F482998

General Info

Members Datasets Scaffolds Average Seq Length
838 466 805 328

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0131828|Ga0495657_0131828_209_1342
Length 377
Sequence MSHAAEAIIEKLPSGTHSRPPVRVTRGTRGGATTLAAGSILVLTAATLPWWAPAEHASSWMRDFVEIACYFVFALMWNLLAGYGGMVSIGQQAYFGLGGYAMLVLANGVGVNPFLAVPLGALVAAAVAVPVSFVAFRLAGGYFAIGTWVIAEVFRLGVANISAVGGGSGTSLTALRGIEKATRETATYGLALACTVTAIMGVYLFLRSKRGLALLAIRDNELAAESQGVDVRGMKLAVYVVAALGAGLAGALYFLGNLRISPDAAFSVNWTAFAIFMVVIGGIGRIEGPLVGALIFWGLNKFLSDYGTWYLLGLGLLAIVVTIFFKQGLWGYAQQRWGWSLFPTQRRLAVHDAAVPKRSMPLKRPTDLELHPHAKHQ

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221658 Variovorax sp. Root411 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2643221683 Variovorax sp. Root473 Isolate Unclassified
9 2738541277 Variovorax sp. GV051 Isolate Unclassified
10 2738541307 Variovorax sp. GV008 Isolate Unclassified
11 2738543019 Variovorax sp. GV040 Isolate Unclassified
12 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
13 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
14 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
15 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
16 2818991446 Variovorax sp. 1180 Isolate Unclassified
17 2818991450 Burkholderia sp. 604 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2885198086 Variovorax sp. 679 Isolate Unclassified
21 2899924645 Variovorax sp. 369 Isolate Unclassified
22 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
23 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
24 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
25 2928037797 Variovorax sp. 1126 Isolate Unclassified
26 2928044640 Variovorax sp. 1128 Isolate Unclassified
27 2928051484 Variovorax sp. 1133 Isolate Unclassified
28 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
29 2928070936 Variovorax gossypii 1167 Isolate Unclassified
30 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
31 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
32 2929520902 Variovorax beijingensis 502 Isolate Unclassified
33 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
41 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
42 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
129 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
130 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
159 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
160 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
163 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
238 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
239 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
242 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
243 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
244 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
245 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
246 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
249 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
256 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
266 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
267 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
268 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
269 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
270 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
271 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
272 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
273 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
277 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
282 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
283 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
284 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
285 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
290 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
294 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
295 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
296 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
297 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
298 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
299 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
300 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
301 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
302 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
303 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
304 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
305 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
306 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
307 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
308 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
311 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
312 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
313 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
314 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
315 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
330 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
331 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
332 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
333 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
334 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
335 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
336 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
337 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
338 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
339 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
345 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
346 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
347 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
354 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
355 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
356 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
357 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
358 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
359 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
362 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
363 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
370 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
390 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
395 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
396 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
397 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
398 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
399 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
400 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
401 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
410 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
411 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
412 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
413 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
414 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
415 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
420 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
421 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
422 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
423 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
424 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
425 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
426 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
427 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
432 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
433 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
434 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
435 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
436 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
437 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
440 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
441 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
442 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
443 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
444 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
445 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
446 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
447 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
448 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
449 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
450 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
451 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
452 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
453 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
454 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
455 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
456 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
457 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
458 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
459 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
460 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
461 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
462 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
463 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.94
Metatranscriptomes 0
Isolates 4.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.47
Nodule 0.12
Rhizoplane 3.34
Rhizosphere 72.32
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1003328 3300002774 Bacteria 3785
2 JGI25159J45721_1008361 3300002987 Bacteria 2849
3 JGI25151J46595_10006295 3300003187 Bacteria 5991
4 JGI25153J46596_10007730 3300003215 Bacteria 5235
5 JGI25153J46596_10012350 3300003215 Bacteria 3695
6 rootH1_10003366 3300003316 Bacteria 5707
7 rootH1_10003366 3300003323 Bacteria 132108
8 rootH1_10019448 3300003316 Bacteria 3684
9 rootH1_10035358 3300003323 Bacteria 3597
10 JGI25160J50197_1008753 3300003354 Bacteria 3829
11 JGI25161J50226_1004068 3300003374 Bacteria 3153
12 JGI25404J52841_10002780 3300003659 Bacteria 3369
13 Ga0055535_1001801 3300003761 Bacteria 9374
14 Ga0055542_1000074 3300003762 Bacteria 141185
15 Ga0055536_1005871 3300003781 Bacteria 5890
16 Ga0055536_1006495 3300003781 Bacteria 5438
17 Ga0055534_1002821 3300003784 Bacteria 5797
18 Ga0055534_1004160 3300003784 Bacteria 4280
19 Ga0055528_1013569 3300003790 Bacteria 3077
20 Ga0055530_10000437 3300003791 Bacteria 37027
21 Ga0055530_10011770 3300003791 Bacteria 3109
22 Ga0055540_1001006 3300003792 Bacteria 18172
23 Ga0055540_1005359 3300003792 Bacteria 5424
24 Ga0055531_10007715 3300003794 Bacteria 5810
25 Ga0065707_10097975 3300005295 Bacteria 3124
26 Ga0070658_10022977 3300005327 Bacteria 5006
27 Ga0070676_10045023 3300005328 Bacteria 2569
28 Ga0070676_10060682 3300005328 Bacteria 2247
29 Ga0070683_100225599 3300005329 Bacteria 1780
30 Ga0070677_10012454 3300005333 Bacteria 2954
31 Ga0068869_100010567 3300005334 Bacteria 6026
32 Ga0068869_100094238 3300005334 Bacteria 2257
33 Ga0070666_10004297 3300005335 Bacteria 8669
34 Ga0070666_10050601 3300005335 Bacteria 2795
35 Ga0070680_100004657 3300005336 Bacteria 10314
36 Ga0070680_100063817 3300005336 Bacteria 3018
37 Ga0070680_100284190 3300005336 Bacteria 1402
38 Ga0068868_100017463 3300005338 Bacteria 5347
39 Ga0068868_100048987 3300005338 Bacteria 3315
40 Ga0070689_100037579 3300005340 Bacteria 3702
41 Ga0070689_100078184 3300005340 Bacteria 2594
42 Ga0070687_100002399 3300005343 Bacteria 6997
43 Ga0070687_100142601 3300005343 Bacteria 1397
44 Ga0070661_100131055 3300005344 Bacteria 1883
45 Ga0070692_10032113 3300005345 Bacteria 2637
46 Ga0070692_10054227 3300005345 Bacteria 2092
47 Ga0070669_100002541 3300005353 Bacteria 13186
48 Ga0070669_100011530 3300005353 Bacteria 6274
49 Ga0070675_100004424 3300005354 Bacteria 10710
50 Ga0070675_100007437 3300005354 Bacteria 8460
51 Ga0070675_100037582 3300005354 Bacteria 3945
52 Ga0070675_100049661 3300005354 Bacteria 3444
53 Ga0070675_100137637 3300005354 Bacteria 2085
54 Ga0070671_100005389 3300005355 Bacteria 10200
55 Ga0070671_100058775 3300005355 Bacteria 3200
56 Ga0070671_100109810 3300005355 Bacteria 2316
57 Ga0070674_100031192 3300005356 Bacteria 3529
58 Ga0070673_100003421 3300005364 Bacteria 9883
59 Ga0070688_100075655 3300005365 Bacteria 2165
60 Ga0070659_100107566 3300005366 Bacteria 2249
61 Ga0070667_100005822 3300005367 Bacteria 10280
62 Ga0070667_100012281 3300005367 Bacteria 7084
63 Ga0070667_100045132 3300005367 Bacteria 3705
64 Ga0070667_100072550 3300005367 Bacteria 2934
65 Ga0070667_100365398 3300005367 Bacteria 1309
66 Ga0070710_10085351 3300005437 Bacteria 1852
67 Ga0070701_10001070 3300005438 Bacteria 10012
68 Ga0070694_100036399 3300005444 Bacteria 3260
69 Ga0070663_100311475 3300005455 Bacteria 1263
70 Ga0070678_100004172 3300005456 Bacteria 8155
71 Ga0070678_100009040 3300005456 Bacteria 6003
72 Ga0070678_100031599 3300005456 Bacteria 3655
73 Ga0070678_100033664 3300005456 Bacteria 3561
74 Ga0070662_100015606 3300005457 Bacteria 5091
75 Ga0070662_100320121 3300005457 Bacteria 1265
76 Ga0070681_10008829 3300005458 Bacteria 9898
77 Ga0070681_10154061 3300005458 Bacteria 2224
78 Ga0068867_100000475 3300005459 Bacteria 26647
79 Ga0068867_100032819 3300005459 Bacteria 3757
80 Ga0068867_100042639 3300005459 Bacteria 3320
81 Ga0068867_100072138 3300005459 Bacteria 2584
82 Ga0070706_100003679 3300005467 Bacteria 15006
83 Ga0070707_100267244 3300005468 Bacteria 1663
84 Ga0070699_100082621 3300005518 Bacteria 2801
85 Ga0070679_100123674 3300005530 Bacteria 2570
86 Ga0070684_100071099 3300005535 Bacteria 3062
87 Ga0070697_100088893 3300005536 Bacteria 2552
88 Ga0068853_100436599 3300005539 Bacteria 1230
89 Ga0070672_100043128 3300005543 Bacteria 3476
90 Ga0070672_100256187 3300005543 Bacteria 1475
91 Ga0070686_100000429 3300005544 Bacteria 26355
92 Ga0070695_100033259 3300005545 Bacteria 3226
93 Ga0070695_100157653 3300005545 Bacteria 1590
94 Ga0070695_100324440 3300005545 Bacteria 1146
95 Ga0070696_100061913 3300005546 Bacteria 2618
96 Ga0070693_100011464 3300005547 Bacteria 4465
97 Ga0070665_100546173 3300005548 Bacteria 1171
98 Ga0070704_100030547 3300005549 Bacteria 3611
99 Ga0068855_100065928 3300005563 Bacteria 4221
100 Ga0068855_100101953 3300005563 Bacteria 3304
101 Ga0068854_100026167 3300005578 Bacteria 4007
102 Ga0068854_100285586 3300005578 Bacteria 1330
103 Ga0070702_100005177 3300005615 Bacteria 6040
104 Ga0068852_100022799 3300005616 Bacteria 5027
105 Ga0068852_100053837 3300005616 Bacteria 3466
106 Ga0068852_100063672 3300005616 Bacteria 3212
107 Ga0068852_100559308 3300005616 Bacteria 1145
108 Ga0068859_100009755 3300005617 Bacteria 9698
109 Ga0068859_100024529 3300005617 Bacteria 6050
110 Ga0068859_100040558 3300005617 Bacteria 4672
111 Ga0068859_100120402 3300005617 Bacteria 2691
112 Ga0068859_100146009 3300005617 Bacteria 2441
113 Ga0068866_10001488 3300005718 Bacteria 9981
114 Ga0068866_10003115 3300005718 Bacteria 6835
115 Ga0068861_100005103 3300005719 Bacteria 8851
116 Ga0068861_100024434 3300005719 Bacteria 4370
117 Ga0068861_100031158 3300005719 Bacteria 3915
118 Ga0068861_100291818 3300005719 Bacteria 1409
119 Ga0068870_10156067 3300005840 Bacteria 1349
120 Ga0068863_100019955 3300005841 Bacteria 6411
121 Ga0068858_100002163 3300005842 Bacteria 19932
122 Ga0068858_100021194 3300005842 Bacteria 6068
123 Ga0068858_100024404 3300005842 Bacteria 5634
124 Ga0068860_100003014 3300005843 Bacteria 17401
125 Ga0068860_100005159 3300005843 Bacteria 13279
126 Ga0068860_100017256 3300005843 Bacteria 7036
127 Ga0068860_100079931 3300005843 Bacteria 3109
128 Ga0068862_100012901 3300005844 Bacteria 6911
129 Ga0068862_100013111 3300005844 Bacteria 6855
130 Ga0068862_100014582 3300005844 Bacteria 6526
131 Ga0068862_100386379 3300005844 Bacteria 1307
132 Ga0081455_10000406 3300005937 Bacteria 56681
133 Ga0081455_10114206 3300005937 Bacteria 2140
134 Ga0081540_1000259 3300005983 Bacteria 55849
135 Ga0081540_1081956 3300005983 Bacteria 1449
136 Ga0081539_10048027 3300005985 Bacteria 2431
137 Ga0075365_10046701 3300006038 Bacteria 2844
138 Ga0075365_10197692 3300006038 Bacteria 1408
139 Ga0075363_100016942 3300006048 Bacteria 3606
140 Ga0075363_100018735 3300006048 Bacteria 3453
141 Ga0075364_10009276 3300006051 Bacteria 5898
142 Ga0075432_10003126 3300006058 Bacteria 5595
143 Ga0075362_10037676 3300006177 Bacteria 2121
144 Ga0075362_10042488 3300006177 Bacteria 2009
145 Ga0075367_10005035 3300006178 Bacteria 6514
146 Ga0075367_10160145 3300006178 Bacteria 1399
147 Ga0075369_10039226 3300006186 Bacteria 2022
148 Ga0075366_10015796 3300006195 Bacteria 4334
149 Ga0075366_10027351 3300006195 Bacteria 3345
150 Ga0075366_10040728 3300006195 Bacteria 2748
151 Ga0075366_10042759 3300006195 Bacteria 2683
152 Ga0075366_10209430 3300006195 Bacteria 1186
153 Ga0097621_100001895 3300006237 Bacteria 14283
154 Ga0097621_100008539 3300006237 Bacteria 7378
155 Ga0097621_100219624 3300006237 Bacteria 1656
156 Ga0075370_10000115 3300006353 Bacteria 26175
157 Ga0075370_10001048 3300006353 Bacteria 11491
158 Ga0075370_10004601 3300006353 Bacteria 6729
159 Ga0075370_10011522 3300006353 Bacteria 4650
160 Ga0075370_10037674 3300006353 Bacteria 2719
161 Ga0075370_10058620 3300006353 Bacteria 2190
162 Ga0075370_10077604 3300006353 Bacteria 1906
163 Ga0068871_100002438 3300006358 Bacteria 12709
164 Ga0068871_100015705 3300006358 Bacteria 5679
165 Ga0075428_100141555 3300006844 Bacteria 2615
166 Ga0075430_100000011 3300006846 Bacteria 99671
167 Ga0075430_100007190 3300006846 Bacteria 9391
168 Ga0075430_100185071 3300006846 Bacteria 1732
169 Ga0075431_100001116 3300006847 Bacteria 24069
170 Ga0075431_100011272 3300006847 Bacteria 9005
171 Ga0075429_100185676 3300006880 Bacteria 1822
172 Ga0068865_100003857 3300006881 Bacteria 8991
173 Ga0068865_100008332 3300006881 Bacteria 6405
174 Ga0068865_100013192 3300006881 Bacteria 5218
175 Ga0068865_100133254 3300006881 Bacteria 1864
176 Ga0075436_100016182 3300006914 Bacteria 5106
177 Ga0097620_100009754 3300006931 Bacteria 9698
178 Ga0097620_100024529 3300006931 Bacteria 6050
179 Ga0097620_100040559 3300006931 Bacteria 4672
180 Ga0097620_100120402 3300006931 Bacteria 2691
181 Ga0097620_100146007 3300006931 Bacteria 2441
182 Ga0075435_100010188 3300007076 Bacteria 6867
183 Ga0105251_10031795 3300009011 Bacteria 2637
184 Ga0105244_10010903 3300009036 Bacteria 5481
185 Ga0105250_10029687 3300009092 Bacteria 2200
186 Ga0105240_10004504 3300009093 Bacteria 21177
187 Ga0105240_10069514 3300009093 Bacteria 4358
188 Ga0111539_10020595 3300009094 Bacteria 8122
189 Ga0105245_10006822 3300009098 Bacteria 10021
190 Ga0105245_10323620 3300009098 Bacteria 1520
191 Ga0114129_10002200 3300009147 Bacteria 26859
192 Ga0114129_10037178 3300009147 Bacteria 6874
193 Ga0105243_10000437 3300009148 Bacteria 43696
194 Ga0105243_10015432 3300009148 Bacteria 5772
195 Ga0105243_10137454 3300009148 Bacteria 2081
196 Ga0105243_10442623 3300009148 Bacteria 1217
197 Ga0105242_10021786 3300009176 Bacteria 5035
198 Ga0105242_10091387 3300009176 Bacteria 2562
199 Ga0105248_10002934 3300009177 Bacteria 18928
200 Ga0105248_10085241 3300009177 Bacteria 3555
201 Ga0105237_10001223 3300009545 Bacteria 34228
202 Ga0105237_10036421 3300009545 Bacteria 4979
203 Ga0105238_10000294 3300009551 Bacteria 55283
204 Ga0105238_10003525 3300009551 Bacteria 15594
205 Ga0105238_10073364 3300009551 Bacteria 3417
206 Ga0105249_10015311 3300009553 Bacteria 6788
207 Ga0105249_10053764 3300009553 Bacteria 3681
208 Ga0105249_10085915 3300009553 Bacteria 2933
209 Ga0105249_10110555 3300009553 Bacteria 2597
210 Ga0105239_10001564 3300010375 Bacteria 30239
211 Ga0105239_10002071 3300010375 Bacteria 25990
212 Ga0105239_10031083 3300010375 Bacteria 5874
213 Ga0105239_10243272 3300010375 Bacteria 2020
214 Ga0105246_10036001 3300011119 Bacteria 3313
215 Ga0105246_10101522 3300011119 Bacteria 2096
216 Ga0157373_10060310 3300013100 Bacteria 2688
217 Ga0157371_10116193 3300013102 Bacteria 1901
218 Ga0157370_10011653 3300013104 Bacteria 9180
219 Ga0157370_10097136 3300013104 Bacteria 2763
220 Ga0157369_10097806 3300013105 Bacteria 3130
221 Ga0157374_10263462 3300013296 Bacteria 1698
222 Ga0157378_10004967 3300013297 Bacteria 11663
223 Ga0157378_10047851 3300013297 Bacteria 3802
224 Ga0163162_10000884 3300013306 Bacteria 27877
225 Ga0163162_10010549 3300013306 Bacteria 8986
226 Ga0163162_10014828 3300013306 Bacteria 7611
227 Ga0163162_10033293 3300013306 Bacteria 5120
228 Ga0163162_10132892 3300013306 Bacteria 2598
229 Ga0163162_10154108 3300013306 Bacteria 2417
230 Ga0163162_10215572 3300013306 Bacteria 2050
231 Ga0163162_10307820 3300013306 Bacteria 1717
232 Ga0163162_10626949 3300013306 Bacteria 1200
233 Ga0157372_10062009 3300013307 Bacteria 4188
234 Ga0157375_10012157 3300013308 Bacteria 7629
235 Ga0157375_10014933 3300013308 Bacteria 6943
236 Ga0157375_10235579 3300013308 Bacteria 1990
237 Ga0163163_10005043 3300014325 Bacteria 11381
238 Ga0163163_10047540 3300014325 Bacteria 4218
239 Ga0157380_10000886 3300014326 Bacteria 18809
240 Ga0157380_10377499 3300014326 Bacteria 1337
241 Ga0182008_10002819 3300014497 Bacteria 10747
242 Ga0182008_10083636 3300014497 Bacteria 1571
243 Ga0157379_10018782 3300014968 Bacteria 6096
244 Ga0157379_10023709 3300014968 Bacteria 5448
245 Ga0157379_10041041 3300014968 Bacteria 4130
246 Ga0157376_10023962 3300014969 Bacteria 4787
247 Ga0182006_1007490 3300015261 Bacteria 4993
248 Ga0182006_1035995 3300015261 Bacteria 1970
249 Ga0182006_1081093 3300015261 Bacteria 1183
250 Ga0182007_10002612 3300015262 Bacteria 8871
251 Ga0182007_10004855 3300015262 Bacteria 6009
252 Ga0182007_10005077 3300015262 Bacteria 5845
253 Ga0182005_1033824 3300015265 Bacteria 1390
254 Ga0183362_10005 3300015683 Bacteria 437616
255 Ga0163161_10003368 3300017792 Bacteria 11212
256 Ga0163161_10019895 3300017792 Bacteria 4708
257 Ga0163161_10110701 3300017792 Bacteria 2053
258 Ga0163161_10151909 3300017792 Bacteria 1760
259 Ga0213872_10077172 3300021361 Bacteria 1498
260 Ga0209672_101000 3300025228 Bacteria 12370
261 Ga0209147_100591 3300025229 Bacteria 20040
262 Ga0209258_100176 3300025242 Bacteria 141261
263 Ga0207425_1000133 3300025245 Bacteria 67802
264 Ga0209148_1000033 3300025254 Bacteria 555508
265 Ga0209129_1000186 3300025258 Bacteria 85793
266 Ga0209565_1000190 3300025263 Bacteria 75207
267 Ga0209673_1000209 3300025273 Bacteria 117670
268 Ga0209673_1000393 3300025273 Bacteria 78531
269 Ga0209130_1000433 3300025284 Bacteria 44915
270 Ga0209130_1001281 3300025284 Bacteria 17402
271 Ga0209130_1003401 3300025284 Bacteria 6802
272 Ga0209675_1000300 3300025291 Bacteria 45407
273 Ga0209675_1004306 3300025291 Bacteria 6387
274 Ga0209676_1000048 3300025292 Bacteria 403716
275 Ga0209676_1000433 3300025292 Bacteria 72480
276 Ga0209676_1000937 3300025292 Bacteria 35920
277 Ga0209676_1008814 3300025292 Bacteria 4440
278 Ga0209025_1000324 3300025294 Bacteria 106257
279 Ga0209025_1000947 3300025294 Bacteria 44024
280 Ga0209025_1001026 3300025294 Bacteria 41040
281 Ga0209025_1026811 3300025294 Bacteria 2878
282 Ga0209564_1000417 3300025295 Bacteria 74808
283 Ga0209564_1000423 3300025295 Bacteria 74528
284 Ga0209758_1000092 3300025297 Bacteria 241910
285 Ga0209758_1000302 3300025297 Bacteria 96619
286 Ga0209758_1040992 3300025297 Bacteria 1738
287 Ga0209050_1000012 3300025298 Bacteria 813717
288 Ga0209050_1000912 3300025298 Bacteria 39073
289 Ga0209050_1007525 3300025298 Bacteria 6076
290 Ga0209050_1014765 3300025298 Bacteria 3336
291 Ga0209256_1000094 3300025299 Bacteria 208177
292 Ga0209256_1000095 3300025299 Bacteria 206120
293 Ga0207426_1000084 3300025302 Bacteria 298123
294 Ga0207426_1000161 3300025302 Bacteria 172765
295 Ga0209051_1000207 3300025303 Bacteria 103683
296 Ga0209051_1000813 3300025303 Bacteria 32442
297 Ga0209051_1005757 3300025303 Bacteria 7150
298 Ga0209051_1028852 3300025303 Bacteria 2183
299 Ga0209257_1000024 3300025304 Bacteria 726068
300 Ga0209257_1000249 3300025304 Bacteria 124522
301 Ga0209257_1019042 3300025304 Bacteria 2605
302 Ga0207655_1008233 3300025728 Bacteria 6644
303 Ga0207682_10014967 3300025893 Bacteria 3021
304 Ga0207642_10012683 3300025899 Bacteria 3051
305 Ga0207642_10020102 3300025899 Bacteria 2600
306 Ga0207642_10209556 3300025899 Bacteria 1082
307 Ga0207680_10004267 3300025903 Bacteria 6774
308 Ga0207699_10161523 3300025906 Bacteria 1491
309 Ga0207645_10000882 3300025907 Bacteria 24904
310 Ga0207645_10005563 3300025907 Bacteria 9123
311 Ga0207645_10010476 3300025907 Bacteria 6364
312 Ga0207643_10015529 3300025908 Bacteria 4145
313 Ga0207705_10110408 3300025909 Bacteria 2031
314 Ga0207707_10081739 3300025912 Bacteria 2820
315 Ga0207707_10159721 3300025912 Bacteria 1971
316 Ga0207695_10005377 3300025913 Bacteria 17023
317 Ga0207695_10017312 3300025913 Bacteria 8390
318 Ga0207695_10103905 3300025913 Bacteria 2832
319 Ga0207671_10100648 3300025914 Bacteria 2189
320 Ga0207671_10109566 3300025914 Bacteria 2100
321 Ga0207671_10169317 3300025914 Bacteria 1696
322 Ga0207660_10026584 3300025917 Bacteria 3942
323 Ga0207660_10082919 3300025917 Bacteria 2359
324 Ga0207662_10015308 3300025918 Bacteria 4316
325 Ga0207662_10051643 3300025918 Bacteria 2446
326 Ga0207657_10149032 3300025919 Bacteria 1907
327 Ga0207652_10489255 3300025921 Bacteria 1108
328 Ga0207646_10223926 3300025922 Bacteria 1699
329 Ga0207681_10005854 3300025923 Bacteria 7536
330 Ga0207681_10009809 3300025923 Bacteria 5856
331 Ga0207694_10000920 3300025924 Bacteria 26083
332 Ga0207694_10058823 3300025924 Bacteria 2989
333 Ga0207650_10310611 3300025925 Bacteria 1289
334 Ga0207659_10000751 3300025926 Bacteria 19207
335 Ga0207659_10007262 3300025926 Bacteria 6806
336 Ga0207687_10205662 3300025927 Bacteria 1541
337 Ga0207644_10017644 3300025931 Bacteria 4825
338 Ga0207644_10068093 3300025931 Bacteria 2596
339 Ga0207644_10184009 3300025931 Bacteria 1639
340 Ga0207690_10081960 3300025932 Bacteria 2256
341 Ga0207706_10010371 3300025933 Bacteria 8510
342 Ga0207706_10182167 3300025933 Bacteria 1845
343 Ga0207686_10016638 3300025934 Bacteria 4128
344 Ga0207709_10000571 3300025935 Bacteria 31043
345 Ga0207709_10001937 3300025935 Bacteria 13608
346 Ga0207709_10093078 3300025935 Bacteria 1975
347 Ga0207670_10001410 3300025936 Bacteria 12623
348 Ga0207670_10172299 3300025936 Bacteria 1624
349 Ga0207669_10001860 3300025937 Bacteria 8951
350 Ga0207669_10064754 3300025937 Bacteria 2264
351 Ga0207704_10004612 3300025938 Bacteria 6318
352 Ga0207704_10008403 3300025938 Bacteria 4935
353 Ga0207704_10025720 3300025938 Bacteria 3217
354 Ga0207691_10009795 3300025940 Bacteria 9200
355 Ga0207691_10011487 3300025940 Bacteria 8499
356 Ga0207691_10077839 3300025940 Bacteria 2986
357 Ga0207711_10220860 3300025941 Bacteria 1733
358 Ga0207689_10002269 3300025942 Bacteria 18022
359 Ga0207689_10007463 3300025942 Bacteria 9586
360 Ga0207689_10058298 3300025942 Bacteria 3176
361 Ga0207689_10110595 3300025942 Bacteria 2258
362 Ga0207661_10264895 3300025944 Bacteria 1532
363 Ga0207667_10217770 3300025949 Bacteria 1956
364 Ga0207667_10262410 3300025949 Bacteria 1766
365 Ga0207651_10057741 3300025960 Bacteria 2678
366 Ga0207651_10135542 3300025960 Bacteria 1893
367 Ga0207651_10249464 3300025960 Bacteria 1451
368 Ga0207712_10028698 3300025961 Bacteria 3724
369 Ga0207668_10025649 3300025972 Bacteria 3817
370 Ga0207668_10271355 3300025972 Bacteria 1387
371 Ga0207640_10134607 3300025981 Bacteria 1792
372 Ga0207658_10030132 3300025986 Bacteria 3839
373 Ga0207658_10036789 3300025986 Bacteria 3512
374 Ga0207658_10320579 3300025986 Bacteria 1341
375 Ga0207677_10006613 3300026023 Bacteria 6359
376 Ga0207677_10013065 3300026023 Bacteria 4798
377 Ga0207703_10005464 3300026035 Bacteria 10219
378 Ga0207639_10161576 3300026041 Bacteria 1888
379 Ga0207678_10045341 3300026067 Bacteria 3802
380 Ga0207678_10076256 3300026067 Bacteria 2872
381 Ga0207678_10173601 3300026067 Bacteria 1840
382 Ga0207708_10000875 3300026075 Bacteria 22680
383 Ga0207708_10009916 3300026075 Bacteria 7072
384 Ga0207641_10003968 3300026088 Bacteria 12923
385 Ga0207648_10004621 3300026089 Bacteria 14105
386 Ga0207648_10011939 3300026089 Bacteria 8154
387 Ga0207648_10015693 3300026089 Bacteria 6951
388 Ga0207648_10056300 3300026089 Bacteria 3432
389 Ga0207676_10000082 3300026095 Bacteria 92500
390 Ga0207676_10463357 3300026095 Bacteria 1197
391 Ga0207674_10012581 3300026116 Bacteria 9456
392 Ga0207675_100000138 3300026118 Bacteria 62372
393 Ga0207675_100003260 3300026118 Bacteria 15894
394 Ga0207675_100010824 3300026118 Bacteria 8546
395 Ga0207675_100321612 3300026118 Bacteria 1510
396 Ga0207675_100349877 3300026118 Bacteria 1448
397 Ga0207683_10004159 3300026121 Bacteria 12528
398 Ga0207683_10012408 3300026121 Bacteria 7271
399 Ga0207683_10039123 3300026121 Bacteria 4137
400 Ga0207683_10155180 3300026121 Bacteria 2067
401 Ga0207698_10083895 3300026142 Bacteria 2581
402 Ga0207698_10092796 3300026142 Bacteria 2476
403 Ga0207698_10109804 3300026142 Bacteria 2309
404 Ga0207428_10119803 3300027907 Bacteria 2019
405 Ga0268266_10313305 3300028379 Bacteria 1467
406 Ga0268265_10013132 3300028380 Bacteria 5626
407 Ga0268265_10029770 3300028380 Bacteria 3925
408 Ga0268265_10107598 3300028380 Bacteria 2268
409 Ga0268265_10142511 3300028380 Bacteria 2008
410 Ga0268265_10223766 3300028380 Bacteria 1648
411 Ga0268264_10002750 3300028381 Bacteria 15365
412 Ga0268264_10014308 3300028381 Bacteria 6524
413 Ga0268264_10018708 3300028381 Bacteria 5664
414 Ga0268264_10196170 3300028381 Bacteria 1843
415 Ga0265318_10000365 3300028577 Bacteria 35710
416 Ga0265336_10006700 3300028666 Bacteria 4131
417 Ga0307515_10000672 3300028794 Bacteria 78835
418 Ga0307515_10011668 3300028794 Bacteria 16643
419 Ga0307515_10011772 3300028794 Bacteria 16555
420 Ga0307515_10133373 3300028794 Bacteria 2718
421 Ga0307515_10210250 3300028794 Bacteria 1792
422 Ga0265338_10011296 3300028800 Bacteria 10334
423 Ga0265338_10168694 3300028800 Bacteria 1681
424 Ga0307512_10117876 3300030522 Bacteria 1719
425 Ga0265330_10018646 3300031235 Bacteria 3185
426 Ga0265332_10001198 3300031238 Bacteria 15028
427 Ga0265328_10001746 3300031239 Bacteria 9943
428 Ga0265328_10004323 3300031239 Bacteria 6175
429 Ga0265320_10002741 3300031240 Bacteria 12184
430 Ga0265320_10033662 3300031240 Bacteria 2613
431 Ga0265329_10002241 3300031242 Bacteria 8909
432 Ga0265329_10012809 3300031242 Bacteria 3006
433 Ga0265339_10006993 3300031249 Bacteria 7334
434 Ga0265339_10007126 3300031249 Bacteria 7259
435 Ga0265327_10008996 3300031251 Bacteria 7312
436 Ga0265316_10003245 3300031344 Bacteria 16520
437 Ga0265316_10051868 3300031344 Bacteria 3221
438 Ga0307513_10017350 3300031456 Bacteria 8633
439 Ga0307513_10035367 3300031456 Bacteria 5589
440 Ga0307513_10255963 3300031456 Bacteria 1544
441 Ga0307509_10001630 3300031507 Bacteria 37623
442 Ga0307509_10142221 3300031507 Bacteria 2332
443 Ga0307408_100018996 3300031548 Bacteria 4622
444 Ga0265313_10016983 3300031595 Bacteria 4160
445 Ga0307508_10003341 3300031616 Bacteria 16294
446 Ga0307508_10004594 3300031616 Bacteria 13432
447 Ga0307508_10042418 3300031616 Bacteria 4081
448 Ga0307508_10159910 3300031616 Bacteria 1856
449 Ga0307514_10001174 3300031649 Bacteria 35389
450 Ga0307514_10011999 3300031649 Bacteria 7211
451 Ga0316575_10007066 3300031665 Bacteria 4061
452 Ga0265314_10010702 3300031711 Bacteria 7633
453 Ga0265314_10011751 3300031711 Bacteria 7201
454 Ga0265314_10012805 3300031711 Bacteria 6815
455 Ga0265314_10049078 3300031711 Bacteria 2958
456 Ga0265314_10117616 3300031711 Bacteria 1679
457 Ga0265342_10000093 3300031712 Bacteria 98424
458 Ga0265342_10000914 3300031712 Bacteria 29315
459 Ga0265342_10004065 3300031712 Bacteria 11667
460 Ga0265342_10010019 3300031712 Bacteria 6617
461 Ga0307516_10000237 3300031730 Bacteria 70929
462 Ga0307516_10080696 3300031730 Bacteria 3097
463 Ga0307516_10199404 3300031730 Bacteria 1722
464 Ga0307405_10004235 3300031731 Bacteria 6750
465 Ga0307405_10240543 3300031731 Bacteria 1340
466 Ga0307412_10205249 3300031911 Bacteria 1499
467 Ga0307409_100095209 3300031995 Bacteria 2453
468 Ga0307416_100147849 3300032002 Bacteria 2149
469 Ga0307416_100301375 3300032002 Bacteria 1593
470 Ga0307411_10063674 3300032005 Bacteria 2465
471 Ga0307411_10088323 3300032005 Bacteria 2156
472 Ga0316583_10037014 3300032133 Bacteria 1729
473 Ga0307507_10065050 3300033179 Bacteria 3358
474 Ga0373930_0017659 3300034816 Bacteria 1363
475 Ga0373958_0018784 3300034819 Bacteria 1257
476 Ga0373941_0061248 3300035115 Bacteria 1225
477 Ga0373941_0065509 3300035115 Bacteria 1193
478 Ga0373956_0012298 3300035119 Bacteria 3546
479 Ga0373946_0039065 3300035171 Bacteria 1936
480 Ga0373955_0078270 3300035172 Bacteria 1863
481 Ga0373955_0166743 3300035172 Bacteria 1302
482 Ga0373942_0093131 3300035207 Bacteria 911
483 Ga0373961_0026240 3300035241 Bacteria 1591
484 Ga0373931_0003357 3300035691 Bacteria 7174
485 Ga0373931_0008665 3300035691 Bacteria 4835
486 Ga0373927_0044393 3300035695 Unclassified 2876
487 Ga0373937_0031176 3300036401 Bacteria 4829
488 Ga0373925_0017392 3300037068 Bacteria 5211
489 Ga0395905_0009460 3300037471 Bacteria 9520
490 Ga0395905_0011143 3300037471 Bacteria 8695
491 Ga0395905_0105098 3300037471 Bacteria 2651
492 Ga0436365_1193388 3300039437 Bacteria 1672
493 Ga0439436_0006520 3300041404 Bacteria 3582
494 Ga0439438_014435 3300041405 Bacteria 2351
495 Ga0439439_0002593 3300041406 Bacteria 3865
496 Ga0439461_0008949 3300041410 Bacteria 1806
497 Ga0439466_0010788 3300041411 Bacteria 3392
498 Ga0439466_0012675 3300041411 Bacteria 3099
499 Ga0439465_0000527 3300041413 Bacteria 11451
500 Ga0439431_0003203 3300041997 Bacteria 3597
501 Ga0439431_0037935 3300041997 Bacteria 1218
502 Ga0439433_0000015 3300041999 Bacteria 22784
503 Ga0439437_003192 3300042000 Bacteria 1766
504 Ga0439442_003355 3300042002 Bacteria 3165
505 Ga0439432_004409 3300042006 Bacteria 5140
506 Ga0439449_0000342 3300042007 Bacteria 16936
507 Ga0439449_0048146 3300042007 Bacteria 1578
508 Ga0439452_000945 3300042010 Bacteria 13044
509 Ga0439457_001906 3300042014 Bacteria 6144
510 Ga0439462_0002282 3300042015 Bacteria 4433
511 Ga0439462_0005165 3300042015 Bacteria 3208
512 Ga0450911_000225 3300042115 Bacteria 21810
513 Ga0450923_009722 3300042125 Bacteria 1690
514 Ga0450898_009755 3300042134 Bacteria 1541
515 Ga0450903_015996 3300042138 Bacteria 1179
516 Ga0439446_0004705 3300042156 Bacteria 3468
517 Ga0439446_0048025 3300042156 Bacteria 1270
518 Ga0439458_0023601 3300042157 Bacteria 1435
519 Ga0439434_0000280 3300042435 Bacteria 14555
520 Ga0439434_0008961 3300042435 Bacteria 2941
521 Ga0439464_0020129 3300042439 Bacteria 1826
522 Ga0450893_0002631 3300042532 Bacteria 2809
523 Ga0439440_0013446 3300042993 Bacteria 1756
524 Ga0495627_025961 3300046453 Bacteria 1894
525 Ga0495592_0000211 3300046454 Bacteria 49780
526 Ga0495592_0072949 3300046454 Bacteria 2497
527 Ga0495603_0016366 3300046455 Bacteria 4486
528 Ga0495603_0040452 3300046455 Bacteria 2790
529 Ga0495629_0000030 3300046459 Bacteria 125026
530 Ga0495629_0002103 3300046459 Bacteria 15450
531 Ga0495629_0005426 3300046459 Bacteria 9506
532 Ga0495629_0116832 3300046459 Bacteria 1859
533 Ga0495638_0002673 3300046460 Bacteria 14362
534 Ga0495638_0015434 3300046460 Bacteria 5127
535 Ga0495638_0025325 3300046460 Bacteria 3858
536 Ga0495638_0175840 3300046460 Unclassified 1225
537 Ga0495651_0151235 3300046462 Bacteria 1673
538 Ga0495653_0000372 3300046463 Bacteria 36242
539 Ga0495650_0008754 3300046471 Bacteria 5856
540 Ga0495580_0009549 3300046472 Bacteria 7621
541 Ga0495580_0042349 3300046472 Bacteria 3245
542 Ga0495580_0092928 3300046472 Bacteria 2100
543 Ga0495605_0002291 3300046474 Bacteria 11955
544 Ga0495605_0080094 3300046474 Bacteria 1529
545 Ga0495639_0006956 3300046475 Bacteria 4859
546 Ga0495639_0008332 3300046475 Bacteria 4447
547 Ga0495664_0127802 3300046477 Bacteria 1538
548 Ga0495585_0000447 3300046492 Bacteria 39452
549 Ga0495596_0017924 3300046500 Bacteria 2924
550 Ga0495607_0000359 3300046501 Bacteria 47053
551 Ga0495583_0000563 3300046506 Bacteria 51367
552 Ga0495583_0007257 3300046506 Bacteria 7013
553 Ga0495583_0033872 3300046506 Bacteria 2453
554 Ga0495606_0002420 3300046507 Bacteria 21749
555 Ga0495606_0058402 3300046507 Bacteria 2479
556 Ga0495610_0020599 3300046512 Bacteria 3658
557 Ga0495620_0009269 3300046515 Bacteria 5241
558 Ga0495628_0078065 3300046516 Bacteria 2575
559 Ga0495630_0006214 3300046517 Bacteria 8475
560 Ga0495630_0046692 3300046517 Bacteria 3238
561 Ga0495631_0000176 3300046518 Bacteria 43388
562 Ga0495632_0026765 3300046519 Bacteria 3030
563 Ga0495637_0012678 3300046520 Bacteria 4025
564 Ga0495643_0011054 3300046522 Bacteria 5519
565 Ga0495643_0045150 3300046522 Bacteria 2393
566 Ga0495644_0012388 3300046523 Bacteria 3280
567 Ga0495648_0012184 3300046524 Bacteria 6428
568 Ga0495648_0029155 3300046524 Bacteria 3666
569 Ga0495666_0131394 3300046526 Bacteria 1170
570 Ga0495642_0003905 3300046528 Bacteria 5836
571 Ga0495642_0016956 3300046528 Bacteria 2843
572 Ga0495642_0062007 3300046528 Bacteria 1552
573 Ga0495642_0067382 3300046528 Bacteria 1493
574 Ga0495654_0003540 3300046530 Bacteria 9529
575 Ga0495654_0067222 3300046530 Bacteria 1707
576 Ga0495665_0032147 3300046531 Bacteria 2806
577 Ga0495586_0114980 3300046535 Bacteria 1500
578 Ga0495609_0029183 3300046538 Bacteria 2513
579 Ga0495597_0014047 3300046542 Bacteria 3821
580 Ga0495645_0000238 3300046543 Bacteria 40111
581 Ga0495645_0014319 3300046543 Bacteria 5624
582 Ga0495645_0048634 3300046543 Bacteria 3088
583 Ga0495645_0073003 3300046543 Bacteria 2472
584 Ga0495622_0000011 3300046557 Bacteria 201507
585 Ga0495633_0000041 3300046558 Bacteria 176298
586 Ga0495667_0024349 3300046559 Bacteria 4077
587 Ga0495656_0000055 3300046615 Bacteria 53908
588 Ga0495656_0000082 3300046615 Bacteria 42150
589 Ga0495656_0075287 3300046615 Bacteria 1510
590 Ga0495668_0018134 3300046616 Bacteria 4071
591 Ga0495634_0127405 3300046642 Bacteria 1626
592 Ga0495611_0004243 3300046648 Bacteria 6240
593 Ga0495625_0000708 3300046660 Bacteria 47135
594 Ga0495625_0003058 3300046660 Bacteria 17143
595 Ga0495625_0015575 3300046660 Bacteria 6015
596 Ga0495625_0036739 3300046660 Bacteria 3598
597 Ga0495625_0098470 3300046660 Bacteria 2011
598 Ga0495625_0129657 3300046660 Bacteria 1709
599 Ga0495661_0000987 3300046665 Bacteria 25699
600 Ga0495588_0018807 3300046674 Bacteria 3375
601 Ga0495588_0068187 3300046674 Bacteria 1847
602 Ga0495588_0080109 3300046674 Bacteria 1704
603 Ga0495657_0131828 3300046675 Bacteria 1565
604 Ga0495646_0007543 3300046680 Bacteria 6912
605 Ga0495647_0025199 3300046681 Bacteria 2171
606 Ga0495658_0004417 3300046683 Bacteria 6924
607 Ga0495658_0078372 3300046683 Bacteria 1934
608 Ga0495669_0017052 3300046684 Bacteria 3114
609 Ga0495669_0032501 3300046684 Bacteria 2294
610 Ga0495613_0009049 3300046689 Bacteria 7389
611 Ga0495613_0031647 3300046689 Bacteria 3930
612 Ga0495624_0004546 3300046690 Bacteria 10138
613 Ga0495624_0248492 3300046690 Bacteria 1076
614 Ga0495670_0000651 3300046691 Bacteria 16586
615 Ga0495670_0030646 3300046691 Bacteria 2672
616 Ga0495670_0050488 3300046691 Bacteria 2082
617 Ga0495671_0012474 3300046692 Bacteria 4640
618 Ga0495671_0020441 3300046692 Bacteria 3488
619 Ga0495671_0054645 3300046692 Bacteria 1979
620 Ga0495649_0001209 3300046694 Bacteria 19919
621 Ga0495649_0087946 3300046694 Bacteria 1658
622 Ga0495589_0001358 3300046794 Bacteria 14298
623 Ga0495589_0021439 3300046794 Bacteria 3301
624 Ga0495589_0135323 3300046794 Bacteria 1182
625 Ga0495660_0004124 3300046810 Bacteria 8852
626 Ga0495660_0063790 3300046810 Bacteria 1971
627 Ga0495660_0142852 3300046810 Bacteria 1189
628 Ga0495581_0002045 3300047315 Bacteria 11345
629 Ga0495581_0053786 3300047315 Unclassified 2325
630 Ga0495674_0005976 3300047319 Bacteria 11682
631 Ga0495674_0012028 3300047319 Bacteria 8158
632 Ga0495674_0013683 3300047319 Bacteria 7623
633 Ga0495674_0113175 3300047319 Bacteria 2298
634 Ga0495676_0016520 3300047321 Bacteria 6546
635 Ga0495680_0095507 3300047322 Bacteria 2222
636 Ga0495680_0098959 3300047322 Unclassified 2175
637 Ga0495683_0044232 3300047323 Bacteria 2239
638 Ga0495683_0117139 3300047323 Bacteria 1267
639 Ga0495687_024134 3300047443 Bacteria 2895
640 Ga0495677_0032393 3300047445 Bacteria 1904
641 Ga0495679_000006 3300047446 Bacteria 449956
642 Ga0495684_0180601 3300047471 Bacteria 1564
643 Ga0495686_0001736 3300047472 Bacteria 22399
644 Ga0495686_0001796 3300047472 Bacteria 21729
645 Ga0495686_0009319 3300047472 Bacteria 7084
646 Ga0495593_0032620 3300047673 Bacteria 2838
647 Ga0495593_0039375 3300047673 Bacteria 2548
648 Ga0495602_0218177 3300048088 Bacteria 1442
649 Ga0495602_0276049 3300048088 Bacteria 1240
650 Ga0495614_0055441 3300048089 Bacteria 1700
651 Ga0495614_0058214 3300048089 Bacteria 1659
652 Ga0495614_0097801 3300048089 Bacteria 1280
653 Ga0495626_0000701 3300048091 Bacteria 31837
654 Ga0495626_0002166 3300048091 Bacteria 14145
655 Ga0495626_0049264 3300048091 Bacteria 1951
656 Ga0496100_0001197 3300048903 Bacteria 12602
657 Ga0496100_0041658 3300048903 Bacteria 2929
658 Ga0496101_0011059 3300048904 Bacteria 5978
659 Ga0496101_0017559 3300048904 Bacteria 4853
660 Ga0496102_0002957 3300048905 Bacteria 14389
661 Ga0496102_0003955 3300048905 Bacteria 12563
662 Ga0496102_0007903 3300048905 Bacteria 9091
663 Ga0496102_0376411 3300048905 Bacteria 1336
664 Ga0496104_0006593 3300048907 Bacteria 10211
665 Ga0496104_0024340 3300048907 Bacteria 5570
666 Ga0496104_0430070 3300048907 Bacteria 1232
667 Ga0496104_0495253 3300048907 Unclassified 1133
668 Ga0496105_0002074 3300048908 Bacteria 14503
669 Ga0496106_0027941 3300048909 Bacteria 4200
670 Ga0496106_0073829 3300048909 Bacteria 2610
671 Ga0496106_0091243 3300048909 Bacteria 2352
672 Ga0496106_0180102 3300048909 Bacteria 1677
673 Ga0496108_0044702 3300048911 Bacteria 3697
674 Ga0496109_0077301 3300048912 Bacteria 3063
675 Ga0496110_0191439 3300048913 Bacteria 1858
676 Ga0496112_0023540 3300048915 Bacteria 5886
677 Ga0496112_0225549 3300048915 Bacteria 1829
678 Ga0496113_0034530 3300048916 Bacteria 3690
679 Ga0496113_0068939 3300048916 Bacteria 2685
680 Ga0496114_0149961 3300048917 Bacteria 2022
681 Ga0496116_0030707 3300048919 Bacteria 3856
682 Ga0496116_0033691 3300048919 Bacteria 3629
683 Ga0496117_0010723 3300048920 Bacteria 8286
684 Ga0496117_0017904 3300048920 Bacteria 5899
685 Ga0496117_0039334 3300048920 Bacteria 3492
686 Ga0496118_0013061 3300048921 Bacteria 7896
687 Ga0496118_0066835 3300048921 Bacteria 2622
688 Ga0496119_0049405 3300048922 Bacteria 2601
689 Ga0496121_0024166 3300048924 Bacteria 5821
690 Ga0496121_0132618 3300048924 Bacteria 1861
691 Ga0496121_0170027 3300048924 Bacteria 1584
692 Ga0496122_0179699 3300048925 Bacteria 1264
693 Ga0496123_0021160 3300048926 Bacteria 5063
694 Ga0496125_0071202 3300048928 Bacteria 2718
695 Ga0496126_0023604 3300048929 Bacteria 5958
696 Ga0496126_0035988 3300048929 Bacteria 4634
697 Ga0496126_0084685 3300048929 Bacteria 2796
698 Ga0496126_0143656 3300048929 Bacteria 2052
699 Ga0495678_011148 3300049459 Bacteria 4320
700 Ga0495682_0005096 3300049460 Bacteria 5506
701 Ga0501298_018446 3300049521 Bacteria 1283
702 Ga0501034_0049908 3300049571 Bacteria 4221
703 Ga0501034_0159811 3300049571 Bacteria 2225
704 Ga0501036_0070638 3300049572 Bacteria 2953
705 Ga0501039_0090761 3300049575 Bacteria 2381
706 Ga0501042_0159181 3300049578 Bacteria 1629
707 Ga0501043_0000004 3300049579 Bacteria 291085
708 Ga0501046_0000016 3300049580 Bacteria 234374
709 Ga0501046_0147127 3300049580 Bacteria 1779
710 Ga0501047_0000012 3300049581 Bacteria 368824
711 Ga0501047_0046097 3300049581 Bacteria 4214
712 Ga0501048_0000926 3300049582 Bacteria 21609
713 Ga0501071_0080358 3300049587 Bacteria 2384
714 Ga0501071_0231480 3300049587 Bacteria 1392
715 Ga0501072_0030575 3300049588 Bacteria 4213
716 Ga0501072_0142486 3300049588 Bacteria 1911
717 Ga0501073_0018665 3300049589 Bacteria 5013
718 Ga0501073_0043103 3300049589 Bacteria 3182
719 Ga0501074_0066721 3300049590 Bacteria 2588
720 Ga0501075_0025728 3300049591 Bacteria 4325
721 Ga0501075_0050576 3300049591 Bacteria 3124
722 Ga0501075_0078662 3300049591 Bacteria 2496
723 Ga0501076_0141985 3300049592 Bacteria 1951
724 Ga0501076_0156853 3300049592 Bacteria 1853
725 Ga0501077_0104714 3300049593 Bacteria 1793
726 Ga0501077_0326375 3300049593 Bacteria 978
727 Ga0501080_0097802 3300049742 Bacteria 2725
728 Ga0501081_0085800 3300049743 Bacteria 2210
729 Ga0501081_0106752 3300049743 Bacteria 1985
730 Ga0501044_0028392 3300049823 Bacteria 5906
731 Ga0501044_0029722 3300049823 Bacteria 5761
732 Ga0501044_0143444 3300049823 Bacteria 2376
733 Ga0501045_0002191 3300049824 Bacteria 13251
734 nmdc:mga03683_11848_c1 3300050489 Bacteria 3169
735 nmdc:mga03683_2833_c1 3300050489 Bacteria 5463
736 nmdc:mga03683_96365_c1 3300050489 Bacteria 1296
737 nmdc:mga03n38_69487_c1 3300050490 Bacteria 1626
738 nmdc:mga00v17_127038_c1 3300050491 Bacteria 1627
739 nmdc:mga00v17_3436_c1 3300050491 Bacteria 7655
740 nmdc:mga0yw44_40551_c1 3300050492 Bacteria 1840
741 nmdc:mga0yw44_4155_c1 3300050492 Bacteria 6579
742 nmdc:mga0k408_10388_c1 3300050493 Bacteria 5035
743 nmdc:mga0k408_37678_c1 3300050493 Bacteria 2776
744 nmdc:mga0k408_45756_c1 3300050493 Bacteria 2526
745 nmdc:mga0k408_5585_c1 3300050493 Bacteria 6691
746 nmdc:mga06z11_201743_c1 3300050494 Bacteria 1156
747 nmdc:mga06z11_24082_c1 3300050494 Bacteria 2868
748 nmdc:mga06z11_65937_c1 3300050494 Bacteria 1902
749 nmdc:mga07m45_12383_c1 3300050496 Bacteria 4508
750 nmdc:mga07m45_134705_c1 3300050496 Bacteria 1430
751 nmdc:mga07m45_177981_c1 3300050496 Bacteria 1237
752 nmdc:mga07m45_20021_c1 3300050496 Bacteria 3632
753 nmdc:mga07m45_538_c1 3300050496 Bacteria 16053
754 nmdc:mga07m45_80008_c1 3300050496 Bacteria 1866
755 nmdc:mga07m45_977_c1 3300050496 Bacteria 12579
756 nmdc:mga05p37_39773_c1 3300050507 Bacteria 5774
757 nmdc:mga05p37_783_c1 3300050507 Bacteria 35363
758 nmdc:mga0qj67_20_c1 3300050509 Bacteria 109238
759 nmdc:mga0qj67_423_c1 3300050509 Bacteria 28921
760 nmdc:mga06r32_1561_c1 3300050510 Bacteria 20670
761 nmdc:mga06r32_8266_c1 3300050510 Bacteria 9367
762 nmdc:mga08y16_88666_c1 3300050511 Bacteria 3224
763 nmdc:mga0n895_2277_c1 3300050512 Bacteria 14891
764 nmdc:mga0rr50_1185_c1 3300050513 Bacteria 14175
765 nmdc:mga08x19_5601_c1 3300050514 Bacteria 7421
766 nmdc:mga0a205_2289_c1 3300050515 Bacteria 16890
767 nmdc:mga0sz30_15060_c2 3300050516 Bacteria 2031
768 Ga0500610_0035368 3300053079 Bacteria 2561
769 Ga0500610_0091821 3300053079 Bacteria 1576
770 Ga0495595_0025679 3300053084 Bacteria 2613
771 Ga0495619_0000882 3300053085 Bacteria 19725
772 Ga0495619_0136730 3300053085 Bacteria 1686
773 Ga0500647_0024825 3300053091 Bacteria 2822
774 Ga0500647_0041190 3300053091 Bacteria 2216
775 Ga0500583_0023527 3300053092 Bacteria 2598
776 Ga0500651_0000286 3300053093 Bacteria 29451
777 Ga0500566_0029149 3300053094 Bacteria 3225
778 Ga0500562_014221 3300053108 Bacteria 2038
779 Ga0500571_001412 3300053110 Bacteria 11195
780 Ga0500593_000452 3300053117 Bacteria 16256
781 Ga0500594_0002152 3300053118 Bacteria 4265
782 Ga0500594_0004492 3300053118 Bacteria 3075
783 Ga0500607_005158 3300053121 Bacteria 8636
784 Ga0500607_014684 3300053121 Bacteria 4536
785 Ga0500608_001053 3300053122 Bacteria 9896
786 Ga0500626_018297 3300053128 Bacteria 3091
787 Ga0500655_000688 3300053133 Bacteria 6710
788 Ga0500658_0000137 3300053134 Bacteria 34691
789 Ga0500658_0000140 3300053134 Bacteria 34349
790 Ga0500559_0000166 3300053136 Bacteria 51944
791 Ga0500564_025690 3300053138 Bacteria 2706
792 Ga0500568_0010495 3300053139 Bacteria 4335
793 Ga0500568_0012170 3300053139 Bacteria 3963
794 Ga0500574_004148 3300053141 Bacteria 2665
795 Ga0500619_012284 3300053154 Bacteria 2233
796 Ga0500627_0000922 3300053158 Bacteria 7920
797 Ga0500634_0001046 3300053161 Bacteria 10149
798 Ga0500638_000736 3300053162 Bacteria 8837
799 Ga0500639_077415 3300053163 Bacteria 1682
800 Ga0500636_0006898 3300053177 Bacteria 6545
801 Ga0500625_010895 3300053729 Bacteria 4114
802 Ga0501084_0047621 3300054114 Bacteria 3590
803 Ga0501082_0086986 3300060353 Bacteria 2696
804 Ga0501082_0296723 3300060353 Bacteria 1407
805 Ga0530510_0366707 3300061734 Bacteria 1083

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0093131 Ga0373942_0093131_10_864 221
2 3300035115 Ga0373941_0065509 Ga0373941_0065509_23_922 236
3 3300046507 Ga0495606_0058402 Ga0495606_0058402_13_891 237
4 3300046454 Ga0495592_0072949 Ga0495592_0072949_1587_2474 238
5 3300046526 Ga0495666_0131394 Ga0495666_0131394_18_926 247
6 3300046455 Ga0495603_0040452 Ga0495603_0040452_1861_2772 253
7 3300049593 Ga0501077_0326375 Ga0501077_0326375_17_967 254
8 3300049587 Ga0501071_0231480 Ga0501071_0231480_395_1354 259
9 3300046810 Ga0495660_0142852 Ga0495660_0142852_38_991 262
10 3300048088 Ga0495602_0276049 Ga0495602_0276049_247_1200 262
11 3300049578 Ga0501042_0159181 Ga0501042_0159181_449_1441 267
12 3300049588 Ga0501072_0030575 Ga0501072_0030575_57_1049 267
13 3300049591 Ga0501075_0078662 Ga0501075_0078662_791_1783 267
14 3300049592 Ga0501076_0156853 Ga0501076_0156853_474_1466 267
15 3300060353 Ga0501082_0296723 Ga0501082_0296723_298_1290 267
16 3300035172 Ga0373955_0166743 Ga0373955_0166743_23_1075 268
17 3300046681 Ga0495647_0025199 Ga0495647_0025199_941_1993 268
18 3300046683 Ga0495658_0078372 Ga0495658_0078372_824_1876 268
19 3300046684 Ga0495669_0017052 Ga0495669_0017052_2073_3086 268
20 3300049589 Ga0501073_0018665 Ga0501073_0018665_3750_4790 269
21 3300005354 Ga0070675_100004424 Ga0070675_1000044249 271
22 3300005364 Ga0070673_100003421 Ga0070673_1000034213 271
23 3300005367 Ga0070667_100005822 Ga0070667_1000058229 271
24 3300005456 Ga0070678_100004172 Ga0070678_1000041724 271
25 3300005719 Ga0068861_100291818 Ga0068861_1002918182 271
26 3300006844 Ga0075428_100141555 Ga0075428_1001415552 271
27 3300006847 Ga0075431_100001116 Ga0075431_10000111623 271
28 3300006880 Ga0075429_100185676 Ga0075429_1001856762 271
29 3300050510 nmdc:mga06r32_1561_c1 nmdc:mga06r32_1561_c1_18740_19732 271
30 3300005336 Ga0070680_100063817 Ga0070680_1000638172 272
31 3300005458 Ga0070681_10154061 Ga0070681_101540611 272
32 3300005617 Ga0068859_100040558 Ga0068859_1000405582 272
33 3300006846 Ga0075430_100007190 Ga0075430_1000071903 272
34 3300006847 Ga0075431_100011272 Ga0075431_10001127210 272
35 3300006931 Ga0097620_100040559 Ga0097620_1000405595 272
36 3300009147 Ga0114129_10002200 Ga0114129_100022006 272
37 3300025912 Ga0207707_10159721 Ga0207707_101597213 272
38 3300025917 Ga0207660_10026584 Ga0207660_100265843 272
39 3300035241 Ga0373961_0026240 Ga0373961_0026240_51_1019 272
40 3300048905 Ga0496102_0007903 Ga0496102_0007903_7795_8805 272
41 3300048909 Ga0496106_0073829 Ga0496106_0073829_663_1673 272
42 3300050507 nmdc:mga05p37_783_c1 nmdc:mga05p37_783_c1_2090_3100 272
43 3300050509 nmdc:mga0qj67_423_c1 nmdc:mga0qj67_423_c1_4187_5197 272
44 3300050510 nmdc:mga06r32_8266_c1 nmdc:mga06r32_8266_c1_6298_7308 272
45 3300049593 Ga0501077_0104714 Ga0501077_0104714_709_1719 273
46 3300006177 Ga0075362_10037676 Ga0075362_100376762 274
47 3300013306 Ga0163162_10215572 Ga0163162_102155722 274
48 3300009094 Ga0111539_10020595 Ga0111539_100205955 276
49 3300050511 nmdc:mga08y16_88666_c1 nmdc:mga08y16_88666_c1_786_1793 276
50 3300005354 Ga0070675_100137637 Ga0070675_1001376372 277
51 3300028666 Ga0265336_10006700 Ga0265336_100067004 277
52 3300031240 Ga0265320_10033662 Ga0265320_100336622 277
53 3300031249 Ga0265339_10006993 Ga0265339_100069935 277
54 3300031711 Ga0265314_10010702 Ga0265314_100107025 277
55 3300031712 Ga0265342_10010019 Ga0265342_100100193 277
56 3300046543 Ga0495645_0048634 Ga0495645_0048634_698_1759 277
57 3300049591 Ga0501075_0025728 Ga0501075_0025728_649_1683 277
58 3300035119 Ga0373956_0012298 Ga0373956_0012298_2348_3379 278
59 3300035172 Ga0373955_0078270 Ga0373955_0078270_162_1193 278
60 3300005937 Ga0081455_10114206 Ga0081455_101142063 280
61 3300005536 Ga0070697_100088893 Ga0070697_1000888932 281
62 3300005545 Ga0070695_100157653 Ga0070695_1001576532 281
63 3300006353 Ga0075370_10000115 Ga0075370_1000011522 281
64 3300009553 Ga0105249_10085915 Ga0105249_100859153 281
65 3300050496 nmdc:mga07m45_977_c1 nmdc:mga07m45_977_c1_1020_2063 281
66 3300053163 Ga0500639_077415 Ga0500639_077415_628_1656 281
67 3300046810 Ga0495660_0004124 Ga0495660_0004124_3506_4549 282
68 3300048091 Ga0495626_0000701 Ga0495626_0000701_2146_3189 282
69 3300006195 Ga0075366_10040728 Ga0075366_100407283 283
70 3300006914 Ga0075436_100016182 Ga0075436_1000161825 283
71 3300007076 Ga0075435_100010188 Ga0075435_1000101882 283
72 3300009147 Ga0114129_10037178 Ga0114129_100371782 283
73 3300050507 nmdc:mga05p37_39773_c1 nmdc:mga05p37_39773_c1_1604_2548 283
74 3300050512 nmdc:mga0n895_2277_c1 nmdc:mga0n895_2277_c1_3484_4428 283
75 3300050513 nmdc:mga0rr50_1185_c1 nmdc:mga0rr50_1185_c1_2768_3712 283
76 3300050514 nmdc:mga08x19_5601_c1 nmdc:mga08x19_5601_c1_5228_6172 283
77 3300050515 nmdc:mga0a205_2289_c1 nmdc:mga0a205_2289_c1_5650_6594 283
78 3300026095 Ga0207676_10463357 Ga0207676_104633572 284
79 3300046642 Ga0495634_0127405 Ga0495634_0127405_309_1349 284
80 iso_pu_bacteria 2775507049 2776915759 284
81 3300035695 Ga0373927_0044393 Ga0373927_0044393_947_1972 285
82 3300046455 Ga0495603_0016366 Ga0495603_0016366_3394_4419 285
83 3300046459 Ga0495629_0005426 Ga0495629_0005426_4261_5286 285
84 3300046557 Ga0495622_0000011 Ga0495622_0000011_47076_48128 285
85 3300046683 Ga0495658_0004417 Ga0495658_0004417_5091_6116 285
86 3300046689 Ga0495613_0031647 Ga0495613_0031647_966_1991 285
87 3300046690 Ga0495624_0248492 Ga0495624_0248492_38_1063 285
88 3300047315 Ga0495581_0053786 Ga0495581_0053786_340_1365 285
89 3300047322 Ga0495680_0098959 Ga0495680_0098959_1020_2045 285
90 3300053085 Ga0495619_0000882 Ga0495619_0000882_16286_17311 285
91 3300005616 Ga0068852_100559308 Ga0068852_1005593081 286
92 3300006195 Ga0075366_10209430 Ga0075366_102094301 286
93 3300009176 Ga0105242_10091387 Ga0105242_100913872 286
94 3300013296 Ga0157374_10263462 Ga0157374_102634622 286
95 3300026067 Ga0207678_10173601 Ga0207678_101736011 286
96 3300034816 Ga0373930_0017659 Ga0373930_0017659_244_1257 286
97 3300035171 Ga0373946_0039065 Ga0373946_0039065_91_1116 286
98 3300035691 Ga0373931_0003357 Ga0373931_0003357_5005_6018 286
99 3300047322 Ga0495680_0095507 Ga0495680_0095507_815_1846 286
100 3300048904 Ga0496101_0017559 Ga0496101_0017559_2511_3524 286
101 3300048905 Ga0496102_0376411 Ga0496102_0376411_148_1161 286
102 3300048907 Ga0496104_0495253 Ga0496104_0495253_63_1097 286
103 3300048917 Ga0496114_0149961 Ga0496114_0149961_781_1794 286
104 3300053085 Ga0495619_0136730 Ga0495619_0136730_477_1508 286
105 3300005340 Ga0070689_100078184 Ga0070689_1000781842 287
106 3300005353 Ga0070669_100011530 Ga0070669_1000115305 287
107 3300005354 Ga0070675_100049661 Ga0070675_1000496613 287
108 3300005365 Ga0070688_100075655 Ga0070688_1000756551 287
109 3300005456 Ga0070678_100009040 Ga0070678_1000090402 287
110 3300006048 Ga0075363_100016942 Ga0075363_1000169422 287
111 3300006178 Ga0075367_10160145 Ga0075367_101601452 287
112 3300013306 Ga0163162_10307820 Ga0163162_103078201 287
113 3300014325 Ga0163163_10047540 Ga0163163_100475402 287
114 3300014326 Ga0157380_10377499 Ga0157380_103774991 287
115 3300025899 Ga0207642_10209556 Ga0207642_102095561 287
116 3300025923 Ga0207681_10005854 Ga0207681_100058546 287
117 3300025936 Ga0207670_10001410 Ga0207670_1000141014 287
118 3300025937 Ga0207669_10001860 Ga0207669_100018609 287
119 3300031995 Ga0307409_100095209 Ga0307409_1000952092 287
120 3300035115 Ga0373941_0061248 Ga0373941_0061248_189_1202 287
121 3300035691 Ga0373931_0008665 Ga0373931_0008665_1369_2382 287
122 3300046543 Ga0495645_0073003 Ga0495645_0073003_884_1897 287
123 3300048912 Ga0496109_0077301 Ga0496109_0077301_891_1904 287
124 3300048915 Ga0496112_0023540 Ga0496112_0023540_4741_5754 287
125 3300048915 Ga0496112_0225549 Ga0496112_0225549_612_1625 287
126 3300048916 Ga0496113_0034530 Ga0496113_0034530_1857_2870 287
127 3300049571 Ga0501034_0159811 Ga0501034_0159811_577_1584 287
128 3300050494 nmdc:mga06z11_201743_c1 nmdc:mga06z11_201743_c1_60_1070 287
129 3300050496 nmdc:mga07m45_80008_c1 nmdc:mga07m45_80008_c1_792_1802 287
130 3300053084 Ga0495595_0025679 Ga0495595_0025679_1188_2201 287
131 3300060353 Ga0501082_0086986 Ga0501082_0086986_705_1712 287
132 3300005336 Ga0070680_100284190 Ga0070680_1002841901 288
133 3300005345 Ga0070692_10054227 Ga0070692_100542272 288
134 3300005438 Ga0070701_10001070 Ga0070701_100010704 288
135 3300005456 Ga0070678_100033664 Ga0070678_1000336643 288
136 3300005459 Ga0068867_100072138 Ga0068867_1000721382 288
137 3300005544 Ga0070686_100000429 Ga0070686_10000042920 288
138 3300005545 Ga0070695_100033259 Ga0070695_1000332593 288
139 3300005547 Ga0070693_100011464 Ga0070693_1000114644 288
140 3300005578 Ga0068854_100285586 Ga0068854_1002855862 288
141 3300005615 Ga0070702_100005177 Ga0070702_1000051773 288
142 3300005718 Ga0068866_10001488 Ga0068866_100014886 288
143 3300005719 Ga0068861_100005103 Ga0068861_1000051034 288
144 3300005843 Ga0068860_100017256 Ga0068860_1000172562 288
145 3300005844 Ga0068862_100014582 Ga0068862_1000145824 288
146 3300005985 Ga0081539_10048027 Ga0081539_100480273 288
147 3300006237 Ga0097621_100008539 Ga0097621_1000085394 288
148 3300006358 Ga0068871_100002438 Ga0068871_10000243812 288
149 3300006881 Ga0068865_100008332 Ga0068865_1000083323 288
150 3300009098 Ga0105245_10006822 Ga0105245_100068226 288
151 3300009176 Ga0105242_10021786 Ga0105242_100217865 288
152 3300009553 Ga0105249_10110555 Ga0105249_101105552 288
153 3300013297 Ga0157378_10004967 Ga0157378_100049678 288
154 3300013306 Ga0163162_10626949 Ga0163162_106269492 288
155 3300025899 Ga0207642_10012683 Ga0207642_100126831 288
156 3300025908 Ga0207643_10015529 Ga0207643_100155294 288
157 3300025934 Ga0207686_10016638 Ga0207686_100166381 288
158 3300025938 Ga0207704_10004612 Ga0207704_100046124 288
159 3300025942 Ga0207689_10007463 Ga0207689_100074636 288
160 3300026075 Ga0207708_10000875 Ga0207708_1000087516 288
161 3300026089 Ga0207648_10004621 Ga0207648_100046218 288
162 3300026118 Ga0207675_100000138 Ga0207675_10000013817 288
163 3300026121 Ga0207683_10012408 Ga0207683_100124083 288
164 3300047472 Ga0495686_0001736 Ga0495686_0001736_15476_16522 288
165 3300005333 Ga0070677_10012454 Ga0070677_100124543 289
166 3300005335 Ga0070666_10050601 Ga0070666_100506013 289
167 3300005343 Ga0070687_100002399 Ga0070687_1000023997 289
168 3300005353 Ga0070669_100002541 Ga0070669_1000025418 289
169 3300005354 Ga0070675_100007437 Ga0070675_1000074373 289
170 3300005367 Ga0070667_100012281 Ga0070667_1000122812 289
171 3300005437 Ga0070710_10085351 Ga0070710_100853512 289
172 3300005456 Ga0070678_100031599 Ga0070678_1000315992 289
173 3300005616 Ga0068852_100022799 Ga0068852_1000227992 289
174 3300005617 Ga0068859_100146009 Ga0068859_1001460093 289
175 3300005718 Ga0068866_10003115 Ga0068866_100031156 289
176 3300005719 Ga0068861_100024434 Ga0068861_1000244346 289
177 3300005841 Ga0068863_100019955 Ga0068863_1000199554 289
178 3300005842 Ga0068858_100021194 Ga0068858_1000211946 289
179 3300005843 Ga0068860_100005159 Ga0068860_1000051598 289
180 3300006038 Ga0075365_10046701 Ga0075365_100467014 289
181 3300006353 Ga0075370_10001048 Ga0075370_100010482 289
182 3300006881 Ga0068865_100003857 Ga0068865_1000038573 289
183 3300006931 Ga0097620_100146007 Ga0097620_1001460073 289
184 3300009177 Ga0105248_10085241 Ga0105248_100852414 289
185 3300013306 Ga0163162_10033293 Ga0163162_100332933 289
186 3300013308 Ga0157375_10014933 Ga0157375_100149338 289
187 3300014326 Ga0157380_10000886 Ga0157380_100008863 289
188 3300014968 Ga0157379_10018782 Ga0157379_100187826 289
189 3300017792 Ga0163161_10003368 Ga0163161_100033688 289
190 3300021361 Ga0213872_10077172 Ga0213872_100771722 289
191 3300025893 Ga0207682_10014967 Ga0207682_100149672 289
192 3300025899 Ga0207642_10020102 Ga0207642_100201022 289
193 3300025903 Ga0207680_10004267 Ga0207680_100042675 289
194 3300025907 Ga0207645_10005563 Ga0207645_100055635 289
195 3300025918 Ga0207662_10015308 Ga0207662_100153085 289
196 3300025926 Ga0207659_10007262 Ga0207659_100072623 289
197 3300025933 Ga0207706_10010371 Ga0207706_100103716 289
198 3300025938 Ga0207704_10008403 Ga0207704_100084036 289
199 3300025940 Ga0207691_10009795 Ga0207691_100097953 289
200 3300025942 Ga0207689_10002269 Ga0207689_1000226912 289
201 3300025960 Ga0207651_10135542 Ga0207651_101355422 289
202 3300025972 Ga0207668_10025649 Ga0207668_100256492 289
203 3300026067 Ga0207678_10076256 Ga0207678_100762564 289
204 3300026075 Ga0207708_10009916 Ga0207708_100099162 289
205 3300026089 Ga0207648_10015693 Ga0207648_100156933 289
206 3300026118 Ga0207675_100010824 Ga0207675_1000108242 289
207 3300026121 Ga0207683_10039123 Ga0207683_100391233 289
208 3300028380 Ga0268265_10013132 Ga0268265_100131326 289
209 3300028381 Ga0268264_10018708 Ga0268264_100187086 289
210 3300042157 Ga0439458_0023601 Ga0439458_0023601_321_1319 289
211 3300046522 Ga0495643_0045150 Ga0495643_0045150_368_1384 289
212 3300050496 nmdc:mga07m45_20021_c1 nmdc:mga07m45_20021_c1_612_1655 289
213 3300006038 Ga0075365_10197692 Ga0075365_101976922 290
214 3300006186 Ga0075369_10039226 Ga0075369_100392262 290
215 3300006353 Ga0075370_10077604 Ga0075370_100776042 290
216 3300046522 Ga0495643_0011054 Ga0495643_0011054_4502_5491 290
217 3300046524 Ga0495648_0012184 Ga0495648_0012184_2406_3395 290
218 3300046665 Ga0495661_0000987 Ga0495661_0000987_19338_20327 290
219 3300046794 Ga0495589_0135323 Ga0495589_0135323_163_1152 290
220 3300050492 nmdc:mga0yw44_40551_c1 nmdc:mga0yw44_40551_c1_84_1094 290
221 3300050494 nmdc:mga06z11_65937_c1 nmdc:mga06z11_65937_c1_831_1841 290
222 3300005367 Ga0070667_100072550 Ga0070667_1000725503 291
223 3300005455 Ga0070663_100311475 Ga0070663_1003114751 291
224 3300005539 Ga0068853_100436599 Ga0068853_1004365991 291
225 3300009011 Ga0105251_10031795 Ga0105251_100317953 291
226 3300009092 Ga0105250_10029687 Ga0105250_100296872 291
227 3300009551 Ga0105238_10073364 Ga0105238_100733642 291
228 3300013306 Ga0163162_10000884 Ga0163162_100008849 291
229 3300025304 Ga0209257_1019042 Ga0209257_10190422 291
230 3300025986 Ga0207658_10036789 Ga0207658_100367892 291
231 3300026067 Ga0207678_10045341 Ga0207678_100453415 291
232 3300046460 Ga0495638_0002673 Ga0495638_0002673_8850_9932 291
233 3300046474 Ga0495605_0002291 Ga0495605_0002291_9110_10192 291
234 3300046523 Ga0495644_0012388 Ga0495644_0012388_508_1590 291
235 3300046691 Ga0495670_0000651 Ga0495670_0000651_9897_10979 291
236 3300046692 Ga0495671_0054645 Ga0495671_0054645_461_1543 291
237 3300046694 Ga0495649_0087946 Ga0495649_0087946_71_1153 291
238 3300046794 Ga0495589_0001358 Ga0495589_0001358_7418_8500 291
239 3300046810 Ga0495660_0063790 Ga0495660_0063790_740_1822 291
240 3300048903 Ga0496100_0041658 Ga0496100_0041658_19_1101 291
241 3300048905 Ga0496102_0002957 Ga0496102_0002957_1070_2152 291
242 3300048909 Ga0496106_0180102 Ga0496106_0180102_61_1143 291
243 3300003316 rootH1_10003366 rootH1_100033663 292
244 3300047319 Ga0495674_0005976 Ga0495674_0005976_3937_5028 292
245 3300049823 Ga0501044_0029722 Ga0501044_0029722_66_1121 292
246 3300046459 Ga0495629_0000030 Ga0495629_0000030_61657_62748 293
247 3300046463 Ga0495653_0000372 Ga0495653_0000372_7959_9050 293
248 3300046471 Ga0495650_0008754 Ga0495650_0008754_2043_3134 293
249 3300046472 Ga0495580_0009549 Ga0495580_0009549_757_1848 293
250 3300046500 Ga0495596_0017924 Ga0495596_0017924_185_1276 293
251 3300046506 Ga0495583_0007257 Ga0495583_0007257_868_1959 293
252 3300046515 Ga0495620_0009269 Ga0495620_0009269_2682_3773 293
253 3300046517 Ga0495630_0006214 Ga0495630_0006214_2032_3123 293
254 3300046524 Ga0495648_0029155 Ga0495648_0029155_2040_3131 293
255 3300046528 Ga0495642_0062007 Ga0495642_0062007_36_1127 293
256 3300046531 Ga0495665_0032147 Ga0495665_0032147_732_1823 293
257 3300046542 Ga0495597_0014047 Ga0495597_0014047_1490_2581 293
258 3300046648 Ga0495611_0004243 Ga0495611_0004243_1468_2559 293
259 3300046660 Ga0495625_0036739 Ga0495625_0036739_1926_3017 293
260 3300046680 Ga0495646_0007543 Ga0495646_0007543_2249_3340 293
261 3300046684 Ga0495669_0032501 Ga0495669_0032501_973_2064 293
262 3300046690 Ga0495624_0004546 Ga0495624_0004546_5749_6840 293
263 3300046692 Ga0495671_0012474 Ga0495671_0012474_43_1134 293
264 3300047319 Ga0495674_0012028 Ga0495674_0012028_1817_2908 293
265 3300047319 Ga0495674_0113175 Ga0495674_0113175_535_1626 293
266 3300047323 Ga0495683_0044232 Ga0495683_0044232_441_1532 293
267 3300047443 Ga0495687_024134 Ga0495687_024134_1762_2853 293
268 3300047446 Ga0495679_000006 Ga0495679_000006_26455_27546 293
269 3300047472 Ga0495686_0009319 Ga0495686_0009319_2606_3697 293
270 3300048089 Ga0495614_0058214 Ga0495614_0058214_281_1372 293
271 3300048091 Ga0495626_0002166 Ga0495626_0002166_10669_11760 293
272 3300048920 Ga0496117_0017904 Ga0496117_0017904_3301_4392 293
273 3300048921 Ga0496118_0066835 Ga0496118_0066835_1131_2222 293
274 3300048924 Ga0496121_0024166 Ga0496121_0024166_4056_5147 293
275 3300048929 Ga0496126_0143656 Ga0496126_0143656_893_1984 293
276 3300049459 Ga0495678_011148 Ga0495678_011148_2761_3852 293
277 3300049589 Ga0501073_0043103 Ga0501073_0043103_583_1665 293
278 3300034819 Ga0373958_0018784 Ga0373958_0018784_32_1123 294
279 3300005468 Ga0070707_100267244 Ga0070707_1002672442 295
280 3300025922 Ga0207646_10223926 Ga0207646_102239262 295
281 3300046460 Ga0495638_0015434 Ga0495638_0015434_3224_4231 295
282 3300046460 Ga0495638_0175840 Ga0495638_0175840_85_1092 295
283 3300046660 Ga0495625_0015575 Ga0495625_0015575_2570_3583 295
284 3300049587 Ga0501071_0080358 Ga0501071_0080358_902_1894 295
285 3300003215 JGI25153J46596_10007730 JGI25153J46596_100077305 296
286 3300003659 JGI25404J52841_10002780 JGI25404J52841_100027803 296
287 3300005983 Ga0081540_1000259 Ga0081540_100025923 296
288 3300025297 Ga0209758_1000302 Ga0209758_100030284 296
289 3300025297 Ga0209758_1040992 Ga0209758_10409922 296
290 3300026121 Ga0207683_10155180 Ga0207683_101551802 296
291 3300031456 Ga0307513_10255963 Ga0307513_102559632 296
292 3300031731 Ga0307405_10004235 Ga0307405_100042356 296
293 3300032002 Ga0307416_100301375 Ga0307416_1003013752 296
294 3300036401 Ga0373937_0031176 Ga0373937_0031176_1323_2375 296
295 3300046474 Ga0495605_0080094 Ga0495605_0080094_214_1269 296
296 3300046506 Ga0495583_0033872 Ga0495583_0033872_84_1139 296
297 3300046507 Ga0495606_0002420 Ga0495606_0002420_6001_6990 296
298 3300046516 Ga0495628_0078065 Ga0495628_0078065_1374_2426 296
299 3300046519 Ga0495632_0026765 Ga0495632_0026765_1268_2323 296
300 3300046615 Ga0495656_0075287 Ga0495656_0075287_455_1450 296
301 3300046616 Ga0495668_0018134 Ga0495668_0018134_2627_3616 296
302 3300046694 Ga0495649_0001209 Ga0495649_0001209_3976_5031 296
303 3300046794 Ga0495589_0021439 Ga0495589_0021439_1154_2143 296
304 3300047323 Ga0495683_0117139 Ga0495683_0117139_17_1006 296
305 3300047471 Ga0495684_0180601 Ga0495684_0180601_277_1329 296
306 3300048091 Ga0495626_0049264 Ga0495626_0049264_344_1399 296
307 3300049521 Ga0501298_018446 Ga0501298_018446_247_1254 296
308 3300050493 nmdc:mga0k408_45756_c1 nmdc:mga0k408_45756_c1_454_1470 296
309 3300005334 Ga0068869_100010567 Ga0068869_1000105674 297
310 3300005335 Ga0070666_10004297 Ga0070666_100042974 297
311 3300005338 Ga0068868_100017463 Ga0068868_1000174633 297
312 3300005340 Ga0070689_100037579 Ga0070689_1000375794 297
313 3300005355 Ga0070671_100005389 Ga0070671_1000053894 297
314 3300005457 Ga0070662_100015606 Ga0070662_1000156062 297
315 3300005459 Ga0068867_100032819 Ga0068867_1000328194 297
316 3300005578 Ga0068854_100026167 Ga0068854_1000261674 297
317 3300005616 Ga0068852_100053837 Ga0068852_1000538373 297
318 3300005617 Ga0068859_100009755 Ga0068859_1000097557 297
319 3300005840 Ga0068870_10156067 Ga0068870_101560672 297
320 3300005842 Ga0068858_100002163 Ga0068858_10000216310 297
321 3300005937 Ga0081455_10000406 Ga0081455_1000040630 297
322 3300006195 Ga0075366_10015796 Ga0075366_100157965 297
323 3300006237 Ga0097621_100001895 Ga0097621_1000018957 297
324 3300006353 Ga0075370_10058620 Ga0075370_100586202 297
325 3300006358 Ga0068871_100015705 Ga0068871_1000157054 297
326 3300006931 Ga0097620_100009754 Ga0097620_1000097544 297
327 3300009093 Ga0105240_10069514 Ga0105240_100695144 297
328 3300009148 Ga0105243_10137454 Ga0105243_101374542 297
329 3300009177 Ga0105248_10002934 Ga0105248_100029349 297
330 3300009545 Ga0105237_10036421 Ga0105237_100364213 297
331 3300010375 Ga0105239_10031083 Ga0105239_100310835 297
332 3300013306 Ga0163162_10014828 Ga0163162_100148283 297
333 3300013308 Ga0157375_10012157 Ga0157375_100121574 297
334 3300014325 Ga0163163_10005043 Ga0163163_100050435 297
335 3300014969 Ga0157376_10023962 Ga0157376_100239624 297
336 3300017792 Ga0163161_10151909 Ga0163161_101519092 297
337 3300025913 Ga0207695_10103905 Ga0207695_101039054 297
338 3300025914 Ga0207671_10109566 Ga0207671_101095662 297
339 3300025921 Ga0207652_10489255 Ga0207652_104892551 297
340 3300025925 Ga0207650_10310611 Ga0207650_103106112 297
341 3300025926 Ga0207659_10000751 Ga0207659_100007512 297
342 3300025931 Ga0207644_10017644 Ga0207644_100176445 297
343 3300025940 Ga0207691_10077839 Ga0207691_100778393 297
344 3300025941 Ga0207711_10220860 Ga0207711_102208602 297
345 3300025942 Ga0207689_10058298 Ga0207689_100582981 297
346 3300025960 Ga0207651_10057741 Ga0207651_100577412 297
347 3300025972 Ga0207668_10271355 Ga0207668_102713552 297
348 3300025986 Ga0207658_10030132 Ga0207658_100301322 297
349 3300026023 Ga0207677_10006613 Ga0207677_100066133 297
350 3300026035 Ga0207703_10005464 Ga0207703_100054645 297
351 3300026041 Ga0207639_10161576 Ga0207639_101615762 297
352 3300026088 Ga0207641_10003968 Ga0207641_100039685 297
353 3300026089 Ga0207648_10056300 Ga0207648_100563002 297
354 3300026095 Ga0207676_10000082 Ga0207676_1000008247 297
355 3300026116 Ga0207674_10012581 Ga0207674_100125813 297
356 3300026118 Ga0207675_100321612 Ga0207675_1003216122 297
357 3300026121 Ga0207683_10004159 Ga0207683_100041596 297
358 3300026142 Ga0207698_10092796 Ga0207698_100927963 297
359 3300026142 Ga0207698_10109804 Ga0207698_101098041 297
360 3300028380 Ga0268265_10107598 Ga0268265_101075982 297
361 3300028794 Ga0307515_10011668 Ga0307515_100116688 297
362 3300028794 Ga0307515_10133373 Ga0307515_101333733 297
363 3300030522 Ga0307512_10117876 Ga0307512_101178762 297
364 3300031456 Ga0307513_10017350 Ga0307513_100173507 297
365 3300031507 Ga0307509_10001630 Ga0307509_100016307 297
366 3300031507 Ga0307509_10142221 Ga0307509_101422212 297
367 3300031616 Ga0307508_10003341 Ga0307508_100033413 297
368 3300031616 Ga0307508_10042418 Ga0307508_100424183 297
369 3300031616 Ga0307508_10159910 Ga0307508_101599102 297
370 3300031649 Ga0307514_10011999 Ga0307514_1001199910 297
371 3300031730 Ga0307516_10000237 Ga0307516_1000023719 297
372 3300031730 Ga0307516_10199404 Ga0307516_101994042 297
373 3300033179 Ga0307507_10065050 Ga0307507_100650502 297
374 3300042993 Ga0439440_0013446 Ga0439440_0013446_299_1315 297
375 3300046472 Ga0495580_0042349 Ga0495580_0042349_52_1158 297
376 3300048909 Ga0496106_0091243 Ga0496106_0091243_1089_2150 297
377 3300048911 Ga0496108_0044702 Ga0496108_0044702_2097_3158 297
378 3300050489 nmdc:mga03683_11848_c1 nmdc:mga03683_11848_c1_1127_2167 297
379 3300050516 nmdc:mga0sz30_15060_c2 nmdc:mga0sz30_15060_c2_557_1597 297
380 3300053091 Ga0500647_0024825 Ga0500647_0024825_1389_2387 297
381 3300053092 Ga0500583_0023527 Ga0500583_0023527_386_1384 297
382 3300053118 Ga0500594_0004492 Ga0500594_0004492_1123_2121 297
383 3300053136 Ga0500559_0000166 Ga0500559_0000166_7476_8474 297
384 3300006846 Ga0075430_100000011 Ga0075430_1000000114 298
385 3300037471 Ga0395905_0105098 Ga0395905_0105098_1197_2210 298
386 3300049571 Ga0501034_0049908 Ga0501034_0049908_1049_2068 298
387 3300049580 Ga0501046_0147127 Ga0501046_0147127_298_1308 298
388 3300049742 Ga0501080_0097802 Ga0501080_0097802_825_1844 298
389 3300050509 nmdc:mga0qj67_20_c1 nmdc:mga0qj67_20_c1_79287_80312 298
390 3300053139 Ga0500568_0010495 Ga0500568_0010495_843_1883 298
391 3300005328 Ga0070676_10060682 Ga0070676_100606822 299
392 3300005338 Ga0068868_100048987 Ga0068868_1000489873 299
393 3300005354 Ga0070675_100037582 Ga0070675_1000375825 299
394 3300005355 Ga0070671_100058775 Ga0070671_1000587753 299
395 3300005367 Ga0070667_100365398 Ga0070667_1003653981 299
396 3300005467 Ga0070706_100003679 Ga0070706_10000367921 299
397 3300005518 Ga0070699_100082621 Ga0070699_1000826212 299
398 3300005543 Ga0070672_100043128 Ga0070672_1000431283 299
399 3300005548 Ga0070665_100546173 Ga0070665_1005461731 299
400 3300006178 Ga0075367_10005035 Ga0075367_100050352 299
401 3300006195 Ga0075366_10027351 Ga0075366_100273512 299
402 3300006353 Ga0075370_10037674 Ga0075370_100376744 299
403 3300013308 Ga0157375_10235579 Ga0157375_102355792 299
404 3300025907 Ga0207645_10010476 Ga0207645_100104767 299
405 3300025931 Ga0207644_10068093 Ga0207644_100680934 299
406 3300025933 Ga0207706_10182167 Ga0207706_101821673 299
407 3300025935 Ga0207709_10093078 Ga0207709_100930782 299
408 3300025940 Ga0207691_10011487 Ga0207691_100114878 299
409 3300025960 Ga0207651_10249464 Ga0207651_102494641 299
410 3300025986 Ga0207658_10320579 Ga0207658_103205792 299
411 3300026023 Ga0207677_10013065 Ga0207677_100130656 299
412 3300028794 Ga0307515_10210250 Ga0307515_102102502 299
413 3300031456 Ga0307513_10035367 Ga0307513_100353673 299
414 3300031649 Ga0307514_10001174 Ga0307514_100011748 299
415 3300031730 Ga0307516_10080696 Ga0307516_100806962 299
416 3300042007 Ga0439449_0048146 Ga0439449_0048146_395_1411 299
417 3300046477 Ga0495664_0127802 Ga0495664_0127802_332_1396 299
418 3300046528 Ga0495642_0067382 Ga0495642_0067382_160_1203 299
419 3300047319 Ga0495674_0013683 Ga0495674_0013683_419_1483 299
420 3300049575 Ga0501039_0090761 Ga0501039_0090761_699_1790 299
421 3300049588 Ga0501072_0142486 Ga0501072_0142486_56_1141 299
422 3300049591 Ga0501075_0050576 Ga0501075_0050576_1708_2781 299
423 3300049592 Ga0501076_0141985 Ga0501076_0141985_818_1903 299
424 3300049743 Ga0501081_0085800 Ga0501081_0085800_1035_2120 299
425 3300050489 nmdc:mga03683_96365_c1 nmdc:mga03683_96365_c1_216_1259 299
426 3300050494 nmdc:mga06z11_24082_c1 nmdc:mga06z11_24082_c1_37_1080 299
427 3300050496 nmdc:mga07m45_12383_c1 nmdc:mga07m45_12383_c1_3290_4330 299
428 3300050496 nmdc:mga07m45_134705_c1 nmdc:mga07m45_134705_c1_161_1201 299
429 3300050496 nmdc:mga07m45_177981_c1 nmdc:mga07m45_177981_c1_34_1077 299
430 3300054114 Ga0501084_0047621 Ga0501084_0047621_1872_2957 299
431 3300061734 Ga0530510_0366707 Ga0530510_0366707_17_1048 299
432 3300005343 Ga0070687_100142601 Ga0070687_1001426012 300
433 3300005444 Ga0070694_100036399 Ga0070694_1000363993 300
434 3300005545 Ga0070695_100324440 Ga0070695_1003244401 300
435 3300005617 Ga0068859_100024529 Ga0068859_1000245296 300
436 3300005843 Ga0068860_100079931 Ga0068860_1000799313 300
437 3300005844 Ga0068862_100013111 Ga0068862_1000131114 300
438 3300006931 Ga0097620_100024529 Ga0097620_1000245296 300
439 3300009553 Ga0105249_10053764 Ga0105249_100537644 300
440 3300013306 Ga0163162_10132892 Ga0163162_101328922 300
441 3300015262 Ga0182007_10005077 Ga0182007_100050776 300
442 3300025918 Ga0207662_10051643 Ga0207662_100516432 300
443 3300025936 Ga0207670_10172299 Ga0207670_101722992 300
444 3300026118 Ga0207675_100349877 Ga0207675_1003498772 300
445 3300028381 Ga0268264_10014308 Ga0268264_100143085 300
446 3300028794 Ga0307515_10000672 Ga0307515_1000067220 300
447 3300031242 Ga0265329_10012809 Ga0265329_100128092 300
448 3300031249 Ga0265339_10007126 Ga0265339_100071265 300
449 3300031344 Ga0265316_10051868 Ga0265316_100518682 300
450 3300031711 Ga0265314_10049078 Ga0265314_100490781 300
451 3300031712 Ga0265342_10000093 Ga0265342_1000009382 300
452 3300046454 Ga0495592_0000211 Ga0495592_0000211_21049_22068 300
453 3300047472 Ga0495686_0001796 Ga0495686_0001796_13980_15017 300
454 3300048929 Ga0496126_0023604 Ga0496126_0023604_560_1666 300
455 3300053154 Ga0500619_012284 Ga0500619_012284_604_1623 300
456 3300005327 Ga0070658_10022977 Ga0070658_100229775 301
457 3300005336 Ga0070680_100004657 Ga0070680_1000046578 301
458 3300005344 Ga0070661_100131055 Ga0070661_1001310552 301
459 3300005366 Ga0070659_100107566 Ga0070659_1001075662 301
460 3300005458 Ga0070681_10008829 Ga0070681_100088294 301
461 3300005530 Ga0070679_100123674 Ga0070679_1001236743 301
462 3300005563 Ga0068855_100065928 Ga0068855_1000659284 301
463 3300009093 Ga0105240_10004504 Ga0105240_1000450413 301
464 3300009148 Ga0105243_10442623 Ga0105243_104426232 301
465 3300009545 Ga0105237_10001223 Ga0105237_1000122321 301
466 3300025909 Ga0207705_10110408 Ga0207705_101104081 301
467 3300025912 Ga0207707_10081739 Ga0207707_100817394 301
468 3300025913 Ga0207695_10017312 Ga0207695_100173123 301
469 3300025917 Ga0207660_10082919 Ga0207660_100829192 301
470 3300025932 Ga0207690_10081960 Ga0207690_100819602 301
471 3300025949 Ga0207667_10262410 Ga0207667_102624102 301
472 3300028379 Ga0268266_10313305 Ga0268266_103133052 301
473 3300028800 Ga0265338_10168694 Ga0265338_101686942 301
474 3300031711 Ga0265314_10117616 Ga0265314_101176162 301
475 3300031712 Ga0265342_10004065 Ga0265342_100040654 301
476 3300037068 Ga0373925_0017392 Ga0373925_0017392_2454_3485 301
477 3300041997 Ga0439431_0037935 Ga0439431_0037935_111_1145 301
478 3300048916 Ga0496113_0068939 Ga0496113_0068939_724_1800 301
479 3300049581 Ga0501047_0046097 Ga0501047_0046097_2746_3762 301
480 3300049590 Ga0501074_0066721 Ga0501074_0066721_898_1914 301
481 3300049823 Ga0501044_0028392 Ga0501044_0028392_2557_3573 301
482 iso_pu_bacteria 2643221683 2644465022 301
483 3300005329 Ga0070683_100225599 Ga0070683_1002255992 302
484 3300005345 Ga0070692_10032113 Ga0070692_100321132 302
485 3300005535 Ga0070684_100071099 Ga0070684_1000710991 302
486 3300005844 Ga0068862_100012901 Ga0068862_1000129015 302
487 3300005983 Ga0081540_1081956 Ga0081540_10819562 302
488 3300006881 Ga0068865_100133254 Ga0068865_1001332542 302
489 3300013306 Ga0163162_10154108 Ga0163162_101541083 302
490 3300014497 Ga0182008_10083636 Ga0182008_100836362 302
491 3300025303 Ga0209051_1028852 Ga0209051_10288522 302
492 3300025906 Ga0207699_10161523 Ga0207699_101615232 302
493 3300025938 Ga0207704_10025720 Ga0207704_100257202 302
494 3300025944 Ga0207661_10264895 Ga0207661_102648952 302
495 3300028380 Ga0268265_10142511 Ga0268265_101425112 302
496 3300031548 Ga0307408_100018996 Ga0307408_1000189964 302
497 3300031665 Ga0316575_10007066 Ga0316575_100070664 302
498 3300031911 Ga0307412_10205249 Ga0307412_102052491 302
499 3300032005 Ga0307411_10088323 Ga0307411_100883232 302
500 3300032133 Ga0316583_10037014 Ga0316583_100370142 302
501 3300037471 Ga0395905_0009460 Ga0395905_0009460_6248_7282 302
502 3300039437 Ga0436365_1193388 Ga0436365_1193388_426_1487 302
503 3300041404 Ga0439436_0006520 Ga0439436_0006520_1406_2449 302
504 3300041406 Ga0439439_0002593 Ga0439439_0002593_669_1712 302
505 3300041411 Ga0439466_0010788 Ga0439466_0010788_1998_3023 302
506 3300041411 Ga0439466_0012675 Ga0439466_0012675_1669_2712 302
507 3300042000 Ga0439437_003192 Ga0439437_003192_443_1447 302
508 3300042006 Ga0439432_004409 Ga0439432_004409_1422_2465 302
509 3300042015 Ga0439462_0002282 Ga0439462_0002282_466_1509 302
510 3300042125 Ga0450923_009722 Ga0450923_009722_148_1191 302
511 3300042134 Ga0450898_009755 Ga0450898_009755_278_1321 302
512 3300042435 Ga0439434_0008961 Ga0439434_0008961_1277_2320 302
513 3300046660 Ga0495625_0003058 Ga0495625_0003058_14955_16016 302
514 3300050493 nmdc:mga0k408_37678_c1 nmdc:mga0k408_37678_c1_1578_2615 302
515 iso_pu_bacteria 2831265667 2831269297 302
516 iso_pu_bacteria 2928084124 2928088468 302
517 3300005844 Ga0068862_100386379 Ga0068862_1003863792 303
518 3300006048 Ga0075363_100018735 Ga0075363_1000187352 303
519 3300006051 Ga0075364_10009276 Ga0075364_100092762 303
520 3300006058 Ga0075432_10003126 Ga0075432_100031266 303
521 3300006177 Ga0075362_10042488 Ga0075362_100424882 303
522 3300006195 Ga0075366_10042759 Ga0075366_100427592 303
523 3300009551 Ga0105238_10003525 Ga0105238_100035259 303
524 3300010375 Ga0105239_10002071 Ga0105239_1000207121 303
525 3300025913 Ga0207695_10005377 Ga0207695_100053772 303
526 3300025914 Ga0207671_10169317 Ga0207671_101693172 303
527 3300025924 Ga0207694_10000920 Ga0207694_1000092011 303
528 3300025924 Ga0207694_10058823 Ga0207694_100588234 303
529 3300027907 Ga0207428_10119803 Ga0207428_101198032 303
530 3300028794 Ga0307515_10011772 Ga0307515_100117721 303
531 3300031616 Ga0307508_10004594 Ga0307508_100045947 303
532 3300032005 Ga0307411_10063674 Ga0307411_100636743 303
533 3300037471 Ga0395905_0011143 Ga0395905_0011143_4645_5709 303
534 3300041405 Ga0439438_014435 Ga0439438_014435_1298_2332 303
535 3300041410 Ga0439461_0008949 Ga0439461_0008949_145_1170 303
536 3300041413 Ga0439465_0000527 Ga0439465_0000527_2467_3492 303
537 3300041997 Ga0439431_0003203 Ga0439431_0003203_135_1160 303
538 3300041999 Ga0439433_0000015 Ga0439433_0000015_12848_13873 303
539 3300042002 Ga0439442_003355 Ga0439442_003355_536_1561 303
540 3300042007 Ga0439449_0000342 Ga0439449_0000342_2649_3674 303
541 3300042010 Ga0439452_000945 Ga0439452_000945_7265_8290 303
542 3300042014 Ga0439457_001906 Ga0439457_001906_4578_5603 303
543 3300042015 Ga0439462_0005165 Ga0439462_0005165_1243_2268 303
544 3300042115 Ga0450911_000225 Ga0450911_000225_8735_9751 303
545 3300042138 Ga0450903_015996 Ga0450903_015996_85_1119 303
546 3300042156 Ga0439446_0004705 Ga0439446_0004705_43_1068 303
547 3300042435 Ga0439434_0000280 Ga0439434_0000280_1244_2269 303
548 3300042439 Ga0439464_0020129 Ga0439464_0020129_159_1193 303
549 3300046543 Ga0495645_0014319 Ga0495645_0014319_1014_2102 303
550 3300046660 Ga0495625_0000708 Ga0495625_0000708_8326_9345 303
551 3300046675 Ga0495657_0131828 Ga0495657_0131828_209_1342 303
552 3300049579 Ga0501043_0000004 Ga0501043_0000004_86157_87188 303
553 3300049580 Ga0501046_0000016 Ga0501046_0000016_204648_205679 303
554 3300049581 Ga0501047_0000012 Ga0501047_0000012_204328_205359 303
555 3300049582 Ga0501048_0000926 Ga0501048_0000926_11783_12814 303
556 3300049823 Ga0501044_0143444 Ga0501044_0143444_458_1489 303
557 3300049824 Ga0501045_0002191 Ga0501045_0002191_3011_4042 303
558 3300050491 nmdc:mga00v17_3436_c1 nmdc:mga00v17_3436_c1_2186_3205 303
559 3300050492 nmdc:mga0yw44_4155_c1 nmdc:mga0yw44_4155_c1_4528_5547 303
560 3300050493 nmdc:mga0k408_5585_c1 nmdc:mga0k408_5585_c1_1058_2077 303
561 3300053138 Ga0500564_025690 Ga0500564_025690_1582_2592 303
562 iso_pu_bacteria 2904541872 2904545368 303
563 iso_pu_bacteria 2929160207 2929165558 303
564 3300003354 JGI25160J50197_1008753 JGI25160J50197_10087533 304
565 3300003792 Ga0055540_1001006 Ga0055540_10010063 304
566 3300009148 Ga0105243_10000437 Ga0105243_1000043711 304
567 3300015261 Ga0182006_1081093 Ga0182006_10810931 304
568 3300025292 Ga0209676_1000937 Ga0209676_100093711 304
569 3300025303 Ga0209051_1000813 Ga0209051_100081311 304
570 3300025935 Ga0207709_10000571 Ga0207709_1000057111 304
571 3300042532 Ga0450893_0002631 Ga0450893_0002631_1396_2439 304
572 3300046492 Ga0495585_0000447 Ga0495585_0000447_5311_6348 304
573 3300046501 Ga0495607_0000359 Ga0495607_0000359_24669_25712 304
574 3300046506 Ga0495583_0000563 Ga0495583_0000563_11520_12557 304
575 3300046615 Ga0495656_0000082 Ga0495656_0000082_7259_8296 304
576 3300047445 Ga0495677_0032393 Ga0495677_0032393_438_1481 304
577 3300048088 Ga0495602_0218177 Ga0495602_0218177_26_1171 304
578 3300048929 Ga0496126_0035988 Ga0496126_0035988_755_1864 304
579 3300049460 Ga0495682_0005096 Ga0495682_0005096_3114_4151 304
580 3300050489 nmdc:mga03683_2833_c1 nmdc:mga03683_2833_c1_3288_4331 304
581 3300050490 nmdc:mga03n38_69487_c1 nmdc:mga03n38_69487_c1_557_1600 304
582 3300050491 nmdc:mga00v17_127038_c1 nmdc:mga00v17_127038_c1_218_1261 304
583 iso_pu_bacteria 8047673197 8047673705 304
584 3300025298 Ga0209050_1014765 Ga0209050_10147652 305
585 3300028800 Ga0265338_10011296 Ga0265338_100112969 305
586 3300031239 Ga0265328_10004323 Ga0265328_100043232 305
587 3300031711 Ga0265314_10012805 Ga0265314_100128054 305
588 3300053108 Ga0500562_014221 Ga0500562_014221_129_1178 305
589 iso_pu_bacteria 2738541307 2738880731 305
590 iso_pu_bacteria 2838054893 2838059274 305
591 3300005295 Ga0065707_10097975 Ga0065707_100979752 306
592 3300025294 Ga0209025_1000324 Ga0209025_100032433 306
593 3300046558 Ga0495633_0000041 Ga0495633_0000041_37953_38987 306
594 3300046674 Ga0495588_0068187 Ga0495588_0068187_147_1154 306
595 3300053121 Ga0500607_005158 Ga0500607_005158_5368_6384 306
596 3300053128 Ga0500626_018297 Ga0500626_018297_556_1563 306
597 3300053141 Ga0500574_004148 Ga0500574_004148_1079_2086 306
598 3300003784 Ga0055534_1002821 Ga0055534_10028212 307
599 3300005334 Ga0068869_100094238 Ga0068869_1000942383 307
600 3300005459 Ga0068867_100000475 Ga0068867_10000047515 307
601 3300005543 Ga0070672_100256187 Ga0070672_1002561872 307
602 3300005719 Ga0068861_100031158 Ga0068861_1000311582 307
603 3300005843 Ga0068860_100003014 Ga0068860_1000030144 307
604 3300006846 Ga0075430_100185071 Ga0075430_1001850712 307
605 3300006881 Ga0068865_100013192 Ga0068865_1000131922 307
606 3300009553 Ga0105249_10015311 Ga0105249_100153112 307
607 3300013297 Ga0157378_10047851 Ga0157378_100478512 307
608 3300013306 Ga0163162_10010549 Ga0163162_100105498 307
609 3300014968 Ga0157379_10023709 Ga0157379_100237093 307
610 3300017792 Ga0163161_10110701 Ga0163161_101107012 307
611 3300025284 Ga0209130_1003401 Ga0209130_10034012 307
612 3300025291 Ga0209675_1004306 Ga0209675_10043062 307
613 3300025292 Ga0209676_1008814 Ga0209676_10088145 307
614 3300025303 Ga0209051_1005757 Ga0209051_10057577 307
615 3300025923 Ga0207681_10009809 Ga0207681_100098092 307
616 3300025937 Ga0207669_10064754 Ga0207669_100647543 307
617 3300025942 Ga0207689_10110595 Ga0207689_101105951 307
618 3300025961 Ga0207712_10028698 Ga0207712_100286982 307
619 3300026089 Ga0207648_10011939 Ga0207648_100119393 307
620 3300026118 Ga0207675_100003260 Ga0207675_10000326014 307
621 3300028381 Ga0268264_10002750 Ga0268264_100027503 307
622 3300042156 Ga0439446_0048025 Ga0439446_0048025_190_1233 307
623 3300049572 Ga0501036_0070638 Ga0501036_0070638_1491_2528 307
624 3300049743 Ga0501081_0106752 Ga0501081_0106752_203_1240 307
625 iso_pu_bacteria 2513020051 2513230582 307
626 iso_pu_bacteria 2643221658 2644328557 307
627 iso_pu_bacteria 2643221672 2644399797 307
628 iso_pu_bacteria 2929520902 2929523005 307
629 iso_pu_bacteria 2945909444 2945909768 307
630 3300005356 Ga0070674_100031192 Ga0070674_1000311923 308
631 3300005617 Ga0068859_100120402 Ga0068859_1001204023 308
632 3300006353 Ga0075370_10004601 Ga0075370_100046012 308
633 3300006931 Ga0097620_100120402 Ga0097620_1001204023 308
634 3300009148 Ga0105243_10015432 Ga0105243_100154325 308
635 3300014968 Ga0157379_10041041 Ga0157379_100410412 308
636 3300028380 Ga0268265_10223766 Ga0268265_102237662 308
637 3300028381 Ga0268264_10196170 Ga0268264_101961702 308
638 3300028577 Ga0265318_10000365 Ga0265318_1000036512 308
639 3300031235 Ga0265330_10018646 Ga0265330_100186463 308
640 3300031238 Ga0265332_10001198 Ga0265332_1000119812 308
641 3300031239 Ga0265328_10001746 Ga0265328_100017466 308
642 3300031240 Ga0265320_10002741 Ga0265320_100027413 308
643 3300031242 Ga0265329_10002241 Ga0265329_100022415 308
644 3300031344 Ga0265316_10003245 Ga0265316_1000324510 308
645 3300031595 Ga0265313_10016983 Ga0265313_100169833 308
646 3300031711 Ga0265314_10011751 Ga0265314_100117514 308
647 3300031712 Ga0265342_10000914 Ga0265342_1000091410 308
648 3300046459 Ga0495629_0002103 Ga0495629_0002103_1822_2904 308
649 3300046462 Ga0495651_0151235 Ga0495651_0151235_382_1464 308
650 3300046472 Ga0495580_0092928 Ga0495580_0092928_102_1184 308
651 3300046517 Ga0495630_0046692 Ga0495630_0046692_1698_2780 308
652 3300046528 Ga0495642_0003905 Ga0495642_0003905_881_1963 308
653 3300046530 Ga0495654_0067222 Ga0495654_0067222_477_1559 308
654 3300046538 Ga0495609_0029183 Ga0495609_0029183_1400_2422 308
655 3300046543 Ga0495645_0000238 Ga0495645_0000238_25343_26425 308
656 3300046559 Ga0495667_0024349 Ga0495667_0024349_794_1876 308
657 3300046689 Ga0495613_0009049 Ga0495613_0009049_2138_3220 308
658 3300046691 Ga0495670_0030646 Ga0495670_0030646_84_1166 308
659 3300047315 Ga0495581_0002045 Ga0495581_0002045_7699_8781 308
660 3300047673 Ga0495593_0032620 Ga0495593_0032620_334_1416 308
661 3300048907 Ga0496104_0024340 Ga0496104_0024340_1870_2952 308
662 3300048907 Ga0496104_0430070 Ga0496104_0430070_55_1170 308
663 3300050493 nmdc:mga0k408_10388_c1 nmdc:mga0k408_10388_c1_2436_3461 308
664 3300050496 nmdc:mga07m45_538_c1 nmdc:mga07m45_538_c1_7336_8361 308
665 3300053079 Ga0500610_0035368 Ga0500610_0035368_750_1772 308
666 3300053091 Ga0500647_0041190 Ga0500647_0041190_1170_2183 308
667 3300002987 JGI25159J45721_1008361 JGI25159J45721_10083613 309
668 3300003215 JGI25153J46596_10012350 JGI25153J46596_100123502 309
669 3300003781 Ga0055536_1005871 Ga0055536_10058716 309
670 3300003784 Ga0055534_1004160 Ga0055534_10041603 309
671 3300003790 Ga0055528_1013569 Ga0055528_10135692 309
672 3300003791 Ga0055530_10000437 Ga0055530_100004375 309
673 3300005563 Ga0068855_100101953 Ga0068855_1001019532 309
674 3300009551 Ga0105238_10000294 Ga0105238_1000029417 309
675 3300010375 Ga0105239_10001564 Ga0105239_100015642 309
676 3300011119 Ga0105246_10036001 Ga0105246_100360012 309
677 3300013100 Ga0157373_10060310 Ga0157373_100603102 309
678 3300013104 Ga0157370_10011653 Ga0157370_100116537 309
679 3300013104 Ga0157370_10097136 Ga0157370_100971363 309
680 3300013105 Ga0157369_10097806 Ga0157369_100978062 309
681 3300025263 Ga0209565_1000190 Ga0209565_100019034 309
682 3300025273 Ga0209673_1000209 Ga0209673_100020929 309
683 3300025273 Ga0209673_1000393 Ga0209673_100039334 309
684 3300025284 Ga0209130_1001281 Ga0209130_100128121 309
685 3300025291 Ga0209675_1000300 Ga0209675_10003008 309
686 3300025292 Ga0209676_1000048 Ga0209676_100004882 309
687 3300025295 Ga0209564_1000423 Ga0209564_10004239 309
688 3300025298 Ga0209050_1000012 Ga0209050_100001282 309
689 3300025299 Ga0209256_1000095 Ga0209256_1000095206 309
690 3300025302 Ga0207426_1000161 Ga0207426_100016191 309
691 3300025304 Ga0209257_1000024 Ga0209257_100002428 309
692 3300025914 Ga0207671_10100648 Ga0207671_101006481 309
693 3300025919 Ga0207657_10149032 Ga0207657_101490321 309
694 3300025949 Ga0207667_10217770 Ga0207667_102177702 309
695 3300046453 Ga0495627_025961 Ga0495627_025961_31_1065 309
696 3300046460 Ga0495638_0025325 Ga0495638_0025325_1879_2895 309
697 3300046512 Ga0495610_0020599 Ga0495610_0020599_1185_2210 309
698 3300046518 Ga0495631_0000176 Ga0495631_0000176_34365_35390 309
699 3300046520 Ga0495637_0012678 Ga0495637_0012678_2130_3155 309
700 3300046530 Ga0495654_0003540 Ga0495654_0003540_5254_6279 309
701 3300046660 Ga0495625_0098470 Ga0495625_0098470_869_1894 309
702 3300046660 Ga0495625_0129657 Ga0495625_0129657_32_1057 309
703 3300046674 Ga0495588_0080109 Ga0495588_0080109_200_1225 309
704 3300046692 Ga0495671_0020441 Ga0495671_0020441_853_1878 309
705 3300047321 Ga0495676_0016520 Ga0495676_0016520_910_1935 309
706 3300047673 Ga0495593_0039375 Ga0495593_0039375_608_1633 309
707 3300048089 Ga0495614_0097801 Ga0495614_0097801_55_1080 309
708 3300048922 Ga0496119_0049405 Ga0496119_0049405_132_1157 309
709 3300048924 Ga0496121_0170027 Ga0496121_0170027_209_1234 309
710 3300048925 Ga0496122_0179699 Ga0496122_0179699_146_1171 309
711 3300048926 Ga0496123_0021160 Ga0496123_0021160_193_1227 309
712 3300048928 Ga0496125_0071202 Ga0496125_0071202_793_1836 309
713 3300048929 Ga0496126_0084685 Ga0496126_0084685_450_1475 309
714 3300053079 Ga0500610_0091821 Ga0500610_0091821_436_1461 309
715 3300053093 Ga0500651_0000286 Ga0500651_0000286_23115_24140 309
716 3300053094 Ga0500566_0029149 Ga0500566_0029149_1137_2162 309
717 3300053110 Ga0500571_001412 Ga0500571_001412_1652_2677 309
718 3300053117 Ga0500593_000452 Ga0500593_000452_8332_9357 309
719 3300053118 Ga0500594_0002152 Ga0500594_0002152_1186_2211 309
720 3300053133 Ga0500655_000688 Ga0500655_000688_4070_5095 309
721 3300053134 Ga0500658_0000137 Ga0500658_0000137_4665_5690 309
722 3300053134 Ga0500658_0000140 Ga0500658_0000140_28045_29070 309
723 3300053139 Ga0500568_0012170 Ga0500568_0012170_2221_3246 309
724 3300053158 Ga0500627_0000922 Ga0500627_0000922_4036_5061 309
725 3300053161 Ga0500634_0001046 Ga0500634_0001046_5104_6129 309
726 3300053162 Ga0500638_000736 Ga0500638_000736_6752_7777 309
727 3300053177 Ga0500636_0006898 Ga0500636_0006898_1684_2709 309
728 3300005355 Ga0070671_100109810 Ga0070671_1001098102 310
729 3300005459 Ga0068867_100042639 Ga0068867_1000426392 310
730 3300025907 Ga0207645_10000882 Ga0207645_1000088226 310
731 3300025931 Ga0207644_10184009 Ga0207644_101840091 310
732 3300032002 Ga0307416_100147849 Ga0307416_1001478492 310
733 iso_pu_bacteria 2791355137 2792840782 310
734 iso_pu_bacteria 2885198086 2885202990 310
735 iso_pu_bacteria 2904449895 2904456489 310
736 iso_pu_bacteria 2904615490 2904623784 310
737 3300003187 JGI25151J46595_10006295 JGI25151J46595_100062952 311
738 3300003316 rootH1_10019448 rootH1_100194483 311
739 3300003781 Ga0055536_1006495 Ga0055536_10064953 311
740 3300003791 Ga0055530_10011770 Ga0055530_100117703 311
741 3300003792 Ga0055540_1005359 Ga0055540_10053594 311
742 3300003794 Ga0055531_10007715 Ga0055531_100077153 311
743 3300005328 Ga0070676_10045023 Ga0070676_100450232 311
744 3300005457 Ga0070662_100320121 Ga0070662_1003201212 311
745 3300005546 Ga0070696_100061913 Ga0070696_1000619132 311
746 3300005549 Ga0070704_100030547 Ga0070704_1000305472 311
747 3300005842 Ga0068858_100024404 Ga0068858_1000244044 311
748 3300006237 Ga0097621_100219624 Ga0097621_1002196242 311
749 3300006353 Ga0075370_10011522 Ga0075370_100115225 311
750 3300009036 Ga0105244_10010903 Ga0105244_100109036 311
751 3300009098 Ga0105245_10323620 Ga0105245_103236201 311
752 3300010375 Ga0105239_10243272 Ga0105239_102432722 311
753 3300011119 Ga0105246_10101522 Ga0105246_101015222 311
754 3300015261 Ga0182006_1007490 Ga0182006_10074904 311
755 3300015262 Ga0182007_10004855 Ga0182007_100048553 311
756 3300025292 Ga0209676_1000433 Ga0209676_10004334 311
757 3300025294 Ga0209025_1001026 Ga0209025_100102635 311
758 3300025298 Ga0209050_1000912 Ga0209050_100091232 311
759 3300025303 Ga0209051_1000207 Ga0209051_100020738 311
760 3300025304 Ga0209257_1000249 Ga0209257_100024996 311
761 3300025728 Ga0207655_1008233 Ga0207655_10082335 311
762 3300025935 Ga0207709_10001937 Ga0207709_100019376 311
763 3300028380 Ga0268265_10029770 Ga0268265_100297703 311
764 3300048919 Ga0496116_0030707 Ga0496116_0030707_1774_2805 311
765 3300048920 Ga0496117_0010723 Ga0496117_0010723_1624_2655 311
766 3300048921 Ga0496118_0013061 Ga0496118_0013061_2160_3191 311
767 3300053121 Ga0500607_014684 Ga0500607_014684_1693_2733 311
768 3300053729 Ga0500625_010895 Ga0500625_010895_889_1929 311
769 iso_pu_bacteria 2744054900 2746090194 311
770 iso_pu_bacteria 2744054901 2746095634 311
771 iso_pu_bacteria 2818991450 2819621106 311
772 3300005367 Ga0070667_100045132 Ga0070667_1000451323 312
773 3300005616 Ga0068852_100063672 Ga0068852_1000636723 312
774 3300015265 Ga0182005_1033824 Ga0182005_10338242 312
775 3300017792 Ga0163161_10019895 Ga0163161_100198954 312
776 3300025927 Ga0207687_10205662 Ga0207687_102056621 312
777 3300026142 Ga0207698_10083895 Ga0207698_100838952 312
778 3300031251 Ga0265327_10008996 Ga0265327_100089962 312
779 3300046459 Ga0495629_0116832 Ga0495629_0116832_307_1383 312
780 3300046475 Ga0495639_0006956 Ga0495639_0006956_2979_4055 312
781 3300046528 Ga0495642_0016956 Ga0495642_0016956_770_1846 312
782 3300046535 Ga0495586_0114980 Ga0495586_0114980_294_1370 312
783 3300046674 Ga0495588_0018807 Ga0495588_0018807_160_1236 312
784 3300046691 Ga0495670_0050488 Ga0495670_0050488_535_1611 312
785 3300048089 Ga0495614_0055441 Ga0495614_0055441_358_1434 312
786 3300048903 Ga0496100_0001197 Ga0496100_0001197_11253_12329 312
787 3300048904 Ga0496101_0011059 Ga0496101_0011059_3472_4548 312
788 3300048905 Ga0496102_0003955 Ga0496102_0003955_8335_9411 312
789 3300048907 Ga0496104_0006593 Ga0496104_0006593_7649_8725 312
790 3300048908 Ga0496105_0002074 Ga0496105_0002074_11158_12234 312
791 3300048909 Ga0496106_0027941 Ga0496106_0027941_955_2031 312
792 3300048913 Ga0496110_0191439 Ga0496110_0191439_313_1389 312
793 3300046615 Ga0495656_0000055 Ga0495656_0000055_20751_21827 313
794 iso_pu_bacteria 2599185214 2599626399 313
795 iso_pu_bacteria 2599185226 2599676277 313
796 iso_pu_bacteria 2599185227 2599682101 313
797 iso_pu_bacteria 2599185229 2599695751 313
798 iso_pu_bacteria 2818991446 2819601674 313
799 iso_pu_bacteria 2899924645 2899930741 313
800 iso_pu_bacteria 2928037797 2928040938 313
801 iso_pu_bacteria 2928044640 2928047780 313
802 iso_pu_bacteria 2928051484 2928055671 313
803 iso_pu_bacteria 2928064002 2928069769 313
804 iso_pu_bacteria 2928070936 2928075373 313
805 3300014497 Ga0182008_10002819 Ga0182008_100028195 314
806 3300015261 Ga0182006_1035995 Ga0182006_10359952 314
807 3300015262 Ga0182007_10002612 Ga0182007_100026125 314
808 3300046475 Ga0495639_0008332 Ga0495639_0008332_2572_3675 314
809 3300015683 Ga0183362_10005 Ga0183362_10005239 315
810 3300025294 Ga0209025_1026811 Ga0209025_10268112 315
811 3300025298 Ga0209050_1007525 Ga0209050_10075253 315
812 3300048919 Ga0496116_0033691 Ga0496116_0033691_719_1810 315
813 3300048920 Ga0496117_0039334 Ga0496117_0039334_771_1862 315
814 3300048924 Ga0496121_0132618 Ga0496121_0132618_112_1194 315
815 3300025981 Ga0207640_10134607 Ga0207640_101346072 316
816 3300031731 Ga0307405_10240543 Ga0307405_102405432 316
817 3300053122 Ga0500608_001053 Ga0500608_001053_4752_5798 316
818 iso_pu_bacteria 2738541277 2738721372 316
819 iso_pu_bacteria 2738543019 2739281041 316
820 3300002774 JGI25150J39212_1003328 JGI25150J39212_10033283 317
821 3300003323 rootH1_10035358 rootH1_100353583 317
822 3300003374 JGI25161J50226_1004068 JGI25161J50226_10040683 317
823 3300003761 Ga0055535_1001801 Ga0055535_10018013 317
824 3300003762 Ga0055542_1000074 Ga0055542_100007434 317
825 3300013102 Ga0157371_10116193 Ga0157371_101161932 317
826 3300013307 Ga0157372_10062009 Ga0157372_100620093 317
827 3300025228 Ga0209672_101000 Ga0209672_10100012 317
828 3300025229 Ga0209147_100591 Ga0209147_1005917 317
829 3300025242 Ga0209258_100176 Ga0209258_100176106 317
830 3300025245 Ga0207425_1000133 Ga0207425_100013342 317
831 3300025254 Ga0209148_1000033 Ga0209148_1000033237 317
832 3300025258 Ga0209129_1000186 Ga0209129_100018643 317
833 3300025284 Ga0209130_1000433 Ga0209130_100043342 317
834 3300025294 Ga0209025_1000947 Ga0209025_10009477 317
835 3300025295 Ga0209564_1000417 Ga0209564_100041742 317
836 3300025297 Ga0209758_1000092 Ga0209758_1000092191 317
837 3300025299 Ga0209256_1000094 Ga0209256_1000094161 317
838 3300025302 Ga0207426_1000084 Ga0207426_100008442 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

63

325

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4717 19 255
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4225 40 256
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4073 26 256
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.3718 19 255
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.3653 40 256
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7815 40 275 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7396 44 275 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6923 40 275 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6842 40 275 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.661 40 275 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A536UBZ2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9405 141 302 GO:0005886
GO:0015658
AF-A0A6A7YB17-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9325 12 299 GO:0005886
GO:0015658
AF-A0A536S1Y1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9302 18 308 GO:0005886
GO:0015658
AF-A0A1F4F3L2-F1-model_v4 ABC transporter permease 0.9284 10 299 GO:0005886
GO:0015658
AF-A0A1Q7CXZ4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9276 40 310 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
77.49 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map