| 533 | Ga0495638_0002673 | 3300046460 | Bacteria | 14362 |
| 534 | Ga0495638_0015434 | 3300046460 | Bacteria | 5127 |
| 535 | Ga0495638_0025325 | 3300046460 | Bacteria | 3858 |
| 536 | Ga0495638_0175840 | 3300046460 | Unclassified | 1225 |
| 537 | Ga0495651_0151235 | 3300046462 | Bacteria | 1673 |
| 538 | Ga0495653_0000372 | 3300046463 | Bacteria | 36242 |
| 539 | Ga0495650_0008754 | 3300046471 | Bacteria | 5856 |
| 540 | Ga0495580_0009549 | 3300046472 | Bacteria | 7621 |
| 541 | Ga0495580_0042349 | 3300046472 | Bacteria | 3245 |
| 542 | Ga0495580_0092928 | 3300046472 | Bacteria | 2100 |
| 543 | Ga0495605_0002291 | 3300046474 | Bacteria | 11955 |
| 544 | Ga0495605_0080094 | 3300046474 | Bacteria | 1529 |
| 545 | Ga0495639_0006956 | 3300046475 | Bacteria | 4859 |
| 546 | Ga0495639_0008332 | 3300046475 | Bacteria | 4447 |
| 547 | Ga0495664_0127802 | 3300046477 | Bacteria | 1538 |
| 548 | Ga0495585_0000447 | 3300046492 | Bacteria | 39452 |
| 549 | Ga0495596_0017924 | 3300046500 | Bacteria | 2924 |
| 550 | Ga0495607_0000359 | 3300046501 | Bacteria | 47053 |
| 551 | Ga0495583_0000563 | 3300046506 | Bacteria | 51367 |
| 552 | Ga0495583_0007257 | 3300046506 | Bacteria | 7013 |
| 553 | Ga0495583_0033872 | 3300046506 | Bacteria | 2453 |
| 554 | Ga0495606_0002420 | 3300046507 | Bacteria | 21749 |
| 555 | Ga0495606_0058402 | 3300046507 | Bacteria | 2479 |
| 556 | Ga0495610_0020599 | 3300046512 | Bacteria | 3658 |
| 557 | Ga0495620_0009269 | 3300046515 | Bacteria | 5241 |
| 558 | Ga0495628_0078065 | 3300046516 | Bacteria | 2575 |
| 559 | Ga0495630_0006214 | 3300046517 | Bacteria | 8475 |
| 560 | Ga0495630_0046692 | 3300046517 | Bacteria | 3238 |
| 561 | Ga0495631_0000176 | 3300046518 | Bacteria | 43388 |
| 562 | Ga0495632_0026765 | 3300046519 | Bacteria | 3030 |
| 563 | Ga0495637_0012678 | 3300046520 | Bacteria | 4025 |
| 564 | Ga0495643_0011054 | 3300046522 | Bacteria | 5519 |
| 565 | Ga0495643_0045150 | 3300046522 | Bacteria | 2393 |
| 566 | Ga0495644_0012388 | 3300046523 | Bacteria | 3280 |
| 567 | Ga0495648_0012184 | 3300046524 | Bacteria | 6428 |
| 568 | Ga0495648_0029155 | 3300046524 | Bacteria | 3666 |
| 569 | Ga0495666_0131394 | 3300046526 | Bacteria | 1170 |
| 570 | Ga0495642_0003905 | 3300046528 | Bacteria | 5836 |
| 571 | Ga0495642_0016956 | 3300046528 | Bacteria | 2843 |
| 572 | Ga0495642_0062007 | 3300046528 | Bacteria | 1552 |
| 573 | Ga0495642_0067382 | 3300046528 | Bacteria | 1493 |
| 574 | Ga0495654_0003540 | 3300046530 | Bacteria | 9529 |
| 575 | Ga0495654_0067222 | 3300046530 | Bacteria | 1707 |
| 576 | Ga0495665_0032147 | 3300046531 | Bacteria | 2806 |
| 577 | Ga0495586_0114980 | 3300046535 | Bacteria | 1500 |
| 578 | Ga0495609_0029183 | 3300046538 | Bacteria | 2513 |
| 579 | Ga0495597_0014047 | 3300046542 | Bacteria | 3821 |
| 580 | Ga0495645_0000238 | 3300046543 | Bacteria | 40111 |
| 581 | Ga0495645_0014319 | 3300046543 | Bacteria | 5624 |
| 582 | Ga0495645_0048634 | 3300046543 | Bacteria | 3088 |
| 583 | Ga0495645_0073003 | 3300046543 | Bacteria | 2472 |
| 584 | Ga0495622_0000011 | 3300046557 | Bacteria | 201507 |
| 585 | Ga0495633_0000041 | 3300046558 | Bacteria | 176298 |
| 586 | Ga0495667_0024349 | 3300046559 | Bacteria | 4077 |
| 587 | Ga0495656_0000055 | 3300046615 | Bacteria | 53908 |
| 588 | Ga0495656_0000082 | 3300046615 | Bacteria | 42150 |
| 589 | Ga0495656_0075287 | 3300046615 | Bacteria | 1510 |
| 590 | Ga0495668_0018134 | 3300046616 | Bacteria | 4071 |
| 591 | Ga0495634_0127405 | 3300046642 | Bacteria | 1626 |
| 592 | Ga0495611_0004243 | 3300046648 | Bacteria | 6240 |
| 593 | Ga0495625_0000708 | 3300046660 | Bacteria | 47135 |
| 594 | Ga0495625_0003058 | 3300046660 | Bacteria | 17143 |
| 595 | Ga0495625_0015575 | 3300046660 | Bacteria | 6015 |
| 596 | Ga0495625_0036739 | 3300046660 | Bacteria | 3598 |
| 597 | Ga0495625_0098470 | 3300046660 | Bacteria | 2011 |
| 598 | Ga0495625_0129657 | 3300046660 | Bacteria | 1709 |
| 599 | Ga0495661_0000987 | 3300046665 | Bacteria | 25699 |
| 600 | Ga0495588_0018807 | 3300046674 | Bacteria | 3375 |
| 601 | Ga0495588_0068187 | 3300046674 | Bacteria | 1847 |
| 602 | Ga0495588_0080109 | 3300046674 | Bacteria | 1704 |
| 603 | Ga0495657_0131828 | 3300046675 | Bacteria | 1565 |
| 604 | Ga0495646_0007543 | 3300046680 | Bacteria | 6912 |
| 605 | Ga0495647_0025199 | 3300046681 | Bacteria | 2171 |
| 606 | Ga0495658_0004417 | 3300046683 | Bacteria | 6924 |
| 607 | Ga0495658_0078372 | 3300046683 | Bacteria | 1934 |
| 608 | Ga0495669_0017052 | 3300046684 | Bacteria | 3114 |
| 609 | Ga0495669_0032501 | 3300046684 | Bacteria | 2294 |
| 610 | Ga0495613_0009049 | 3300046689 | Bacteria | 7389 |
| 611 | Ga0495613_0031647 | 3300046689 | Bacteria | 3930 |
| 612 | Ga0495624_0004546 | 3300046690 | Bacteria | 10138 |
| 613 | Ga0495624_0248492 | 3300046690 | Bacteria | 1076 |
| 614 | Ga0495670_0000651 | 3300046691 | Bacteria | 16586 |
| 615 | Ga0495670_0030646 | 3300046691 | Bacteria | 2672 |
| 616 | Ga0495670_0050488 | 3300046691 | Bacteria | 2082 |
| 617 | Ga0495671_0012474 | 3300046692 | Bacteria | 4640 |
| 618 | Ga0495671_0020441 | 3300046692 | Bacteria | 3488 |
| 619 | Ga0495671_0054645 | 3300046692 | Bacteria | 1979 |
| 620 | Ga0495649_0001209 | 3300046694 | Bacteria | 19919 |
| 621 | Ga0495649_0087946 | 3300046694 | Bacteria | 1658 |
| 622 | Ga0495589_0001358 | 3300046794 | Bacteria | 14298 |
| 623 | Ga0495589_0021439 | 3300046794 | Bacteria | 3301 |
| 624 | Ga0495589_0135323 | 3300046794 | Bacteria | 1182 |
| 625 | Ga0495660_0004124 | 3300046810 | Bacteria | 8852 |
| 626 | Ga0495660_0063790 | 3300046810 | Bacteria | 1971 |
| 627 | Ga0495660_0142852 | 3300046810 | Bacteria | 1189 |
| 628 | Ga0495581_0002045 | 3300047315 | Bacteria | 11345 |
| 629 | Ga0495581_0053786 | 3300047315 | Unclassified | 2325 |
| 630 | Ga0495674_0005976 | 3300047319 | Bacteria | 11682 |
| 631 | Ga0495674_0012028 | 3300047319 | Bacteria | 8158 |
| 632 | Ga0495674_0013683 | 3300047319 | Bacteria | 7623 |
| 633 | Ga0495674_0113175 | 3300047319 | Bacteria | 2298 |
| 634 | Ga0495676_0016520 | 3300047321 | Bacteria | 6546 |
| 635 | Ga0495680_0095507 | 3300047322 | Bacteria | 2222 |
| 636 | Ga0495680_0098959 | 3300047322 | Unclassified | 2175 |
| 637 | Ga0495683_0044232 | 3300047323 | Bacteria | 2239 |
| 638 | Ga0495683_0117139 | 3300047323 | Bacteria | 1267 |
| 639 | Ga0495687_024134 | 3300047443 | Bacteria | 2895 |
| 640 | Ga0495677_0032393 | 3300047445 | Bacteria | 1904 |
| 641 | Ga0495679_000006 | 3300047446 | Bacteria | 449956 |
| 642 | Ga0495684_0180601 | 3300047471 | Bacteria | 1564 |
| 643 | Ga0495686_0001736 | 3300047472 | Bacteria | 22399 |
| 644 | Ga0495686_0001796 | 3300047472 | Bacteria | 21729 |
| 645 | Ga0495686_0009319 | 3300047472 | Bacteria | 7084 |
| 646 | Ga0495593_0032620 | 3300047673 | Bacteria | 2838 |
| 647 | Ga0495593_0039375 | 3300047673 | Bacteria | 2548 |
| 648 | Ga0495602_0218177 | 3300048088 | Bacteria | 1442 |
| 649 | Ga0495602_0276049 | 3300048088 | Bacteria | 1240 |
| 650 | Ga0495614_0055441 | 3300048089 | Bacteria | 1700 |
| 651 | Ga0495614_0058214 | 3300048089 | Bacteria | 1659 |
| 652 | Ga0495614_0097801 | 3300048089 | Bacteria | 1280 |
| 653 | Ga0495626_0000701 | 3300048091 | Bacteria | 31837 |
| 654 | Ga0495626_0002166 | 3300048091 | Bacteria | 14145 |
| 655 | Ga0495626_0049264 | 3300048091 | Bacteria | 1951 |
| 656 | Ga0496100_0001197 | 3300048903 | Bacteria | 12602 |
| 657 | Ga0496100_0041658 | 3300048903 | Bacteria | 2929 |
| 658 | Ga0496101_0011059 | 3300048904 | Bacteria | 5978 |
| 659 | Ga0496101_0017559 | 3300048904 | Bacteria | 4853 |
| 660 | Ga0496102_0002957 | 3300048905 | Bacteria | 14389 |
| 661 | Ga0496102_0003955 | 3300048905 | Bacteria | 12563 |
| 662 | Ga0496102_0007903 | 3300048905 | Bacteria | 9091 |
| 663 | Ga0496102_0376411 | 3300048905 | Bacteria | 1336 |
| 664 | Ga0496104_0006593 | 3300048907 | Bacteria | 10211 |
| 665 | Ga0496104_0024340 | 3300048907 | Bacteria | 5570 |
| 666 | Ga0496104_0430070 | 3300048907 | Bacteria | 1232 |
| 667 | Ga0496104_0495253 | 3300048907 | Unclassified | 1133 |
| 668 | Ga0496105_0002074 | 3300048908 | Bacteria | 14503 |
| 669 | Ga0496106_0027941 | 3300048909 | Bacteria | 4200 |
| 670 | Ga0496106_0073829 | 3300048909 | Bacteria | 2610 |
| 671 | Ga0496106_0091243 | 3300048909 | Bacteria | 2352 |
| 672 | Ga0496106_0180102 | 3300048909 | Bacteria | 1677 |
| 673 | Ga0496108_0044702 | 3300048911 | Bacteria | 3697 |
| 674 | Ga0496109_0077301 | 3300048912 | Bacteria | 3063 |
| 675 | Ga0496110_0191439 | 3300048913 | Bacteria | 1858 |
| 676 | Ga0496112_0023540 | 3300048915 | Bacteria | 5886 |
| 677 | Ga0496112_0225549 | 3300048915 | Bacteria | 1829 |
| 678 | Ga0496113_0034530 | 3300048916 | Bacteria | 3690 |
| 679 | Ga0496113_0068939 | 3300048916 | Bacteria | 2685 |
| 680 | Ga0496114_0149961 | 3300048917 | Bacteria | 2022 |
| 681 | Ga0496116_0030707 | 3300048919 | Bacteria | 3856 |
| 682 | Ga0496116_0033691 | 3300048919 | Bacteria | 3629 |
| 683 | Ga0496117_0010723 | 3300048920 | Bacteria | 8286 |
| 684 | Ga0496117_0017904 | 3300048920 | Bacteria | 5899 |
| 685 | Ga0496117_0039334 | 3300048920 | Bacteria | 3492 |
| 686 | Ga0496118_0013061 | 3300048921 | Bacteria | 7896 |
| 687 | Ga0496118_0066835 | 3300048921 | Bacteria | 2622 |
| 688 | Ga0496119_0049405 | 3300048922 | Bacteria | 2601 |
| 689 | Ga0496121_0024166 | 3300048924 | Bacteria | 5821 |
| 690 | Ga0496121_0132618 | 3300048924 | Bacteria | 1861 |
| 691 | Ga0496121_0170027 | 3300048924 | Bacteria | 1584 |
| 692 | Ga0496122_0179699 | 3300048925 | Bacteria | 1264 |
| 693 | Ga0496123_0021160 | 3300048926 | Bacteria | 5063 |
| 694 | Ga0496125_0071202 | 3300048928 | Bacteria | 2718 |
| 695 | Ga0496126_0023604 | 3300048929 | Bacteria | 5958 |
| 696 | Ga0496126_0035988 | 3300048929 | Bacteria | 4634 |
| 697 | Ga0496126_0084685 | 3300048929 | Bacteria | 2796 |
| 698 | Ga0496126_0143656 | 3300048929 | Bacteria | 2052 |
| 699 | Ga0495678_011148 | 3300049459 | Bacteria | 4320 |
| 700 | Ga0495682_0005096 | 3300049460 | Bacteria | 5506 |
| 701 | Ga0501298_018446 | 3300049521 | Bacteria | 1283 |
| 702 | Ga0501034_0049908 | 3300049571 | Bacteria | 4221 |
| 703 | Ga0501034_0159811 | 3300049571 | Bacteria | 2225 |
| 704 | Ga0501036_0070638 | 3300049572 | Bacteria | 2953 |
| 705 | Ga0501039_0090761 | 3300049575 | Bacteria | 2381 |
| 706 | Ga0501042_0159181 | 3300049578 | Bacteria | 1629 |
| 707 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 708 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 709 | Ga0501046_0147127 | 3300049580 | Bacteria | 1779 |
| 710 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 711 | Ga0501047_0046097 | 3300049581 | Bacteria | 4214 |
| 712 | Ga0501048_0000926 | 3300049582 | Bacteria | 21609 |
| 713 | Ga0501071_0080358 | 3300049587 | Bacteria | 2384 |
| 714 | Ga0501071_0231480 | 3300049587 | Bacteria | 1392 |
| 715 | Ga0501072_0030575 | 3300049588 | Bacteria | 4213 |
| 716 | Ga0501072_0142486 | 3300049588 | Bacteria | 1911 |
| 717 | Ga0501073_0018665 | 3300049589 | Bacteria | 5013 |
| 718 | Ga0501073_0043103 | 3300049589 | Bacteria | 3182 |
| 719 | Ga0501074_0066721 | 3300049590 | Bacteria | 2588 |
| 720 | Ga0501075_0025728 | 3300049591 | Bacteria | 4325 |
| 721 | Ga0501075_0050576 | 3300049591 | Bacteria | 3124 |
| 722 | Ga0501075_0078662 | 3300049591 | Bacteria | 2496 |
| 723 | Ga0501076_0141985 | 3300049592 | Bacteria | 1951 |
| 724 | Ga0501076_0156853 | 3300049592 | Bacteria | 1853 |
| 725 | Ga0501077_0104714 | 3300049593 | Bacteria | 1793 |
| 726 | Ga0501077_0326375 | 3300049593 | Bacteria | 978 |
| 727 | Ga0501080_0097802 | 3300049742 | Bacteria | 2725 |
| 728 | Ga0501081_0085800 | 3300049743 | Bacteria | 2210 |
| 729 | Ga0501081_0106752 | 3300049743 | Bacteria | 1985 |
| 730 | Ga0501044_0028392 | 3300049823 | Bacteria | 5906 |
| 731 | Ga0501044_0029722 | 3300049823 | Bacteria | 5761 |
| 732 | Ga0501044_0143444 | 3300049823 | Bacteria | 2376 |
| 733 | Ga0501045_0002191 | 3300049824 | Bacteria | 13251 |
| 734 | nmdc:mga03683_11848_c1 | 3300050489 | Bacteria | 3169 |
| 735 | nmdc:mga03683_2833_c1 | 3300050489 | Bacteria | 5463 |
| 736 | nmdc:mga03683_96365_c1 | 3300050489 | Bacteria | 1296 |
| 737 | nmdc:mga03n38_69487_c1 | 3300050490 | Bacteria | 1626 |
| 738 | nmdc:mga00v17_127038_c1 | 3300050491 | Bacteria | 1627 |
| 739 | nmdc:mga00v17_3436_c1 | 3300050491 | Bacteria | 7655 |
| 740 | nmdc:mga0yw44_40551_c1 | 3300050492 | Bacteria | 1840 |
| 741 | nmdc:mga0yw44_4155_c1 | 3300050492 | Bacteria | 6579 |
| 742 | nmdc:mga0k408_10388_c1 | 3300050493 | Bacteria | 5035 |
| 743 | nmdc:mga0k408_37678_c1 | 3300050493 | Bacteria | 2776 |
| 744 | nmdc:mga0k408_45756_c1 | 3300050493 | Bacteria | 2526 |
| 745 | nmdc:mga0k408_5585_c1 | 3300050493 | Bacteria | 6691 |
| 746 | nmdc:mga06z11_201743_c1 | 3300050494 | Bacteria | 1156 |
| 747 | nmdc:mga06z11_24082_c1 | 3300050494 | Bacteria | 2868 |
| 748 | nmdc:mga06z11_65937_c1 | 3300050494 | Bacteria | 1902 |
| 749 | nmdc:mga07m45_12383_c1 | 3300050496 | Bacteria | 4508 |
| 750 | nmdc:mga07m45_134705_c1 | 3300050496 | Bacteria | 1430 |
| 751 | nmdc:mga07m45_177981_c1 | 3300050496 | Bacteria | 1237 |
| 752 | nmdc:mga07m45_20021_c1 | 3300050496 | Bacteria | 3632 |
| 753 | nmdc:mga07m45_538_c1 | 3300050496 | Bacteria | 16053 |
| 754 | nmdc:mga07m45_80008_c1 | 3300050496 | Bacteria | 1866 |
| 755 | nmdc:mga07m45_977_c1 | 3300050496 | Bacteria | 12579 |
| 756 | nmdc:mga05p37_39773_c1 | 3300050507 | Bacteria | 5774 |
| 757 | nmdc:mga05p37_783_c1 | 3300050507 | Bacteria | 35363 |
| 758 | nmdc:mga0qj67_20_c1 | 3300050509 | Bacteria | 109238 |
| 759 | nmdc:mga0qj67_423_c1 | 3300050509 | Bacteria | 28921 |
| 760 | nmdc:mga06r32_1561_c1 | 3300050510 | Bacteria | 20670 |
| 761 | nmdc:mga06r32_8266_c1 | 3300050510 | Bacteria | 9367 |
| 762 | nmdc:mga08y16_88666_c1 | 3300050511 | Bacteria | 3224 |
| 763 | nmdc:mga0n895_2277_c1 | 3300050512 | Bacteria | 14891 |
| 764 | nmdc:mga0rr50_1185_c1 | 3300050513 | Bacteria | 14175 |
| 765 | nmdc:mga08x19_5601_c1 | 3300050514 | Bacteria | 7421 |
| 766 | nmdc:mga0a205_2289_c1 | 3300050515 | Bacteria | 16890 |
| 767 | nmdc:mga0sz30_15060_c2 | 3300050516 | Bacteria | 2031 |
| 768 | Ga0500610_0035368 | 3300053079 | Bacteria | 2561 |
| 769 | Ga0500610_0091821 | 3300053079 | Bacteria | 1576 |
| 770 | Ga0495595_0025679 | 3300053084 | Bacteria | 2613 |
| 771 | Ga0495619_0000882 | 3300053085 | Bacteria | 19725 |
| 772 | Ga0495619_0136730 | 3300053085 | Bacteria | 1686 |
| 773 | Ga0500647_0024825 | 3300053091 | Bacteria | 2822 |
| 774 | Ga0500647_0041190 | 3300053091 | Bacteria | 2216 |
| 775 | Ga0500583_0023527 | 3300053092 | Bacteria | 2598 |
| 776 | Ga0500651_0000286 | 3300053093 | Bacteria | 29451 |
| 777 | Ga0500566_0029149 | 3300053094 | Bacteria | 3225 |
| 778 | Ga0500562_014221 | 3300053108 | Bacteria | 2038 |
| 779 | Ga0500571_001412 | 3300053110 | Bacteria | 11195 |
| 780 | Ga0500593_000452 | 3300053117 | Bacteria | 16256 |
| 781 | Ga0500594_0002152 | 3300053118 | Bacteria | 4265 |
| 782 | Ga0500594_0004492 | 3300053118 | Bacteria | 3075 |
| 783 | Ga0500607_005158 | 3300053121 | Bacteria | 8636 |
| 784 | Ga0500607_014684 | 3300053121 | Bacteria | 4536 |
| 785 | Ga0500608_001053 | 3300053122 | Bacteria | 9896 |
| 786 | Ga0500626_018297 | 3300053128 | Bacteria | 3091 |
| 787 | Ga0500655_000688 | 3300053133 | Bacteria | 6710 |
| 788 | Ga0500658_0000137 | 3300053134 | Bacteria | 34691 |
| 789 | Ga0500658_0000140 | 3300053134 | Bacteria | 34349 |
| 790 | Ga0500559_0000166 | 3300053136 | Bacteria | 51944 |
| 791 | Ga0500564_025690 | 3300053138 | Bacteria | 2706 |
| 792 | Ga0500568_0010495 | 3300053139 | Bacteria | 4335 |
| 793 | Ga0500568_0012170 | 3300053139 | Bacteria | 3963 |
| 794 | Ga0500574_004148 | 3300053141 | Bacteria | 2665 |
| 795 | Ga0500619_012284 | 3300053154 | Bacteria | 2233 |
| 796 | Ga0500627_0000922 | 3300053158 | Bacteria | 7920 |
| 797 | Ga0500634_0001046 | 3300053161 | Bacteria | 10149 |
| 798 | Ga0500638_000736 | 3300053162 | Bacteria | 8837 |
| 799 | Ga0500639_077415 | 3300053163 | Bacteria | 1682 |
| 800 | Ga0500636_0006898 | 3300053177 | Bacteria | 6545 |
| 801 | Ga0500625_010895 | 3300053729 | Bacteria | 4114 |
| 802 | Ga0501084_0047621 | 3300054114 | Bacteria | 3590 |
| 803 | Ga0501082_0086986 | 3300060353 | Bacteria | 2696 |
| 804 | Ga0501082_0296723 | 3300060353 | Bacteria | 1407 |
| 805 | Ga0530510_0366707 | 3300061734 | Bacteria | 1083 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035207 | Ga0373942_0093131 | Ga0373942_0093131_10_864 | 221 |
| 2 | 3300035115 | Ga0373941_0065509 | Ga0373941_0065509_23_922 | 236 |
| 3 | 3300046507 | Ga0495606_0058402 | Ga0495606_0058402_13_891 | 237 |
| 4 | 3300046454 | Ga0495592_0072949 | Ga0495592_0072949_1587_2474 | 238 |
| 5 | 3300046526 | Ga0495666_0131394 | Ga0495666_0131394_18_926 | 247 |
| 6 | 3300046455 | Ga0495603_0040452 | Ga0495603_0040452_1861_2772 | 253 |
| 7 | 3300049593 | Ga0501077_0326375 | Ga0501077_0326375_17_967 | 254 |
| 8 | 3300049587 | Ga0501071_0231480 | Ga0501071_0231480_395_1354 | 259 |
| 9 | 3300046810 | Ga0495660_0142852 | Ga0495660_0142852_38_991 | 262 |
| 10 | 3300048088 | Ga0495602_0276049 | Ga0495602_0276049_247_1200 | 262 |
| 11 | 3300049578 | Ga0501042_0159181 | Ga0501042_0159181_449_1441 | 267 |
| 12 | 3300049588 | Ga0501072_0030575 | Ga0501072_0030575_57_1049 | 267 |
| 13 | 3300049591 | Ga0501075_0078662 | Ga0501075_0078662_791_1783 | 267 |
| 14 | 3300049592 | Ga0501076_0156853 | Ga0501076_0156853_474_1466 | 267 |
| 15 | 3300060353 | Ga0501082_0296723 | Ga0501082_0296723_298_1290 | 267 |
| 16 | 3300035172 | Ga0373955_0166743 | Ga0373955_0166743_23_1075 | 268 |
| 17 | 3300046681 | Ga0495647_0025199 | Ga0495647_0025199_941_1993 | 268 |
| 18 | 3300046683 | Ga0495658_0078372 | Ga0495658_0078372_824_1876 | 268 |
| 19 | 3300046684 | Ga0495669_0017052 | Ga0495669_0017052_2073_3086 | 268 |
| 20 | 3300049589 | Ga0501073_0018665 | Ga0501073_0018665_3750_4790 | 269 |
| 21 | 3300005354 | Ga0070675_100004424 | Ga0070675_1000044249 | 271 |
| 22 | 3300005364 | Ga0070673_100003421 | Ga0070673_1000034213 | 271 |
| 23 | 3300005367 | Ga0070667_100005822 | Ga0070667_1000058229 | 271 |
| 24 | 3300005456 | Ga0070678_100004172 | Ga0070678_1000041724 | 271 |
| 25 | 3300005719 | Ga0068861_100291818 | Ga0068861_1002918182 | 271 |
| 26 | 3300006844 | Ga0075428_100141555 | Ga0075428_1001415552 | 271 |
| 27 | 3300006847 | Ga0075431_100001116 | Ga0075431_10000111623 | 271 |
| 28 | 3300006880 | Ga0075429_100185676 | Ga0075429_1001856762 | 271 |
| 29 | 3300050510 | nmdc:mga06r32_1561_c1 | nmdc:mga06r32_1561_c1_18740_19732 | 271 |
| 30 | 3300005336 | Ga0070680_100063817 | Ga0070680_1000638172 | 272 |
| 31 | 3300005458 | Ga0070681_10154061 | Ga0070681_101540611 | 272 |
| 32 | 3300005617 | Ga0068859_100040558 | Ga0068859_1000405582 | 272 |
| 33 | 3300006846 | Ga0075430_100007190 | Ga0075430_1000071903 | 272 |
| 34 | 3300006847 | Ga0075431_100011272 | Ga0075431_10001127210 | 272 |
| 35 | 3300006931 | Ga0097620_100040559 | Ga0097620_1000405595 | 272 |
| 36 | 3300009147 | Ga0114129_10002200 | Ga0114129_100022006 | 272 |
| 37 | 3300025912 | Ga0207707_10159721 | Ga0207707_101597213 | 272 |
| 38 | 3300025917 | Ga0207660_10026584 | Ga0207660_100265843 | 272 |
| 39 | 3300035241 | Ga0373961_0026240 | Ga0373961_0026240_51_1019 | 272 |
| 40 | 3300048905 | Ga0496102_0007903 | Ga0496102_0007903_7795_8805 | 272 |
| 41 | 3300048909 | Ga0496106_0073829 | Ga0496106_0073829_663_1673 | 272 |
| 42 | 3300050507 | nmdc:mga05p37_783_c1 | nmdc:mga05p37_783_c1_2090_3100 | 272 |
| 43 | 3300050509 | nmdc:mga0qj67_423_c1 | nmdc:mga0qj67_423_c1_4187_5197 | 272 |
| 44 | 3300050510 | nmdc:mga06r32_8266_c1 | nmdc:mga06r32_8266_c1_6298_7308 | 272 |
| 45 | 3300049593 | Ga0501077_0104714 | Ga0501077_0104714_709_1719 | 273 |
| 46 | 3300006177 | Ga0075362_10037676 | Ga0075362_100376762 | 274 |
| 47 | 3300013306 | Ga0163162_10215572 | Ga0163162_102155722 | 274 |
| 48 | 3300009094 | Ga0111539_10020595 | Ga0111539_100205955 | 276 |
| 49 | 3300050511 | nmdc:mga08y16_88666_c1 | nmdc:mga08y16_88666_c1_786_1793 | 276 |
| 50 | 3300005354 | Ga0070675_100137637 | Ga0070675_1001376372 | 277 |
| 51 | 3300028666 | Ga0265336_10006700 | Ga0265336_100067004 | 277 |
| 52 | 3300031240 | Ga0265320_10033662 | Ga0265320_100336622 | 277 |
| 53 | 3300031249 | Ga0265339_10006993 | Ga0265339_100069935 | 277 |
| 54 | 3300031711 | Ga0265314_10010702 | Ga0265314_100107025 | 277 |
| 55 | 3300031712 | Ga0265342_10010019 | Ga0265342_100100193 | 277 |
| 56 | 3300046543 | Ga0495645_0048634 | Ga0495645_0048634_698_1759 | 277 |
| 57 | 3300049591 | Ga0501075_0025728 | Ga0501075_0025728_649_1683 | 277 |
| 58 | 3300035119 | Ga0373956_0012298 | Ga0373956_0012298_2348_3379 | 278 |
| 59 | 3300035172 | Ga0373955_0078270 | Ga0373955_0078270_162_1193 | 278 |
| 60 | 3300005937 | Ga0081455_10114206 | Ga0081455_101142063 | 280 |
| 61 | 3300005536 | Ga0070697_100088893 | Ga0070697_1000888932 | 281 |
| 62 | 3300005545 | Ga0070695_100157653 | Ga0070695_1001576532 | 281 |
| 63 | 3300006353 | Ga0075370_10000115 | Ga0075370_1000011522 | 281 |
| 64 | 3300009553 | Ga0105249_10085915 | Ga0105249_100859153 | 281 |
| 65 | 3300050496 | nmdc:mga07m45_977_c1 | nmdc:mga07m45_977_c1_1020_2063 | 281 |
| 66 | 3300053163 | Ga0500639_077415 | Ga0500639_077415_628_1656 | 281 |
| 67 | 3300046810 | Ga0495660_0004124 | Ga0495660_0004124_3506_4549 | 282 |
| 68 | 3300048091 | Ga0495626_0000701 | Ga0495626_0000701_2146_3189 | 282 |
| 69 | 3300006195 | Ga0075366_10040728 | Ga0075366_100407283 | 283 |
| 70 | 3300006914 | Ga0075436_100016182 | Ga0075436_1000161825 | 283 |
| 71 | 3300007076 | Ga0075435_100010188 | Ga0075435_1000101882 | 283 |
| 72 | 3300009147 | Ga0114129_10037178 | Ga0114129_100371782 | 283 |
| 73 | 3300050507 | nmdc:mga05p37_39773_c1 | nmdc:mga05p37_39773_c1_1604_2548 | 283 |
| 74 | 3300050512 | nmdc:mga0n895_2277_c1 | nmdc:mga0n895_2277_c1_3484_4428 | 283 |
| 75 | 3300050513 | nmdc:mga0rr50_1185_c1 | nmdc:mga0rr50_1185_c1_2768_3712 | 283 |
| 76 | 3300050514 | nmdc:mga08x19_5601_c1 | nmdc:mga08x19_5601_c1_5228_6172 | 283 |
| 77 | 3300050515 | nmdc:mga0a205_2289_c1 | nmdc:mga0a205_2289_c1_5650_6594 | 283 |
| 78 | 3300026095 | Ga0207676_10463357 | Ga0207676_104633572 | 284 |
| 79 | 3300046642 | Ga0495634_0127405 | Ga0495634_0127405_309_1349 | 284 |
| 80 | iso_pu_bacteria | 2775507049 | 2776915759 | 284 |
| 81 | 3300035695 | Ga0373927_0044393 | Ga0373927_0044393_947_1972 | 285 |
| 82 | 3300046455 | Ga0495603_0016366 | Ga0495603_0016366_3394_4419 | 285 |
| 83 | 3300046459 | Ga0495629_0005426 | Ga0495629_0005426_4261_5286 | 285 |
| 84 | 3300046557 | Ga0495622_0000011 | Ga0495622_0000011_47076_48128 | 285 |
| 85 | 3300046683 | Ga0495658_0004417 | Ga0495658_0004417_5091_6116 | 285 |
| 86 | 3300046689 | Ga0495613_0031647 | Ga0495613_0031647_966_1991 | 285 |
| 87 | 3300046690 | Ga0495624_0248492 | Ga0495624_0248492_38_1063 | 285 |
| 88 | 3300047315 | Ga0495581_0053786 | Ga0495581_0053786_340_1365 | 285 |
| 89 | 3300047322 | Ga0495680_0098959 | Ga0495680_0098959_1020_2045 | 285 |
| 90 | 3300053085 | Ga0495619_0000882 | Ga0495619_0000882_16286_17311 | 285 |
| 91 | 3300005616 | Ga0068852_100559308 | Ga0068852_1005593081 | 286 |
| 92 | 3300006195 | Ga0075366_10209430 | Ga0075366_102094301 | 286 |
| 93 | 3300009176 | Ga0105242_10091387 | Ga0105242_100913872 | 286 |
| 94 | 3300013296 | Ga0157374_10263462 | Ga0157374_102634622 | 286 |
| 95 | 3300026067 | Ga0207678_10173601 | Ga0207678_101736011 | 286 |
| 96 | 3300034816 | Ga0373930_0017659 | Ga0373930_0017659_244_1257 | 286 |
| 97 | 3300035171 | Ga0373946_0039065 | Ga0373946_0039065_91_1116 | 286 |
| 98 | 3300035691 | Ga0373931_0003357 | Ga0373931_0003357_5005_6018 | 286 |
| 99 | 3300047322 | Ga0495680_0095507 | Ga0495680_0095507_815_1846 | 286 |
| 100 | 3300048904 | Ga0496101_0017559 | Ga0496101_0017559_2511_3524 | 286 |
| 101 | 3300048905 | Ga0496102_0376411 | Ga0496102_0376411_148_1161 | 286 |
| 102 | 3300048907 | Ga0496104_0495253 | Ga0496104_0495253_63_1097 | 286 |
| 103 | 3300048917 | Ga0496114_0149961 | Ga0496114_0149961_781_1794 | 286 |
| 104 | 3300053085 | Ga0495619_0136730 | Ga0495619_0136730_477_1508 | 286 |
| 105 | 3300005340 | Ga0070689_100078184 | Ga0070689_1000781842 | 287 |
| 106 | 3300005353 | Ga0070669_100011530 | Ga0070669_1000115305 | 287 |
| 107 | 3300005354 | Ga0070675_100049661 | Ga0070675_1000496613 | 287 |
| 108 | 3300005365 | Ga0070688_100075655 | Ga0070688_1000756551 | 287 |
| 109 | 3300005456 | Ga0070678_100009040 | Ga0070678_1000090402 | 287 |
| 110 | 3300006048 | Ga0075363_100016942 | Ga0075363_1000169422 | 287 |
| 111 | 3300006178 | Ga0075367_10160145 | Ga0075367_101601452 | 287 |
| 112 | 3300013306 | Ga0163162_10307820 | Ga0163162_103078201 | 287 |
| 113 | 3300014325 | Ga0163163_10047540 | Ga0163163_100475402 | 287 |
| 114 | 3300014326 | Ga0157380_10377499 | Ga0157380_103774991 | 287 |
| 115 | 3300025899 | Ga0207642_10209556 | Ga0207642_102095561 | 287 |
| 116 | 3300025923 | Ga0207681_10005854 | Ga0207681_100058546 | 287 |
| 117 | 3300025936 | Ga0207670_10001410 | Ga0207670_1000141014 | 287 |
| 118 | 3300025937 | Ga0207669_10001860 | Ga0207669_100018609 | 287 |
| 119 | 3300031995 | Ga0307409_100095209 | Ga0307409_1000952092 | 287 |
| 120 | 3300035115 | Ga0373941_0061248 | Ga0373941_0061248_189_1202 | 287 |
| 121 | 3300035691 | Ga0373931_0008665 | Ga0373931_0008665_1369_2382 | 287 |
| 122 | 3300046543 | Ga0495645_0073003 | Ga0495645_0073003_884_1897 | 287 |
| 123 | 3300048912 | Ga0496109_0077301 | Ga0496109_0077301_891_1904 | 287 |
| 124 | 3300048915 | Ga0496112_0023540 | Ga0496112_0023540_4741_5754 | 287 |
| 125 | 3300048915 | Ga0496112_0225549 | Ga0496112_0225549_612_1625 | 287 |
| 126 | 3300048916 | Ga0496113_0034530 | Ga0496113_0034530_1857_2870 | 287 |
| 127 | 3300049571 | Ga0501034_0159811 | Ga0501034_0159811_577_1584 | 287 |
| 128 | 3300050494 | nmdc:mga06z11_201743_c1 | nmdc:mga06z11_201743_c1_60_1070 | 287 |
| 129 | 3300050496 | nmdc:mga07m45_80008_c1 | nmdc:mga07m45_80008_c1_792_1802 | 287 |
| 130 | 3300053084 | Ga0495595_0025679 | Ga0495595_0025679_1188_2201 | 287 |
| 131 | 3300060353 | Ga0501082_0086986 | Ga0501082_0086986_705_1712 | 287 |
| 132 | 3300005336 | Ga0070680_100284190 | Ga0070680_1002841901 | 288 |
| 133 | 3300005345 | Ga0070692_10054227 | Ga0070692_100542272 | 288 |
| 134 | 3300005438 | Ga0070701_10001070 | Ga0070701_100010704 | 288 |
| 135 | 3300005456 | Ga0070678_100033664 | Ga0070678_1000336643 | 288 |
| 136 | 3300005459 | Ga0068867_100072138 | Ga0068867_1000721382 | 288 |
| 137 | 3300005544 | Ga0070686_100000429 | Ga0070686_10000042920 | 288 |
| 138 | 3300005545 | Ga0070695_100033259 | Ga0070695_1000332593 | 288 |
| 139 | 3300005547 | Ga0070693_100011464 | Ga0070693_1000114644 | 288 |
| 140 | 3300005578 | Ga0068854_100285586 | Ga0068854_1002855862 | 288 |
| 141 | 3300005615 | Ga0070702_100005177 | Ga0070702_1000051773 | 288 |
| 142 | 3300005718 | Ga0068866_10001488 | Ga0068866_100014886 | 288 |
| 143 | 3300005719 | Ga0068861_100005103 | Ga0068861_1000051034 | 288 |
| 144 | 3300005843 | Ga0068860_100017256 | Ga0068860_1000172562 | 288 |
| 145 | 3300005844 | Ga0068862_100014582 | Ga0068862_1000145824 | 288 |
| 146 | 3300005985 | Ga0081539_10048027 | Ga0081539_100480273 | 288 |
| 147 | 3300006237 | Ga0097621_100008539 | Ga0097621_1000085394 | 288 |
| 148 | 3300006358 | Ga0068871_100002438 | Ga0068871_10000243812 | 288 |
| 149 | 3300006881 | Ga0068865_100008332 | Ga0068865_1000083323 | 288 |
| 150 | 3300009098 | Ga0105245_10006822 | Ga0105245_100068226 | 288 |
| 151 | 3300009176 | Ga0105242_10021786 | Ga0105242_100217865 | 288 |
| 152 | 3300009553 | Ga0105249_10110555 | Ga0105249_101105552 | 288 |
| 153 | 3300013297 | Ga0157378_10004967 | Ga0157378_100049678 | 288 |
| 154 | 3300013306 | Ga0163162_10626949 | Ga0163162_106269492 | 288 |
| 155 | 3300025899 | Ga0207642_10012683 | Ga0207642_100126831 | 288 |
| 156 | 3300025908 | Ga0207643_10015529 | Ga0207643_100155294 | 288 |
| 157 | 3300025934 | Ga0207686_10016638 | Ga0207686_100166381 | 288 |
| 158 | 3300025938 | Ga0207704_10004612 | Ga0207704_100046124 | 288 |
| 159 | 3300025942 | Ga0207689_10007463 | Ga0207689_100074636 | 288 |
| 160 | 3300026075 | Ga0207708_10000875 | Ga0207708_1000087516 | 288 |
| 161 | 3300026089 | Ga0207648_10004621 | Ga0207648_100046218 | 288 |
| 162 | 3300026118 | Ga0207675_100000138 | Ga0207675_10000013817 | 288 |
| 163 | 3300026121 | Ga0207683_10012408 | Ga0207683_100124083 | 288 |
| 164 | 3300047472 | Ga0495686_0001736 | Ga0495686_0001736_15476_16522 | 288 |
| 165 | 3300005333 | Ga0070677_10012454 | Ga0070677_100124543 | 289 |
| 166 | 3300005335 | Ga0070666_10050601 | Ga0070666_100506013 | 289 |
| 167 | 3300005343 | Ga0070687_100002399 | Ga0070687_1000023997 | 289 |
| 168 | 3300005353 | Ga0070669_100002541 | Ga0070669_1000025418 | 289 |
| 169 | 3300005354 | Ga0070675_100007437 | Ga0070675_1000074373 | 289 |
| 170 | 3300005367 | Ga0070667_100012281 | Ga0070667_1000122812 | 289 |
| 171 | 3300005437 | Ga0070710_10085351 | Ga0070710_100853512 | 289 |
| 172 | 3300005456 | Ga0070678_100031599 | Ga0070678_1000315992 | 289 |
| 173 | 3300005616 | Ga0068852_100022799 | Ga0068852_1000227992 | 289 |
| 174 | 3300005617 | Ga0068859_100146009 | Ga0068859_1001460093 | 289 |
| 175 | 3300005718 | Ga0068866_10003115 | Ga0068866_100031156 | 289 |
| 176 | 3300005719 | Ga0068861_100024434 | Ga0068861_1000244346 | 289 |
| 177 | 3300005841 | Ga0068863_100019955 | Ga0068863_1000199554 | 289 |
| 178 | 3300005842 | Ga0068858_100021194 | Ga0068858_1000211946 | 289 |
| 179 | 3300005843 | Ga0068860_100005159 | Ga0068860_1000051598 | 289 |
| 180 | 3300006038 | Ga0075365_10046701 | Ga0075365_100467014 | 289 |
| 181 | 3300006353 | Ga0075370_10001048 | Ga0075370_100010482 | 289 |
| 182 | 3300006881 | Ga0068865_100003857 | Ga0068865_1000038573 | 289 |
| 183 | 3300006931 | Ga0097620_100146007 | Ga0097620_1001460073 | 289 |
| 184 | 3300009177 | Ga0105248_10085241 | Ga0105248_100852414 | 289 |
| 185 | 3300013306 | Ga0163162_10033293 | Ga0163162_100332933 | 289 |
| 186 | 3300013308 | Ga0157375_10014933 | Ga0157375_100149338 | 289 |
| 187 | 3300014326 | Ga0157380_10000886 | Ga0157380_100008863 | 289 |
| 188 | 3300014968 | Ga0157379_10018782 | Ga0157379_100187826 | 289 |
| 189 | 3300017792 | Ga0163161_10003368 | Ga0163161_100033688 | 289 |
| 190 | 3300021361 | Ga0213872_10077172 | Ga0213872_100771722 | 289 |
| 191 | 3300025893 | Ga0207682_10014967 | Ga0207682_100149672 | 289 |
| 192 | 3300025899 | Ga0207642_10020102 | Ga0207642_100201022 | 289 |
| 193 | 3300025903 | Ga0207680_10004267 | Ga0207680_100042675 | 289 |
| 194 | 3300025907 | Ga0207645_10005563 | Ga0207645_100055635 | 289 |
| 195 | 3300025918 | Ga0207662_10015308 | Ga0207662_100153085 | 289 |
| 196 | 3300025926 | Ga0207659_10007262 | Ga0207659_100072623 | 289 |
| 197 | 3300025933 | Ga0207706_10010371 | Ga0207706_100103716 | 289 |
| 198 | 3300025938 | Ga0207704_10008403 | Ga0207704_100084036 | 289 |
| 199 | 3300025940 | Ga0207691_10009795 | Ga0207691_100097953 | 289 |
| 200 | 3300025942 | Ga0207689_10002269 | Ga0207689_1000226912 | 289 |
| 201 | 3300025960 | Ga0207651_10135542 | Ga0207651_101355422 | 289 |
| 202 | 3300025972 | Ga0207668_10025649 | Ga0207668_100256492 | 289 |
| 203 | 3300026067 | Ga0207678_10076256 | Ga0207678_100762564 | 289 |
| 204 | 3300026075 | Ga0207708_10009916 | Ga0207708_100099162 | 289 |
| 205 | 3300026089 | Ga0207648_10015693 | Ga0207648_100156933 | 289 |
| 206 | 3300026118 | Ga0207675_100010824 | Ga0207675_1000108242 | 289 |
| 207 | 3300026121 | Ga0207683_10039123 | Ga0207683_100391233 | 289 |
| 208 | 3300028380 | Ga0268265_10013132 | Ga0268265_100131326 | 289 |
| 209 | 3300028381 | Ga0268264_10018708 | Ga0268264_100187086 | 289 |
| 210 | 3300042157 | Ga0439458_0023601 | Ga0439458_0023601_321_1319 | 289 |
| 211 | 3300046522 | Ga0495643_0045150 | Ga0495643_0045150_368_1384 | 289 |
| 212 | 3300050496 | nmdc:mga07m45_20021_c1 | nmdc:mga07m45_20021_c1_612_1655 | 289 |
| 213 | 3300006038 | Ga0075365_10197692 | Ga0075365_101976922 | 290 |
| 214 | 3300006186 | Ga0075369_10039226 | Ga0075369_100392262 | 290 |
| 215 | 3300006353 | Ga0075370_10077604 | Ga0075370_100776042 | 290 |
| 216 | 3300046522 | Ga0495643_0011054 | Ga0495643_0011054_4502_5491 | 290 |
| 217 | 3300046524 | Ga0495648_0012184 | Ga0495648_0012184_2406_3395 | 290 |
| 218 | 3300046665 | Ga0495661_0000987 | Ga0495661_0000987_19338_20327 | 290 |
| 219 | 3300046794 | Ga0495589_0135323 | Ga0495589_0135323_163_1152 | 290 |
| 220 | 3300050492 | nmdc:mga0yw44_40551_c1 | nmdc:mga0yw44_40551_c1_84_1094 | 290 |
| 221 | 3300050494 | nmdc:mga06z11_65937_c1 | nmdc:mga06z11_65937_c1_831_1841 | 290 |
| 222 | 3300005367 | Ga0070667_100072550 | Ga0070667_1000725503 | 291 |
| 223 | 3300005455 | Ga0070663_100311475 | Ga0070663_1003114751 | 291 |
| 224 | 3300005539 | Ga0068853_100436599 | Ga0068853_1004365991 | 291 |
| 225 | 3300009011 | Ga0105251_10031795 | Ga0105251_100317953 | 291 |
| 226 | 3300009092 | Ga0105250_10029687 | Ga0105250_100296872 | 291 |
| 227 | 3300009551 | Ga0105238_10073364 | Ga0105238_100733642 | 291 |
| 228 | 3300013306 | Ga0163162_10000884 | Ga0163162_100008849 | 291 |
| 229 | 3300025304 | Ga0209257_1019042 | Ga0209257_10190422 | 291 |
| 230 | 3300025986 | Ga0207658_10036789 | Ga0207658_100367892 | 291 |
| 231 | 3300026067 | Ga0207678_10045341 | Ga0207678_100453415 | 291 |
| 232 | 3300046460 | Ga0495638_0002673 | Ga0495638_0002673_8850_9932 | 291 |
| 233 | 3300046474 | Ga0495605_0002291 | Ga0495605_0002291_9110_10192 | 291 |
| 234 | 3300046523 | Ga0495644_0012388 | Ga0495644_0012388_508_1590 | 291 |
| 235 | 3300046691 | Ga0495670_0000651 | Ga0495670_0000651_9897_10979 | 291 |
| 236 | 3300046692 | Ga0495671_0054645 | Ga0495671_0054645_461_1543 | 291 |
| 237 | 3300046694 | Ga0495649_0087946 | Ga0495649_0087946_71_1153 | 291 |
| 238 | 3300046794 | Ga0495589_0001358 | Ga0495589_0001358_7418_8500 | 291 |
| 239 | 3300046810 | Ga0495660_0063790 | Ga0495660_0063790_740_1822 | 291 |
| 240 | 3300048903 | Ga0496100_0041658 | Ga0496100_0041658_19_1101 | 291 |
| 241 | 3300048905 | Ga0496102_0002957 | Ga0496102_0002957_1070_2152 | 291 |
| 242 | 3300048909 | Ga0496106_0180102 | Ga0496106_0180102_61_1143 | 291 |
| 243 | 3300003316 | rootH1_10003366 | rootH1_100033663 | 292 |
| 244 | 3300047319 | Ga0495674_0005976 | Ga0495674_0005976_3937_5028 | 292 |
| 245 | 3300049823 | Ga0501044_0029722 | Ga0501044_0029722_66_1121 | 292 |
| 246 | 3300046459 | Ga0495629_0000030 | Ga0495629_0000030_61657_62748 | 293 |
| 247 | 3300046463 | Ga0495653_0000372 | Ga0495653_0000372_7959_9050 | 293 |
| 248 | 3300046471 | Ga0495650_0008754 | Ga0495650_0008754_2043_3134 | 293 |
| 249 | 3300046472 | Ga0495580_0009549 | Ga0495580_0009549_757_1848 | 293 |
| 250 | 3300046500 | Ga0495596_0017924 | Ga0495596_0017924_185_1276 | 293 |
| 251 | 3300046506 | Ga0495583_0007257 | Ga0495583_0007257_868_1959 | 293 |
| 252 | 3300046515 | Ga0495620_0009269 | Ga0495620_0009269_2682_3773 | 293 |
| 253 | 3300046517 | Ga0495630_0006214 | Ga0495630_0006214_2032_3123 | 293 |
| 254 | 3300046524 | Ga0495648_0029155 | Ga0495648_0029155_2040_3131 | 293 |
| 255 | 3300046528 | Ga0495642_0062007 | Ga0495642_0062007_36_1127 | 293 |
| 256 | 3300046531 | Ga0495665_0032147 | Ga0495665_0032147_732_1823 | 293 |
| 257 | 3300046542 | Ga0495597_0014047 | Ga0495597_0014047_1490_2581 | 293 |
| 258 | 3300046648 | Ga0495611_0004243 | Ga0495611_0004243_1468_2559 | 293 |
| 259 | 3300046660 | Ga0495625_0036739 | Ga0495625_0036739_1926_3017 | 293 |
| 260 | 3300046680 | Ga0495646_0007543 | Ga0495646_0007543_2249_3340 | 293 |
| 261 | 3300046684 | Ga0495669_0032501 | Ga0495669_0032501_973_2064 | 293 |
| 262 | 3300046690 | Ga0495624_0004546 | Ga0495624_0004546_5749_6840 | 293 |
| 263 | 3300046692 | Ga0495671_0012474 | Ga0495671_0012474_43_1134 | 293 |
| 264 | 3300047319 | Ga0495674_0012028 | Ga0495674_0012028_1817_2908 | 293 |
| 265 | 3300047319 | Ga0495674_0113175 | Ga0495674_0113175_535_1626 | 293 |
| 266 | 3300047323 | Ga0495683_0044232 | Ga0495683_0044232_441_1532 | 293 |
| 267 | 3300047443 | Ga0495687_024134 | Ga0495687_024134_1762_2853 | 293 |
| 268 | 3300047446 | Ga0495679_000006 | Ga0495679_000006_26455_27546 | 293 |
| 269 | 3300047472 | Ga0495686_0009319 | Ga0495686_0009319_2606_3697 | 293 |
| 270 | 3300048089 | Ga0495614_0058214 | Ga0495614_0058214_281_1372 | 293 |
| 271 | 3300048091 | Ga0495626_0002166 | Ga0495626_0002166_10669_11760 | 293 |
| 272 | 3300048920 | Ga0496117_0017904 | Ga0496117_0017904_3301_4392 | 293 |
| 273 | 3300048921 | Ga0496118_0066835 | Ga0496118_0066835_1131_2222 | 293 |
| 274 | 3300048924 | Ga0496121_0024166 | Ga0496121_0024166_4056_5147 | 293 |
| 275 | 3300048929 | Ga0496126_0143656 | Ga0496126_0143656_893_1984 | 293 |
| 276 | 3300049459 | Ga0495678_011148 | Ga0495678_011148_2761_3852 | 293 |
| 277 | 3300049589 | Ga0501073_0043103 | Ga0501073_0043103_583_1665 | 293 |
| 278 | 3300034819 | Ga0373958_0018784 | Ga0373958_0018784_32_1123 | 294 |
| 279 | 3300005468 | Ga0070707_100267244 | Ga0070707_1002672442 | 295 |
| 280 | 3300025922 | Ga0207646_10223926 | Ga0207646_102239262 | 295 |
| 281 | 3300046460 | Ga0495638_0015434 | Ga0495638_0015434_3224_4231 | 295 |
| 282 | 3300046460 | Ga0495638_0175840 | Ga0495638_0175840_85_1092 | 295 |
| 283 | 3300046660 | Ga0495625_0015575 | Ga0495625_0015575_2570_3583 | 295 |
| 284 | 3300049587 | Ga0501071_0080358 | Ga0501071_0080358_902_1894 | 295 |
| 285 | 3300003215 | JGI25153J46596_10007730 | JGI25153J46596_100077305 | 296 |
| 286 | 3300003659 | JGI25404J52841_10002780 | JGI25404J52841_100027803 | 296 |
| 287 | 3300005983 | Ga0081540_1000259 | Ga0081540_100025923 | 296 |
| 288 | 3300025297 | Ga0209758_1000302 | Ga0209758_100030284 | 296 |
| 289 | 3300025297 | Ga0209758_1040992 | Ga0209758_10409922 | 296 |
| 290 | 3300026121 | Ga0207683_10155180 | Ga0207683_101551802 | 296 |
| 291 | 3300031456 | Ga0307513_10255963 | Ga0307513_102559632 | 296 |
| 292 | 3300031731 | Ga0307405_10004235 | Ga0307405_100042356 | 296 |
| 293 | 3300032002 | Ga0307416_100301375 | Ga0307416_1003013752 | 296 |
| 294 | 3300036401 | Ga0373937_0031176 | Ga0373937_0031176_1323_2375 | 296 |
| 295 | 3300046474 | Ga0495605_0080094 | Ga0495605_0080094_214_1269 | 296 |
| 296 | 3300046506 | Ga0495583_0033872 | Ga0495583_0033872_84_1139 | 296 |
| 297 | 3300046507 | Ga0495606_0002420 | Ga0495606_0002420_6001_6990 | 296 |
| 298 | 3300046516 | Ga0495628_0078065 | Ga0495628_0078065_1374_2426 | 296 |
| 299 | 3300046519 | Ga0495632_0026765 | Ga0495632_0026765_1268_2323 | 296 |
| 300 | 3300046615 | Ga0495656_0075287 | Ga0495656_0075287_455_1450 | 296 |
| 301 | 3300046616 | Ga0495668_0018134 | Ga0495668_0018134_2627_3616 | 296 |
| 302 | 3300046694 | Ga0495649_0001209 | Ga0495649_0001209_3976_5031 | 296 |
| 303 | 3300046794 | Ga0495589_0021439 | Ga0495589_0021439_1154_2143 | 296 |
| 304 | 3300047323 | Ga0495683_0117139 | Ga0495683_0117139_17_1006 | 296 |
| 305 | 3300047471 | Ga0495684_0180601 | Ga0495684_0180601_277_1329 | 296 |
| 306 | 3300048091 | Ga0495626_0049264 | Ga0495626_0049264_344_1399 | 296 |
| 307 | 3300049521 | Ga0501298_018446 | Ga0501298_018446_247_1254 | 296 |
| 308 | 3300050493 | nmdc:mga0k408_45756_c1 | nmdc:mga0k408_45756_c1_454_1470 | 296 |
| 309 | 3300005334 | Ga0068869_100010567 | Ga0068869_1000105674 | 297 |
| 310 | 3300005335 | Ga0070666_10004297 | Ga0070666_100042974 | 297 |
| 311 | 3300005338 | Ga0068868_100017463 | Ga0068868_1000174633 | 297 |
| 312 | 3300005340 | Ga0070689_100037579 | Ga0070689_1000375794 | 297 |
| 313 | 3300005355 | Ga0070671_100005389 | Ga0070671_1000053894 | 297 |
| 314 | 3300005457 | Ga0070662_100015606 | Ga0070662_1000156062 | 297 |
| 315 | 3300005459 | Ga0068867_100032819 | Ga0068867_1000328194 | 297 |
| 316 | 3300005578 | Ga0068854_100026167 | Ga0068854_1000261674 | 297 |
| 317 | 3300005616 | Ga0068852_100053837 | Ga0068852_1000538373 | 297 |
| 318 | 3300005617 | Ga0068859_100009755 | Ga0068859_1000097557 | 297 |
| 319 | 3300005840 | Ga0068870_10156067 | Ga0068870_101560672 | 297 |
| 320 | 3300005842 | Ga0068858_100002163 | Ga0068858_10000216310 | 297 |
| 321 | 3300005937 | Ga0081455_10000406 | Ga0081455_1000040630 | 297 |
| 322 | 3300006195 | Ga0075366_10015796 | Ga0075366_100157965 | 297 |
| 323 | 3300006237 | Ga0097621_100001895 | Ga0097621_1000018957 | 297 |
| 324 | 3300006353 | Ga0075370_10058620 | Ga0075370_100586202 | 297 |
| 325 | 3300006358 | Ga0068871_100015705 | Ga0068871_1000157054 | 297 |
| 326 | 3300006931 | Ga0097620_100009754 | Ga0097620_1000097544 | 297 |
| 327 | 3300009093 | Ga0105240_10069514 | Ga0105240_100695144 | 297 |
| 328 | 3300009148 | Ga0105243_10137454 | Ga0105243_101374542 | 297 |
| 329 | 3300009177 | Ga0105248_10002934 | Ga0105248_100029349 | 297 |
| 330 | 3300009545 | Ga0105237_10036421 | Ga0105237_100364213 | 297 |
| 331 | 3300010375 | Ga0105239_10031083 | Ga0105239_100310835 | 297 |
| 332 | 3300013306 | Ga0163162_10014828 | Ga0163162_100148283 | 297 |
| 333 | 3300013308 | Ga0157375_10012157 | Ga0157375_100121574 | 297 |
| 334 | 3300014325 | Ga0163163_10005043 | Ga0163163_100050435 | 297 |
| 335 | 3300014969 | Ga0157376_10023962 | Ga0157376_100239624 | 297 |
| 336 | 3300017792 | Ga0163161_10151909 | Ga0163161_101519092 | 297 |
| 337 | 3300025913 | Ga0207695_10103905 | Ga0207695_101039054 | 297 |
| 338 | 3300025914 | Ga0207671_10109566 | Ga0207671_101095662 | 297 |
| 339 | 3300025921 | Ga0207652_10489255 | Ga0207652_104892551 | 297 |
| 340 | 3300025925 | Ga0207650_10310611 | Ga0207650_103106112 | 297 |
| 341 | 3300025926 | Ga0207659_10000751 | Ga0207659_100007512 | 297 |
| 342 | 3300025931 | Ga0207644_10017644 | Ga0207644_100176445 | 297 |
| 343 | 3300025940 | Ga0207691_10077839 | Ga0207691_100778393 | 297 |
| 344 | 3300025941 | Ga0207711_10220860 | Ga0207711_102208602 | 297 |
| 345 | 3300025942 | Ga0207689_10058298 | Ga0207689_100582981 | 297 |
| 346 | 3300025960 | Ga0207651_10057741 | Ga0207651_100577412 | 297 |
| 347 | 3300025972 | Ga0207668_10271355 | Ga0207668_102713552 | 297 |
| 348 | 3300025986 | Ga0207658_10030132 | Ga0207658_100301322 | 297 |
| 349 | 3300026023 | Ga0207677_10006613 | Ga0207677_100066133 | 297 |
| 350 | 3300026035 | Ga0207703_10005464 | Ga0207703_100054645 | 297 |
| 351 | 3300026041 | Ga0207639_10161576 | Ga0207639_101615762 | 297 |
| 352 | 3300026088 | Ga0207641_10003968 | Ga0207641_100039685 | 297 |
| 353 | 3300026089 | Ga0207648_10056300 | Ga0207648_100563002 | 297 |
| 354 | 3300026095 | Ga0207676_10000082 | Ga0207676_1000008247 | 297 |
| 355 | 3300026116 | Ga0207674_10012581 | Ga0207674_100125813 | 297 |
| 356 | 3300026118 | Ga0207675_100321612 | Ga0207675_1003216122 | 297 |
| 357 | 3300026121 | Ga0207683_10004159 | Ga0207683_100041596 | 297 |
| 358 | 3300026142 | Ga0207698_10092796 | Ga0207698_100927963 | 297 |
| 359 | 3300026142 | Ga0207698_10109804 | Ga0207698_101098041 | 297 |
| 360 | 3300028380 | Ga0268265_10107598 | Ga0268265_101075982 | 297 |
| 361 | 3300028794 | Ga0307515_10011668 | Ga0307515_100116688 | 297 |
| 362 | 3300028794 | Ga0307515_10133373 | Ga0307515_101333733 | 297 |
| 363 | 3300030522 | Ga0307512_10117876 | Ga0307512_101178762 | 297 |
| 364 | 3300031456 | Ga0307513_10017350 | Ga0307513_100173507 | 297 |
| 365 | 3300031507 | Ga0307509_10001630 | Ga0307509_100016307 | 297 |
| 366 | 3300031507 | Ga0307509_10142221 | Ga0307509_101422212 | 297 |
| 367 | 3300031616 | Ga0307508_10003341 | Ga0307508_100033413 | 297 |
| 368 | 3300031616 | Ga0307508_10042418 | Ga0307508_100424183 | 297 |
| 369 | 3300031616 | Ga0307508_10159910 | Ga0307508_101599102 | 297 |
| 370 | 3300031649 | Ga0307514_10011999 | Ga0307514_1001199910 | 297 |
| 371 | 3300031730 | Ga0307516_10000237 | Ga0307516_1000023719 | 297 |
| 372 | 3300031730 | Ga0307516_10199404 | Ga0307516_101994042 | 297 |
| 373 | 3300033179 | Ga0307507_10065050 | Ga0307507_100650502 | 297 |
| 374 | 3300042993 | Ga0439440_0013446 | Ga0439440_0013446_299_1315 | 297 |
| 375 | 3300046472 | Ga0495580_0042349 | Ga0495580_0042349_52_1158 | 297 |
| 376 | 3300048909 | Ga0496106_0091243 | Ga0496106_0091243_1089_2150 | 297 |
| 377 | 3300048911 | Ga0496108_0044702 | Ga0496108_0044702_2097_3158 | 297 |
| 378 | 3300050489 | nmdc:mga03683_11848_c1 | nmdc:mga03683_11848_c1_1127_2167 | 297 |
| 379 | 3300050516 | nmdc:mga0sz30_15060_c2 | nmdc:mga0sz30_15060_c2_557_1597 | 297 |
| 380 | 3300053091 | Ga0500647_0024825 | Ga0500647_0024825_1389_2387 | 297 |
| 381 | 3300053092 | Ga0500583_0023527 | Ga0500583_0023527_386_1384 | 297 |
| 382 | 3300053118 | Ga0500594_0004492 | Ga0500594_0004492_1123_2121 | 297 |
| 383 | 3300053136 | Ga0500559_0000166 | Ga0500559_0000166_7476_8474 | 297 |
| 384 | 3300006846 | Ga0075430_100000011 | Ga0075430_1000000114 | 298 |
| 385 | 3300037471 | Ga0395905_0105098 | Ga0395905_0105098_1197_2210 | 298 |
| 386 | 3300049571 | Ga0501034_0049908 | Ga0501034_0049908_1049_2068 | 298 |
| 387 | 3300049580 | Ga0501046_0147127 | Ga0501046_0147127_298_1308 | 298 |
| 388 | 3300049742 | Ga0501080_0097802 | Ga0501080_0097802_825_1844 | 298 |
| 389 | 3300050509 | nmdc:mga0qj67_20_c1 | nmdc:mga0qj67_20_c1_79287_80312 | 298 |
| 390 | 3300053139 | Ga0500568_0010495 | Ga0500568_0010495_843_1883 | 298 |
| 391 | 3300005328 | Ga0070676_10060682 | Ga0070676_100606822 | 299 |
| 392 | 3300005338 | Ga0068868_100048987 | Ga0068868_1000489873 | 299 |
| 393 | 3300005354 | Ga0070675_100037582 | Ga0070675_1000375825 | 299 |
| 394 | 3300005355 | Ga0070671_100058775 | Ga0070671_1000587753 | 299 |
| 395 | 3300005367 | Ga0070667_100365398 | Ga0070667_1003653981 | 299 |
| 396 | 3300005467 | Ga0070706_100003679 | Ga0070706_10000367921 | 299 |
| 397 | 3300005518 | Ga0070699_100082621 | Ga0070699_1000826212 | 299 |
| 398 | 3300005543 | Ga0070672_100043128 | Ga0070672_1000431283 | 299 |
| 399 | 3300005548 | Ga0070665_100546173 | Ga0070665_1005461731 | 299 |
| 400 | 3300006178 | Ga0075367_10005035 | Ga0075367_100050352 | 299 |
| 401 | 3300006195 | Ga0075366_10027351 | Ga0075366_100273512 | 299 |
| 402 | 3300006353 | Ga0075370_10037674 | Ga0075370_100376744 | 299 |
| 403 | 3300013308 | Ga0157375_10235579 | Ga0157375_102355792 | 299 |
| 404 | 3300025907 | Ga0207645_10010476 | Ga0207645_100104767 | 299 |
| 405 | 3300025931 | Ga0207644_10068093 | Ga0207644_100680934 | 299 |
| 406 | 3300025933 | Ga0207706_10182167 | Ga0207706_101821673 | 299 |
| 407 | 3300025935 | Ga0207709_10093078 | Ga0207709_100930782 | 299 |
| 408 | 3300025940 | Ga0207691_10011487 | Ga0207691_100114878 | 299 |
| 409 | 3300025960 | Ga0207651_10249464 | Ga0207651_102494641 | 299 |
| 410 | 3300025986 | Ga0207658_10320579 | Ga0207658_103205792 | 299 |
| 411 | 3300026023 | Ga0207677_10013065 | Ga0207677_100130656 | 299 |
| 412 | 3300028794 | Ga0307515_10210250 | Ga0307515_102102502 | 299 |
| 413 | 3300031456 | Ga0307513_10035367 | Ga0307513_100353673 | 299 |
| 414 | 3300031649 | Ga0307514_10001174 | Ga0307514_100011748 | 299 |
| 415 | 3300031730 | Ga0307516_10080696 | Ga0307516_100806962 | 299 |
| 416 | 3300042007 | Ga0439449_0048146 | Ga0439449_0048146_395_1411 | 299 |
| 417 | 3300046477 | Ga0495664_0127802 | Ga0495664_0127802_332_1396 | 299 |
| 418 | 3300046528 | Ga0495642_0067382 | Ga0495642_0067382_160_1203 | 299 |
| 419 | 3300047319 | Ga0495674_0013683 | Ga0495674_0013683_419_1483 | 299 |
| 420 | 3300049575 | Ga0501039_0090761 | Ga0501039_0090761_699_1790 | 299 |
| 421 | 3300049588 | Ga0501072_0142486 | Ga0501072_0142486_56_1141 | 299 |
| 422 | 3300049591 | Ga0501075_0050576 | Ga0501075_0050576_1708_2781 | 299 |
| 423 | 3300049592 | Ga0501076_0141985 | Ga0501076_0141985_818_1903 | 299 |
| 424 | 3300049743 | Ga0501081_0085800 | Ga0501081_0085800_1035_2120 | 299 |
| 425 | 3300050489 | nmdc:mga03683_96365_c1 | nmdc:mga03683_96365_c1_216_1259 | 299 |
| 426 | 3300050494 | nmdc:mga06z11_24082_c1 | nmdc:mga06z11_24082_c1_37_1080 | 299 |
| 427 | 3300050496 | nmdc:mga07m45_12383_c1 | nmdc:mga07m45_12383_c1_3290_4330 | 299 |
| 428 | 3300050496 | nmdc:mga07m45_134705_c1 | nmdc:mga07m45_134705_c1_161_1201 | 299 |
| 429 | 3300050496 | nmdc:mga07m45_177981_c1 | nmdc:mga07m45_177981_c1_34_1077 | 299 |
| 430 | 3300054114 | Ga0501084_0047621 | Ga0501084_0047621_1872_2957 | 299 |
| 431 | 3300061734 | Ga0530510_0366707 | Ga0530510_0366707_17_1048 | 299 |
| 432 | 3300005343 | Ga0070687_100142601 | Ga0070687_1001426012 | 300 |
| 433 | 3300005444 | Ga0070694_100036399 | Ga0070694_1000363993 | 300 |
| 434 | 3300005545 | Ga0070695_100324440 | Ga0070695_1003244401 | 300 |
| 435 | 3300005617 | Ga0068859_100024529 | Ga0068859_1000245296 | 300 |
| 436 | 3300005843 | Ga0068860_100079931 | Ga0068860_1000799313 | 300 |
| 437 | 3300005844 | Ga0068862_100013111 | Ga0068862_1000131114 | 300 |
| 438 | 3300006931 | Ga0097620_100024529 | Ga0097620_1000245296 | 300 |
| 439 | 3300009553 | Ga0105249_10053764 | Ga0105249_100537644 | 300 |
| 440 | 3300013306 | Ga0163162_10132892 | Ga0163162_101328922 | 300 |
| 441 | 3300015262 | Ga0182007_10005077 | Ga0182007_100050776 | 300 |
| 442 | 3300025918 | Ga0207662_10051643 | Ga0207662_100516432 | 300 |
| 443 | 3300025936 | Ga0207670_10172299 | Ga0207670_101722992 | 300 |
| 444 | 3300026118 | Ga0207675_100349877 | Ga0207675_1003498772 | 300 |
| 445 | 3300028381 | Ga0268264_10014308 | Ga0268264_100143085 | 300 |
| 446 | 3300028794 | Ga0307515_10000672 | Ga0307515_1000067220 | 300 |
| 447 | 3300031242 | Ga0265329_10012809 | Ga0265329_100128092 | 300 |
| 448 | 3300031249 | Ga0265339_10007126 | Ga0265339_100071265 | 300 |
| 449 | 3300031344 | Ga0265316_10051868 | Ga0265316_100518682 | 300 |
| 450 | 3300031711 | Ga0265314_10049078 | Ga0265314_100490781 | 300 |
| 451 | 3300031712 | Ga0265342_10000093 | Ga0265342_1000009382 | 300 |
| 452 | 3300046454 | Ga0495592_0000211 | Ga0495592_0000211_21049_22068 | 300 |
| 453 | 3300047472 | Ga0495686_0001796 | Ga0495686_0001796_13980_15017 | 300 |
| 454 | 3300048929 | Ga0496126_0023604 | Ga0496126_0023604_560_1666 | 300 |
| 455 | 3300053154 | Ga0500619_012284 | Ga0500619_012284_604_1623 | 300 |
| 456 | 3300005327 | Ga0070658_10022977 | Ga0070658_100229775 | 301 |
| 457 | 3300005336 | Ga0070680_100004657 | Ga0070680_1000046578 | 301 |
| 458 | 3300005344 | Ga0070661_100131055 | Ga0070661_1001310552 | 301 |
| 459 | 3300005366 | Ga0070659_100107566 | Ga0070659_1001075662 | 301 |
| 460 | 3300005458 | Ga0070681_10008829 | Ga0070681_100088294 | 301 |
| 461 | 3300005530 | Ga0070679_100123674 | Ga0070679_1001236743 | 301 |
| 462 | 3300005563 | Ga0068855_100065928 | Ga0068855_1000659284 | 301 |
| 463 | 3300009093 | Ga0105240_10004504 | Ga0105240_1000450413 | 301 |
| 464 | 3300009148 | Ga0105243_10442623 | Ga0105243_104426232 | 301 |
| 465 | 3300009545 | Ga0105237_10001223 | Ga0105237_1000122321 | 301 |
| 466 | 3300025909 | Ga0207705_10110408 | Ga0207705_101104081 | 301 |
| 467 | 3300025912 | Ga0207707_10081739 | Ga0207707_100817394 | 301 |
| 468 | 3300025913 | Ga0207695_10017312 | Ga0207695_100173123 | 301 |
| 469 | 3300025917 | Ga0207660_10082919 | Ga0207660_100829192 | 301 |
| 470 | 3300025932 | Ga0207690_10081960 | Ga0207690_100819602 | 301 |
| 471 | 3300025949 | Ga0207667_10262410 | Ga0207667_102624102 | 301 |
| 472 | 3300028379 | Ga0268266_10313305 | Ga0268266_103133052 | 301 |
| 473 | 3300028800 | Ga0265338_10168694 | Ga0265338_101686942 | 301 |
| 474 | 3300031711 | Ga0265314_10117616 | Ga0265314_101176162 | 301 |
| 475 | 3300031712 | Ga0265342_10004065 | Ga0265342_100040654 | 301 |
| 476 | 3300037068 | Ga0373925_0017392 | Ga0373925_0017392_2454_3485 | 301 |
| 477 | 3300041997 | Ga0439431_0037935 | Ga0439431_0037935_111_1145 | 301 |
| 478 | 3300048916 | Ga0496113_0068939 | Ga0496113_0068939_724_1800 | 301 |
| 479 | 3300049581 | Ga0501047_0046097 | Ga0501047_0046097_2746_3762 | 301 |
| 480 | 3300049590 | Ga0501074_0066721 | Ga0501074_0066721_898_1914 | 301 |
| 481 | 3300049823 | Ga0501044_0028392 | Ga0501044_0028392_2557_3573 | 301 |
| 482 | iso_pu_bacteria | 2643221683 | 2644465022 | 301 |
| 483 | 3300005329 | Ga0070683_100225599 | Ga0070683_1002255992 | 302 |
| 484 | 3300005345 | Ga0070692_10032113 | Ga0070692_100321132 | 302 |
| 485 | 3300005535 | Ga0070684_100071099 | Ga0070684_1000710991 | 302 |
| 486 | 3300005844 | Ga0068862_100012901 | Ga0068862_1000129015 | 302 |
| 487 | 3300005983 | Ga0081540_1081956 | Ga0081540_10819562 | 302 |
| 488 | 3300006881 | Ga0068865_100133254 | Ga0068865_1001332542 | 302 |
| 489 | 3300013306 | Ga0163162_10154108 | Ga0163162_101541083 | 302 |
| 490 | 3300014497 | Ga0182008_10083636 | Ga0182008_100836362 | 302 |
| 491 | 3300025303 | Ga0209051_1028852 | Ga0209051_10288522 | 302 |
| 492 | 3300025906 | Ga0207699_10161523 | Ga0207699_101615232 | 302 |
| 493 | 3300025938 | Ga0207704_10025720 | Ga0207704_100257202 | 302 |
| 494 | 3300025944 | Ga0207661_10264895 | Ga0207661_102648952 | 302 |
| 495 | 3300028380 | Ga0268265_10142511 | Ga0268265_101425112 | 302 |
| 496 | 3300031548 | Ga0307408_100018996 | Ga0307408_1000189964 | 302 |
| 497 | 3300031665 | Ga0316575_10007066 | Ga0316575_100070664 | 302 |
| 498 | 3300031911 | Ga0307412_10205249 | Ga0307412_102052491 | 302 |
| 499 | 3300032005 | Ga0307411_10088323 | Ga0307411_100883232 | 302 |
| 500 | 3300032133 | Ga0316583_10037014 | Ga0316583_100370142 | 302 |
| 501 | 3300037471 | Ga0395905_0009460 | Ga0395905_0009460_6248_7282 | 302 |
| 502 | 3300039437 | Ga0436365_1193388 | Ga0436365_1193388_426_1487 | 302 |
| 503 | 3300041404 | Ga0439436_0006520 | Ga0439436_0006520_1406_2449 | 302 |
| 504 | 3300041406 | Ga0439439_0002593 | Ga0439439_0002593_669_1712 | 302 |
| 505 | 3300041411 | Ga0439466_0010788 | Ga0439466_0010788_1998_3023 | 302 |
| 506 | 3300041411 | Ga0439466_0012675 | Ga0439466_0012675_1669_2712 | 302 |
| 507 | 3300042000 | Ga0439437_003192 | Ga0439437_003192_443_1447 | 302 |
| 508 | 3300042006 | Ga0439432_004409 | Ga0439432_004409_1422_2465 | 302 |
| 509 | 3300042015 | Ga0439462_0002282 | Ga0439462_0002282_466_1509 | 302 |
| 510 | 3300042125 | Ga0450923_009722 | Ga0450923_009722_148_1191 | 302 |
| 511 | 3300042134 | Ga0450898_009755 | Ga0450898_009755_278_1321 | 302 |
| 512 | 3300042435 | Ga0439434_0008961 | Ga0439434_0008961_1277_2320 | 302 |
| 513 | 3300046660 | Ga0495625_0003058 | Ga0495625_0003058_14955_16016 | 302 |
| 514 | 3300050493 | nmdc:mga0k408_37678_c1 | nmdc:mga0k408_37678_c1_1578_2615 | 302 |
| 515 | iso_pu_bacteria | 2831265667 | 2831269297 | 302 |
| 516 | iso_pu_bacteria | 2928084124 | 2928088468 | 302 |
| 517 | 3300005844 | Ga0068862_100386379 | Ga0068862_1003863792 | 303 |
| 518 | 3300006048 | Ga0075363_100018735 | Ga0075363_1000187352 | 303 |
| 519 | 3300006051 | Ga0075364_10009276 | Ga0075364_100092762 | 303 |
| 520 | 3300006058 | Ga0075432_10003126 | Ga0075432_100031266 | 303 |
| 521 | 3300006177 | Ga0075362_10042488 | Ga0075362_100424882 | 303 |
| 522 | 3300006195 | Ga0075366_10042759 | Ga0075366_100427592 | 303 |
| 523 | 3300009551 | Ga0105238_10003525 | Ga0105238_100035259 | 303 |
| 524 | 3300010375 | Ga0105239_10002071 | Ga0105239_1000207121 | 303 |
| 525 | 3300025913 | Ga0207695_10005377 | Ga0207695_100053772 | 303 |
| 526 | 3300025914 | Ga0207671_10169317 | Ga0207671_101693172 | 303 |
| 527 | 3300025924 | Ga0207694_10000920 | Ga0207694_1000092011 | 303 |
| 528 | 3300025924 | Ga0207694_10058823 | Ga0207694_100588234 | 303 |
| 529 | 3300027907 | Ga0207428_10119803 | Ga0207428_101198032 | 303 |
| 530 | 3300028794 | Ga0307515_10011772 | Ga0307515_100117721 | 303 |
| 531 | 3300031616 | Ga0307508_10004594 | Ga0307508_100045947 | 303 |
| 532 | 3300032005 | Ga0307411_10063674 | Ga0307411_100636743 | 303 |
| 533 | 3300037471 | Ga0395905_0011143 | Ga0395905_0011143_4645_5709 | 303 |
| 534 | 3300041405 | Ga0439438_014435 | Ga0439438_014435_1298_2332 | 303 |
| 535 | 3300041410 | Ga0439461_0008949 | Ga0439461_0008949_145_1170 | 303 |
| 536 | 3300041413 | Ga0439465_0000527 | Ga0439465_0000527_2467_3492 | 303 |
| 537 | 3300041997 | Ga0439431_0003203 | Ga0439431_0003203_135_1160 | 303 |
| 538 | 3300041999 | Ga0439433_0000015 | Ga0439433_0000015_12848_13873 | 303 |
| 539 | 3300042002 | Ga0439442_003355 | Ga0439442_003355_536_1561 | 303 |
| 540 | 3300042007 | Ga0439449_0000342 | Ga0439449_0000342_2649_3674 | 303 |
| 541 | 3300042010 | Ga0439452_000945 | Ga0439452_000945_7265_8290 | 303 |
| 542 | 3300042014 | Ga0439457_001906 | Ga0439457_001906_4578_5603 | 303 |
| 543 | 3300042015 | Ga0439462_0005165 | Ga0439462_0005165_1243_2268 | 303 |
| 544 | 3300042115 | Ga0450911_000225 | Ga0450911_000225_8735_9751 | 303 |
| 545 | 3300042138 | Ga0450903_015996 | Ga0450903_015996_85_1119 | 303 |
| 546 | 3300042156 | Ga0439446_0004705 | Ga0439446_0004705_43_1068 | 303 |
| 547 | 3300042435 | Ga0439434_0000280 | Ga0439434_0000280_1244_2269 | 303 |
| 548 | 3300042439 | Ga0439464_0020129 | Ga0439464_0020129_159_1193 | 303 |
| 549 | 3300046543 | Ga0495645_0014319 | Ga0495645_0014319_1014_2102 | 303 |
| 550 | 3300046660 | Ga0495625_0000708 | Ga0495625_0000708_8326_9345 | 303 |
| 551 | 3300046675 | Ga0495657_0131828 | Ga0495657_0131828_209_1342 | 303 |
| 552 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_86157_87188 | 303 |
| 553 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_204648_205679 | 303 |
| 554 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_204328_205359 | 303 |
| 555 | 3300049582 | Ga0501048_0000926 | Ga0501048_0000926_11783_12814 | 303 |
| 556 | 3300049823 | Ga0501044_0143444 | Ga0501044_0143444_458_1489 | 303 |
| 557 | 3300049824 | Ga0501045_0002191 | Ga0501045_0002191_3011_4042 | 303 |
| 558 | 3300050491 | nmdc:mga00v17_3436_c1 | nmdc:mga00v17_3436_c1_2186_3205 | 303 |
| 559 | 3300050492 | nmdc:mga0yw44_4155_c1 | nmdc:mga0yw44_4155_c1_4528_5547 | 303 |
| 560 | 3300050493 | nmdc:mga0k408_5585_c1 | nmdc:mga0k408_5585_c1_1058_2077 | 303 |
| 561 | 3300053138 | Ga0500564_025690 | Ga0500564_025690_1582_2592 | 303 |
| 562 | iso_pu_bacteria | 2904541872 | 2904545368 | 303 |
| 563 | iso_pu_bacteria | 2929160207 | 2929165558 | 303 |
| 564 | 3300003354 | JGI25160J50197_1008753 | JGI25160J50197_10087533 | 304 |
| 565 | 3300003792 | Ga0055540_1001006 | Ga0055540_10010063 | 304 |
| 566 | 3300009148 | Ga0105243_10000437 | Ga0105243_1000043711 | 304 |
| 567 | 3300015261 | Ga0182006_1081093 | Ga0182006_10810931 | 304 |
| 568 | 3300025292 | Ga0209676_1000937 | Ga0209676_100093711 | 304 |
| 569 | 3300025303 | Ga0209051_1000813 | Ga0209051_100081311 | 304 |
| 570 | 3300025935 | Ga0207709_10000571 | Ga0207709_1000057111 | 304 |
| 571 | 3300042532 | Ga0450893_0002631 | Ga0450893_0002631_1396_2439 | 304 |
| 572 | 3300046492 | Ga0495585_0000447 | Ga0495585_0000447_5311_6348 | 304 |
| 573 | 3300046501 | Ga0495607_0000359 | Ga0495607_0000359_24669_25712 | 304 |
| 574 | 3300046506 | Ga0495583_0000563 | Ga0495583_0000563_11520_12557 | 304 |
| 575 | 3300046615 | Ga0495656_0000082 | Ga0495656_0000082_7259_8296 | 304 |
| 576 | 3300047445 | Ga0495677_0032393 | Ga0495677_0032393_438_1481 | 304 |
| 577 | 3300048088 | Ga0495602_0218177 | Ga0495602_0218177_26_1171 | 304 |
| 578 | 3300048929 | Ga0496126_0035988 | Ga0496126_0035988_755_1864 | 304 |
| 579 | 3300049460 | Ga0495682_0005096 | Ga0495682_0005096_3114_4151 | 304 |
| 580 | 3300050489 | nmdc:mga03683_2833_c1 | nmdc:mga03683_2833_c1_3288_4331 | 304 |
| 581 | 3300050490 | nmdc:mga03n38_69487_c1 | nmdc:mga03n38_69487_c1_557_1600 | 304 |
| 582 | 3300050491 | nmdc:mga00v17_127038_c1 | nmdc:mga00v17_127038_c1_218_1261 | 304 |
| 583 | iso_pu_bacteria | 8047673197 | 8047673705 | 304 |
| 584 | 3300025298 | Ga0209050_1014765 | Ga0209050_10147652 | 305 |
| 585 | 3300028800 | Ga0265338_10011296 | Ga0265338_100112969 | 305 |
| 586 | 3300031239 | Ga0265328_10004323 | Ga0265328_100043232 | 305 |
| 587 | 3300031711 | Ga0265314_10012805 | Ga0265314_100128054 | 305 |
| 588 | 3300053108 | Ga0500562_014221 | Ga0500562_014221_129_1178 | 305 |
| 589 | iso_pu_bacteria | 2738541307 | 2738880731 | 305 |
| 590 | iso_pu_bacteria | 2838054893 | 2838059274 | 305 |
| 591 | 3300005295 | Ga0065707_10097975 | Ga0065707_100979752 | 306 |
| 592 | 3300025294 | Ga0209025_1000324 | Ga0209025_100032433 | 306 |
| 593 | 3300046558 | Ga0495633_0000041 | Ga0495633_0000041_37953_38987 | 306 |
| 594 | 3300046674 | Ga0495588_0068187 | Ga0495588_0068187_147_1154 | 306 |
| 595 | 3300053121 | Ga0500607_005158 | Ga0500607_005158_5368_6384 | 306 |
| 596 | 3300053128 | Ga0500626_018297 | Ga0500626_018297_556_1563 | 306 |
| 597 | 3300053141 | Ga0500574_004148 | Ga0500574_004148_1079_2086 | 306 |
| 598 | 3300003784 | Ga0055534_1002821 | Ga0055534_10028212 | 307 |
| 599 | 3300005334 | Ga0068869_100094238 | Ga0068869_1000942383 | 307 |
| 600 | 3300005459 | Ga0068867_100000475 | Ga0068867_10000047515 | 307 |
| 601 | 3300005543 | Ga0070672_100256187 | Ga0070672_1002561872 | 307 |
| 602 | 3300005719 | Ga0068861_100031158 | Ga0068861_1000311582 | 307 |
| 603 | 3300005843 | Ga0068860_100003014 | Ga0068860_1000030144 | 307 |
| 604 | 3300006846 | Ga0075430_100185071 | Ga0075430_1001850712 | 307 |
| 605 | 3300006881 | Ga0068865_100013192 | Ga0068865_1000131922 | 307 |
| 606 | 3300009553 | Ga0105249_10015311 | Ga0105249_100153112 | 307 |
| 607 | 3300013297 | Ga0157378_10047851 | Ga0157378_100478512 | 307 |
| 608 | 3300013306 | Ga0163162_10010549 | Ga0163162_100105498 | 307 |
| 609 | 3300014968 | Ga0157379_10023709 | Ga0157379_100237093 | 307 |
| 610 | 3300017792 | Ga0163161_10110701 | Ga0163161_101107012 | 307 |
| 611 | 3300025284 | Ga0209130_1003401 | Ga0209130_10034012 | 307 |
| 612 | 3300025291 | Ga0209675_1004306 | Ga0209675_10043062 | 307 |
| 613 | 3300025292 | Ga0209676_1008814 | Ga0209676_10088145 | 307 |
| 614 | 3300025303 | Ga0209051_1005757 | Ga0209051_10057577 | 307 |
| 615 | 3300025923 | Ga0207681_10009809 | Ga0207681_100098092 | 307 |
| 616 | 3300025937 | Ga0207669_10064754 | Ga0207669_100647543 | 307 |
| 617 | 3300025942 | Ga0207689_10110595 | Ga0207689_101105951 | 307 |
| 618 | 3300025961 | Ga0207712_10028698 | Ga0207712_100286982 | 307 |
| 619 | 3300026089 | Ga0207648_10011939 | Ga0207648_100119393 | 307 |
| 620 | 3300026118 | Ga0207675_100003260 | Ga0207675_10000326014 | 307 |
| 621 | 3300028381 | Ga0268264_10002750 | Ga0268264_100027503 | 307 |
| 622 | 3300042156 | Ga0439446_0048025 | Ga0439446_0048025_190_1233 | 307 |
| 623 | 3300049572 | Ga0501036_0070638 | Ga0501036_0070638_1491_2528 | 307 |
| 624 | 3300049743 | Ga0501081_0106752 | Ga0501081_0106752_203_1240 | 307 |
| 625 | iso_pu_bacteria | 2513020051 | 2513230582 | 307 |
| 626 | iso_pu_bacteria | 2643221658 | 2644328557 | 307 |
| 627 | iso_pu_bacteria | 2643221672 | 2644399797 | 307 |
| 628 | iso_pu_bacteria | 2929520902 | 2929523005 | 307 |
| 629 | iso_pu_bacteria | 2945909444 | 2945909768 | 307 |
| 630 | 3300005356 | Ga0070674_100031192 | Ga0070674_1000311923 | 308 |
| 631 | 3300005617 | Ga0068859_100120402 | Ga0068859_1001204023 | 308 |
| 632 | 3300006353 | Ga0075370_10004601 | Ga0075370_100046012 | 308 |
| 633 | 3300006931 | Ga0097620_100120402 | Ga0097620_1001204023 | 308 |
| 634 | 3300009148 | Ga0105243_10015432 | Ga0105243_100154325 | 308 |
| 635 | 3300014968 | Ga0157379_10041041 | Ga0157379_100410412 | 308 |
| 636 | 3300028380 | Ga0268265_10223766 | Ga0268265_102237662 | 308 |
| 637 | 3300028381 | Ga0268264_10196170 | Ga0268264_101961702 | 308 |
| 638 | 3300028577 | Ga0265318_10000365 | Ga0265318_1000036512 | 308 |
| 639 | 3300031235 | Ga0265330_10018646 | Ga0265330_100186463 | 308 |
| 640 | 3300031238 | Ga0265332_10001198 | Ga0265332_1000119812 | 308 |
| 641 | 3300031239 | Ga0265328_10001746 | Ga0265328_100017466 | 308 |
| 642 | 3300031240 | Ga0265320_10002741 | Ga0265320_100027413 | 308 |
| 643 | 3300031242 | Ga0265329_10002241 | Ga0265329_100022415 | 308 |
| 644 | 3300031344 | Ga0265316_10003245 | Ga0265316_1000324510 | 308 |
| 645 | 3300031595 | Ga0265313_10016983 | Ga0265313_100169833 | 308 |
| 646 | 3300031711 | Ga0265314_10011751 | Ga0265314_100117514 | 308 |
| 647 | 3300031712 | Ga0265342_10000914 | Ga0265342_1000091410 | 308 |
| 648 | 3300046459 | Ga0495629_0002103 | Ga0495629_0002103_1822_2904 | 308 |
| 649 | 3300046462 | Ga0495651_0151235 | Ga0495651_0151235_382_1464 | 308 |
| 650 | 3300046472 | Ga0495580_0092928 | Ga0495580_0092928_102_1184 | 308 |
| 651 | 3300046517 | Ga0495630_0046692 | Ga0495630_0046692_1698_2780 | 308 |
| 652 | 3300046528 | Ga0495642_0003905 | Ga0495642_0003905_881_1963 | 308 |
| 653 | 3300046530 | Ga0495654_0067222 | Ga0495654_0067222_477_1559 | 308 |
| 654 | 3300046538 | Ga0495609_0029183 | Ga0495609_0029183_1400_2422 | 308 |
| 655 | 3300046543 | Ga0495645_0000238 | Ga0495645_0000238_25343_26425 | 308 |
| 656 | 3300046559 | Ga0495667_0024349 | Ga0495667_0024349_794_1876 | 308 |
| 657 | 3300046689 | Ga0495613_0009049 | Ga0495613_0009049_2138_3220 | 308 |
| 658 | 3300046691 | Ga0495670_0030646 | Ga0495670_0030646_84_1166 | 308 |
| 659 | 3300047315 | Ga0495581_0002045 | Ga0495581_0002045_7699_8781 | 308 |
| 660 | 3300047673 | Ga0495593_0032620 | Ga0495593_0032620_334_1416 | 308 |
| 661 | 3300048907 | Ga0496104_0024340 | Ga0496104_0024340_1870_2952 | 308 |
| 662 | 3300048907 | Ga0496104_0430070 | Ga0496104_0430070_55_1170 | 308 |
| 663 | 3300050493 | nmdc:mga0k408_10388_c1 | nmdc:mga0k408_10388_c1_2436_3461 | 308 |
| 664 | 3300050496 | nmdc:mga07m45_538_c1 | nmdc:mga07m45_538_c1_7336_8361 | 308 |
| 665 | 3300053079 | Ga0500610_0035368 | Ga0500610_0035368_750_1772 | 308 |
| 666 | 3300053091 | Ga0500647_0041190 | Ga0500647_0041190_1170_2183 | 308 |
| 667 | 3300002987 | JGI25159J45721_1008361 | JGI25159J45721_10083613 | 309 |
| 668 | 3300003215 | JGI25153J46596_10012350 | JGI25153J46596_100123502 | 309 |
| 669 | 3300003781 | Ga0055536_1005871 | Ga0055536_10058716 | 309 |
| 670 | 3300003784 | Ga0055534_1004160 | Ga0055534_10041603 | 309 |
| 671 | 3300003790 | Ga0055528_1013569 | Ga0055528_10135692 | 309 |
| 672 | 3300003791 | Ga0055530_10000437 | Ga0055530_100004375 | 309 |
| 673 | 3300005563 | Ga0068855_100101953 | Ga0068855_1001019532 | 309 |
| 674 | 3300009551 | Ga0105238_10000294 | Ga0105238_1000029417 | 309 |
| 675 | 3300010375 | Ga0105239_10001564 | Ga0105239_100015642 | 309 |
| 676 | 3300011119 | Ga0105246_10036001 | Ga0105246_100360012 | 309 |
| 677 | 3300013100 | Ga0157373_10060310 | Ga0157373_100603102 | 309 |
| 678 | 3300013104 | Ga0157370_10011653 | Ga0157370_100116537 | 309 |
| 679 | 3300013104 | Ga0157370_10097136 | Ga0157370_100971363 | 309 |
| 680 | 3300013105 | Ga0157369_10097806 | Ga0157369_100978062 | 309 |
| 681 | 3300025263 | Ga0209565_1000190 | Ga0209565_100019034 | 309 |
| 682 | 3300025273 | Ga0209673_1000209 | Ga0209673_100020929 | 309 |
| 683 | 3300025273 | Ga0209673_1000393 | Ga0209673_100039334 | 309 |
| 684 | 3300025284 | Ga0209130_1001281 | Ga0209130_100128121 | 309 |
| 685 | 3300025291 | Ga0209675_1000300 | Ga0209675_10003008 | 309 |
| 686 | 3300025292 | Ga0209676_1000048 | Ga0209676_100004882 | 309 |
| 687 | 3300025295 | Ga0209564_1000423 | Ga0209564_10004239 | 309 |
| 688 | 3300025298 | Ga0209050_1000012 | Ga0209050_100001282 | 309 |
| 689 | 3300025299 | Ga0209256_1000095 | Ga0209256_1000095206 | 309 |
| 690 | 3300025302 | Ga0207426_1000161 | Ga0207426_100016191 | 309 |
| 691 | 3300025304 | Ga0209257_1000024 | Ga0209257_100002428 | 309 |
| 692 | 3300025914 | Ga0207671_10100648 | Ga0207671_101006481 | 309 |
| 693 | 3300025919 | Ga0207657_10149032 | Ga0207657_101490321 | 309 |
| 694 | 3300025949 | Ga0207667_10217770 | Ga0207667_102177702 | 309 |
| 695 | 3300046453 | Ga0495627_025961 | Ga0495627_025961_31_1065 | 309 |
| 696 | 3300046460 | Ga0495638_0025325 | Ga0495638_0025325_1879_2895 | 309 |
| 697 | 3300046512 | Ga0495610_0020599 | Ga0495610_0020599_1185_2210 | 309 |
| 698 | 3300046518 | Ga0495631_0000176 | Ga0495631_0000176_34365_35390 | 309 |
| 699 | 3300046520 | Ga0495637_0012678 | Ga0495637_0012678_2130_3155 | 309 |
| 700 | 3300046530 | Ga0495654_0003540 | Ga0495654_0003540_5254_6279 | 309 |
| 701 | 3300046660 | Ga0495625_0098470 | Ga0495625_0098470_869_1894 | 309 |
| 702 | 3300046660 | Ga0495625_0129657 | Ga0495625_0129657_32_1057 | 309 |
| 703 | 3300046674 | Ga0495588_0080109 | Ga0495588_0080109_200_1225 | 309 |
| 704 | 3300046692 | Ga0495671_0020441 | Ga0495671_0020441_853_1878 | 309 |
| 705 | 3300047321 | Ga0495676_0016520 | Ga0495676_0016520_910_1935 | 309 |
| 706 | 3300047673 | Ga0495593_0039375 | Ga0495593_0039375_608_1633 | 309 |
| 707 | 3300048089 | Ga0495614_0097801 | Ga0495614_0097801_55_1080 | 309 |
| 708 | 3300048922 | Ga0496119_0049405 | Ga0496119_0049405_132_1157 | 309 |
| 709 | 3300048924 | Ga0496121_0170027 | Ga0496121_0170027_209_1234 | 309 |
| 710 | 3300048925 | Ga0496122_0179699 | Ga0496122_0179699_146_1171 | 309 |
| 711 | 3300048926 | Ga0496123_0021160 | Ga0496123_0021160_193_1227 | 309 |
| 712 | 3300048928 | Ga0496125_0071202 | Ga0496125_0071202_793_1836 | 309 |
| 713 | 3300048929 | Ga0496126_0084685 | Ga0496126_0084685_450_1475 | 309 |
| 714 | 3300053079 | Ga0500610_0091821 | Ga0500610_0091821_436_1461 | 309 |
| 715 | 3300053093 | Ga0500651_0000286 | Ga0500651_0000286_23115_24140 | 309 |
| 716 | 3300053094 | Ga0500566_0029149 | Ga0500566_0029149_1137_2162 | 309 |
| 717 | 3300053110 | Ga0500571_001412 | Ga0500571_001412_1652_2677 | 309 |
| 718 | 3300053117 | Ga0500593_000452 | Ga0500593_000452_8332_9357 | 309 |
| 719 | 3300053118 | Ga0500594_0002152 | Ga0500594_0002152_1186_2211 | 309 |
| 720 | 3300053133 | Ga0500655_000688 | Ga0500655_000688_4070_5095 | 309 |
| 721 | 3300053134 | Ga0500658_0000137 | Ga0500658_0000137_4665_5690 | 309 |
| 722 | 3300053134 | Ga0500658_0000140 | Ga0500658_0000140_28045_29070 | 309 |
| 723 | 3300053139 | Ga0500568_0012170 | Ga0500568_0012170_2221_3246 | 309 |
| 724 | 3300053158 | Ga0500627_0000922 | Ga0500627_0000922_4036_5061 | 309 |
| 725 | 3300053161 | Ga0500634_0001046 | Ga0500634_0001046_5104_6129 | 309 |
| 726 | 3300053162 | Ga0500638_000736 | Ga0500638_000736_6752_7777 | 309 |
| 727 | 3300053177 | Ga0500636_0006898 | Ga0500636_0006898_1684_2709 | 309 |
| 728 | 3300005355 | Ga0070671_100109810 | Ga0070671_1001098102 | 310 |
| 729 | 3300005459 | Ga0068867_100042639 | Ga0068867_1000426392 | 310 |
| 730 | 3300025907 | Ga0207645_10000882 | Ga0207645_1000088226 | 310 |
| 731 | 3300025931 | Ga0207644_10184009 | Ga0207644_101840091 | 310 |
| 732 | 3300032002 | Ga0307416_100147849 | Ga0307416_1001478492 | 310 |
| 733 | iso_pu_bacteria | 2791355137 | 2792840782 | 310 |
| 734 | iso_pu_bacteria | 2885198086 | 2885202990 | 310 |
| 735 | iso_pu_bacteria | 2904449895 | 2904456489 | 310 |
| 736 | iso_pu_bacteria | 2904615490 | 2904623784 | 310 |
| 737 | 3300003187 | JGI25151J46595_10006295 | JGI25151J46595_100062952 | 311 |
| 738 | 3300003316 | rootH1_10019448 | rootH1_100194483 | 311 |
| 739 | 3300003781 | Ga0055536_1006495 | Ga0055536_10064953 | 311 |
| 740 | 3300003791 | Ga0055530_10011770 | Ga0055530_100117703 | 311 |
| 741 | 3300003792 | Ga0055540_1005359 | Ga0055540_10053594 | 311 |
| 742 | 3300003794 | Ga0055531_10007715 | Ga0055531_100077153 | 311 |
| 743 | 3300005328 | Ga0070676_10045023 | Ga0070676_100450232 | 311 |
| 744 | 3300005457 | Ga0070662_100320121 | Ga0070662_1003201212 | 311 |
| 745 | 3300005546 | Ga0070696_100061913 | Ga0070696_1000619132 | 311 |
| 746 | 3300005549 | Ga0070704_100030547 | Ga0070704_1000305472 | 311 |
| 747 | 3300005842 | Ga0068858_100024404 | Ga0068858_1000244044 | 311 |
| 748 | 3300006237 | Ga0097621_100219624 | Ga0097621_1002196242 | 311 |
| 749 | 3300006353 | Ga0075370_10011522 | Ga0075370_100115225 | 311 |
| 750 | 3300009036 | Ga0105244_10010903 | Ga0105244_100109036 | 311 |
| 751 | 3300009098 | Ga0105245_10323620 | Ga0105245_103236201 | 311 |
| 752 | 3300010375 | Ga0105239_10243272 | Ga0105239_102432722 | 311 |
| 753 | 3300011119 | Ga0105246_10101522 | Ga0105246_101015222 | 311 |
| 754 | 3300015261 | Ga0182006_1007490 | Ga0182006_10074904 | 311 |
| 755 | 3300015262 | Ga0182007_10004855 | Ga0182007_100048553 | 311 |
| 756 | 3300025292 | Ga0209676_1000433 | Ga0209676_10004334 | 311 |
| 757 | 3300025294 | Ga0209025_1001026 | Ga0209025_100102635 | 311 |
| 758 | 3300025298 | Ga0209050_1000912 | Ga0209050_100091232 | 311 |
| 759 | 3300025303 | Ga0209051_1000207 | Ga0209051_100020738 | 311 |
| 760 | 3300025304 | Ga0209257_1000249 | Ga0209257_100024996 | 311 |
| 761 | 3300025728 | Ga0207655_1008233 | Ga0207655_10082335 | 311 |
| 762 | 3300025935 | Ga0207709_10001937 | Ga0207709_100019376 | 311 |
| 763 | 3300028380 | Ga0268265_10029770 | Ga0268265_100297703 | 311 |
| 764 | 3300048919 | Ga0496116_0030707 | Ga0496116_0030707_1774_2805 | 311 |
| 765 | 3300048920 | Ga0496117_0010723 | Ga0496117_0010723_1624_2655 | 311 |
| 766 | 3300048921 | Ga0496118_0013061 | Ga0496118_0013061_2160_3191 | 311 |
| 767 | 3300053121 | Ga0500607_014684 | Ga0500607_014684_1693_2733 | 311 |
| 768 | 3300053729 | Ga0500625_010895 | Ga0500625_010895_889_1929 | 311 |
| 769 | iso_pu_bacteria | 2744054900 | 2746090194 | 311 |
| 770 | iso_pu_bacteria | 2744054901 | 2746095634 | 311 |
| 771 | iso_pu_bacteria | 2818991450 | 2819621106 | 311 |
| 772 | 3300005367 | Ga0070667_100045132 | Ga0070667_1000451323 | 312 |
| 773 | 3300005616 | Ga0068852_100063672 | Ga0068852_1000636723 | 312 |
| 774 | 3300015265 | Ga0182005_1033824 | Ga0182005_10338242 | 312 |
| 775 | 3300017792 | Ga0163161_10019895 | Ga0163161_100198954 | 312 |
| 776 | 3300025927 | Ga0207687_10205662 | Ga0207687_102056621 | 312 |
| 777 | 3300026142 | Ga0207698_10083895 | Ga0207698_100838952 | 312 |
| 778 | 3300031251 | Ga0265327_10008996 | Ga0265327_100089962 | 312 |
| 779 | 3300046459 | Ga0495629_0116832 | Ga0495629_0116832_307_1383 | 312 |
| 780 | 3300046475 | Ga0495639_0006956 | Ga0495639_0006956_2979_4055 | 312 |
| 781 | 3300046528 | Ga0495642_0016956 | Ga0495642_0016956_770_1846 | 312 |
| 782 | 3300046535 | Ga0495586_0114980 | Ga0495586_0114980_294_1370 | 312 |
| 783 | 3300046674 | Ga0495588_0018807 | Ga0495588_0018807_160_1236 | 312 |
| 784 | 3300046691 | Ga0495670_0050488 | Ga0495670_0050488_535_1611 | 312 |
| 785 | 3300048089 | Ga0495614_0055441 | Ga0495614_0055441_358_1434 | 312 |
| 786 | 3300048903 | Ga0496100_0001197 | Ga0496100_0001197_11253_12329 | 312 |
| 787 | 3300048904 | Ga0496101_0011059 | Ga0496101_0011059_3472_4548 | 312 |
| 788 | 3300048905 | Ga0496102_0003955 | Ga0496102_0003955_8335_9411 | 312 |
| 789 | 3300048907 | Ga0496104_0006593 | Ga0496104_0006593_7649_8725 | 312 |
| 790 | 3300048908 | Ga0496105_0002074 | Ga0496105_0002074_11158_12234 | 312 |
| 791 | 3300048909 | Ga0496106_0027941 | Ga0496106_0027941_955_2031 | 312 |
| 792 | 3300048913 | Ga0496110_0191439 | Ga0496110_0191439_313_1389 | 312 |
| 793 | 3300046615 | Ga0495656_0000055 | Ga0495656_0000055_20751_21827 | 313 |
| 794 | iso_pu_bacteria | 2599185214 | 2599626399 | 313 |
| 795 | iso_pu_bacteria | 2599185226 | 2599676277 | 313 |
| 796 | iso_pu_bacteria | 2599185227 | 2599682101 | 313 |
| 797 | iso_pu_bacteria | 2599185229 | 2599695751 | 313 |
| 798 | iso_pu_bacteria | 2818991446 | 2819601674 | 313 |
| 799 | iso_pu_bacteria | 2899924645 | 2899930741 | 313 |
| 800 | iso_pu_bacteria | 2928037797 | 2928040938 | 313 |
| 801 | iso_pu_bacteria | 2928044640 | 2928047780 | 313 |
| 802 | iso_pu_bacteria | 2928051484 | 2928055671 | 313 |
| 803 | iso_pu_bacteria | 2928064002 | 2928069769 | 313 |
| 804 | iso_pu_bacteria | 2928070936 | 2928075373 | 313 |
| 805 | 3300014497 | Ga0182008_10002819 | Ga0182008_100028195 | 314 |
| 806 | 3300015261 | Ga0182006_1035995 | Ga0182006_10359952 | 314 |
| 807 | 3300015262 | Ga0182007_10002612 | Ga0182007_100026125 | 314 |
| 808 | 3300046475 | Ga0495639_0008332 | Ga0495639_0008332_2572_3675 | 314 |
| 809 | 3300015683 | Ga0183362_10005 | Ga0183362_10005239 | 315 |
| 810 | 3300025294 | Ga0209025_1026811 | Ga0209025_10268112 | 315 |
| 811 | 3300025298 | Ga0209050_1007525 | Ga0209050_10075253 | 315 |
| 812 | 3300048919 | Ga0496116_0033691 | Ga0496116_0033691_719_1810 | 315 |
| 813 | 3300048920 | Ga0496117_0039334 | Ga0496117_0039334_771_1862 | 315 |
| 814 | 3300048924 | Ga0496121_0132618 | Ga0496121_0132618_112_1194 | 315 |
| 815 | 3300025981 | Ga0207640_10134607 | Ga0207640_101346072 | 316 |
| 816 | 3300031731 | Ga0307405_10240543 | Ga0307405_102405432 | 316 |
| 817 | 3300053122 | Ga0500608_001053 | Ga0500608_001053_4752_5798 | 316 |
| 818 | iso_pu_bacteria | 2738541277 | 2738721372 | 316 |
| 819 | iso_pu_bacteria | 2738543019 | 2739281041 | 316 |
| 820 | 3300002774 | JGI25150J39212_1003328 | JGI25150J39212_10033283 | 317 |
| 821 | 3300003323 | rootH1_10035358 | rootH1_100353583 | 317 |
| 822 | 3300003374 | JGI25161J50226_1004068 | JGI25161J50226_10040683 | 317 |
| 823 | 3300003761 | Ga0055535_1001801 | Ga0055535_10018013 | 317 |
| 824 | 3300003762 | Ga0055542_1000074 | Ga0055542_100007434 | 317 |
| 825 | 3300013102 | Ga0157371_10116193 | Ga0157371_101161932 | 317 |
| 826 | 3300013307 | Ga0157372_10062009 | Ga0157372_100620093 | 317 |
| 827 | 3300025228 | Ga0209672_101000 | Ga0209672_10100012 | 317 |
| 828 | 3300025229 | Ga0209147_100591 | Ga0209147_1005917 | 317 |
| 829 | 3300025242 | Ga0209258_100176 | Ga0209258_100176106 | 317 |
| 830 | 3300025245 | Ga0207425_1000133 | Ga0207425_100013342 | 317 |
| 831 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033237 | 317 |
| 832 | 3300025258 | Ga0209129_1000186 | Ga0209129_100018643 | 317 |
| 833 | 3300025284 | Ga0209130_1000433 | Ga0209130_100043342 | 317 |
| 834 | 3300025294 | Ga0209025_1000947 | Ga0209025_10009477 | 317 |
| 835 | 3300025295 | Ga0209564_1000417 | Ga0209564_100041742 | 317 |
| 836 | 3300025297 | Ga0209758_1000092 | Ga0209758_1000092191 | 317 |
| 837 | 3300025299 | Ga0209256_1000094 | Ga0209256_1000094161 | 317 |
| 838 | 3300025302 | Ga0207426_1000084 | Ga0207426_100008442 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.4717 | 19 | 255 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4225 | 40 | 256 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4073 | 26 | 256 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.3718 | 19 | 255 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.3653 | 40 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7815 | 40 | 275 | 1.10.3470.10 |
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7396 | 44 | 275 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6923 | 40 | 275 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6842 | 40 | 275 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.661 | 40 | 275 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536UBZ2-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9405 | 141 | 302 |
GO:0005886
GO:0015658 |
| AF-A0A6A7YB17-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9325 | 12 | 299 |
GO:0005886
GO:0015658 |
| AF-A0A536S1Y1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9302 | 18 | 308 |
GO:0005886
GO:0015658 |
| AF-A0A1F4F3L2-F1-model_v4 | ABC transporter permease | 0.9284 | 10 | 299 |
GO:0005886
GO:0015658 |
| AF-A0A1Q7CXZ4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9276 | 40 | 310 |
GO:0005886
GO:0015658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar