F482999
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 838 | 253 | 1676 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300046692|Ga0495671_0184893|Ga0495671_0184893_277_801 |
| Length | 174 |
| Sequence | MQNQRARFLAPFFLAAASALSVTKPFKIPESVLVVIHTAELEVLLIERADHAGYWQSVTGSKDAPDEPLETTARREVLEETGIRIGSPEVPVENLRDWHLHNVYEIYPVWRHRYADGVTHNTEFVFGLRVPGGVPVVLSPREHLAHLWLPWREAADKCFSPSNAQAIRQLPRHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 34 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 57 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 95 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 103 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 104 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 105 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 106 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 107 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 108 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 109 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 110 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 111 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 112 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 115 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 116 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 117 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 118 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 119 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 223 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 224 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 225 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 226 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 237 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 240 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 243 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 250 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 251 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 252 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 253 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 1.07 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.77 |
| Nodule | 0.12 |
| Rhizoplane | 4.3 |
| Rhizosphere | 88.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495671_0184893 | 3300046692 | Bacteria | 1012 |
| 2 | JGI25159J45721_1006121 | 3300002987 | Bacteria | 3650 |
| 3 | rootL2_10061727 | 3300003322 | Bacteria | 13340 |
| 4 | rootL2_10083645 | 3300003322 | Bacteria | 2250 |
| 5 | rootL2_10084421 | 3300003322 | Bacteria | 1172 |
| 6 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 7 | Ga0055542_1007139 | 3300003762 | Bacteria | 2306 |
| 8 | Ga0055537_1001720 | 3300003773 | Bacteria | 8082 |
| 9 | Ga0055524_1026165 | 3300003775 | Bacteria | 1811 |
| 10 | Ga0055534_1001549 | 3300003784 | Bacteria | 8967 |
| 11 | Ga0055528_1003223 | 3300003790 | Bacteria | 8324 |
| 12 | Ga0055528_1003362 | 3300003790 | Bacteria | 8078 |
| 13 | Ga0055543_1006717 | 3300004625 | Bacteria | 2741 |
| 14 | Ga0065165_1000379 | 3300005262 | Bacteria | 72513 |
| 15 | Ga0065165_1005927 | 3300005262 | Bacteria | 6626 |
| 16 | Ga0065165_1010778 | 3300005262 | Bacteria | 3900 |
| 17 | Ga0065715_10022541 | 3300005293 | Bacteria | 1693 |
| 18 | Ga0070658_10158111 | 3300005327 | Bacteria | 1900 |
| 19 | Ga0070658_10410750 | 3300005327 | Bacteria | 1163 |
| 20 | Ga0070658_10777872 | 3300005327 | Bacteria | 831 |
| 21 | Ga0070660_100083255 | 3300005339 | Bacteria | 2513 |
| 22 | Ga0070661_100295017 | 3300005344 | Bacteria | 1261 |
| 23 | Ga0070671_100303845 | 3300005355 | Bacteria | 1359 |
| 24 | Ga0070673_100191802 | 3300005364 | Bacteria | 1755 |
| 25 | Ga0070659_100024252 | 3300005366 | Bacteria | 4649 |
| 26 | Ga0070659_101298647 | 3300005366 | Bacteria | 645 |
| 27 | Ga0070667_100001552 | 3300005367 | Bacteria | 20593 |
| 28 | Ga0070663_100164975 | 3300005455 | Bacteria | 1708 |
| 29 | Ga0070678_101021506 | 3300005456 | Bacteria | 761 |
| 30 | Ga0070662_100056986 | 3300005457 | Bacteria | 2838 |
| 31 | Ga0070662_100248719 | 3300005457 | Bacteria | 1428 |
| 32 | Ga0070662_100702261 | 3300005457 | Bacteria | 856 |
| 33 | Ga0070685_10679058 | 3300005466 | Bacteria | 749 |
| 34 | Ga0070707_100100829 | 3300005468 | Bacteria | 2798 |
| 35 | Ga0070707_100277262 | 3300005468 | Bacteria | 1630 |
| 36 | Ga0070699_100427046 | 3300005518 | Bacteria | 1200 |
| 37 | Ga0070665_100901584 | 3300005548 | Bacteria | 897 |
| 38 | Ga0068855_100060526 | 3300005563 | Bacteria | 4428 |
| 39 | Ga0070664_100095965 | 3300005564 | Bacteria | 2572 |
| 40 | Ga0070664_100120554 | 3300005564 | Bacteria | 2296 |
| 41 | Ga0070664_100873491 | 3300005564 | Bacteria | 842 |
| 42 | Ga0068857_100644580 | 3300005577 | Bacteria | 1003 |
| 43 | Ga0068852_100362542 | 3300005616 | Bacteria | 1418 |
| 44 | Ga0068852_100987195 | 3300005616 | Bacteria | 861 |
| 45 | Ga0075368_10007481 | 3300006042 | Bacteria | 3852 |
| 46 | Ga0075363_100056028 | 3300006048 | Bacteria | 2112 |
| 47 | Ga0075363_100139808 | 3300006048 | Bacteria | 1363 |
| 48 | Ga0075362_10015394 | 3300006177 | Bacteria | 3110 |
| 49 | Ga0075367_10011116 | 3300006178 | Bacteria | 4749 |
| 50 | Ga0075367_10076935 | 3300006178 | Bacteria | 2014 |
| 51 | Ga0075366_10082065 | 3300006195 | Bacteria | 1926 |
| 52 | Ga0075370_10020673 | 3300006353 | Bacteria | 3601 |
| 53 | Ga0075370_10134015 | 3300006353 | Bacteria | 1446 |
| 54 | Ga0097620_101304639 | 3300006931 | Bacteria | 800 |
| 55 | Ga0099823_1111318 | 3300006944 | Bacteria | 758 |
| 56 | Ga0105240_10045259 | 3300009093 | Bacteria | 5584 |
| 57 | Ga0105240_10109254 | 3300009093 | Bacteria | 3349 |
| 58 | Ga0105245_10417425 | 3300009098 | Bacteria | 1344 |
| 59 | Ga0105243_10002215 | 3300009148 | Bacteria | 16379 |
| 60 | Ga0105241_10005986 | 3300009174 | Bacteria | 8974 |
| 61 | Ga0105242_10014469 | 3300009176 | Bacteria | 6113 |
| 62 | Ga0105237_10020509 | 3300009545 | Bacteria | 6811 |
| 63 | Ga0105238_10660229 | 3300009551 | Bacteria | 1056 |
| 64 | Ga0105238_11349575 | 3300009551 | Bacteria | 740 |
| 65 | Ga0105239_10046332 | 3300010375 | Bacteria | 4765 |
| 66 | Ga0105246_11541566 | 3300011119 | Bacteria | 626 |
| 67 | Ga0157371_10000018 | 3300013102 | Bacteria | 310522 |
| 68 | Ga0157369_10899359 | 3300013105 | Bacteria | 908 |
| 69 | Ga0157372_10277979 | 3300013307 | Bacteria | 1947 |
| 70 | Ga0157375_10817909 | 3300013308 | Bacteria | 1080 |
| 71 | Ga0182008_10044562 | 3300014497 | Bacteria | 2206 |
| 72 | Ga0157379_10266625 | 3300014968 | Bacteria | 1557 |
| 73 | Ga0157376_11174487 | 3300014969 | Bacteria | 795 |
| 74 | Ga0182007_10054224 | 3300015262 | Bacteria | 1319 |
| 75 | Ga0213872_10000124 | 3300021361 | Bacteria | 72197 |
| 76 | Ga0209148_1001117 | 3300025254 | Bacteria | 15972 |
| 77 | Ga0209565_1000123 | 3300025263 | Bacteria | 111069 |
| 78 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 79 | Ga0209130_1000195 | 3300025284 | Bacteria | 83371 |
| 80 | Ga0209675_1000117 | 3300025291 | Bacteria | 111087 |
| 81 | Ga0209564_1000121 | 3300025295 | Bacteria | 204081 |
| 82 | Ga0209256_1000288 | 3300025299 | Bacteria | 88470 |
| 83 | Ga0207426_1056280 | 3300025302 | Bacteria | 1149 |
| 84 | Ga0207705_10009012 | 3300025909 | Bacteria | 7269 |
| 85 | Ga0207705_10829292 | 3300025909 | Bacteria | 717 |
| 86 | Ga0207684_10003818 | 3300025910 | Bacteria | 14514 |
| 87 | Ga0207654_10002804 | 3300025911 | Bacteria | 8851 |
| 88 | Ga0207695_10240854 | 3300025913 | Bacteria | 1710 |
| 89 | Ga0207671_10016967 | 3300025914 | Bacteria | 5636 |
| 90 | Ga0207657_10009828 | 3300025919 | Bacteria | 9583 |
| 91 | Ga0207657_10197042 | 3300025919 | Bacteria | 1622 |
| 92 | Ga0207649_10014709 | 3300025920 | Bacteria | 4387 |
| 93 | Ga0207649_10305823 | 3300025920 | Bacteria | 1164 |
| 94 | Ga0207646_10286503 | 3300025922 | Bacteria | 1489 |
| 95 | Ga0207694_10505007 | 3300025924 | Bacteria | 1013 |
| 96 | Ga0207687_10181401 | 3300025927 | Bacteria | 1631 |
| 97 | Ga0207687_10198678 | 3300025927 | Bacteria | 1565 |
| 98 | Ga0207644_10192353 | 3300025931 | Bacteria | 1605 |
| 99 | Ga0207690_10023417 | 3300025932 | Bacteria | 3853 |
| 100 | Ga0207706_10046269 | 3300025933 | Bacteria | 3853 |
| 101 | Ga0207706_10275802 | 3300025933 | Bacteria | 1467 |
| 102 | Ga0207706_10367778 | 3300025933 | Bacteria | 1249 |
| 103 | Ga0207686_10016983 | 3300025934 | Bacteria | 4092 |
| 104 | Ga0207709_10036328 | 3300025935 | Bacteria | 2919 |
| 105 | Ga0207689_10136306 | 3300025942 | Bacteria | 2021 |
| 106 | Ga0207689_10163461 | 3300025942 | Bacteria | 1834 |
| 107 | Ga0207679_10099245 | 3300025945 | Bacteria | 2273 |
| 108 | Ga0207679_10569845 | 3300025945 | Bacteria | 1018 |
| 109 | Ga0207667_10035454 | 3300025949 | Bacteria | 5352 |
| 110 | Ga0207667_11000673 | 3300025949 | Bacteria | 823 |
| 111 | Ga0207651_10100454 | 3300025960 | Bacteria | 2145 |
| 112 | Ga0207640_10324365 | 3300025981 | Bacteria | 1227 |
| 113 | Ga0207658_10001532 | 3300025986 | Bacteria | 17967 |
| 114 | Ga0207677_10428967 | 3300026023 | Bacteria | 1128 |
| 115 | Ga0207678_10172684 | 3300026067 | Bacteria | 1846 |
| 116 | Ga0207648_10541945 | 3300026089 | Bacteria | 1068 |
| 117 | Ga0207674_10308583 | 3300026116 | Bacteria | 1531 |
| 118 | Ga0207698_10033237 | 3300026142 | Bacteria | 3746 |
| 119 | Ga0209813_10029371 | 3300027866 | Bacteria | 1609 |
| 120 | Ga0268266_10561503 | 3300028379 | Bacteria | 1094 |
| 121 | Ga0268264_10441000 | 3300028381 | Bacteria | 1260 |
| 122 | Ga0316181_1170813 | 3300030744 | Bacteria | 737 |
| 123 | Ga0307513_10497163 | 3300031456 | Bacteria | 937 |
| 124 | Ga0307412_10501518 | 3300031911 | Bacteria | 1011 |
| 125 | Ga0395899_0000249 | 3300037312 | Bacteria | 71998 |
| 126 | Ga0395899_0033763 | 3300037312 | Bacteria | 3842 |
| 127 | Ga0395899_0048851 | 3300037312 | Bacteria | 3146 |
| 128 | Ga0395899_0107856 | 3300037312 | Bacteria | 2004 |
| 129 | Ga0395899_0137553 | 3300037312 | Bacteria | 1740 |
| 130 | Ga0395899_0188231 | 3300037312 | Bacteria | 1445 |
| 131 | Ga0395899_0234849 | 3300037312 | Bacteria | 1264 |
| 132 | Ga0395899_0466535 | 3300037312 | Bacteria | 824 |
| 133 | Ga0395899_0606730 | 3300037312 | Bacteria | 696 |
| 134 | Ga0395900_0001341 | 3300037418 | Bacteria | 29739 |
| 135 | Ga0395900_0048852 | 3300037418 | Bacteria | 4357 |
| 136 | Ga0395900_0074025 | 3300037418 | Bacteria | 3502 |
| 137 | Ga0395900_0096486 | 3300037418 | Bacteria | 3037 |
| 138 | Ga0395900_0159135 | 3300037418 | Bacteria | 2304 |
| 139 | Ga0395900_0182666 | 3300037418 | Bacteria | 2130 |
| 140 | Ga0395900_0222150 | 3300037418 | Bacteria | 1903 |
| 141 | Ga0395900_0235211 | 3300037418 | Bacteria | 1840 |
| 142 | Ga0395900_0245402 | 3300037418 | Bacteria | 1794 |
| 143 | Ga0395900_0277087 | 3300037418 | Bacteria | 1670 |
| 144 | Ga0395900_0639926 | 3300037418 | Bacteria | 1001 |
| 145 | Ga0395900_0657244 | 3300037418 | Bacteria | 984 |
| 146 | Ga0395900_0874464 | 3300037418 | Bacteria | 823 |
| 147 | Ga0395900_0878902 | 3300037418 | Bacteria | 820 |
| 148 | Ga0395898_0042884 | 3300037466 | Bacteria | 4461 |
| 149 | Ga0395898_0226410 | 3300037466 | Bacteria | 1783 |
| 150 | Ga0395898_0519146 | 3300037466 | Bacteria | 1132 |
| 151 | Ga0395898_1693884 | 3300037466 | Bacteria | 555 |
| 152 | Ga0395905_0099219 | 3300037471 | Bacteria | 2735 |
| 153 | Ga0395905_0105005 | 3300037471 | Bacteria | 2652 |
| 154 | Ga0395905_0112723 | 3300037471 | Bacteria | 2554 |
| 155 | Ga0395905_0430900 | 3300037471 | Bacteria | 1215 |
| 156 | Ga0395905_0450154 | 3300037471 | Bacteria | 1185 |
| 157 | Ga0395905_0487525 | 3300037471 | Bacteria | 1132 |
| 158 | Ga0395905_1362971 | 3300037471 | Bacteria | 613 |
| 159 | Ga0395901_0000943 | 3300038443 | Bacteria | 31649 |
| 160 | Ga0395901_0033793 | 3300038443 | Bacteria | 5280 |
| 161 | Ga0395901_0071349 | 3300038443 | Bacteria | 3619 |
| 162 | Ga0395901_0131622 | 3300038443 | Bacteria | 2628 |
| 163 | Ga0395901_0181792 | 3300038443 | Bacteria | 2205 |
| 164 | Ga0395901_1072245 | 3300038443 | Bacteria | 777 |
| 165 | Ga0436361_0638016 | 3300039447 | Bacteria | 61418 |
| 166 | Ga0439442_039300 | 3300042002 | Bacteria | 992 |
| 167 | Ga0439448_0000168 | 3300042005 | Bacteria | 13108 |
| 168 | Ga0439448_0007191 | 3300042005 | Bacteria | 3218 |
| 169 | Ga0439449_0052511 | 3300042007 | Bacteria | 1507 |
| 170 | Ga0439455_0018873 | 3300042012 | Bacteria | 1621 |
| 171 | Ga0439455_0040059 | 3300042012 | Bacteria | 1197 |
| 172 | Ga0450911_011722 | 3300042115 | Bacteria | 1194 |
| 173 | Ga0450904_000209 | 3300042139 | Bacteria | 12729 |
| 174 | Ga0439458_0026919 | 3300042157 | Bacteria | 1354 |
| 175 | Ga0466969_0013213 | 3300044656 | Bacteria | 4349 |
| 176 | Ga0466969_0146380 | 3300044656 | Bacteria | 1090 |
| 177 | Ga0466969_0169188 | 3300044656 | Bacteria | 1002 |
| 178 | Ga0466972_0016349 | 3300044658 | Bacteria | 3709 |
| 179 | Ga0466965_0380128 | 3300044683 | Bacteria | 777 |
| 180 | Ga0466966_0003925 | 3300044684 | Bacteria | 9822 |
| 181 | Ga0466966_0267686 | 3300044684 | Bacteria | 1028 |
| 182 | Ga0466966_0346593 | 3300044684 | Bacteria | 892 |
| 183 | Ga0466966_0367215 | 3300044684 | Bacteria | 864 |
| 184 | Ga0466961_0075458 | 3300044693 | Bacteria | 2137 |
| 185 | Ga0466961_0345172 | 3300044693 | Bacteria | 906 |
| 186 | Ga0466963_0251659 | 3300044694 | Bacteria | 1240 |
| 187 | Ga0466963_0631243 | 3300044694 | Bacteria | 756 |
| 188 | Ga0466964_0002942 | 3300044706 | Bacteria | 6149 |
| 189 | Ga0466964_0004101 | 3300044706 | Bacteria | 5362 |
| 190 | Ga0466964_0199572 | 3300044706 | Bacteria | 959 |
| 191 | Ga0466968_0062297 | 3300044735 | Bacteria | 1610 |
| 192 | Ga0466957_0010320 | 3300044842 | Bacteria | 5356 |
| 193 | Ga0466957_0048974 | 3300044842 | Bacteria | 2568 |
| 194 | Ga0466957_0055251 | 3300044842 | Bacteria | 2426 |
| 195 | Ga0466957_0675636 | 3300044842 | Bacteria | 727 |
| 196 | Ga0466960_0160077 | 3300044901 | Bacteria | 1208 |
| 197 | Ga0466959_0119744 | 3300045049 | Bacteria | 1872 |
| 198 | Ga0466959_0168749 | 3300045049 | Bacteria | 1535 |
| 199 | Ga0466959_0228712 | 3300045049 | Bacteria | 1288 |
| 200 | Ga0466958_0152842 | 3300045836 | Bacteria | 1456 |
| 201 | Ga0466967_0056063 | 3300045976 | Bacteria | 3473 |
| 202 | Ga0466967_0865092 | 3300045976 | Bacteria | 898 |
| 203 | Ga0495617_018345 | 3300046452 | Bacteria | 2365 |
| 204 | Ga0495617_100122 | 3300046452 | Bacteria | 942 |
| 205 | Ga0495627_007797 | 3300046453 | Bacteria | 4073 |
| 206 | Ga0495603_0112260 | 3300046455 | Bacteria | 1589 |
| 207 | Ga0495603_0314135 | 3300046455 | Bacteria | 900 |
| 208 | Ga0495590_0000663 | 3300046457 | Bacteria | 15925 |
| 209 | Ga0495590_0005163 | 3300046457 | Bacteria | 5194 |
| 210 | Ga0495590_0122133 | 3300046457 | Bacteria | 933 |
| 211 | Ga0495591_004471 | 3300046458 | Bacteria | 6843 |
| 212 | Ga0495629_0007996 | 3300046459 | Bacteria | 7781 |
| 213 | Ga0495629_0070182 | 3300046459 | Bacteria | 2444 |
| 214 | Ga0495629_0080564 | 3300046459 | Bacteria | 2273 |
| 215 | Ga0495638_0009687 | 3300046460 | Bacteria | 6735 |
| 216 | Ga0495638_0101725 | 3300046460 | Bacteria | 1718 |
| 217 | Ga0495638_0108204 | 3300046460 | Bacteria | 1654 |
| 218 | Ga0495638_0146174 | 3300046460 | Bacteria | 1375 |
| 219 | Ga0495638_0587057 | 3300046460 | Bacteria | 549 |
| 220 | Ga0495653_0023954 | 3300046463 | Bacteria | 4925 |
| 221 | Ga0495653_0045230 | 3300046463 | Bacteria | 3414 |
| 222 | Ga0495653_0047784 | 3300046463 | Bacteria | 3308 |
| 223 | Ga0495653_0047806 | 3300046463 | Bacteria | 3307 |
| 224 | Ga0495653_0331405 | 3300046463 | Bacteria | 984 |
| 225 | Ga0495653_0383204 | 3300046463 | Bacteria | 897 |
| 226 | Ga0495650_0000082 | 3300046471 | Bacteria | 239477 |
| 227 | Ga0495650_0003329 | 3300046471 | Bacteria | 11841 |
| 228 | Ga0495650_0015120 | 3300046471 | Bacteria | 3976 |
| 229 | Ga0495580_0132480 | 3300046472 | Bacteria | 1728 |
| 230 | Ga0495580_0844317 | 3300046472 | Bacteria | 591 |
| 231 | Ga0495582_0037319 | 3300046473 | Bacteria | 2673 |
| 232 | Ga0495582_0064919 | 3300046473 | Bacteria | 2016 |
| 233 | Ga0495582_0076367 | 3300046473 | Bacteria | 1857 |
| 234 | Ga0495582_0147174 | 3300046473 | Bacteria | 1336 |
| 235 | Ga0495605_0000630 | 3300046474 | Bacteria | 27218 |
| 236 | Ga0495605_0003691 | 3300046474 | Bacteria | 9089 |
| 237 | Ga0495605_0008256 | 3300046474 | Bacteria | 5890 |
| 238 | Ga0495605_0013691 | 3300046474 | Bacteria | 4457 |
| 239 | Ga0495605_0026279 | 3300046474 | Bacteria | 3027 |
| 240 | Ga0495605_0032548 | 3300046474 | Bacteria | 2654 |
| 241 | Ga0495605_0042373 | 3300046474 | Bacteria | 2263 |
| 242 | Ga0495605_0064943 | 3300046474 | Bacteria | 1737 |
| 243 | Ga0495605_0103419 | 3300046474 | Bacteria | 1306 |
| 244 | Ga0495605_0109480 | 3300046474 | Bacteria | 1262 |
| 245 | Ga0495605_0114525 | 3300046474 | Bacteria | 1227 |
| 246 | Ga0495605_0115681 | 3300046474 | Bacteria | 1220 |
| 247 | Ga0495605_0119823 | 3300046474 | Bacteria | 1193 |
| 248 | Ga0495639_0211271 | 3300046475 | Bacteria | 952 |
| 249 | Ga0495584_0000005 | 3300046491 | Bacteria | 306957 |
| 250 | Ga0495584_0000994 | 3300046491 | Bacteria | 17803 |
| 251 | Ga0495584_0001189 | 3300046491 | Bacteria | 16000 |
| 252 | Ga0495584_0008421 | 3300046491 | Bacteria | 5341 |
| 253 | Ga0495584_0012773 | 3300046491 | Bacteria | 4285 |
| 254 | Ga0495584_0014148 | 3300046491 | Bacteria | 4066 |
| 255 | Ga0495584_0015107 | 3300046491 | Bacteria | 3934 |
| 256 | Ga0495584_0015109 | 3300046491 | Bacteria | 3934 |
| 257 | Ga0495584_0025718 | 3300046491 | Bacteria | 2984 |
| 258 | Ga0495584_0029664 | 3300046491 | Bacteria | 2773 |
| 259 | Ga0495584_0045931 | 3300046491 | Bacteria | 2203 |
| 260 | Ga0495584_0073256 | 3300046491 | Bacteria | 1721 |
| 261 | Ga0495584_0107155 | 3300046491 | Bacteria | 1413 |
| 262 | Ga0495584_0109382 | 3300046491 | Bacteria | 1398 |
| 263 | Ga0495584_0134020 | 3300046491 | Bacteria | 1257 |
| 264 | Ga0495584_0135170 | 3300046491 | Bacteria | 1251 |
| 265 | Ga0495584_0184802 | 3300046491 | Bacteria | 1059 |
| 266 | Ga0495584_0329400 | 3300046491 | Bacteria | 775 |
| 267 | Ga0495585_0000472 | 3300046492 | Bacteria | 38451 |
| 268 | Ga0495585_0000660 | 3300046492 | Bacteria | 31723 |
| 269 | Ga0495585_0003691 | 3300046492 | Bacteria | 10230 |
| 270 | Ga0495585_0003712 | 3300046492 | Bacteria | 10209 |
| 271 | Ga0495585_0004627 | 3300046492 | Bacteria | 8884 |
| 272 | Ga0495585_0006113 | 3300046492 | Bacteria | 7521 |
| 273 | Ga0495585_0009218 | 3300046492 | Bacteria | 5934 |
| 274 | Ga0495585_0010813 | 3300046492 | Bacteria | 5422 |
| 275 | Ga0495585_0014093 | 3300046492 | Bacteria | 4668 |
| 276 | Ga0495585_0026242 | 3300046492 | Bacteria | 3328 |
| 277 | Ga0495585_0033864 | 3300046492 | Bacteria | 2889 |
| 278 | Ga0495585_0045625 | 3300046492 | Bacteria | 2445 |
| 279 | Ga0495585_0077478 | 3300046492 | Bacteria | 1804 |
| 280 | Ga0495585_0082583 | 3300046492 | Bacteria | 1739 |
| 281 | Ga0495585_0090799 | 3300046492 | Bacteria | 1645 |
| 282 | Ga0495585_0094593 | 3300046492 | Bacteria | 1605 |
| 283 | Ga0495585_0165944 | 3300046492 | Bacteria | 1143 |
| 284 | Ga0495585_0209223 | 3300046492 | Bacteria | 989 |
| 285 | Ga0495585_0234651 | 3300046492 | Bacteria | 920 |
| 286 | Ga0495585_0238779 | 3300046492 | Bacteria | 910 |
| 287 | Ga0495585_0261680 | 3300046492 | Bacteria | 860 |
| 288 | Ga0495594_0003215 | 3300046499 | Bacteria | 8465 |
| 289 | Ga0495594_0041504 | 3300046499 | Bacteria | 2519 |
| 290 | Ga0495594_0103717 | 3300046499 | Bacteria | 1600 |
| 291 | Ga0495594_0115309 | 3300046499 | Bacteria | 1516 |
| 292 | Ga0495594_0384659 | 3300046499 | Bacteria | 798 |
| 293 | Ga0495594_0412116 | 3300046499 | Bacteria | 768 |
| 294 | Ga0495594_0687699 | 3300046499 | Bacteria | 578 |
| 295 | Ga0495596_0001058 | 3300046500 | Bacteria | 16362 |
| 296 | Ga0495596_0002388 | 3300046500 | Bacteria | 10153 |
| 297 | Ga0495596_0004797 | 3300046500 | Bacteria | 6501 |
| 298 | Ga0495596_0005314 | 3300046500 | Bacteria | 6102 |
| 299 | Ga0495596_0008879 | 3300046500 | Bacteria | 4448 |
| 300 | Ga0495596_0016727 | 3300046500 | Bacteria | 3043 |
| 301 | Ga0495596_0018984 | 3300046500 | Bacteria | 2829 |
| 302 | Ga0495596_0024433 | 3300046500 | Bacteria | 2445 |
| 303 | Ga0495596_0082923 | 3300046500 | Bacteria | 1244 |
| 304 | Ga0495596_0102864 | 3300046500 | Bacteria | 1109 |
| 305 | Ga0495596_0274697 | 3300046500 | Bacteria | 654 |
| 306 | Ga0495607_0002407 | 3300046501 | Bacteria | 15272 |
| 307 | Ga0495607_0008978 | 3300046501 | Bacteria | 6803 |
| 308 | Ga0495607_0010961 | 3300046501 | Bacteria | 6062 |
| 309 | Ga0495607_0016145 | 3300046501 | Bacteria | 4822 |
| 310 | Ga0495607_0023527 | 3300046501 | Bacteria | 3856 |
| 311 | Ga0495607_0029160 | 3300046501 | Bacteria | 3398 |
| 312 | Ga0495607_0033927 | 3300046501 | Bacteria | 3101 |
| 313 | Ga0495607_0057824 | 3300046501 | Bacteria | 2220 |
| 314 | Ga0495607_0075634 | 3300046501 | Bacteria | 1865 |
| 315 | Ga0495607_0126260 | 3300046501 | Bacteria | 1337 |
| 316 | Ga0495607_0181337 | 3300046501 | Bacteria | 1055 |
| 317 | Ga0495607_0262639 | 3300046501 | Bacteria | 826 |
| 318 | Ga0495607_0299453 | 3300046501 | Bacteria | 757 |
| 319 | Ga0495607_0443751 | 3300046501 | Bacteria | 583 |
| 320 | Ga0495583_0000592 | 3300046506 | Bacteria | 49635 |
| 321 | Ga0495583_0001039 | 3300046506 | Bacteria | 31364 |
| 322 | Ga0495583_0002694 | 3300046506 | Bacteria | 14762 |
| 323 | Ga0495583_0003626 | 3300046506 | Bacteria | 11553 |
| 324 | Ga0495583_0009561 | 3300046506 | Bacteria | 5777 |
| 325 | Ga0495583_0010563 | 3300046506 | Bacteria | 5370 |
| 326 | Ga0495583_0027555 | 3300046506 | Bacteria | 2803 |
| 327 | Ga0495583_0031266 | 3300046506 | Bacteria | 2582 |
| 328 | Ga0495583_0032373 | 3300046506 | Bacteria | 2524 |
| 329 | Ga0495583_0045967 | 3300046506 | Bacteria | 2015 |
| 330 | Ga0495583_0324516 | 3300046506 | Bacteria | 609 |
| 331 | Ga0495606_0014378 | 3300046507 | Bacteria | 6183 |
| 332 | Ga0495606_0017806 | 3300046507 | Bacteria | 5352 |
| 333 | Ga0495606_0037466 | 3300046507 | Bacteria | 3293 |
| 334 | Ga0495606_0059057 | 3300046507 | Bacteria | 2462 |
| 335 | Ga0495606_0064213 | 3300046507 | Bacteria | 2337 |
| 336 | Ga0495606_0107186 | 3300046507 | Bacteria | 1690 |
| 337 | Ga0495606_0109619 | 3300046507 | Bacteria | 1667 |
| 338 | Ga0495606_0137455 | 3300046507 | Bacteria | 1446 |
| 339 | Ga0495606_0178678 | 3300046507 | Bacteria | 1225 |
| 340 | Ga0495606_0210834 | 3300046507 | Bacteria | 1100 |
| 341 | Ga0495606_0261673 | 3300046507 | Bacteria | 955 |
| 342 | Ga0495606_0365372 | 3300046507 | Bacteria | 761 |
| 343 | Ga0495606_0406781 | 3300046507 | Bacteria | 707 |
| 344 | Ga0495606_0528996 | 3300046507 | Bacteria | 590 |
| 345 | Ga0495610_0049834 | 3300046512 | Bacteria | 2047 |
| 346 | Ga0495616_0001261 | 3300046513 | Bacteria | 17787 |
| 347 | Ga0495616_0001787 | 3300046513 | Bacteria | 14615 |
| 348 | Ga0495616_0006906 | 3300046513 | Bacteria | 6835 |
| 349 | Ga0495616_0008663 | 3300046513 | Bacteria | 6003 |
| 350 | Ga0495616_0009936 | 3300046513 | Bacteria | 5530 |
| 351 | Ga0495616_0010968 | 3300046513 | Bacteria | 5216 |
| 352 | Ga0495616_0014758 | 3300046513 | Bacteria | 4361 |
| 353 | Ga0495616_0023667 | 3300046513 | Bacteria | 3302 |
| 354 | Ga0495616_0040061 | 3300046513 | Bacteria | 2396 |
| 355 | Ga0495616_0046907 | 3300046513 | Bacteria | 2178 |
| 356 | Ga0495616_0052509 | 3300046513 | Bacteria | 2029 |
| 357 | Ga0495616_0112117 | 3300046513 | Bacteria | 1266 |
| 358 | Ga0495616_0140889 | 3300046513 | Bacteria | 1097 |
| 359 | Ga0495620_0036340 | 3300046515 | Bacteria | 2205 |
| 360 | Ga0495631_0000973 | 3300046518 | Bacteria | 17775 |
| 361 | Ga0495631_0001348 | 3300046518 | Bacteria | 15022 |
| 362 | Ga0495631_0007570 | 3300046518 | Bacteria | 5521 |
| 363 | Ga0495631_0008959 | 3300046518 | Bacteria | 5018 |
| 364 | Ga0495631_0012110 | 3300046518 | Bacteria | 4224 |
| 365 | Ga0495631_0013606 | 3300046518 | Bacteria | 3945 |
| 366 | Ga0495631_0021691 | 3300046518 | Bacteria | 2990 |
| 367 | Ga0495631_0039749 | 3300046518 | Bacteria | 2085 |
| 368 | Ga0495631_0056784 | 3300046518 | Bacteria | 1704 |
| 369 | Ga0495631_0081416 | 3300046518 | Bacteria | 1397 |
| 370 | Ga0495631_0085794 | 3300046518 | Bacteria | 1356 |
| 371 | Ga0495631_0092383 | 3300046518 | Bacteria | 1302 |
| 372 | Ga0495631_0099747 | 3300046518 | Bacteria | 1250 |
| 373 | Ga0495631_0141071 | 3300046518 | Bacteria | 1034 |
| 374 | Ga0495631_0221160 | 3300046518 | Bacteria | 808 |
| 375 | Ga0495632_0002249 | 3300046519 | Bacteria | 14865 |
| 376 | Ga0495632_0002671 | 3300046519 | Bacteria | 13366 |
| 377 | Ga0495632_0003465 | 3300046519 | Bacteria | 11167 |
| 378 | Ga0495632_0011663 | 3300046519 | Bacteria | 5117 |
| 379 | Ga0495632_0017531 | 3300046519 | Bacteria | 3949 |
| 380 | Ga0495632_0053309 | 3300046519 | Bacteria | 1986 |
| 381 | Ga0495632_0179830 | 3300046519 | Bacteria | 969 |
| 382 | Ga0495637_0000221 | 3300046520 | Bacteria | 43880 |
| 383 | Ga0495637_0037801 | 3300046520 | Bacteria | 2093 |
| 384 | Ga0495637_0054849 | 3300046520 | Bacteria | 1654 |
| 385 | Ga0495637_0087913 | 3300046520 | Bacteria | 1230 |
| 386 | Ga0495643_0000109 | 3300046522 | Bacteria | 135859 |
| 387 | Ga0495643_0003754 | 3300046522 | Bacteria | 10991 |
| 388 | Ga0495643_0028501 | 3300046522 | Bacteria | 3129 |
| 389 | Ga0495643_0040795 | 3300046522 | Bacteria | 2533 |
| 390 | Ga0495643_0050351 | 3300046522 | Bacteria | 2243 |
| 391 | Ga0495643_0062070 | 3300046522 | Bacteria | 1979 |
| 392 | Ga0495643_0079702 | 3300046522 | Bacteria | 1706 |
| 393 | Ga0495643_0108059 | 3300046522 | Bacteria | 1417 |
| 394 | Ga0495643_0112399 | 3300046522 | Bacteria | 1383 |
| 395 | Ga0495643_0120973 | 3300046522 | Bacteria | 1323 |
| 396 | Ga0495643_0254012 | 3300046522 | Bacteria | 819 |
| 397 | Ga0495643_0419112 | 3300046522 | Bacteria | 587 |
| 398 | Ga0495644_0005187 | 3300046523 | Bacteria | 5097 |
| 399 | Ga0495644_0006677 | 3300046523 | Bacteria | 4470 |
| 400 | Ga0495644_0020277 | 3300046523 | Bacteria | 2536 |
| 401 | Ga0495644_0027776 | 3300046523 | Bacteria | 2143 |
| 402 | Ga0495644_0064768 | 3300046523 | Bacteria | 1373 |
| 403 | Ga0495644_0094945 | 3300046523 | Bacteria | 1126 |
| 404 | Ga0495644_0105006 | 3300046523 | Bacteria | 1070 |
| 405 | Ga0495644_0255928 | 3300046523 | Bacteria | 680 |
| 406 | Ga0495648_0000048 | 3300046524 | Bacteria | 164840 |
| 407 | Ga0495648_0005150 | 3300046524 | Bacteria | 10939 |
| 408 | Ga0495648_0005316 | 3300046524 | Bacteria | 10737 |
| 409 | Ga0495648_0018179 | 3300046524 | Bacteria | 4992 |
| 410 | Ga0495648_0035023 | 3300046524 | Bacteria | 3259 |
| 411 | Ga0495648_0047307 | 3300046524 | Bacteria | 2659 |
| 412 | Ga0495648_0171463 | 3300046524 | Bacteria | 1111 |
| 413 | Ga0495648_0203903 | 3300046524 | Bacteria | 988 |
| 414 | Ga0495648_0325204 | 3300046524 | Bacteria | 711 |
| 415 | Ga0495663_0007203 | 3300046525 | Bacteria | 3069 |
| 416 | Ga0495663_0053023 | 3300046525 | Bacteria | 1260 |
| 417 | Ga0495666_0041056 | 3300046526 | Bacteria | 2241 |
| 418 | Ga0495666_0046910 | 3300046526 | Bacteria | 2081 |
| 419 | Ga0495666_0064078 | 3300046526 | Bacteria | 1754 |
| 420 | Ga0495666_0106649 | 3300046526 | Bacteria | 1318 |
| 421 | Ga0495642_0000679 | 3300046528 | Bacteria | 16868 |
| 422 | Ga0495642_0001256 | 3300046528 | Bacteria | 11580 |
| 423 | Ga0495642_0007596 | 3300046528 | Bacteria | 4154 |
| 424 | Ga0495642_0008409 | 3300046528 | Bacteria | 3949 |
| 425 | Ga0495642_0008507 | 3300046528 | Bacteria | 3926 |
| 426 | Ga0495642_0034152 | 3300046528 | Bacteria | 2047 |
| 427 | Ga0495642_0037039 | 3300046528 | Bacteria | 1972 |
| 428 | Ga0495642_0049422 | 3300046528 | Bacteria | 1727 |
| 429 | Ga0495642_0077008 | 3300046528 | Bacteria | 1400 |
| 430 | Ga0495642_0137440 | 3300046528 | Bacteria | 1054 |
| 431 | Ga0495652_0088191 | 3300046529 | Bacteria | 2543 |
| 432 | Ga0495652_0224485 | 3300046529 | Bacteria | 1409 |
| 433 | Ga0495654_0064635 | 3300046530 | Bacteria | 1748 |
| 434 | Ga0495654_0086148 | 3300046530 | Bacteria | 1464 |
| 435 | Ga0495654_0165585 | 3300046530 | Bacteria | 967 |
| 436 | Ga0495654_0173022 | 3300046530 | Bacteria | 940 |
| 437 | Ga0495654_0319114 | 3300046530 | Bacteria | 630 |
| 438 | Ga0495665_0002869 | 3300046531 | Bacteria | 9317 |
| 439 | Ga0495665_0038671 | 3300046531 | Bacteria | 2543 |
| 440 | Ga0495665_0070472 | 3300046531 | Bacteria | 1842 |
| 441 | Ga0495640_0176391 | 3300046533 | Bacteria | 1364 |
| 442 | Ga0495586_0011177 | 3300046535 | Bacteria | 4770 |
| 443 | Ga0495586_0027446 | 3300046535 | Bacteria | 3046 |
| 444 | Ga0495586_0262189 | 3300046535 | Bacteria | 987 |
| 445 | Ga0495586_0390797 | 3300046535 | Bacteria | 800 |
| 446 | Ga0495587_0021803 | 3300046536 | Bacteria | 3952 |
| 447 | Ga0495587_0024059 | 3300046536 | Bacteria | 3737 |
| 448 | Ga0495587_0108650 | 3300046536 | Bacteria | 1594 |
| 449 | Ga0495587_0140212 | 3300046536 | Bacteria | 1380 |
| 450 | Ga0495609_0000007 | 3300046538 | Bacteria | 398812 |
| 451 | Ga0495609_0002784 | 3300046538 | Bacteria | 10519 |
| 452 | Ga0495609_0004623 | 3300046538 | Bacteria | 7479 |
| 453 | Ga0495609_0006393 | 3300046538 | Bacteria | 6013 |
| 454 | Ga0495609_0029788 | 3300046538 | Bacteria | 2484 |
| 455 | Ga0495609_0051103 | 3300046538 | Bacteria | 1841 |
| 456 | Ga0495609_0076777 | 3300046538 | Bacteria | 1463 |
| 457 | Ga0495609_0092056 | 3300046538 | Bacteria | 1318 |
| 458 | Ga0495621_0413864 | 3300046539 | Bacteria | 573 |
| 459 | Ga0495597_0000084 | 3300046542 | Bacteria | 83344 |
| 460 | Ga0495597_0003580 | 3300046542 | Bacteria | 8963 |
| 461 | Ga0495597_0007302 | 3300046542 | Bacteria | 5629 |
| 462 | Ga0495597_0009326 | 3300046542 | Bacteria | 4857 |
| 463 | Ga0495597_0011019 | 3300046542 | Bacteria | 4394 |
| 464 | Ga0495597_0014499 | 3300046542 | Bacteria | 3751 |
| 465 | Ga0495597_0051691 | 3300046542 | Bacteria | 1811 |
| 466 | Ga0495597_0287616 | 3300046542 | Bacteria | 639 |
| 467 | Ga0495645_0108234 | 3300046543 | Bacteria | 1969 |
| 468 | Ga0495645_0222533 | 3300046543 | Bacteria | 1269 |
| 469 | Ga0495622_0020014 | 3300046557 | Bacteria | 3115 |
| 470 | Ga0495622_0046142 | 3300046557 | Bacteria | 2024 |
| 471 | Ga0495622_0050689 | 3300046557 | Bacteria | 1925 |
| 472 | Ga0495622_0105811 | 3300046557 | Bacteria | 1289 |
| 473 | Ga0495633_0000990 | 3300046558 | Bacteria | 23327 |
| 474 | Ga0495633_0008654 | 3300046558 | Bacteria | 5714 |
| 475 | Ga0495633_0009872 | 3300046558 | Bacteria | 5244 |
| 476 | Ga0495633_0011214 | 3300046558 | Bacteria | 4847 |
| 477 | Ga0495633_0012265 | 3300046558 | Bacteria | 4569 |
| 478 | Ga0495633_0027111 | 3300046558 | Bacteria | 2803 |
| 479 | Ga0495633_0032480 | 3300046558 | Bacteria | 2521 |
| 480 | Ga0495633_0041368 | 3300046558 | Bacteria | 2191 |
| 481 | Ga0495633_0041393 | 3300046558 | Bacteria | 2191 |
| 482 | Ga0495633_0065158 | 3300046558 | Bacteria | 1703 |
| 483 | Ga0495633_0097592 | 3300046558 | Bacteria | 1364 |
| 484 | Ga0495633_0109157 | 3300046558 | Bacteria | 1283 |
| 485 | Ga0495633_0149405 | 3300046558 | Bacteria | 1079 |
| 486 | Ga0495633_0298169 | 3300046558 | Bacteria | 732 |
| 487 | Ga0495656_0008329 | 3300046615 | Bacteria | 3698 |
| 488 | Ga0495656_0013934 | 3300046615 | Bacteria | 3003 |
| 489 | Ga0495656_0038243 | 3300046615 | Bacteria | 1986 |
| 490 | Ga0495656_0214057 | 3300046615 | Bacteria | 961 |
| 491 | Ga0495656_0411791 | 3300046615 | Bacteria | 708 |
| 492 | Ga0495668_0000035 | 3300046616 | Bacteria | 240241 |
| 493 | Ga0495668_0002368 | 3300046616 | Bacteria | 15679 |
| 494 | Ga0495668_0002371 | 3300046616 | Bacteria | 15670 |
| 495 | Ga0495668_0010855 | 3300046616 | Bacteria | 5485 |
| 496 | Ga0495668_0011351 | 3300046616 | Bacteria | 5340 |
| 497 | Ga0495668_0017050 | 3300046616 | Bacteria | 4217 |
| 498 | Ga0495668_0101085 | 3300046616 | Bacteria | 1577 |
| 499 | Ga0495668_0131361 | 3300046616 | Bacteria | 1370 |
| 500 | Ga0495668_0132446 | 3300046616 | Bacteria | 1364 |
| 501 | Ga0495668_0143985 | 3300046616 | Bacteria | 1304 |
| 502 | Ga0495668_0201889 | 3300046616 | Bacteria | 1088 |
| 503 | Ga0495668_0216194 | 3300046616 | Bacteria | 1049 |
| 504 | Ga0495668_0355246 | 3300046616 | Bacteria | 804 |
| 505 | Ga0495668_0551024 | 3300046616 | Bacteria | 636 |
| 506 | Ga0495634_0058359 | 3300046642 | Bacteria | 2572 |
| 507 | Ga0495634_0431404 | 3300046642 | Bacteria | 779 |
| 508 | Ga0495611_0000071 | 3300046648 | Bacteria | 70920 |
| 509 | Ga0495611_0001459 | 3300046648 | Bacteria | 11767 |
| 510 | Ga0495611_0009239 | 3300046648 | Bacteria | 4162 |
| 511 | Ga0495611_0016689 | 3300046648 | Bacteria | 3138 |
| 512 | Ga0495611_0020841 | 3300046648 | Bacteria | 2826 |
| 513 | Ga0495611_0027815 | 3300046648 | Bacteria | 2474 |
| 514 | Ga0495611_0036874 | 3300046648 | Bacteria | 2171 |
| 515 | Ga0495611_0059613 | 3300046648 | Bacteria | 1733 |
| 516 | Ga0495611_0115899 | 3300046648 | Bacteria | 1248 |
| 517 | Ga0495611_0129253 | 3300046648 | Bacteria | 1178 |
| 518 | Ga0495611_0221770 | 3300046648 | Bacteria | 879 |
| 519 | Ga0495611_0358678 | 3300046648 | Bacteria | 668 |
| 520 | Ga0495625_0009426 | 3300046660 | Bacteria | 8169 |
| 521 | Ga0495625_0015366 | 3300046660 | Bacteria | 6066 |
| 522 | Ga0495625_0059330 | 3300046660 | Bacteria | 2715 |
| 523 | Ga0495625_0148131 | 3300046660 | Bacteria | 1579 |
| 524 | Ga0495625_0149311 | 3300046660 | Bacteria | 1572 |
| 525 | Ga0495625_0211122 | 3300046660 | Bacteria | 1276 |
| 526 | Ga0495625_0255708 | 3300046660 | Bacteria | 1135 |
| 527 | Ga0495625_0370888 | 3300046660 | Bacteria | 900 |
| 528 | Ga0495625_0642361 | 3300046660 | Bacteria | 633 |
| 529 | Ga0495635_0014979 | 3300046663 | Bacteria | 5423 |
| 530 | Ga0495659_0087618 | 3300046664 | Bacteria | 1191 |
| 531 | Ga0495659_0177561 | 3300046664 | Bacteria | 866 |
| 532 | Ga0495661_0002080 | 3300046665 | Bacteria | 15698 |
| 533 | Ga0495661_0002763 | 3300046665 | Bacteria | 13317 |
| 534 | Ga0495661_0003309 | 3300046665 | Bacteria | 11945 |
| 535 | Ga0495661_0005821 | 3300046665 | Bacteria | 8718 |
| 536 | Ga0495661_0008948 | 3300046665 | Bacteria | 6889 |
| 537 | Ga0495661_0028493 | 3300046665 | Bacteria | 3574 |
| 538 | Ga0495661_0040890 | 3300046665 | Bacteria | 2872 |
| 539 | Ga0495661_0055194 | 3300046665 | Bacteria | 2381 |
| 540 | Ga0495661_0077005 | 3300046665 | Bacteria | 1933 |
| 541 | Ga0495661_0080859 | 3300046665 | Bacteria | 1874 |
| 542 | Ga0495661_0092135 | 3300046665 | Bacteria | 1722 |
| 543 | Ga0495661_0100863 | 3300046665 | Bacteria | 1624 |
| 544 | Ga0495661_0105559 | 3300046665 | Bacteria | 1577 |
| 545 | Ga0495661_0114155 | 3300046665 | Bacteria | 1501 |
| 546 | Ga0495661_0307996 | 3300046665 | Bacteria | 790 |
| 547 | Ga0495661_0348845 | 3300046665 | Bacteria | 729 |
| 548 | Ga0495661_0573494 | 3300046665 | Bacteria | 532 |
| 549 | Ga0495588_0000147 | 3300046674 | Bacteria | 100948 |
| 550 | Ga0495588_0002825 | 3300046674 | Bacteria | 7465 |
| 551 | Ga0495588_0012740 | 3300046674 | Bacteria | 3984 |
| 552 | Ga0495588_0073813 | 3300046674 | Bacteria | 1776 |
| 553 | Ga0495588_0079126 | 3300046674 | Bacteria | 1715 |
| 554 | Ga0495588_0117985 | 3300046674 | Bacteria | 1398 |
| 555 | Ga0495588_0126901 | 3300046674 | Bacteria | 1345 |
| 556 | Ga0495588_0144574 | 3300046674 | Bacteria | 1256 |
| 557 | Ga0495588_0327552 | 3300046674 | Bacteria | 805 |
| 558 | Ga0495588_0334443 | 3300046674 | Bacteria | 796 |
| 559 | Ga0495588_0373834 | 3300046674 | Bacteria | 748 |
| 560 | Ga0495588_0693581 | 3300046674 | Bacteria | 532 |
| 561 | Ga0495623_0039441 | 3300046679 | Bacteria | 3018 |
| 562 | Ga0495623_0053850 | 3300046679 | Bacteria | 2540 |
| 563 | Ga0495623_0062275 | 3300046679 | Bacteria | 2338 |
| 564 | Ga0495623_0113963 | 3300046679 | Bacteria | 1635 |
| 565 | Ga0495623_0161142 | 3300046679 | Bacteria | 1318 |
| 566 | Ga0495669_0000124 | 3300046684 | Bacteria | 49700 |
| 567 | Ga0495669_0008315 | 3300046684 | Bacteria | 4359 |
| 568 | Ga0495669_0019990 | 3300046684 | Bacteria | 2893 |
| 569 | Ga0495669_0044090 | 3300046684 | Bacteria | 1986 |
| 570 | Ga0495669_0052970 | 3300046684 | Bacteria | 1824 |
| 571 | Ga0495669_0115914 | 3300046684 | Bacteria | 1253 |
| 572 | Ga0495613_0068984 | 3300046689 | Bacteria | 2578 |
| 573 | Ga0495613_0284174 | 3300046689 | Bacteria | 1148 |
| 574 | Ga0495624_0006451 | 3300046690 | Bacteria | 8325 |
| 575 | Ga0495670_0001924 | 3300046691 | Bacteria | 10226 |
| 576 | Ga0495670_0009455 | 3300046691 | Bacteria | 4791 |
| 577 | Ga0495670_0010712 | 3300046691 | Bacteria | 4506 |
| 578 | Ga0495670_0014233 | 3300046691 | Bacteria | 3914 |
| 579 | Ga0495670_0031890 | 3300046691 | Bacteria | 2620 |
| 580 | Ga0495670_0032597 | 3300046691 | Bacteria | 2591 |
| 581 | Ga0495670_0037510 | 3300046691 | Bacteria | 2415 |
| 582 | Ga0495670_0044416 | 3300046691 | Bacteria | 2218 |
| 583 | Ga0495670_0108414 | 3300046691 | Bacteria | 1435 |
| 584 | Ga0495670_0150015 | 3300046691 | Bacteria | 1222 |
| 585 | Ga0495670_0248342 | 3300046691 | Bacteria | 948 |
| 586 | Ga0495670_0325957 | 3300046691 | Bacteria | 825 |
| 587 | Ga0495671_0011043 | 3300046692 | Bacteria | 4986 |
| 588 | Ga0495671_0086425 | 3300046692 | Bacteria | 1536 |
| 589 | Ga0495671_0166479 | 3300046692 | Bacteria | 1072 |
| 590 | Ga0495671_0209369 | 3300046692 | Bacteria | 945 |
| 591 | Ga0495671_0455240 | 3300046692 | Bacteria | 611 |
| 592 | Ga0495649_0037708 | 3300046694 | Bacteria | 2652 |
| 593 | Ga0495649_0038241 | 3300046694 | Bacteria | 2633 |
| 594 | Ga0495649_0042215 | 3300046694 | Bacteria | 2492 |
| 595 | Ga0495649_0049882 | 3300046694 | Bacteria | 2273 |
| 596 | Ga0495649_0072036 | 3300046694 | Bacteria | 1852 |
| 597 | Ga0495649_0090590 | 3300046694 | Bacteria | 1630 |
| 598 | Ga0495649_0123764 | 3300046694 | Bacteria | 1366 |
| 599 | Ga0495649_0239565 | 3300046694 | Bacteria | 934 |
| 600 | Ga0495589_0000020 | 3300046794 | Bacteria | 199645 |
| 601 | Ga0495589_0002448 | 3300046794 | Bacteria | 10424 |
| 602 | Ga0495589_0015745 | 3300046794 | Bacteria | 3887 |
| 603 | Ga0495589_0019390 | 3300046794 | Bacteria | 3487 |
| 604 | Ga0495589_0026426 | 3300046794 | Bacteria | 2941 |
| 605 | Ga0495589_0042729 | 3300046794 | Bacteria | 2258 |
| 606 | Ga0495589_0043185 | 3300046794 | Bacteria | 2244 |
| 607 | Ga0495589_0046451 | 3300046794 | Bacteria | 2155 |
| 608 | Ga0495589_0058558 | 3300046794 | Bacteria | 1894 |
| 609 | Ga0495589_0104288 | 3300046794 | Bacteria | 1370 |
| 610 | Ga0495589_0105248 | 3300046794 | Bacteria | 1363 |
| 611 | Ga0495589_0167753 | 3300046794 | Bacteria | 1044 |
| 612 | Ga0495589_0182137 | 3300046794 | Bacteria | 996 |
| 613 | Ga0495589_0211831 | 3300046794 | Bacteria | 912 |
| 614 | Ga0495600_0094322 | 3300046809 | Bacteria | 1951 |
| 615 | Ga0495600_0380652 | 3300046809 | Bacteria | 880 |
| 616 | Ga0495600_0489215 | 3300046809 | Bacteria | 757 |
| 617 | Ga0495660_0000299 | 3300046810 | Bacteria | 45148 |
| 618 | Ga0495660_0002546 | 3300046810 | Bacteria | 11627 |
| 619 | Ga0495660_0019578 | 3300046810 | Bacteria | 3885 |
| 620 | Ga0495660_0033218 | 3300046810 | Bacteria | 2894 |
| 621 | Ga0495660_0048771 | 3300046810 | Bacteria | 2314 |
| 622 | Ga0495660_0126112 | 3300046810 | Bacteria | 1289 |
| 623 | Ga0495660_0286454 | 3300046810 | Bacteria | 751 |
| 624 | Ga0495581_0006811 | 3300047315 | Bacteria | 6626 |
| 625 | Ga0495581_0010035 | 3300047315 | Bacteria | 5477 |
| 626 | Ga0495581_0104105 | 3300047315 | Bacteria | 1649 |
| 627 | Ga0495604_0005099 | 3300047317 | Bacteria | 10401 |
| 628 | Ga0495604_0028956 | 3300047317 | Bacteria | 4406 |
| 629 | Ga0495636_0013036 | 3300047318 | Bacteria | 3295 |
| 630 | Ga0495636_0017460 | 3300047318 | Bacteria | 2873 |
| 631 | Ga0495636_0028521 | 3300047318 | Bacteria | 2277 |
| 632 | Ga0495636_0059191 | 3300047318 | Bacteria | 1616 |
| 633 | Ga0495674_0001181 | 3300047319 | Bacteria | 25219 |
| 634 | Ga0495672_0000148 | 3300047320 | Bacteria | 101427 |
| 635 | Ga0495672_0002800 | 3300047320 | Bacteria | 15555 |
| 636 | Ga0495672_0003594 | 3300047320 | Bacteria | 13170 |
| 637 | Ga0495672_0005495 | 3300047320 | Bacteria | 10046 |
| 638 | Ga0495672_0031171 | 3300047320 | Bacteria | 3331 |
| 639 | Ga0495672_0045069 | 3300047320 | Bacteria | 2642 |
| 640 | Ga0495672_0138481 | 3300047320 | Bacteria | 1273 |
| 641 | Ga0495676_0000015 | 3300047321 | Bacteria | 199492 |
| 642 | Ga0495676_0019070 | 3300047321 | Bacteria | 6039 |
| 643 | Ga0495676_0099412 | 3300047321 | Bacteria | 2156 |
| 644 | Ga0495676_0136813 | 3300047321 | Bacteria | 1760 |
| 645 | Ga0495676_0219706 | 3300047321 | Bacteria | 1310 |
| 646 | Ga0495676_0235696 | 3300047321 | Bacteria | 1255 |
| 647 | Ga0495676_0346511 | 3300047321 | Bacteria | 994 |
| 648 | Ga0495680_0021860 | 3300047322 | Bacteria | 5345 |
| 649 | Ga0495680_0041791 | 3300047322 | Bacteria | 3642 |
| 650 | Ga0495680_0060522 | 3300047322 | Bacteria | 2918 |
| 651 | Ga0495680_0374131 | 3300047322 | Bacteria | 988 |
| 652 | Ga0495683_0000350 | 3300047323 | Bacteria | 38149 |
| 653 | Ga0495683_0001211 | 3300047323 | Bacteria | 17582 |
| 654 | Ga0495683_0015182 | 3300047323 | Bacteria | 4010 |
| 655 | Ga0495683_0036763 | 3300047323 | Bacteria | 2485 |
| 656 | Ga0495683_0044386 | 3300047323 | Bacteria | 2235 |
| 657 | Ga0495683_0081854 | 3300047323 | Bacteria | 1574 |
| 658 | Ga0495683_0083294 | 3300047323 | Bacteria | 1557 |
| 659 | Ga0495683_0128819 | 3300047323 | Bacteria | 1195 |
| 660 | Ga0495683_0135527 | 3300047323 | Bacteria | 1157 |
| 661 | Ga0495683_0199830 | 3300047323 | Bacteria | 902 |
| 662 | Ga0495683_0202155 | 3300047323 | Bacteria | 895 |
| 663 | Ga0495683_0229717 | 3300047323 | Bacteria | 823 |
| 664 | Ga0495687_000030 | 3300047443 | Bacteria | 279992 |
| 665 | Ga0495687_000120 | 3300047443 | Bacteria | 120987 |
| 666 | Ga0495687_000390 | 3300047443 | Bacteria | 54357 |
| 667 | Ga0495687_002124 | 3300047443 | Bacteria | 16587 |
| 668 | Ga0495687_002301 | 3300047443 | Bacteria | 15611 |
| 669 | Ga0495687_002872 | 3300047443 | Bacteria | 13188 |
| 670 | Ga0495687_005528 | 3300047443 | Bacteria | 8018 |
| 671 | Ga0495687_037927 | 3300047443 | Bacteria | 2143 |
| 672 | Ga0495675_0015118 | 3300047444 | Bacteria | 4879 |
| 673 | Ga0495675_0069009 | 3300047444 | Bacteria | 2232 |
| 674 | Ga0495677_0000045 | 3300047445 | Bacteria | 73995 |
| 675 | Ga0495677_0000503 | 3300047445 | Bacteria | 16548 |
| 676 | Ga0495677_0000510 | 3300047445 | Bacteria | 16420 |
| 677 | Ga0495677_0002868 | 3300047445 | Bacteria | 6717 |
| 678 | Ga0495677_0008677 | 3300047445 | Bacteria | 3771 |
| 679 | Ga0495677_0051356 | 3300047445 | Bacteria | 1518 |
| 680 | Ga0495677_0052780 | 3300047445 | Bacteria | 1498 |
| 681 | Ga0495677_0067163 | 3300047445 | Bacteria | 1334 |
| 682 | Ga0495677_0114897 | 3300047445 | Bacteria | 1024 |
| 683 | Ga0495677_0125489 | 3300047445 | Bacteria | 980 |
| 684 | Ga0495677_0202879 | 3300047445 | Bacteria | 771 |
| 685 | Ga0495677_0224336 | 3300047445 | Bacteria | 732 |
| 686 | Ga0495679_026498 | 3300047446 | Bacteria | 1924 |
| 687 | Ga0495679_045695 | 3300047446 | Bacteria | 1336 |
| 688 | Ga0495679_052210 | 3300047446 | Bacteria | 1223 |
| 689 | Ga0495679_068710 | 3300047446 | Bacteria | 1024 |
| 690 | Ga0495685_002056 | 3300047447 | Bacteria | 6256 |
| 691 | Ga0495685_003936 | 3300047447 | Bacteria | 4769 |
| 692 | Ga0495685_010250 | 3300047447 | Bacteria | 3141 |
| 693 | Ga0495685_025260 | 3300047447 | Bacteria | 2044 |
| 694 | Ga0495685_070806 | 3300047447 | Bacteria | 1168 |
| 695 | Ga0495685_090816 | 3300047447 | Bacteria | 1013 |
| 696 | Ga0495685_197079 | 3300047447 | Bacteria | 646 |
| 697 | Ga0495681_0006141 | 3300047470 | Bacteria | 7932 |
| 698 | Ga0495681_0013415 | 3300047470 | Bacteria | 4752 |
| 699 | Ga0495681_0044868 | 3300047470 | Bacteria | 2120 |
| 700 | Ga0495681_0049088 | 3300047470 | Bacteria | 1997 |
| 701 | Ga0495681_0057502 | 3300047470 | Bacteria | 1806 |
| 702 | Ga0495681_0073367 | 3300047470 | Bacteria | 1545 |
| 703 | Ga0495681_0077115 | 3300047470 | Bacteria | 1496 |
| 704 | Ga0495681_0134429 | 3300047470 | Bacteria | 1050 |
| 705 | Ga0495681_0189551 | 3300047470 | Bacteria | 840 |
| 706 | Ga0495681_0305692 | 3300047470 | Bacteria | 614 |
| 707 | Ga0495684_0736479 | 3300047471 | Bacteria | 650 |
| 708 | Ga0495686_0002455 | 3300047472 | Bacteria | 17478 |
| 709 | Ga0495686_0009603 | 3300047472 | Bacteria | 6949 |
| 710 | Ga0495686_0010484 | 3300047472 | Bacteria | 6587 |
| 711 | Ga0495686_0022502 | 3300047472 | Bacteria | 4171 |
| 712 | Ga0495686_0077301 | 3300047472 | Bacteria | 2038 |
| 713 | Ga0495686_0180047 | 3300047472 | Bacteria | 1225 |
| 714 | Ga0495686_0200699 | 3300047472 | Bacteria | 1145 |
| 715 | Ga0495686_0380309 | 3300047472 | Bacteria | 762 |
| 716 | Ga0495593_0006146 | 3300047673 | Bacteria | 7063 |
| 717 | Ga0495593_0008376 | 3300047673 | Bacteria | 6015 |
| 718 | Ga0495593_0012881 | 3300047673 | Bacteria | 4777 |
| 719 | Ga0495593_0099617 | 3300047673 | Bacteria | 1491 |
| 720 | Ga0495602_0050543 | 3300048088 | Bacteria | 3713 |
| 721 | Ga0495602_0050633 | 3300048088 | Bacteria | 3709 |
| 722 | Ga0495602_0607535 | 3300048088 | Bacteria | 751 |
| 723 | Ga0495614_0006856 | 3300048089 | Bacteria | 5095 |
| 724 | Ga0495614_0012239 | 3300048089 | Bacteria | 3768 |
| 725 | Ga0495614_0116208 | 3300048089 | Bacteria | 1177 |
| 726 | Ga0495614_0230459 | 3300048089 | Bacteria | 844 |
| 727 | Ga0495615_0000541 | 3300048090 | Bacteria | 5397 |
| 728 | Ga0495626_0000022 | 3300048091 | Bacteria | 216166 |
| 729 | Ga0495626_0001540 | 3300048091 | Bacteria | 18097 |
| 730 | Ga0495626_0001950 | 3300048091 | Bacteria | 15324 |
| 731 | Ga0495626_0002030 | 3300048091 | Bacteria | 14860 |
| 732 | Ga0495626_0002265 | 3300048091 | Bacteria | 13714 |
| 733 | Ga0495626_0003732 | 3300048091 | Bacteria | 9622 |
| 734 | Ga0495626_0008789 | 3300048091 | Bacteria | 5497 |
| 735 | Ga0495626_0011126 | 3300048091 | Bacteria | 4770 |
| 736 | Ga0495626_0025930 | 3300048091 | Bacteria | 2861 |
| 737 | Ga0495626_0030628 | 3300048091 | Bacteria | 2594 |
| 738 | Ga0495626_0031076 | 3300048091 | Bacteria | 2572 |
| 739 | Ga0495626_0038883 | 3300048091 | Bacteria | 2253 |
| 740 | Ga0495626_0042774 | 3300048091 | Bacteria | 2127 |
| 741 | Ga0495626_0044954 | 3300048091 | Bacteria | 2063 |
| 742 | Ga0495626_0047504 | 3300048091 | Bacteria | 1995 |
| 743 | Ga0495626_0121152 | 3300048091 | Bacteria | 1124 |
| 744 | Ga0495626_0121452 | 3300048091 | Bacteria | 1122 |
| 745 | Ga0495626_0232185 | 3300048091 | Bacteria | 745 |
| 746 | Ga0496100_0119383 | 3300048903 | Bacteria | 1842 |
| 747 | Ga0496101_0063645 | 3300048904 | Bacteria | 2685 |
| 748 | Ga0496101_0194138 | 3300048904 | Bacteria | 1568 |
| 749 | Ga0496102_0081745 | 3300048905 | Bacteria | 2979 |
| 750 | Ga0496102_0177083 | 3300048905 | Bacteria | 2008 |
| 751 | Ga0496102_0365437 | 3300048905 | Bacteria | 1358 |
| 752 | Ga0496102_0375238 | 3300048905 | Bacteria | 1338 |
| 753 | Ga0496102_0663144 | 3300048905 | Bacteria | 966 |
| 754 | Ga0496102_1008470 | 3300048905 | Bacteria | 753 |
| 755 | Ga0496103_0002995 | 3300048906 | Bacteria | 10442 |
| 756 | Ga0496103_0125074 | 3300048906 | Bacteria | 1639 |
| 757 | Ga0496103_0139605 | 3300048906 | Bacteria | 1549 |
| 758 | Ga0496103_0174003 | 3300048906 | Bacteria | 1383 |
| 759 | Ga0496104_0277244 | 3300048907 | Bacteria | 1590 |
| 760 | Ga0496105_0457120 | 3300048908 | Bacteria | 1007 |
| 761 | Ga0496105_0554098 | 3300048908 | Bacteria | 897 |
| 762 | Ga0496105_1165195 | 3300048908 | Bacteria | 569 |
| 763 | Ga0496106_0100462 | 3300048909 | Bacteria | 2243 |
| 764 | Ga0496106_0150595 | 3300048909 | Bacteria | 1835 |
| 765 | Ga0496107_0160925 | 3300048910 | Bacteria | 1664 |
| 766 | Ga0496107_0173989 | 3300048910 | Bacteria | 1598 |
| 767 | Ga0496108_0199842 | 3300048911 | Bacteria | 1735 |
| 768 | Ga0496108_0335163 | 3300048911 | Bacteria | 1319 |
| 769 | Ga0496109_0096622 | 3300048912 | Bacteria | 2737 |
| 770 | Ga0496110_0009391 | 3300048913 | Bacteria | 7918 |
| 771 | Ga0496110_0147566 | 3300048913 | Bacteria | 2128 |
| 772 | Ga0496111_1128944 | 3300048914 | Bacteria | 558 |
| 773 | Ga0496112_0842022 | 3300048915 | Bacteria | 841 |
| 774 | Ga0496113_0005827 | 3300048916 | Bacteria | 7730 |
| 775 | Ga0496113_0021448 | 3300048916 | Bacteria | 4557 |
| 776 | Ga0496113_0384158 | 3300048916 | Bacteria | 1127 |
| 777 | Ga0496113_0594637 | 3300048916 | Bacteria | 886 |
| 778 | Ga0496114_0135817 | 3300048917 | Bacteria | 2127 |
| 779 | Ga0496115_0051104 | 3300048918 | Bacteria | 3314 |
| 780 | Ga0496115_0058320 | 3300048918 | Bacteria | 3106 |
| 781 | Ga0496115_0245138 | 3300048918 | Bacteria | 1476 |
| 782 | Ga0496122_0014679 | 3300048925 | Bacteria | 7553 |
| 783 | Ga0496122_0020345 | 3300048925 | Bacteria | 6001 |
| 784 | Ga0496123_0014582 | 3300048926 | Bacteria | 6503 |
| 785 | Ga0496123_0048321 | 3300048926 | Bacteria | 2863 |
| 786 | Ga0496124_0007340 | 3300048927 | Bacteria | 11744 |
| 787 | Ga0496124_0043025 | 3300048927 | Bacteria | 3884 |
| 788 | Ga0496124_0137541 | 3300048927 | Bacteria | 1932 |
| 789 | Ga0496124_0274241 | 3300048927 | Bacteria | 1233 |
| 790 | Ga0496124_0278469 | 3300048927 | Bacteria | 1221 |
| 791 | Ga0496124_0287722 | 3300048927 | Bacteria | 1194 |
| 792 | Ga0496125_0016500 | 3300048928 | Bacteria | 7088 |
| 793 | Ga0496125_0068076 | 3300048928 | Bacteria | 2802 |
| 794 | Ga0496125_0159933 | 3300048928 | Bacteria | 1532 |
| 795 | Ga0501308_002211 | 3300049128 | Bacteria | 1679 |
| 796 | Ga0501304_004320 | 3300049160 | Bacteria | 1076 |
| 797 | Ga0495678_001688 | 3300049459 | Bacteria | 16717 |
| 798 | Ga0495678_002890 | 3300049459 | Bacteria | 11063 |
| 799 | Ga0495678_008181 | 3300049459 | Bacteria | 5312 |
| 800 | Ga0495678_013753 | 3300049459 | Bacteria | 3787 |
| 801 | Ga0495678_037296 | 3300049459 | Bacteria | 1976 |
| 802 | Ga0495678_114301 | 3300049459 | Bacteria | 916 |
| 803 | Ga0495682_0001410 | 3300049460 | Bacteria | 13087 |
| 804 | Ga0495682_0011868 | 3300049460 | Bacteria | 3348 |
| 805 | Ga0495682_0015601 | 3300049460 | Bacteria | 2878 |
| 806 | Ga0495682_0023226 | 3300049460 | Bacteria | 2315 |
| 807 | Ga0495682_0032634 | 3300049460 | Bacteria | 1923 |
| 808 | Ga0495682_0059011 | 3300049460 | Bacteria | 1387 |
| 809 | Ga0495682_0248494 | 3300049460 | Bacteria | 629 |
| 810 | Ga0501036_1344126 | 3300049572 | Bacteria | 580 |
| 811 | Ga0501047_0147017 | 3300049581 | Bacteria | 2233 |
| 812 | Ga0501222_024812 | 3300049662 | Bacteria | 811 |
| 813 | Ga0501035_0053908 | 3300049822 | Bacteria | 3594 |
| 814 | Ga0501044_0339913 | 3300049823 | Bacteria | 1422 |
| 815 | nmdc:mga03683_3948_c1 | 3300050489 | Bacteria | 4856 |
| 816 | nmdc:mga03n38_163000_c1 | 3300050490 | Bacteria | 1130 |
| 817 | nmdc:mga00v17_20995_c1 | 3300050491 | Bacteria | 3749 |
| 818 | nmdc:mga0k408_87298_c1 | 3300050493 | Bacteria | 1832 |
| 819 | nmdc:mga06z11_19491_c1 | 3300050494 | Bacteria | 3120 |
| 820 | nmdc:mga06z11_201713_c1 | 3300050494 | Bacteria | 1156 |
| 821 | nmdc:mga07m45_206547_c1 | 3300050496 | Bacteria | 1143 |
| 822 | nmdc:mga07m45_36321_c1 | 3300050496 | Bacteria | 2744 |
| 823 | nmdc:mga07m45_429204_c1 | 3300050496 | Bacteria | 767 |
| 824 | nmdc:mga0rr50_1417667_c1 | 3300050513 | Bacteria | 588 |
| 825 | Ga0500578_0081043 | 3300053086 | Bacteria | 2064 |
| 826 | Ga0587080_097210 | 3300059503 | Bacteria | 625 |
| 827 | Ga0587082_003672 | 3300059504 | Bacteria | 1864 |
| 828 | Ga0587090_077458 | 3300059510 | Bacteria | 660 |
| 829 | Ga0587101_036866 | 3300059623 | Bacteria | 790 |
| 830 | Ga0587068_001335 | 3300059641 | Bacteria | 2726 |
| 831 | Ga0587079_010423 | 3300059647 | Bacteria | 1473 |
| 832 | Ga0587079_058765 | 3300059647 | Bacteria | 828 |
| 833 | Ga0466962_0106355 | 3300061719 | Bacteria | 1349 |
| 834 | Ga0466962_0123799 | 3300061719 | Bacteria | 1248 |
| 835 | 2643799537 | 2643221556 | Bacteria | 7251154 |
| 836 | 2644471627 | 2643221684 | Bacteria | 7145183 |
| 837 | 2809145757 | 2808606418 | Bacteria | 6724496 |
| 838 | 8047675967 | 8047673197 | Bacteria | 7395230 |
| 839 | Ga0495671_0184893 | |||
| 840 | JGI25159J45721_1006121 | |||
| 841 | rootL2_10061727 | |||
| 842 | rootL2_10083645 | |||
| 843 | rootL2_10084421 | |||
| 844 | Ga0055525_1000018 | |||
| 845 | Ga0055542_1007139 | |||
| 846 | Ga0055537_1001720 | |||
| 847 | Ga0055524_1026165 | |||
| 848 | Ga0055534_1001549 | |||
| 849 | Ga0055528_1003223 | |||
| 850 | Ga0055528_1003362 | |||
| 851 | Ga0055543_1006717 | |||
| 852 | Ga0065165_1000379 | |||
| 853 | Ga0065165_1005927 | |||
| 854 | Ga0065165_1010778 | |||
| 855 | Ga0065715_10022541 | |||
| 856 | Ga0070658_10158111 | |||
| 857 | Ga0070658_10410750 | |||
| 858 | Ga0070658_10777872 | |||
| 859 | Ga0070660_100083255 | |||
| 860 | Ga0070661_100295017 | |||
| 861 | Ga0070671_100303845 | |||
| 862 | Ga0070673_100191802 | |||
| 863 | Ga0070659_100024252 | |||
| 864 | Ga0070659_101298647 | |||
| 865 | Ga0070667_100001552 | |||
| 866 | Ga0070663_100164975 | |||
| 867 | Ga0070678_101021506 | |||
| 868 | Ga0070662_100056986 | |||
| 869 | Ga0070662_100248719 | |||
| 870 | Ga0070662_100702261 | |||
| 871 | Ga0070685_10679058 | |||
| 872 | Ga0070707_100100829 | |||
| 873 | Ga0070707_100277262 | |||
| 874 | Ga0070699_100427046 | |||
| 875 | Ga0070665_100901584 | |||
| 876 | Ga0068855_100060526 | |||
| 877 | Ga0070664_100095965 | |||
| 878 | Ga0070664_100120554 | |||
| 879 | Ga0070664_100873491 | |||
| 880 | Ga0068857_100644580 | |||
| 881 | Ga0068852_100362542 | |||
| 882 | Ga0068852_100987195 | |||
| 883 | Ga0075368_10007481 | |||
| 884 | Ga0075363_100056028 | |||
| 885 | Ga0075363_100139808 | |||
| 886 | Ga0075362_10015394 | |||
| 887 | Ga0075367_10011116 | |||
| 888 | Ga0075367_10076935 | |||
| 889 | Ga0075366_10082065 | |||
| 890 | Ga0075370_10020673 | |||
| 891 | Ga0075370_10134015 | |||
| 892 | Ga0097620_101304639 | |||
| 893 | Ga0099823_1111318 | |||
| 894 | Ga0105240_10045259 | |||
| 895 | Ga0105240_10109254 | |||
| 896 | Ga0105245_10417425 | |||
| 897 | Ga0105243_10002215 | |||
| 898 | Ga0105241_10005986 | |||
| 899 | Ga0105242_10014469 | |||
| 900 | Ga0105237_10020509 | |||
| 901 | Ga0105238_10660229 | |||
| 902 | Ga0105238_11349575 | |||
| 903 | Ga0105239_10046332 | |||
| 904 | Ga0105246_11541566 | |||
| 905 | Ga0157371_10000018 | |||
| 906 | Ga0157369_10899359 | |||
| 907 | Ga0157372_10277979 | |||
| 908 | Ga0157375_10817909 | |||
| 909 | Ga0182008_10044562 | |||
| 910 | Ga0157379_10266625 | |||
| 911 | Ga0157376_11174487 | |||
| 912 | Ga0182007_10054224 | |||
| 913 | Ga0213872_10000124 | |||
| 914 | Ga0209148_1001117 | |||
| 915 | Ga0209565_1000123 | |||
| 916 | Ga0209673_1000040 | |||
| 917 | Ga0209130_1000195 | |||
| 918 | Ga0209675_1000117 | |||
| 919 | Ga0209564_1000121 | |||
| 920 | Ga0209256_1000288 | |||
| 921 | Ga0207426_1056280 | |||
| 922 | Ga0207705_10009012 | |||
| 923 | Ga0207705_10829292 | |||
| 924 | Ga0207684_10003818 | |||
| 925 | Ga0207654_10002804 | |||
| 926 | Ga0207695_10240854 | |||
| 927 | Ga0207671_10016967 | |||
| 928 | Ga0207657_10009828 | |||
| 929 | Ga0207657_10197042 | |||
| 930 | Ga0207649_10014709 | |||
| 931 | Ga0207649_10305823 | |||
| 932 | Ga0207646_10286503 | |||
| 933 | Ga0207694_10505007 | |||
| 934 | Ga0207687_10181401 | |||
| 935 | Ga0207687_10198678 | |||
| 936 | Ga0207644_10192353 | |||
| 937 | Ga0207690_10023417 | |||
| 938 | Ga0207706_10046269 | |||
| 939 | Ga0207706_10275802 | |||
| 940 | Ga0207706_10367778 | |||
| 941 | Ga0207686_10016983 | |||
| 942 | Ga0207709_10036328 | |||
| 943 | Ga0207689_10136306 | |||
| 944 | Ga0207689_10163461 | |||
| 945 | Ga0207679_10099245 | |||
| 946 | Ga0207679_10569845 | |||
| 947 | Ga0207667_10035454 | |||
| 948 | Ga0207667_11000673 | |||
| 949 | Ga0207651_10100454 | |||
| 950 | Ga0207640_10324365 | |||
| 951 | Ga0207658_10001532 | |||
| 952 | Ga0207677_10428967 | |||
| 953 | Ga0207678_10172684 | |||
| 954 | Ga0207648_10541945 | |||
| 955 | Ga0207674_10308583 | |||
| 956 | Ga0207698_10033237 | |||
| 957 | Ga0209813_10029371 | |||
| 958 | Ga0268266_10561503 | |||
| 959 | Ga0268264_10441000 | |||
| 960 | Ga0316181_1170813 | |||
| 961 | Ga0307513_10497163 | |||
| 962 | Ga0307412_10501518 | |||
| 963 | Ga0395899_0000249 | |||
| 964 | Ga0395899_0033763 | |||
| 965 | Ga0395899_0048851 | |||
| 966 | Ga0395899_0107856 | |||
| 967 | Ga0395899_0137553 | |||
| 968 | Ga0395899_0188231 | |||
| 969 | Ga0395899_0234849 | |||
| 970 | Ga0395899_0466535 | |||
| 971 | Ga0395899_0606730 | |||
| 972 | Ga0395900_0001341 | |||
| 973 | Ga0395900_0048852 | |||
| 974 | Ga0395900_0074025 | |||
| 975 | Ga0395900_0096486 | |||
| 976 | Ga0395900_0159135 | |||
| 977 | Ga0395900_0182666 | |||
| 978 | Ga0395900_0222150 | |||
| 979 | Ga0395900_0235211 | |||
| 980 | Ga0395900_0245402 | |||
| 981 | Ga0395900_0277087 | |||
| 982 | Ga0395900_0639926 | |||
| 983 | Ga0395900_0657244 | |||
| 984 | Ga0395900_0874464 | |||
| 985 | Ga0395900_0878902 | |||
| 986 | Ga0395898_0042884 | |||
| 987 | Ga0395898_0226410 | |||
| 988 | Ga0395898_0519146 | |||
| 989 | Ga0395898_1693884 | |||
| 990 | Ga0395905_0099219 | |||
| 991 | Ga0395905_0105005 | |||
| 992 | Ga0395905_0112723 | |||
| 993 | Ga0395905_0430900 | |||
| 994 | Ga0395905_0450154 | |||
| 995 | Ga0395905_0487525 | |||
| 996 | Ga0395905_1362971 | |||
| 997 | Ga0395901_0000943 | |||
| 998 | Ga0395901_0033793 | |||
| 999 | Ga0395901_0071349 | |||
| 1000 | Ga0395901_0131622 | |||
| 1001 | Ga0395901_0181792 | |||
| 1002 | Ga0395901_1072245 | |||
| 1003 | Ga0436361_0638016 | |||
| 1004 | Ga0439442_039300 | |||
| 1005 | Ga0439448_0000168 | |||
| 1006 | Ga0439448_0007191 | |||
| 1007 | Ga0439449_0052511 | |||
| 1008 | Ga0439455_0018873 | |||
| 1009 | Ga0439455_0040059 | |||
| 1010 | Ga0450911_011722 | |||
| 1011 | Ga0450904_000209 | |||
| 1012 | Ga0439458_0026919 | |||
| 1013 | Ga0466969_0013213 | |||
| 1014 | Ga0466969_0146380 | |||
| 1015 | Ga0466969_0169188 | |||
| 1016 | Ga0466972_0016349 | |||
| 1017 | Ga0466965_0380128 | |||
| 1018 | Ga0466966_0003925 | |||
| 1019 | Ga0466966_0267686 | |||
| 1020 | Ga0466966_0346593 | |||
| 1021 | Ga0466966_0367215 | |||
| 1022 | Ga0466961_0075458 | |||
| 1023 | Ga0466961_0345172 | |||
| 1024 | Ga0466963_0251659 | |||
| 1025 | Ga0466963_0631243 | |||
| 1026 | Ga0466964_0002942 | |||
| 1027 | Ga0466964_0004101 | |||
| 1028 | Ga0466964_0199572 | |||
| 1029 | Ga0466968_0062297 | |||
| 1030 | Ga0466957_0010320 | |||
| 1031 | Ga0466957_0048974 | |||
| 1032 | Ga0466957_0055251 | |||
| 1033 | Ga0466957_0675636 | |||
| 1034 | Ga0466960_0160077 | |||
| 1035 | Ga0466959_0119744 | |||
| 1036 | Ga0466959_0168749 | |||
| 1037 | Ga0466959_0228712 | |||
| 1038 | Ga0466958_0152842 | |||
| 1039 | Ga0466967_0056063 | |||
| 1040 | Ga0466967_0865092 | |||
| 1041 | Ga0495617_018345 | |||
| 1042 | Ga0495617_100122 | |||
| 1043 | Ga0495627_007797 | |||
| 1044 | Ga0495603_0112260 | |||
| 1045 | Ga0495603_0314135 | |||
| 1046 | Ga0495590_0000663 | |||
| 1047 | Ga0495590_0005163 | |||
| 1048 | Ga0495590_0122133 | |||
| 1049 | Ga0495591_004471 | |||
| 1050 | Ga0495629_0007996 | |||
| 1051 | Ga0495629_0070182 | |||
| 1052 | Ga0495629_0080564 | |||
| 1053 | Ga0495638_0009687 | |||
| 1054 | Ga0495638_0101725 | |||
| 1055 | Ga0495638_0108204 | |||
| 1056 | Ga0495638_0146174 | |||
| 1057 | Ga0495638_0587057 | |||
| 1058 | Ga0495653_0023954 | |||
| 1059 | Ga0495653_0045230 | |||
| 1060 | Ga0495653_0047784 | |||
| 1061 | Ga0495653_0047806 | |||
| 1062 | Ga0495653_0331405 | |||
| 1063 | Ga0495653_0383204 | |||
| 1064 | Ga0495650_0000082 | |||
| 1065 | Ga0495650_0003329 | |||
| 1066 | Ga0495650_0015120 | |||
| 1067 | Ga0495580_0132480 | |||
| 1068 | Ga0495580_0844317 | |||
| 1069 | Ga0495582_0037319 | |||
| 1070 | Ga0495582_0064919 | |||
| 1071 | Ga0495582_0076367 | |||
| 1072 | Ga0495582_0147174 | |||
| 1073 | Ga0495605_0000630 | |||
| 1074 | Ga0495605_0003691 | |||
| 1075 | Ga0495605_0008256 | |||
| 1076 | Ga0495605_0013691 | |||
| 1077 | Ga0495605_0026279 | |||
| 1078 | Ga0495605_0032548 | |||
| 1079 | Ga0495605_0042373 | |||
| 1080 | Ga0495605_0064943 | |||
| 1081 | Ga0495605_0103419 | |||
| 1082 | Ga0495605_0109480 | |||
| 1083 | Ga0495605_0114525 | |||
| 1084 | Ga0495605_0115681 | |||
| 1085 | Ga0495605_0119823 | |||
| 1086 | Ga0495639_0211271 | |||
| 1087 | Ga0495584_0000005 | |||
| 1088 | Ga0495584_0000994 | |||
| 1089 | Ga0495584_0001189 | |||
| 1090 | Ga0495584_0008421 | |||
| 1091 | Ga0495584_0012773 | |||
| 1092 | Ga0495584_0014148 | |||
| 1093 | Ga0495584_0015107 | |||
| 1094 | Ga0495584_0015109 | |||
| 1095 | Ga0495584_0025718 | |||
| 1096 | Ga0495584_0029664 | |||
| 1097 | Ga0495584_0045931 | |||
| 1098 | Ga0495584_0073256 | |||
| 1099 | Ga0495584_0107155 | |||
| 1100 | Ga0495584_0109382 | |||
| 1101 | Ga0495584_0134020 | |||
| 1102 | Ga0495584_0135170 | |||
| 1103 | Ga0495584_0184802 | |||
| 1104 | Ga0495584_0329400 | |||
| 1105 | Ga0495585_0000472 | |||
| 1106 | Ga0495585_0000660 | |||
| 1107 | Ga0495585_0003691 | |||
| 1108 | Ga0495585_0003712 | |||
| 1109 | Ga0495585_0004627 | |||
| 1110 | Ga0495585_0006113 | |||
| 1111 | Ga0495585_0009218 | |||
| 1112 | Ga0495585_0010813 | |||
| 1113 | Ga0495585_0014093 | |||
| 1114 | Ga0495585_0026242 | |||
| 1115 | Ga0495585_0033864 | |||
| 1116 | Ga0495585_0045625 | |||
| 1117 | Ga0495585_0077478 | |||
| 1118 | Ga0495585_0082583 | |||
| 1119 | Ga0495585_0090799 | |||
| 1120 | Ga0495585_0094593 | |||
| 1121 | Ga0495585_0165944 | |||
| 1122 | Ga0495585_0209223 | |||
| 1123 | Ga0495585_0234651 | |||
| 1124 | Ga0495585_0238779 | |||
| 1125 | Ga0495585_0261680 | |||
| 1126 | Ga0495594_0003215 | |||
| 1127 | Ga0495594_0041504 | |||
| 1128 | Ga0495594_0103717 | |||
| 1129 | Ga0495594_0115309 | |||
| 1130 | Ga0495594_0384659 | |||
| 1131 | Ga0495594_0412116 | |||
| 1132 | Ga0495594_0687699 | |||
| 1133 | Ga0495596_0001058 | |||
| 1134 | Ga0495596_0002388 | |||
| 1135 | Ga0495596_0004797 | |||
| 1136 | Ga0495596_0005314 | |||
| 1137 | Ga0495596_0008879 | |||
| 1138 | Ga0495596_0016727 | |||
| 1139 | Ga0495596_0018984 | |||
| 1140 | Ga0495596_0024433 | |||
| 1141 | Ga0495596_0082923 | |||
| 1142 | Ga0495596_0102864 | |||
| 1143 | Ga0495596_0274697 | |||
| 1144 | Ga0495607_0002407 | |||
| 1145 | Ga0495607_0008978 | |||
| 1146 | Ga0495607_0010961 | |||
| 1147 | Ga0495607_0016145 | |||
| 1148 | Ga0495607_0023527 | |||
| 1149 | Ga0495607_0029160 | |||
| 1150 | Ga0495607_0033927 | |||
| 1151 | Ga0495607_0057824 | |||
| 1152 | Ga0495607_0075634 | |||
| 1153 | Ga0495607_0126260 | |||
| 1154 | Ga0495607_0181337 | |||
| 1155 | Ga0495607_0262639 | |||
| 1156 | Ga0495607_0299453 | |||
| 1157 | Ga0495607_0443751 | |||
| 1158 | Ga0495583_0000592 | |||
| 1159 | Ga0495583_0001039 | |||
| 1160 | Ga0495583_0002694 | |||
| 1161 | Ga0495583_0003626 | |||
| 1162 | Ga0495583_0009561 | |||
| 1163 | Ga0495583_0010563 | |||
| 1164 | Ga0495583_0027555 | |||
| 1165 | Ga0495583_0031266 | |||
| 1166 | Ga0495583_0032373 | |||
| 1167 | Ga0495583_0045967 | |||
| 1168 | Ga0495583_0324516 | |||
| 1169 | Ga0495606_0014378 | |||
| 1170 | Ga0495606_0017806 | |||
| 1171 | Ga0495606_0037466 | |||
| 1172 | Ga0495606_0059057 | |||
| 1173 | Ga0495606_0064213 | |||
| 1174 | Ga0495606_0107186 | |||
| 1175 | Ga0495606_0109619 | |||
| 1176 | Ga0495606_0137455 | |||
| 1177 | Ga0495606_0178678 | |||
| 1178 | Ga0495606_0210834 | |||
| 1179 | Ga0495606_0261673 | |||
| 1180 | Ga0495606_0365372 | |||
| 1181 | Ga0495606_0406781 | |||
| 1182 | Ga0495606_0528996 | |||
| 1183 | Ga0495610_0049834 | |||
| 1184 | Ga0495616_0001261 | |||
| 1185 | Ga0495616_0001787 | |||
| 1186 | Ga0495616_0006906 | |||
| 1187 | Ga0495616_0008663 | |||
| 1188 | Ga0495616_0009936 | |||
| 1189 | Ga0495616_0010968 | |||
| 1190 | Ga0495616_0014758 | |||
| 1191 | Ga0495616_0023667 | |||
| 1192 | Ga0495616_0040061 | |||
| 1193 | Ga0495616_0046907 | |||
| 1194 | Ga0495616_0052509 | |||
| 1195 | Ga0495616_0112117 | |||
| 1196 | Ga0495616_0140889 | |||
| 1197 | Ga0495620_0036340 | |||
| 1198 | Ga0495631_0000973 | |||
| 1199 | Ga0495631_0001348 | |||
| 1200 | Ga0495631_0007570 | |||
| 1201 | Ga0495631_0008959 | |||
| 1202 | Ga0495631_0012110 | |||
| 1203 | Ga0495631_0013606 | |||
| 1204 | Ga0495631_0021691 | |||
| 1205 | Ga0495631_0039749 | |||
| 1206 | Ga0495631_0056784 | |||
| 1207 | Ga0495631_0081416 | |||
| 1208 | Ga0495631_0085794 | |||
| 1209 | Ga0495631_0092383 | |||
| 1210 | Ga0495631_0099747 | |||
| 1211 | Ga0495631_0141071 | |||
| 1212 | Ga0495631_0221160 | |||
| 1213 | Ga0495632_0002249 | |||
| 1214 | Ga0495632_0002671 | |||
| 1215 | Ga0495632_0003465 | |||
| 1216 | Ga0495632_0011663 | |||
| 1217 | Ga0495632_0017531 | |||
| 1218 | Ga0495632_0053309 | |||
| 1219 | Ga0495632_0179830 | |||
| 1220 | Ga0495637_0000221 | |||
| 1221 | Ga0495637_0037801 | |||
| 1222 | Ga0495637_0054849 | |||
| 1223 | Ga0495637_0087913 | |||
| 1224 | Ga0495643_0000109 | |||
| 1225 | Ga0495643_0003754 | |||
| 1226 | Ga0495643_0028501 | |||
| 1227 | Ga0495643_0040795 | |||
| 1228 | Ga0495643_0050351 | |||
| 1229 | Ga0495643_0062070 | |||
| 1230 | Ga0495643_0079702 | |||
| 1231 | Ga0495643_0108059 | |||
| 1232 | Ga0495643_0112399 | |||
| 1233 | Ga0495643_0120973 | |||
| 1234 | Ga0495643_0254012 | |||
| 1235 | Ga0495643_0419112 | |||
| 1236 | Ga0495644_0005187 | |||
| 1237 | Ga0495644_0006677 | |||
| 1238 | Ga0495644_0020277 | |||
| 1239 | Ga0495644_0027776 | |||
| 1240 | Ga0495644_0064768 | |||
| 1241 | Ga0495644_0094945 | |||
| 1242 | Ga0495644_0105006 | |||
| 1243 | Ga0495644_0255928 | |||
| 1244 | Ga0495648_0000048 | |||
| 1245 | Ga0495648_0005150 | |||
| 1246 | Ga0495648_0005316 | |||
| 1247 | Ga0495648_0018179 | |||
| 1248 | Ga0495648_0035023 | |||
| 1249 | Ga0495648_0047307 | |||
| 1250 | Ga0495648_0171463 | |||
| 1251 | Ga0495648_0203903 | |||
| 1252 | Ga0495648_0325204 | |||
| 1253 | Ga0495663_0007203 | |||
| 1254 | Ga0495663_0053023 | |||
| 1255 | Ga0495666_0041056 | |||
| 1256 | Ga0495666_0046910 | |||
| 1257 | Ga0495666_0064078 | |||
| 1258 | Ga0495666_0106649 | |||
| 1259 | Ga0495642_0000679 | |||
| 1260 | Ga0495642_0001256 | |||
| 1261 | Ga0495642_0007596 | |||
| 1262 | Ga0495642_0008409 | |||
| 1263 | Ga0495642_0008507 | |||
| 1264 | Ga0495642_0034152 | |||
| 1265 | Ga0495642_0037039 | |||
| 1266 | Ga0495642_0049422 | |||
| 1267 | Ga0495642_0077008 | |||
| 1268 | Ga0495642_0137440 | |||
| 1269 | Ga0495652_0088191 | |||
| 1270 | Ga0495652_0224485 | |||
| 1271 | Ga0495654_0064635 | |||
| 1272 | Ga0495654_0086148 | |||
| 1273 | Ga0495654_0165585 | |||
| 1274 | Ga0495654_0173022 | |||
| 1275 | Ga0495654_0319114 | |||
| 1276 | Ga0495665_0002869 | |||
| 1277 | Ga0495665_0038671 | |||
| 1278 | Ga0495665_0070472 | |||
| 1279 | Ga0495640_0176391 | |||
| 1280 | Ga0495586_0011177 | |||
| 1281 | Ga0495586_0027446 | |||
| 1282 | Ga0495586_0262189 | |||
| 1283 | Ga0495586_0390797 | |||
| 1284 | Ga0495587_0021803 | |||
| 1285 | Ga0495587_0024059 | |||
| 1286 | Ga0495587_0108650 | |||
| 1287 | Ga0495587_0140212 | |||
| 1288 | Ga0495609_0000007 | |||
| 1289 | Ga0495609_0002784 | |||
| 1290 | Ga0495609_0004623 | |||
| 1291 | Ga0495609_0006393 | |||
| 1292 | Ga0495609_0029788 | |||
| 1293 | Ga0495609_0051103 | |||
| 1294 | Ga0495609_0076777 | |||
| 1295 | Ga0495609_0092056 | |||
| 1296 | Ga0495621_0413864 | |||
| 1297 | Ga0495597_0000084 | |||
| 1298 | Ga0495597_0003580 | |||
| 1299 | Ga0495597_0007302 | |||
| 1300 | Ga0495597_0009326 | |||
| 1301 | Ga0495597_0011019 | |||
| 1302 | Ga0495597_0014499 | |||
| 1303 | Ga0495597_0051691 | |||
| 1304 | Ga0495597_0287616 | |||
| 1305 | Ga0495645_0108234 | |||
| 1306 | Ga0495645_0222533 | |||
| 1307 | Ga0495622_0020014 | |||
| 1308 | Ga0495622_0046142 | |||
| 1309 | Ga0495622_0050689 | |||
| 1310 | Ga0495622_0105811 | |||
| 1311 | Ga0495633_0000990 | |||
| 1312 | Ga0495633_0008654 | |||
| 1313 | Ga0495633_0009872 | |||
| 1314 | Ga0495633_0011214 | |||
| 1315 | Ga0495633_0012265 | |||
| 1316 | Ga0495633_0027111 | |||
| 1317 | Ga0495633_0032480 | |||
| 1318 | Ga0495633_0041368 | |||
| 1319 | Ga0495633_0041393 | |||
| 1320 | Ga0495633_0065158 | |||
| 1321 | Ga0495633_0097592 | |||
| 1322 | Ga0495633_0109157 | |||
| 1323 | Ga0495633_0149405 | |||
| 1324 | Ga0495633_0298169 | |||
| 1325 | Ga0495656_0008329 | |||
| 1326 | Ga0495656_0013934 | |||
| 1327 | Ga0495656_0038243 | |||
| 1328 | Ga0495656_0214057 | |||
| 1329 | Ga0495656_0411791 | |||
| 1330 | Ga0495668_0000035 | |||
| 1331 | Ga0495668_0002368 | |||
| 1332 | Ga0495668_0002371 | |||
| 1333 | Ga0495668_0010855 | |||
| 1334 | Ga0495668_0011351 | |||
| 1335 | Ga0495668_0017050 | |||
| 1336 | Ga0495668_0101085 | |||
| 1337 | Ga0495668_0131361 | |||
| 1338 | Ga0495668_0132446 | |||
| 1339 | Ga0495668_0143985 | |||
| 1340 | Ga0495668_0201889 | |||
| 1341 | Ga0495668_0216194 | |||
| 1342 | Ga0495668_0355246 | |||
| 1343 | Ga0495668_0551024 | |||
| 1344 | Ga0495634_0058359 | |||
| 1345 | Ga0495634_0431404 | |||
| 1346 | Ga0495611_0000071 | |||
| 1347 | Ga0495611_0001459 | |||
| 1348 | Ga0495611_0009239 | |||
| 1349 | Ga0495611_0016689 | |||
| 1350 | Ga0495611_0020841 | |||
| 1351 | Ga0495611_0027815 | |||
| 1352 | Ga0495611_0036874 | |||
| 1353 | Ga0495611_0059613 | |||
| 1354 | Ga0495611_0115899 | |||
| 1355 | Ga0495611_0129253 | |||
| 1356 | Ga0495611_0221770 | |||
| 1357 | Ga0495611_0358678 | |||
| 1358 | Ga0495625_0009426 | |||
| 1359 | Ga0495625_0015366 | |||
| 1360 | Ga0495625_0059330 | |||
| 1361 | Ga0495625_0148131 | |||
| 1362 | Ga0495625_0149311 | |||
| 1363 | Ga0495625_0211122 | |||
| 1364 | Ga0495625_0255708 | |||
| 1365 | Ga0495625_0370888 | |||
| 1366 | Ga0495625_0642361 | |||
| 1367 | Ga0495635_0014979 | |||
| 1368 | Ga0495659_0087618 | |||
| 1369 | Ga0495659_0177561 | |||
| 1370 | Ga0495661_0002080 | |||
| 1371 | Ga0495661_0002763 | |||
| 1372 | Ga0495661_0003309 | |||
| 1373 | Ga0495661_0005821 | |||
| 1374 | Ga0495661_0008948 | |||
| 1375 | Ga0495661_0028493 | |||
| 1376 | Ga0495661_0040890 | |||
| 1377 | Ga0495661_0055194 | |||
| 1378 | Ga0495661_0077005 | |||
| 1379 | Ga0495661_0080859 | |||
| 1380 | Ga0495661_0092135 | |||
| 1381 | Ga0495661_0100863 | |||
| 1382 | Ga0495661_0105559 | |||
| 1383 | Ga0495661_0114155 | |||
| 1384 | Ga0495661_0307996 | |||
| 1385 | Ga0495661_0348845 | |||
| 1386 | Ga0495661_0573494 | |||
| 1387 | Ga0495588_0000147 | |||
| 1388 | Ga0495588_0002825 | |||
| 1389 | Ga0495588_0012740 | |||
| 1390 | Ga0495588_0073813 | |||
| 1391 | Ga0495588_0079126 | |||
| 1392 | Ga0495588_0117985 | |||
| 1393 | Ga0495588_0126901 | |||
| 1394 | Ga0495588_0144574 | |||
| 1395 | Ga0495588_0327552 | |||
| 1396 | Ga0495588_0334443 | |||
| 1397 | Ga0495588_0373834 | |||
| 1398 | Ga0495588_0693581 | |||
| 1399 | Ga0495623_0039441 | |||
| 1400 | Ga0495623_0053850 | |||
| 1401 | Ga0495623_0062275 | |||
| 1402 | Ga0495623_0113963 | |||
| 1403 | Ga0495623_0161142 | |||
| 1404 | Ga0495669_0000124 | |||
| 1405 | Ga0495669_0008315 | |||
| 1406 | Ga0495669_0019990 | |||
| 1407 | Ga0495669_0044090 | |||
| 1408 | Ga0495669_0052970 | |||
| 1409 | Ga0495669_0115914 | |||
| 1410 | Ga0495613_0068984 | |||
| 1411 | Ga0495613_0284174 | |||
| 1412 | Ga0495624_0006451 | |||
| 1413 | Ga0495670_0001924 | |||
| 1414 | Ga0495670_0009455 | |||
| 1415 | Ga0495670_0010712 | |||
| 1416 | Ga0495670_0014233 | |||
| 1417 | Ga0495670_0031890 | |||
| 1418 | Ga0495670_0032597 | |||
| 1419 | Ga0495670_0037510 | |||
| 1420 | Ga0495670_0044416 | |||
| 1421 | Ga0495670_0108414 | |||
| 1422 | Ga0495670_0150015 | |||
| 1423 | Ga0495670_0248342 | |||
| 1424 | Ga0495670_0325957 | |||
| 1425 | Ga0495671_0011043 | |||
| 1426 | Ga0495671_0086425 | |||
| 1427 | Ga0495671_0166479 | |||
| 1428 | Ga0495671_0209369 | |||
| 1429 | Ga0495671_0455240 | |||
| 1430 | Ga0495649_0037708 | |||
| 1431 | Ga0495649_0038241 | |||
| 1432 | Ga0495649_0042215 | |||
| 1433 | Ga0495649_0049882 | |||
| 1434 | Ga0495649_0072036 | |||
| 1435 | Ga0495649_0090590 | |||
| 1436 | Ga0495649_0123764 | |||
| 1437 | Ga0495649_0239565 | |||
| 1438 | Ga0495589_0000020 | |||
| 1439 | Ga0495589_0002448 | |||
| 1440 | Ga0495589_0015745 | |||
| 1441 | Ga0495589_0019390 | |||
| 1442 | Ga0495589_0026426 | |||
| 1443 | Ga0495589_0042729 | |||
| 1444 | Ga0495589_0043185 | |||
| 1445 | Ga0495589_0046451 | |||
| 1446 | Ga0495589_0058558 | |||
| 1447 | Ga0495589_0104288 | |||
| 1448 | Ga0495589_0105248 | |||
| 1449 | Ga0495589_0167753 | |||
| 1450 | Ga0495589_0182137 | |||
| 1451 | Ga0495589_0211831 | |||
| 1452 | Ga0495600_0094322 | |||
| 1453 | Ga0495600_0380652 | |||
| 1454 | Ga0495600_0489215 | |||
| 1455 | Ga0495660_0000299 | |||
| 1456 | Ga0495660_0002546 | |||
| 1457 | Ga0495660_0019578 | |||
| 1458 | Ga0495660_0033218 | |||
| 1459 | Ga0495660_0048771 | |||
| 1460 | Ga0495660_0126112 | |||
| 1461 | Ga0495660_0286454 | |||
| 1462 | Ga0495581_0006811 | |||
| 1463 | Ga0495581_0010035 | |||
| 1464 | Ga0495581_0104105 | |||
| 1465 | Ga0495604_0005099 | |||
| 1466 | Ga0495604_0028956 | |||
| 1467 | Ga0495636_0013036 | |||
| 1468 | Ga0495636_0017460 | |||
| 1469 | Ga0495636_0028521 | |||
| 1470 | Ga0495636_0059191 | |||
| 1471 | Ga0495674_0001181 | |||
| 1472 | Ga0495672_0000148 | |||
| 1473 | Ga0495672_0002800 | |||
| 1474 | Ga0495672_0003594 | |||
| 1475 | Ga0495672_0005495 | |||
| 1476 | Ga0495672_0031171 | |||
| 1477 | Ga0495672_0045069 | |||
| 1478 | Ga0495672_0138481 | |||
| 1479 | Ga0495676_0000015 | |||
| 1480 | Ga0495676_0019070 | |||
| 1481 | Ga0495676_0099412 | |||
| 1482 | Ga0495676_0136813 | |||
| 1483 | Ga0495676_0219706 | |||
| 1484 | Ga0495676_0235696 | |||
| 1485 | Ga0495676_0346511 | |||
| 1486 | Ga0495680_0021860 | |||
| 1487 | Ga0495680_0041791 | |||
| 1488 | Ga0495680_0060522 | |||
| 1489 | Ga0495680_0374131 | |||
| 1490 | Ga0495683_0000350 | |||
| 1491 | Ga0495683_0001211 | |||
| 1492 | Ga0495683_0015182 | |||
| 1493 | Ga0495683_0036763 | |||
| 1494 | Ga0495683_0044386 | |||
| 1495 | Ga0495683_0081854 | |||
| 1496 | Ga0495683_0083294 | |||
| 1497 | Ga0495683_0128819 | |||
| 1498 | Ga0495683_0135527 | |||
| 1499 | Ga0495683_0199830 | |||
| 1500 | Ga0495683_0202155 | |||
| 1501 | Ga0495683_0229717 | |||
| 1502 | Ga0495687_000030 | |||
| 1503 | Ga0495687_000120 | |||
| 1504 | Ga0495687_000390 | |||
| 1505 | Ga0495687_002124 | |||
| 1506 | Ga0495687_002301 | |||
| 1507 | Ga0495687_002872 | |||
| 1508 | Ga0495687_005528 | |||
| 1509 | Ga0495687_037927 | |||
| 1510 | Ga0495675_0015118 | |||
| 1511 | Ga0495675_0069009 | |||
| 1512 | Ga0495677_0000045 | |||
| 1513 | Ga0495677_0000503 | |||
| 1514 | Ga0495677_0000510 | |||
| 1515 | Ga0495677_0002868 | |||
| 1516 | Ga0495677_0008677 | |||
| 1517 | Ga0495677_0051356 | |||
| 1518 | Ga0495677_0052780 | |||
| 1519 | Ga0495677_0067163 | |||
| 1520 | Ga0495677_0114897 | |||
| 1521 | Ga0495677_0125489 | |||
| 1522 | Ga0495677_0202879 | |||
| 1523 | Ga0495677_0224336 | |||
| 1524 | Ga0495679_026498 | |||
| 1525 | Ga0495679_045695 | |||
| 1526 | Ga0495679_052210 | |||
| 1527 | Ga0495679_068710 | |||
| 1528 | Ga0495685_002056 | |||
| 1529 | Ga0495685_003936 | |||
| 1530 | Ga0495685_010250 | |||
| 1531 | Ga0495685_025260 | |||
| 1532 | Ga0495685_070806 | |||
| 1533 | Ga0495685_090816 | |||
| 1534 | Ga0495685_197079 | |||
| 1535 | Ga0495681_0006141 | |||
| 1536 | Ga0495681_0013415 | |||
| 1537 | Ga0495681_0044868 | |||
| 1538 | Ga0495681_0049088 | |||
| 1539 | Ga0495681_0057502 | |||
| 1540 | Ga0495681_0073367 | |||
| 1541 | Ga0495681_0077115 | |||
| 1542 | Ga0495681_0134429 | |||
| 1543 | Ga0495681_0189551 | |||
| 1544 | Ga0495681_0305692 | |||
| 1545 | Ga0495684_0736479 | |||
| 1546 | Ga0495686_0002455 | |||
| 1547 | Ga0495686_0009603 | |||
| 1548 | Ga0495686_0010484 | |||
| 1549 | Ga0495686_0022502 | |||
| 1550 | Ga0495686_0077301 | |||
| 1551 | Ga0495686_0180047 | |||
| 1552 | Ga0495686_0200699 | |||
| 1553 | Ga0495686_0380309 | |||
| 1554 | Ga0495593_0006146 | |||
| 1555 | Ga0495593_0008376 | |||
| 1556 | Ga0495593_0012881 | |||
| 1557 | Ga0495593_0099617 | |||
| 1558 | Ga0495602_0050543 | |||
| 1559 | Ga0495602_0050633 | |||
| 1560 | Ga0495602_0607535 | |||
| 1561 | Ga0495614_0006856 | |||
| 1562 | Ga0495614_0012239 | |||
| 1563 | Ga0495614_0116208 | |||
| 1564 | Ga0495614_0230459 | |||
| 1565 | Ga0495615_0000541 | |||
| 1566 | Ga0495626_0000022 | |||
| 1567 | Ga0495626_0001540 | |||
| 1568 | Ga0495626_0001950 | |||
| 1569 | Ga0495626_0002030 | |||
| 1570 | Ga0495626_0002265 | |||
| 1571 | Ga0495626_0003732 | |||
| 1572 | Ga0495626_0008789 | |||
| 1573 | Ga0495626_0011126 | |||
| 1574 | Ga0495626_0025930 | |||
| 1575 | Ga0495626_0030628 | |||
| 1576 | Ga0495626_0031076 | |||
| 1577 | Ga0495626_0038883 | |||
| 1578 | Ga0495626_0042774 | |||
| 1579 | Ga0495626_0044954 | |||
| 1580 | Ga0495626_0047504 | |||
| 1581 | Ga0495626_0121152 | |||
| 1582 | Ga0495626_0121452 | |||
| 1583 | Ga0495626_0232185 | |||
| 1584 | Ga0496100_0119383 | |||
| 1585 | Ga0496101_0063645 | |||
| 1586 | Ga0496101_0194138 | |||
| 1587 | Ga0496102_0081745 | |||
| 1588 | Ga0496102_0177083 | |||
| 1589 | Ga0496102_0365437 | |||
| 1590 | Ga0496102_0375238 | |||
| 1591 | Ga0496102_0663144 | |||
| 1592 | Ga0496102_1008470 | |||
| 1593 | Ga0496103_0002995 | |||
| 1594 | Ga0496103_0125074 | |||
| 1595 | Ga0496103_0139605 | |||
| 1596 | Ga0496103_0174003 | |||
| 1597 | Ga0496104_0277244 | |||
| 1598 | Ga0496105_0457120 | |||
| 1599 | Ga0496105_0554098 | |||
| 1600 | Ga0496105_1165195 | |||
| 1601 | Ga0496106_0100462 | |||
| 1602 | Ga0496106_0150595 | |||
| 1603 | Ga0496107_0160925 | |||
| 1604 | Ga0496107_0173989 | |||
| 1605 | Ga0496108_0199842 | |||
| 1606 | Ga0496108_0335163 | |||
| 1607 | Ga0496109_0096622 | |||
| 1608 | Ga0496110_0009391 | |||
| 1609 | Ga0496110_0147566 | |||
| 1610 | Ga0496111_1128944 | |||
| 1611 | Ga0496112_0842022 | |||
| 1612 | Ga0496113_0005827 | |||
| 1613 | Ga0496113_0021448 | |||
| 1614 | Ga0496113_0384158 | |||
| 1615 | Ga0496113_0594637 | |||
| 1616 | Ga0496114_0135817 | |||
| 1617 | Ga0496115_0051104 | |||
| 1618 | Ga0496115_0058320 | |||
| 1619 | Ga0496115_0245138 | |||
| 1620 | Ga0496122_0014679 | |||
| 1621 | Ga0496122_0020345 | |||
| 1622 | Ga0496123_0014582 | |||
| 1623 | Ga0496123_0048321 | |||
| 1624 | Ga0496124_0007340 | |||
| 1625 | Ga0496124_0043025 | |||
| 1626 | Ga0496124_0137541 | |||
| 1627 | Ga0496124_0274241 | |||
| 1628 | Ga0496124_0278469 | |||
| 1629 | Ga0496124_0287722 | |||
| 1630 | Ga0496125_0016500 | |||
| 1631 | Ga0496125_0068076 | |||
| 1632 | Ga0496125_0159933 | |||
| 1633 | Ga0501308_002211 | |||
| 1634 | Ga0501304_004320 | |||
| 1635 | Ga0495678_001688 | |||
| 1636 | Ga0495678_002890 | |||
| 1637 | Ga0495678_008181 | |||
| 1638 | Ga0495678_013753 | |||
| 1639 | Ga0495678_037296 | |||
| 1640 | Ga0495678_114301 | |||
| 1641 | Ga0495682_0001410 | |||
| 1642 | Ga0495682_0011868 | |||
| 1643 | Ga0495682_0015601 | |||
| 1644 | Ga0495682_0023226 | |||
| 1645 | Ga0495682_0032634 | |||
| 1646 | Ga0495682_0059011 | |||
| 1647 | Ga0495682_0248494 | |||
| 1648 | Ga0501036_1344126 | |||
| 1649 | Ga0501047_0147017 | |||
| 1650 | Ga0501222_024812 | |||
| 1651 | Ga0501035_0053908 | |||
| 1652 | Ga0501044_0339913 | |||
| 1653 | nmdc:mga03683_3948_c1 | |||
| 1654 | nmdc:mga03n38_163000_c1 | |||
| 1655 | nmdc:mga00v17_20995_c1 | |||
| 1656 | nmdc:mga0k408_87298_c1 | |||
| 1657 | nmdc:mga06z11_19491_c1 | |||
| 1658 | nmdc:mga06z11_201713_c1 | |||
| 1659 | nmdc:mga07m45_206547_c1 | |||
| 1660 | nmdc:mga07m45_36321_c1 | |||
| 1661 | nmdc:mga07m45_429204_c1 | |||
| 1662 | nmdc:mga0rr50_1417667_c1 | |||
| 1663 | Ga0500578_0081043 | |||
| 1664 | Ga0587080_097210 | |||
| 1665 | Ga0587082_003672 | |||
| 1666 | Ga0587090_077458 | |||
| 1667 | Ga0587101_036866 | |||
| 1668 | Ga0587068_001335 | |||
| 1669 | Ga0587079_010423 | |||
| 1670 | Ga0587079_058765 | |||
| 1671 | Ga0466962_0106355 | |||
| 1672 | Ga0466962_0123799 | |||
| 1673 | 2643799537 | |||
| 1674 | 2644471627 | |||
| 1675 | 2809145757 | |||
| 1676 | 8047675967 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o1c-assembly2.cif.gz_B | structure of the e. coli dihydroneopterin triphosphate pyrophosphohydrolase | 0.9088 | 2 | 144 |
| 2o1c-assembly2.cif.gz_B | structure of the e. coli dihydroneopterin triphosphate pyrophosphohydrolase | 0.8738 | 2 | 144 |
| 6m6y-assembly1.cif.gz_A | crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp | 0.8669 | 8 | 147 |
| 5ggc-assembly1.cif.gz_A | crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) | 0.8502 | 8 | 147 |
| 5xd2-assembly1.cif.gz_A | crystal structure of mycobacterium smegmatis mutt1 in complex with ap5a, atp and manganese | 0.8475 | 8 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o1cB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9088 | 2 | 144 | 3.90.79.10 |
| 2o1cB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8738 | 2 | 144 | 3.90.79.10 |
| 3sonB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8156 | 6 | 151 | 3.90.79.10 |
| 4nfwI00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8124 | 1 | 147 | 3.90.79.10 |
| 2pbtB01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8094 | 9 | 150 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N7E3V3-F1-model_v4 | Dihydroneopterin triphosphate diphosphatase | 0.9892 | 4 | 147 |
GO:0008828
GO:0019177 GO:0046656 GO:0046872 |
| AF-A0A1E7WGE6-F1-model_v4 | Dihydroneopterin triphosphate pyrophosphatase (EC 3.6.1.-) | 0.9888 | 1 | 149 |
GO:0008828
GO:0019177 GO:0046656 GO:0046872 |
| AF-A0A6A8W2F4-F1-model_v4 | deleted | 0.9792 | 1 | 149 |
|
| AF-A0A165L9G4-F1-model_v4 | NUDIX pyrophosphatase | 0.9777 | 1 | 147 |
GO:0004081
GO:0006167 GO:0006754 GO:0008828 GO:0019177 GO:0046656 GO:0046872 |
| AF-A0A554XBW0-F1-model_v4 | Dihydroneopterin triphosphate diphosphatase (EC 3.6.1.67) | 0.9772 | 1 | 147 |
GO:0008828
GO:0019177 GO:0046656 GO:0046872 |