F483033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 839 | 268 | 839 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0000020|Ga0501070_0000020_145432_146541 |
| Length | 369 |
| Sequence | MTIGIDERVMSVNEKFHRLKIAEVRRETPDAVSIRFEIPAELKDAFAFKAGQHLTLRTEMNGEDLRRNYSVCVAPHENEIRIAVKQTPGGRFSGWANSALQAGHTIEVLPPMGRFVVPHTDSIEPYYVALAGGSGITPVLSILKTVLAENPRAHFTLLYGNRDSASIMFLEELAGLKNRYLDRLEIYHFLENEAEEIELFNGRLDRAKLDDVFATLVDVKDADAFFICGPGPMMDAAESALLARAIAPERIFIERFTTGAISAEQLARDEALQQKAQGTQITVTLDGRRSKIAFNAEKGNILESVQAAGLPAPYACKGGVCSTCRAKVLSGTVTMKKNYGLTDAEVAEGYVLTCQSVPTSEDVALSYDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 194 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 195 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 196 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 197 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 198 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 199 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 258 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 259 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 260 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 261 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 262 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 263 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 265 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.07 |
| Nodule | 0 |
| Rhizoplane | 2.98 |
| Rhizosphere | 93.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1006675 | 3300001904 | Bacteria | 1943 |
| 2 | JGI24740J21852_10015235 | 3300001979 | Bacteria | 2812 |
| 3 | JGI24740J21852_10021560 | 3300001979 | Bacteria | 2232 |
| 4 | JGI24739J22299_10002585 | 3300001989 | Bacteria | 6974 |
| 5 | JGI24739J22299_10018333 | 3300001989 | Bacteria | 2517 |
| 6 | JGI24737J22298_10001425 | 3300001990 | Bacteria | 8512 |
| 7 | JGI24737J22298_10002822 | 3300001990 | Bacteria | 6153 |
| 8 | JGI24735J21928_10035395 | 3300002067 | Bacteria | 1468 |
| 9 | JGI24745J21846_1001648 | 3300002073 | Bacteria | 2197 |
| 10 | JGI24738J21930_10000935 | 3300002075 | Bacteria | 8390 |
| 11 | JGI24738J21930_10004197 | 3300002075 | Bacteria | 3554 |
| 12 | JGI24738J21930_10011075 | 3300002075 | Bacteria | 1992 |
| 13 | rootH2_10000496 | 3300003320 | Bacteria | 59982 |
| 14 | Ga0065712_10097408 | 3300005290 | Bacteria | 2145 |
| 15 | Ga0065715_10101666 | 3300005293 | Bacteria | 3182 |
| 16 | Ga0070658_10001352 | 3300005327 | Bacteria | 20951 |
| 17 | Ga0070658_10033393 | 3300005327 | Bacteria | 4139 |
| 18 | Ga0070658_10039138 | 3300005327 | Bacteria | 3825 |
| 19 | Ga0070658_10045883 | 3300005327 | Bacteria | 3535 |
| 20 | Ga0070658_10046477 | 3300005327 | Bacteria | 3512 |
| 21 | Ga0070658_10080745 | 3300005327 | Bacteria | 2671 |
| 22 | Ga0070658_10154884 | 3300005327 | Bacteria | 1920 |
| 23 | Ga0070658_10184105 | 3300005327 | Bacteria | 1758 |
| 24 | Ga0070658_10248653 | 3300005327 | Bacteria | 1508 |
| 25 | Ga0070676_10013596 | 3300005328 | Bacteria | 4463 |
| 26 | Ga0070676_10062332 | 3300005328 | Bacteria | 2219 |
| 27 | Ga0070683_100154301 | 3300005329 | Bacteria | 2177 |
| 28 | Ga0070683_100257611 | 3300005329 | Bacteria | 1659 |
| 29 | Ga0070683_100324654 | 3300005329 | Bacteria | 1465 |
| 30 | Ga0070670_100000388 | 3300005331 | Bacteria | 36452 |
| 31 | Ga0070670_100005434 | 3300005331 | Bacteria | 10747 |
| 32 | Ga0070670_100019494 | 3300005331 | Bacteria | 5821 |
| 33 | Ga0070670_100027696 | 3300005331 | Bacteria | 4875 |
| 34 | Ga0070670_100163433 | 3300005331 | Bacteria | 1930 |
| 35 | Ga0070677_10000261 | 3300005333 | Bacteria | 18228 |
| 36 | Ga0070677_10029338 | 3300005333 | Bacteria | 2085 |
| 37 | Ga0070677_10043353 | 3300005333 | Bacteria | 1786 |
| 38 | Ga0068869_100000651 | 3300005334 | Bacteria | 19629 |
| 39 | Ga0070666_10003451 | 3300005335 | Bacteria | 9579 |
| 40 | Ga0070666_10007885 | 3300005335 | Bacteria | 6579 |
| 41 | Ga0070680_100000210 | 3300005336 | Bacteria | 38357 |
| 42 | Ga0070680_100050386 | 3300005336 | Bacteria | 3396 |
| 43 | Ga0070680_100125076 | 3300005336 | Bacteria | 2148 |
| 44 | Ga0070682_100249915 | 3300005337 | Bacteria | 1278 |
| 45 | Ga0068868_100005456 | 3300005338 | Bacteria | 8939 |
| 46 | Ga0068868_100112512 | 3300005338 | Bacteria | 2213 |
| 47 | Ga0070660_100000012 | 3300005339 | Bacteria | 123961 |
| 48 | Ga0070660_100000184 | 3300005339 | Bacteria | 41526 |
| 49 | Ga0070660_100001087 | 3300005339 | Bacteria | 18289 |
| 50 | Ga0070660_100014232 | 3300005339 | Bacteria | 5729 |
| 51 | Ga0070660_100026000 | 3300005339 | Bacteria | 4356 |
| 52 | Ga0070660_100088051 | 3300005339 | Bacteria | 2445 |
| 53 | Ga0070660_100118990 | 3300005339 | Bacteria | 2107 |
| 54 | Ga0070660_100264666 | 3300005339 | Bacteria | 1404 |
| 55 | Ga0070660_100288143 | 3300005339 | Bacteria | 1344 |
| 56 | Ga0070661_100000251 | 3300005344 | Bacteria | 44128 |
| 57 | Ga0070661_100010425 | 3300005344 | Bacteria | 6462 |
| 58 | Ga0070661_100093457 | 3300005344 | Bacteria | 2228 |
| 59 | Ga0070661_100113016 | 3300005344 | Bacteria | 2029 |
| 60 | Ga0070692_10001068 | 3300005345 | Bacteria | 9508 |
| 61 | Ga0070692_10003352 | 3300005345 | Bacteria | 6484 |
| 62 | Ga0070692_10053613 | 3300005345 | Bacteria | 2103 |
| 63 | Ga0070668_100280608 | 3300005347 | Bacteria | 1391 |
| 64 | Ga0070669_100000319 | 3300005353 | Bacteria | 37553 |
| 65 | Ga0070669_100104940 | 3300005353 | Bacteria | 2137 |
| 66 | Ga0070669_100130651 | 3300005353 | Bacteria | 1926 |
| 67 | Ga0070669_100210718 | 3300005353 | Bacteria | 1533 |
| 68 | Ga0070675_100000603 | 3300005354 | Bacteria | 24726 |
| 69 | Ga0070675_100004372 | 3300005354 | Bacteria | 10781 |
| 70 | Ga0070675_100008839 | 3300005354 | Bacteria | 7830 |
| 71 | Ga0070675_100079735 | 3300005354 | Bacteria | 2728 |
| 72 | Ga0070675_100270921 | 3300005354 | Bacteria | 1490 |
| 73 | Ga0070671_100000356 | 3300005355 | Bacteria | 31426 |
| 74 | Ga0070671_100000659 | 3300005355 | Bacteria | 24798 |
| 75 | Ga0070671_100001617 | 3300005355 | Bacteria | 16971 |
| 76 | Ga0070671_100026134 | 3300005355 | Bacteria | 4796 |
| 77 | Ga0070671_100042974 | 3300005355 | Bacteria | 3758 |
| 78 | Ga0070671_100047417 | 3300005355 | Bacteria | 3573 |
| 79 | Ga0070674_100076700 | 3300005356 | Bacteria | 2377 |
| 80 | Ga0070673_100000675 | 3300005364 | Bacteria | 18818 |
| 81 | Ga0070673_100009692 | 3300005364 | Bacteria | 6478 |
| 82 | Ga0070673_100072884 | 3300005364 | Bacteria | 2763 |
| 83 | Ga0070659_100000254 | 3300005366 | Bacteria | 42101 |
| 84 | Ga0070659_100001722 | 3300005366 | Bacteria | 15711 |
| 85 | Ga0070659_100004372 | 3300005366 | Bacteria | 10089 |
| 86 | Ga0070659_100008405 | 3300005366 | Bacteria | 7540 |
| 87 | Ga0070659_100016282 | 3300005366 | Bacteria | 5581 |
| 88 | Ga0070659_100022101 | 3300005366 | Bacteria | 4853 |
| 89 | Ga0070659_100118184 | 3300005366 | Bacteria | 2144 |
| 90 | Ga0070659_100214898 | 3300005366 | Bacteria | 1586 |
| 91 | Ga0070667_100004784 | 3300005367 | Bacteria | 11339 |
| 92 | Ga0070667_100022125 | 3300005367 | Bacteria | 5273 |
| 93 | Ga0070667_100060499 | 3300005367 | Bacteria | 3204 |
| 94 | Ga0070667_100304973 | 3300005367 | Bacteria | 1434 |
| 95 | Ga0070667_100452124 | 3300005367 | Bacteria | 1174 |
| 96 | Ga0070714_100033443 | 3300005435 | Bacteria | 4298 |
| 97 | Ga0070714_100033859 | 3300005435 | Bacteria | 4275 |
| 98 | Ga0070711_100063493 | 3300005439 | Bacteria | 2578 |
| 99 | Ga0070700_100296018 | 3300005441 | Bacteria | 1179 |
| 100 | Ga0070694_100087830 | 3300005444 | Bacteria | 2176 |
| 101 | Ga0070663_100000089 | 3300005455 | Bacteria | 41316 |
| 102 | Ga0070663_100011503 | 3300005455 | Bacteria | 5559 |
| 103 | Ga0070663_100021154 | 3300005455 | Bacteria | 4322 |
| 104 | Ga0070663_100028204 | 3300005455 | Bacteria | 3820 |
| 105 | Ga0070663_100050002 | 3300005455 | Bacteria | 2971 |
| 106 | Ga0070663_100152034 | 3300005455 | Bacteria | 1775 |
| 107 | Ga0070663_100188663 | 3300005455 | Bacteria | 1603 |
| 108 | Ga0070663_100362044 | 3300005455 | Bacteria | 1177 |
| 109 | Ga0070678_100054895 | 3300005456 | Bacteria | 2906 |
| 110 | Ga0070678_100097762 | 3300005456 | Bacteria | 2268 |
| 111 | Ga0070662_100000023 | 3300005457 | Bacteria | 91833 |
| 112 | Ga0070662_100000934 | 3300005457 | Bacteria | 17887 |
| 113 | Ga0070662_100005820 | 3300005457 | Bacteria | 7907 |
| 114 | Ga0070662_100022871 | 3300005457 | Bacteria | 4286 |
| 115 | Ga0070662_100022953 | 3300005457 | Bacteria | 4281 |
| 116 | Ga0070662_100049545 | 3300005457 | Bacteria | 3029 |
| 117 | Ga0070662_100062257 | 3300005457 | Bacteria | 2726 |
| 118 | Ga0070662_100115991 | 3300005457 | Bacteria | 2046 |
| 119 | Ga0070662_100198940 | 3300005457 | Bacteria | 1589 |
| 120 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 121 | Ga0070681_10109637 | 3300005458 | Bacteria | 2700 |
| 122 | Ga0070681_10128720 | 3300005458 | Bacteria | 2464 |
| 123 | Ga0070681_10205840 | 3300005458 | Bacteria | 1885 |
| 124 | Ga0070681_10408852 | 3300005458 | Bacteria | 1269 |
| 125 | Ga0068867_100003550 | 3300005459 | Bacteria | 10965 |
| 126 | Ga0068867_100222577 | 3300005459 | Bacteria | 1522 |
| 127 | Ga0070679_100000037 | 3300005530 | Bacteria | 100971 |
| 128 | Ga0070679_100015465 | 3300005530 | Bacteria | 7332 |
| 129 | Ga0070679_100086549 | 3300005530 | Bacteria | 3120 |
| 130 | Ga0070684_100165230 | 3300005535 | Bacteria | 2009 |
| 131 | Ga0068853_100000491 | 3300005539 | Bacteria | 26988 |
| 132 | Ga0068853_100002174 | 3300005539 | Bacteria | 14608 |
| 133 | Ga0068853_100015019 | 3300005539 | Bacteria | 6362 |
| 134 | Ga0068853_100025600 | 3300005539 | Bacteria | 4953 |
| 135 | Ga0068853_100445949 | 3300005539 | Bacteria | 1217 |
| 136 | Ga0070672_100024460 | 3300005543 | Bacteria | 4465 |
| 137 | Ga0070672_100027109 | 3300005543 | Bacteria | 4271 |
| 138 | Ga0070672_100056233 | 3300005543 | Bacteria | 3085 |
| 139 | Ga0070672_100086467 | 3300005543 | Bacteria | 2521 |
| 140 | Ga0070686_100000194 | 3300005544 | Bacteria | 42189 |
| 141 | Ga0070696_100006262 | 3300005546 | Bacteria | 7967 |
| 142 | Ga0070693_100001473 | 3300005547 | Bacteria | 10600 |
| 143 | Ga0070693_100087214 | 3300005547 | Bacteria | 1874 |
| 144 | Ga0070665_100000038 | 3300005548 | Bacteria | 309230 |
| 145 | Ga0070665_100029805 | 3300005548 | Bacteria | 5491 |
| 146 | Ga0070665_100159605 | 3300005548 | Bacteria | 2256 |
| 147 | Ga0068855_100000006 | 3300005563 | Bacteria | 298092 |
| 148 | Ga0068855_100000907 | 3300005563 | Bacteria | 36754 |
| 149 | Ga0068855_100003914 | 3300005563 | Bacteria | 18177 |
| 150 | Ga0068855_100010483 | 3300005563 | Bacteria | 11180 |
| 151 | Ga0068855_100063810 | 3300005563 | Bacteria | 4297 |
| 152 | Ga0068855_100075717 | 3300005563 | Bacteria | 3907 |
| 153 | Ga0068855_100124556 | 3300005563 | Bacteria | 2948 |
| 154 | Ga0070664_100000951 | 3300005564 | Bacteria | 22639 |
| 155 | Ga0070664_100001431 | 3300005564 | Bacteria | 19035 |
| 156 | Ga0070664_100003472 | 3300005564 | Bacteria | 12729 |
| 157 | Ga0070664_100005277 | 3300005564 | Bacteria | 10368 |
| 158 | Ga0070664_100016044 | 3300005564 | Bacteria | 6137 |
| 159 | Ga0070664_100046538 | 3300005564 | Bacteria | 3663 |
| 160 | Ga0070664_100111150 | 3300005564 | Bacteria | 2392 |
| 161 | Ga0070664_100137329 | 3300005564 | Bacteria | 2151 |
| 162 | Ga0070664_100328277 | 3300005564 | Bacteria | 1387 |
| 163 | Ga0068857_100000246 | 3300005577 | Bacteria | 36409 |
| 164 | Ga0068857_100027732 | 3300005577 | Bacteria | 4995 |
| 165 | Ga0068857_100108328 | 3300005577 | Bacteria | 2496 |
| 166 | Ga0068857_100178947 | 3300005577 | Bacteria | 1930 |
| 167 | Ga0068854_100000337 | 3300005578 | Bacteria | 30470 |
| 168 | Ga0068854_100004180 | 3300005578 | Bacteria | 9084 |
| 169 | Ga0068854_100063584 | 3300005578 | Bacteria | 2679 |
| 170 | Ga0068854_100180479 | 3300005578 | Bacteria | 1649 |
| 171 | Ga0068856_100000128 | 3300005614 | Bacteria | 76603 |
| 172 | Ga0068856_100011043 | 3300005614 | Bacteria | 8771 |
| 173 | Ga0068856_100038399 | 3300005614 | Bacteria | 4701 |
| 174 | Ga0068856_100186209 | 3300005614 | Bacteria | 2090 |
| 175 | Ga0068856_100261939 | 3300005614 | Bacteria | 1744 |
| 176 | Ga0068856_100342438 | 3300005614 | Bacteria | 1513 |
| 177 | Ga0068852_100004492 | 3300005616 | Bacteria | 9861 |
| 178 | Ga0068852_100004895 | 3300005616 | Bacteria | 9512 |
| 179 | Ga0068852_100012155 | 3300005616 | Bacteria | 6520 |
| 180 | Ga0068852_100020151 | 3300005616 | Bacteria | 5298 |
| 181 | Ga0068852_100030143 | 3300005616 | Bacteria | 4463 |
| 182 | Ga0068852_100044626 | 3300005616 | Bacteria | 3766 |
| 183 | Ga0068852_100081452 | 3300005616 | Bacteria | 2873 |
| 184 | Ga0068859_100026636 | 3300005617 | Bacteria | 5797 |
| 185 | Ga0068859_100041454 | 3300005617 | Bacteria | 4623 |
| 186 | Ga0068859_100068911 | 3300005617 | Bacteria | 3572 |
| 187 | Ga0068864_100000810 | 3300005618 | Bacteria | 26293 |
| 188 | Ga0068864_100031779 | 3300005618 | Bacteria | 4480 |
| 189 | Ga0068864_100080580 | 3300005618 | Bacteria | 2852 |
| 190 | Ga0068864_100188983 | 3300005618 | Bacteria | 1887 |
| 191 | Ga0068864_100208010 | 3300005618 | Bacteria | 1800 |
| 192 | Ga0068866_10089172 | 3300005718 | Bacteria | 1675 |
| 193 | Ga0068861_100020531 | 3300005719 | Bacteria | 4735 |
| 194 | Ga0068851_10007344 | 3300005834 | Bacteria | 5056 |
| 195 | Ga0068851_10039294 | 3300005834 | Bacteria | 2376 |
| 196 | Ga0068863_100011456 | 3300005841 | Bacteria | 8575 |
| 197 | Ga0068863_100014813 | 3300005841 | Bacteria | 7496 |
| 198 | Ga0068863_100083752 | 3300005841 | Bacteria | 3022 |
| 199 | Ga0068863_100122058 | 3300005841 | Bacteria | 2485 |
| 200 | Ga0068858_100001398 | 3300005842 | Bacteria | 24841 |
| 201 | Ga0068858_100028428 | 3300005842 | Bacteria | 5195 |
| 202 | Ga0068858_100090284 | 3300005842 | Bacteria | 2851 |
| 203 | Ga0068858_100196695 | 3300005842 | Bacteria | 1905 |
| 204 | Ga0068858_100246666 | 3300005842 | Bacteria | 1696 |
| 205 | Ga0068860_100008870 | 3300005843 | Bacteria | 10019 |
| 206 | Ga0068860_100042173 | 3300005843 | Bacteria | 4359 |
| 207 | Ga0068860_100248486 | 3300005843 | Bacteria | 1732 |
| 208 | Ga0068862_100012502 | 3300005844 | Bacteria | 7025 |
| 209 | Ga0068862_100104836 | 3300005844 | Bacteria | 2477 |
| 210 | Ga0081539_10015018 | 3300005985 | Bacteria | 5673 |
| 211 | Ga0070717_10002429 | 3300006028 | Bacteria | 13152 |
| 212 | Ga0097621_100163904 | 3300006237 | Unclassified | 1912 |
| 213 | Ga0068871_100039311 | 3300006358 | Bacteria | 3784 |
| 214 | Ga0068871_100059672 | 3300006358 | Bacteria | 3109 |
| 215 | Ga0068871_100071988 | 3300006358 | Bacteria | 2845 |
| 216 | Ga0068871_100096756 | 3300006358 | Bacteria | 2467 |
| 217 | Ga0068871_100112633 | 3300006358 | Bacteria | 2290 |
| 218 | Ga0068865_100000374 | 3300006881 | Bacteria | 24788 |
| 219 | Ga0068865_100029172 | 3300006881 | Bacteria | 3658 |
| 220 | Ga0097620_100026636 | 3300006931 | Bacteria | 5797 |
| 221 | Ga0097620_100041460 | 3300006931 | Bacteria | 4623 |
| 222 | Ga0097620_100068911 | 3300006931 | Bacteria | 3572 |
| 223 | Ga0105240_10000080 | 3300009093 | Bacteria | 195633 |
| 224 | Ga0105240_10042396 | 3300009093 | Bacteria | 5799 |
| 225 | Ga0105240_10142920 | 3300009093 | Bacteria | 2859 |
| 226 | Ga0105240_10328846 | 3300009093 | Bacteria | 1740 |
| 227 | Ga0111539_10426741 | 3300009094 | Bacteria | 1544 |
| 228 | Ga0105245_10000275 | 3300009098 | Bacteria | 48749 |
| 229 | Ga0105245_10147928 | 3300009098 | Bacteria | 2218 |
| 230 | Ga0114129_10482387 | 3300009147 | Bacteria | 1622 |
| 231 | Ga0105243_10097274 | 3300009148 | Bacteria | 2436 |
| 232 | Ga0105243_10098445 | 3300009148 | Bacteria | 2423 |
| 233 | Ga0105241_10025842 | 3300009174 | Bacteria | 4365 |
| 234 | Ga0105241_10043775 | 3300009174 | Bacteria | 3391 |
| 235 | Ga0105241_10068303 | 3300009174 | Bacteria | 2753 |
| 236 | Ga0105242_10048655 | 3300009176 | Bacteria | 3446 |
| 237 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 238 | Ga0105248_10000168 | 3300009177 | Bacteria | 76376 |
| 239 | Ga0105248_10017719 | 3300009177 | Bacteria | 7855 |
| 240 | Ga0105248_10029417 | 3300009177 | Bacteria | 6128 |
| 241 | Ga0105248_10050687 | 3300009177 | Bacteria | 4656 |
| 242 | Ga0105248_10051898 | 3300009177 | Bacteria | 4602 |
| 243 | Ga0105248_10093967 | 3300009177 | Bacteria | 3377 |
| 244 | Ga0105248_10270326 | 3300009177 | Bacteria | 1914 |
| 245 | Ga0105237_10044058 | 3300009545 | Bacteria | 4493 |
| 246 | Ga0105237_10067428 | 3300009545 | Bacteria | 3572 |
| 247 | Ga0105237_10092892 | 3300009545 | Bacteria | 3007 |
| 248 | Ga0105238_10006284 | 3300009551 | Bacteria | 11808 |
| 249 | Ga0105238_10009334 | 3300009551 | Bacteria | 9824 |
| 250 | Ga0105238_10033370 | 3300009551 | Bacteria | 5239 |
| 251 | Ga0105238_10105763 | 3300009551 | Bacteria | 2796 |
| 252 | Ga0105239_10000300 | 3300010375 | Bacteria | 73306 |
| 253 | Ga0105239_10003501 | 3300010375 | Bacteria | 19214 |
| 254 | Ga0105239_10070459 | 3300010375 | Bacteria | 3841 |
| 255 | Ga0157373_10033941 | 3300013100 | Bacteria | 3666 |
| 256 | Ga0157373_10047551 | 3300013100 | Bacteria | 3060 |
| 257 | Ga0157373_10061732 | 3300013100 | Bacteria | 2654 |
| 258 | Ga0157373_10100804 | 3300013100 | Bacteria | 2032 |
| 259 | Ga0157371_10000637 | 3300013102 | Bacteria | 41589 |
| 260 | Ga0157371_10000705 | 3300013102 | Bacteria | 39219 |
| 261 | Ga0157371_10000765 | 3300013102 | Bacteria | 37140 |
| 262 | Ga0157371_10015562 | 3300013102 | Bacteria | 5704 |
| 263 | Ga0157370_10023121 | 3300013104 | Bacteria | 6179 |
| 264 | Ga0157370_10102693 | 3300013104 | Bacteria | 2677 |
| 265 | Ga0157370_10115040 | 3300013104 | Bacteria | 2513 |
| 266 | Ga0157370_10215942 | 3300013104 | Bacteria | 1777 |
| 267 | Ga0157370_10721671 | 3300013104 | Bacteria | 909 |
| 268 | Ga0157369_10000553 | 3300013105 | Bacteria | 49107 |
| 269 | Ga0157369_10003259 | 3300013105 | Bacteria | 19324 |
| 270 | Ga0157369_10004144 | 3300013105 | Bacteria | 17177 |
| 271 | Ga0157369_10009186 | 3300013105 | Bacteria | 11312 |
| 272 | Ga0157369_10012679 | 3300013105 | Bacteria | 9559 |
| 273 | Ga0157369_10016020 | 3300013105 | Bacteria | 8437 |
| 274 | Ga0157369_10019337 | 3300013105 | Bacteria | 7620 |
| 275 | Ga0157369_10209745 | 3300013105 | Bacteria | 2042 |
| 276 | Ga0157374_10029566 | 3300013296 | Bacteria | 4964 |
| 277 | Ga0157374_10046825 | 3300013296 | Bacteria | 4007 |
| 278 | Ga0157374_10057287 | 3300013296 | Bacteria | 3640 |
| 279 | Ga0157378_10002341 | 3300013297 | Bacteria | 16827 |
| 280 | Ga0163162_10041315 | 3300013306 | Bacteria | 4614 |
| 281 | Ga0163162_10114624 | 3300013306 | Bacteria | 2795 |
| 282 | Ga0157372_10009318 | 3300013307 | Bacteria | 10443 |
| 283 | Ga0157372_10011503 | 3300013307 | Bacteria | 9411 |
| 284 | Ga0157372_10044309 | 3300013307 | Bacteria | 4929 |
| 285 | Ga0157372_10191366 | 3300013307 | Bacteria | 2370 |
| 286 | Ga0157372_10222507 | 3300013307 | Bacteria | 2188 |
| 287 | Ga0157372_10338003 | 3300013307 | Bacteria | 1754 |
| 288 | Ga0157372_10470850 | 3300013307 | Bacteria | 1464 |
| 289 | Ga0157375_10024591 | 3300013308 | Bacteria | 5577 |
| 290 | Ga0157375_10090811 | 3300013308 | Bacteria | 3114 |
| 291 | Ga0157375_10234854 | 3300013308 | Bacteria | 1993 |
| 292 | Ga0163163_10000151 | 3300014325 | Bacteria | 72496 |
| 293 | Ga0163163_10020309 | 3300014325 | Bacteria | 6252 |
| 294 | Ga0163163_10219782 | 3300014325 | Bacteria | 1948 |
| 295 | Ga0157380_10047066 | 3300014326 | Bacteria | 3390 |
| 296 | Ga0157379_10001085 | 3300014968 | Bacteria | 22205 |
| 297 | Ga0157379_10157663 | 3300014968 | Bacteria | 2048 |
| 298 | Ga0157376_10098265 | 3300014969 | Bacteria | 2552 |
| 299 | Ga0163161_10043603 | 3300017792 | Bacteria | 3230 |
| 300 | Ga0163161_10061084 | 3300017792 | Bacteria | 2743 |
| 301 | Ga0163161_10334649 | 3300017792 | Bacteria | 1200 |
| 302 | Ga0206354_10790246 | 3300020081 | Bacteria | 3652 |
| 303 | Ga0206353_11349930 | 3300020082 | Bacteria | 12700 |
| 304 | Ga0213873_10000008 | 3300021358 | Bacteria | 263363 |
| 305 | Ga0213874_10001849 | 3300021377 | Bacteria | 4449 |
| 306 | Ga0213874_10005538 | 3300021377 | Bacteria | 2946 |
| 307 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 308 | Ga0213876_10000613 | 3300021384 | Bacteria | 26322 |
| 309 | Ga0213876_10000690 | 3300021384 | Bacteria | 23786 |
| 310 | Ga0213876_10001060 | 3300021384 | Bacteria | 17750 |
| 311 | Ga0213876_10006225 | 3300021384 | Bacteria | 6512 |
| 312 | Ga0207697_10000112 | 3300025315 | Bacteria | 37791 |
| 313 | Ga0207697_10046664 | 3300025315 | Bacteria | 1785 |
| 314 | Ga0207656_10013006 | 3300025321 | Bacteria | 3172 |
| 315 | Ga0207682_10006022 | 3300025893 | Bacteria | 4904 |
| 316 | Ga0207682_10038635 | 3300025893 | Bacteria | 1937 |
| 317 | Ga0207682_10040071 | 3300025893 | Bacteria | 1907 |
| 318 | Ga0207642_10080653 | 3300025899 | Bacteria | 1579 |
| 319 | Ga0207642_10166195 | 3300025899 | Bacteria | 1189 |
| 320 | Ga0207680_10005882 | 3300025903 | Bacteria | 5891 |
| 321 | Ga0207680_10009163 | 3300025903 | Bacteria | 4893 |
| 322 | Ga0207647_10000101 | 3300025904 | Bacteria | 66258 |
| 323 | Ga0207647_10007269 | 3300025904 | Bacteria | 8015 |
| 324 | Ga0207647_10008288 | 3300025904 | Bacteria | 7458 |
| 325 | Ga0207647_10049733 | 3300025904 | Bacteria | 2599 |
| 326 | Ga0207645_10021817 | 3300025907 | Bacteria | 4171 |
| 327 | Ga0207645_10079400 | 3300025907 | Bacteria | 2103 |
| 328 | Ga0207645_10130488 | 3300025907 | Bacteria | 1635 |
| 329 | Ga0207643_10058822 | 3300025908 | Bacteria | 2192 |
| 330 | Ga0207705_10000050 | 3300025909 | Bacteria | 170078 |
| 331 | Ga0207705_10000060 | 3300025909 | Bacteria | 152576 |
| 332 | Ga0207705_10000274 | 3300025909 | Bacteria | 49320 |
| 333 | Ga0207705_10004174 | 3300025909 | Bacteria | 10960 |
| 334 | Ga0207705_10012399 | 3300025909 | Bacteria | 6159 |
| 335 | Ga0207705_10018504 | 3300025909 | Bacteria | 4980 |
| 336 | Ga0207705_10020161 | 3300025909 | Bacteria | 4769 |
| 337 | Ga0207705_10020570 | 3300025909 | Bacteria | 4713 |
| 338 | Ga0207705_10023256 | 3300025909 | Bacteria | 4422 |
| 339 | Ga0207705_10056246 | 3300025909 | Bacteria | 2836 |
| 340 | Ga0207654_10008443 | 3300025911 | Bacteria | 5208 |
| 341 | Ga0207654_10022070 | 3300025911 | Bacteria | 3391 |
| 342 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 343 | Ga0207707_10001960 | 3300025912 | Bacteria | 18707 |
| 344 | Ga0207707_10055094 | 3300025912 | Bacteria | 3460 |
| 345 | Ga0207707_10154428 | 3300025912 | Bacteria | 2007 |
| 346 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 347 | Ga0207695_10003088 | 3300025913 | Bacteria | 23842 |
| 348 | Ga0207671_10059259 | 3300025914 | Bacteria | 2839 |
| 349 | Ga0207671_10292514 | 3300025914 | Bacteria | 1286 |
| 350 | Ga0207663_10106260 | 3300025916 | Bacteria | 1897 |
| 351 | Ga0207660_10000029 | 3300025917 | Bacteria | 67115 |
| 352 | Ga0207660_10001572 | 3300025917 | Bacteria | 15311 |
| 353 | Ga0207660_10036898 | 3300025917 | Bacteria | 3401 |
| 354 | Ga0207662_10160548 | 3300025918 | Bacteria | 1436 |
| 355 | Ga0207657_10000038 | 3300025919 | Bacteria | 123940 |
| 356 | Ga0207657_10000210 | 3300025919 | Bacteria | 60425 |
| 357 | Ga0207657_10000301 | 3300025919 | Bacteria | 52361 |
| 358 | Ga0207657_10000543 | 3300025919 | Bacteria | 40303 |
| 359 | Ga0207657_10001185 | 3300025919 | Bacteria | 27703 |
| 360 | Ga0207657_10003350 | 3300025919 | Bacteria | 17139 |
| 361 | Ga0207657_10005535 | 3300025919 | Bacteria | 13186 |
| 362 | Ga0207657_10008443 | 3300025919 | Bacteria | 10448 |
| 363 | Ga0207657_10020141 | 3300025919 | Bacteria | 6312 |
| 364 | Ga0207657_10022376 | 3300025919 | Bacteria | 5916 |
| 365 | Ga0207657_10030396 | 3300025919 | Bacteria | 4903 |
| 366 | Ga0207657_10035936 | 3300025919 | Bacteria | 4438 |
| 367 | Ga0207657_10048813 | 3300025919 | Bacteria | 3694 |
| 368 | Ga0207657_10101526 | 3300025919 | Bacteria | 2387 |
| 369 | Ga0207657_10122573 | 3300025919 | Bacteria | 2138 |
| 370 | Ga0207649_10000826 | 3300025920 | Bacteria | 19904 |
| 371 | Ga0207649_10003264 | 3300025920 | Bacteria | 8874 |
| 372 | Ga0207649_10008313 | 3300025920 | Bacteria | 5656 |
| 373 | Ga0207649_10072670 | 3300025920 | Bacteria | 2201 |
| 374 | Ga0207649_10138628 | 3300025920 | Bacteria | 1661 |
| 375 | Ga0207649_10143278 | 3300025920 | Bacteria | 1638 |
| 376 | Ga0207649_10201601 | 3300025920 | Bacteria | 1406 |
| 377 | Ga0207652_10000190 | 3300025921 | Bacteria | 64841 |
| 378 | Ga0207652_10006721 | 3300025921 | Bacteria | 9268 |
| 379 | Ga0207652_10120543 | 3300025921 | Bacteria | 2333 |
| 380 | Ga0207652_10167716 | 3300025921 | Bacteria | 1969 |
| 381 | Ga0207681_10001255 | 3300025923 | Bacteria | 16359 |
| 382 | Ga0207681_10046810 | 3300025923 | Bacteria | 2910 |
| 383 | Ga0207681_10052122 | 3300025923 | Bacteria | 2774 |
| 384 | Ga0207694_10000014 | 3300025924 | Bacteria | 374435 |
| 385 | Ga0207694_10024885 | 3300025924 | Bacteria | 4547 |
| 386 | Ga0207694_10027420 | 3300025924 | Bacteria | 4338 |
| 387 | Ga0207650_10002447 | 3300025925 | Bacteria | 12930 |
| 388 | Ga0207650_10019995 | 3300025925 | Bacteria | 4715 |
| 389 | Ga0207650_10027155 | 3300025925 | Bacteria | 4094 |
| 390 | Ga0207650_10033921 | 3300025925 | Bacteria | 3700 |
| 391 | Ga0207650_10085683 | 3300025925 | Bacteria | 2397 |
| 392 | Ga0207650_10175154 | 3300025925 | Bacteria | 1707 |
| 393 | Ga0207659_10002669 | 3300025926 | Bacteria | 10632 |
| 394 | Ga0207659_10049227 | 3300025926 | Bacteria | 2988 |
| 395 | Ga0207659_10087823 | 3300025926 | Bacteria | 2315 |
| 396 | Ga0207659_10230410 | 3300025926 | Bacteria | 1494 |
| 397 | Ga0207687_10001375 | 3300025927 | Bacteria | 16604 |
| 398 | Ga0207687_10029658 | 3300025927 | Bacteria | 3681 |
| 399 | Ga0207664_10021997 | 3300025929 | Bacteria | 4753 |
| 400 | Ga0207664_10155231 | 3300025929 | Bacteria | 1948 |
| 401 | Ga0207644_10006246 | 3300025931 | Bacteria | 7764 |
| 402 | Ga0207644_10008084 | 3300025931 | Bacteria | 6886 |
| 403 | Ga0207644_10019570 | 3300025931 | Bacteria | 4593 |
| 404 | Ga0207644_10024637 | 3300025931 | Bacteria | 4132 |
| 405 | Ga0207644_10070024 | 3300025931 | Bacteria | 2562 |
| 406 | Ga0207644_10108199 | 3300025931 | Bacteria | 2098 |
| 407 | Ga0207644_10244357 | 3300025931 | Bacteria | 1430 |
| 408 | Ga0207690_10000149 | 3300025932 | Bacteria | 55374 |
| 409 | Ga0207690_10000830 | 3300025932 | Bacteria | 19806 |
| 410 | Ga0207690_10003045 | 3300025932 | Bacteria | 10097 |
| 411 | Ga0207690_10051616 | 3300025932 | Bacteria | 2751 |
| 412 | Ga0207690_10069801 | 3300025932 | Bacteria | 2418 |
| 413 | Ga0207706_10000061 | 3300025933 | Bacteria | 109447 |
| 414 | Ga0207706_10000318 | 3300025933 | Bacteria | 52104 |
| 415 | Ga0207706_10000675 | 3300025933 | Bacteria | 35813 |
| 416 | Ga0207706_10001971 | 3300025933 | Bacteria | 20129 |
| 417 | Ga0207706_10023055 | 3300025933 | Bacteria | 5591 |
| 418 | Ga0207706_10030488 | 3300025933 | Bacteria | 4810 |
| 419 | Ga0207706_10031942 | 3300025933 | Bacteria | 4690 |
| 420 | Ga0207706_10033822 | 3300025933 | Bacteria | 4549 |
| 421 | Ga0207706_10049774 | 3300025933 | Bacteria | 3702 |
| 422 | Ga0207706_10076561 | 3300025933 | Bacteria | 2942 |
| 423 | Ga0207706_10392287 | 3300025933 | Bacteria | 1204 |
| 424 | Ga0207686_10006977 | 3300025934 | Bacteria | 6078 |
| 425 | Ga0207704_10014755 | 3300025938 | Bacteria | 3957 |
| 426 | Ga0207704_10019113 | 3300025938 | Bacteria | 3592 |
| 427 | Ga0207665_10054385 | 3300025939 | Bacteria | 2699 |
| 428 | Ga0207691_10000593 | 3300025940 | Bacteria | 36106 |
| 429 | Ga0207691_10005337 | 3300025940 | Bacteria | 12408 |
| 430 | Ga0207691_10042460 | 3300025940 | Bacteria | 4192 |
| 431 | Ga0207691_10075765 | 3300025940 | Bacteria | 3033 |
| 432 | Ga0207691_10102686 | 3300025940 | Bacteria | 2550 |
| 433 | Ga0207691_10108516 | 3300025940 | Bacteria | 2470 |
| 434 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 435 | Ga0207711_10001606 | 3300025941 | Bacteria | 20889 |
| 436 | Ga0207711_10003620 | 3300025941 | Bacteria | 13367 |
| 437 | Ga0207711_10008250 | 3300025941 | Bacteria | 8723 |
| 438 | Ga0207711_10011871 | 3300025941 | Bacteria | 7240 |
| 439 | Ga0207711_10013967 | 3300025941 | Bacteria | 6671 |
| 440 | Ga0207711_10101095 | 3300025941 | Bacteria | 2551 |
| 441 | Ga0207689_10000016 | 3300025942 | Bacteria | 118140 |
| 442 | Ga0207661_10005095 | 3300025944 | Bacteria | 9221 |
| 443 | Ga0207661_10042830 | 3300025944 | Bacteria | 3571 |
| 444 | Ga0207679_10009735 | 3300025945 | Bacteria | 6165 |
| 445 | Ga0207679_10017177 | 3300025945 | Bacteria | 4820 |
| 446 | Ga0207679_10028236 | 3300025945 | Bacteria | 3890 |
| 447 | Ga0207679_10093663 | 3300025945 | Bacteria | 2330 |
| 448 | Ga0207679_10279840 | 3300025945 | Bacteria | 1430 |
| 449 | Ga0207667_10000051 | 3300025949 | Bacteria | 233836 |
| 450 | Ga0207667_10000327 | 3300025949 | Bacteria | 66205 |
| 451 | Ga0207667_10006609 | 3300025949 | Bacteria | 14018 |
| 452 | Ga0207667_10020597 | 3300025949 | Bacteria | 7329 |
| 453 | Ga0207667_10036525 | 3300025949 | Bacteria | 5265 |
| 454 | Ga0207667_10058591 | 3300025949 | Bacteria | 4038 |
| 455 | Ga0207667_10168865 | 3300025949 | Bacteria | 2249 |
| 456 | Ga0207667_10196794 | 3300025949 | Bacteria | 2068 |
| 457 | Ga0207667_10206345 | 3300025949 | Bacteria | 2015 |
| 458 | Ga0207651_10000500 | 3300025960 | Bacteria | 16461 |
| 459 | Ga0207651_10012043 | 3300025960 | Bacteria | 4872 |
| 460 | Ga0207668_10131930 | 3300025972 | Bacteria | 1909 |
| 461 | Ga0207640_10000668 | 3300025981 | Bacteria | 20054 |
| 462 | Ga0207640_10002516 | 3300025981 | Bacteria | 9826 |
| 463 | Ga0207640_10056924 | 3300025981 | Bacteria | 2569 |
| 464 | Ga0207640_10087960 | 3300025981 | Bacteria | 2143 |
| 465 | Ga0207640_10093582 | 3300025981 | Bacteria | 2088 |
| 466 | Ga0207640_10130643 | 3300025981 | Bacteria | 1815 |
| 467 | Ga0207640_10148347 | 3300025981 | Bacteria | 1720 |
| 468 | Ga0207658_10005506 | 3300025986 | Bacteria | 8680 |
| 469 | Ga0207658_10029888 | 3300025986 | Bacteria | 3853 |
| 470 | Ga0207658_10072673 | 3300025986 | Bacteria | 2608 |
| 471 | Ga0207677_10001192 | 3300026023 | Bacteria | 14092 |
| 472 | Ga0207677_10078027 | 3300026023 | Bacteria | 2364 |
| 473 | Ga0207703_10003151 | 3300026035 | Bacteria | 13916 |
| 474 | Ga0207703_10047376 | 3300026035 | Bacteria | 3465 |
| 475 | Ga0207703_10077075 | 3300026035 | Bacteria | 2767 |
| 476 | Ga0207639_10003483 | 3300026041 | Bacteria | 10593 |
| 477 | Ga0207639_10004735 | 3300026041 | Bacteria | 9165 |
| 478 | Ga0207639_10005405 | 3300026041 | Bacteria | 8640 |
| 479 | Ga0207639_10012930 | 3300026041 | Bacteria | 5822 |
| 480 | Ga0207639_10017987 | 3300026041 | Bacteria | 5014 |
| 481 | Ga0207639_10234789 | 3300026041 | Bacteria | 1592 |
| 482 | Ga0207678_10001868 | 3300026067 | Bacteria | 19215 |
| 483 | Ga0207678_10002362 | 3300026067 | Bacteria | 17108 |
| 484 | Ga0207678_10003447 | 3300026067 | Bacteria | 14247 |
| 485 | Ga0207678_10012117 | 3300026067 | Bacteria | 7572 |
| 486 | Ga0207678_10025662 | 3300026067 | Bacteria | 5144 |
| 487 | Ga0207678_10031207 | 3300026067 | Bacteria | 4649 |
| 488 | Ga0207678_10031537 | 3300026067 | Bacteria | 4623 |
| 489 | Ga0207678_10040503 | 3300026067 | Bacteria | 4040 |
| 490 | Ga0207678_10177641 | 3300026067 | Bacteria | 1818 |
| 491 | Ga0207702_10000323 | 3300026078 | Bacteria | 54764 |
| 492 | Ga0207702_10007957 | 3300026078 | Bacteria | 8982 |
| 493 | Ga0207702_10017016 | 3300026078 | Bacteria | 6017 |
| 494 | Ga0207702_10337392 | 3300026078 | Bacteria | 1439 |
| 495 | Ga0207641_10010383 | 3300026088 | Bacteria | 7655 |
| 496 | Ga0207641_10017437 | 3300026088 | Bacteria | 5878 |
| 497 | Ga0207641_10217422 | 3300026088 | Bacteria | 1770 |
| 498 | Ga0207648_10007206 | 3300026089 | Bacteria | 10966 |
| 499 | Ga0207676_10001961 | 3300026095 | Bacteria | 14987 |
| 500 | Ga0207676_10025146 | 3300026095 | Bacteria | 4416 |
| 501 | Ga0207676_10030880 | 3300026095 | Bacteria | 4025 |
| 502 | Ga0207676_10097809 | 3300026095 | Bacteria | 2425 |
| 503 | Ga0207676_10134383 | 3300026095 | Bacteria | 2108 |
| 504 | Ga0207674_10000114 | 3300026116 | Bacteria | 93676 |
| 505 | Ga0207674_10003420 | 3300026116 | Bacteria | 19432 |
| 506 | Ga0207674_10038316 | 3300026116 | Bacteria | 4977 |
| 507 | Ga0207674_10069778 | 3300026116 | Bacteria | 3534 |
| 508 | Ga0207674_10073446 | 3300026116 | Bacteria | 3434 |
| 509 | Ga0207675_100085879 | 3300026118 | Bacteria | 2954 |
| 510 | Ga0207675_100087559 | 3300026118 | Bacteria | 2925 |
| 511 | Ga0207683_10035193 | 3300026121 | Bacteria | 4355 |
| 512 | Ga0207683_10073276 | 3300026121 | Bacteria | 3029 |
| 513 | Ga0207698_10004921 | 3300026142 | Bacteria | 8190 |
| 514 | Ga0207698_10006034 | 3300026142 | Bacteria | 7533 |
| 515 | Ga0207698_10019087 | 3300026142 | Bacteria | 4685 |
| 516 | Ga0207698_10035723 | 3300026142 | Bacteria | 3639 |
| 517 | Ga0207698_10073286 | 3300026142 | Bacteria | 2726 |
| 518 | Ga0207698_10091421 | 3300026142 | Bacteria | 2491 |
| 519 | Ga0207698_10339995 | 3300026142 | Bacteria | 1413 |
| 520 | Ga0268266_10000118 | 3300028379 | Bacteria | 163466 |
| 521 | Ga0268266_10002147 | 3300028379 | Bacteria | 21684 |
| 522 | Ga0268266_10021267 | 3300028379 | Bacteria | 5527 |
| 523 | Ga0268266_10150457 | 3300028379 | Bacteria | 2097 |
| 524 | Ga0268265_10005379 | 3300028380 | Bacteria | 8767 |
| 525 | Ga0268265_10040259 | 3300028380 | Bacteria | 3451 |
| 526 | Ga0265318_10000017 | 3300028577 | Bacteria | 174748 |
| 527 | Ga0265338_10000007 | 3300028800 | Bacteria | 498229 |
| 528 | Ga0265325_10000001 | 3300031241 | Bacteria | 726814 |
| 529 | Ga0265329_10024903 | 3300031242 | Bacteria | 1983 |
| 530 | Ga0265339_10000769 | 3300031249 | Bacteria | 24846 |
| 531 | Ga0265331_10011069 | 3300031250 | Bacteria | 4949 |
| 532 | Ga0307408_100003245 | 3300031548 | Bacteria | 11190 |
| 533 | Ga0307408_100072666 | 3300031548 | Bacteria | 2547 |
| 534 | Ga0307408_100200373 | 3300031548 | Bacteria | 1615 |
| 535 | Ga0307408_100222018 | 3300031548 | Bacteria | 1542 |
| 536 | Ga0307408_100258195 | 3300031548 | Bacteria | 1441 |
| 537 | Ga0265313_10002115 | 3300031595 | Bacteria | 17679 |
| 538 | Ga0265314_10008637 | 3300031711 | Bacteria | 8714 |
| 539 | Ga0265314_10015067 | 3300031711 | Bacteria | 6150 |
| 540 | Ga0265342_10047385 | 3300031712 | Bacteria | 2579 |
| 541 | Ga0307405_10004008 | 3300031731 | Bacteria | 6904 |
| 542 | Ga0307413_10001065 | 3300031824 | Bacteria | 9979 |
| 543 | Ga0307413_10002155 | 3300031824 | Bacteria | 7907 |
| 544 | Ga0307413_10003599 | 3300031824 | Bacteria | 6564 |
| 545 | Ga0307413_10011026 | 3300031824 | Bacteria | 4420 |
| 546 | Ga0307413_10027746 | 3300031824 | Bacteria | 3143 |
| 547 | Ga0307410_10000440 | 3300031852 | Bacteria | 16660 |
| 548 | Ga0307410_10016223 | 3300031852 | Bacteria | 4437 |
| 549 | Ga0307410_10027400 | 3300031852 | Bacteria | 3601 |
| 550 | Ga0307410_10031443 | 3300031852 | Bacteria | 3406 |
| 551 | Ga0307410_10045602 | 3300031852 | Bacteria | 2920 |
| 552 | Ga0307410_10069236 | 3300031852 | Bacteria | 2440 |
| 553 | Ga0307410_10086714 | 3300031852 | Bacteria | 2212 |
| 554 | Ga0307410_10148273 | 3300031852 | Bacteria | 1743 |
| 555 | Ga0307406_10006909 | 3300031901 | Bacteria | 6287 |
| 556 | Ga0307406_10029115 | 3300031901 | Bacteria | 3342 |
| 557 | Ga0307406_10143013 | 3300031901 | Bacteria | 1696 |
| 558 | Ga0307406_10253894 | 3300031901 | Bacteria | 1326 |
| 559 | Ga0307407_10001159 | 3300031903 | Bacteria | 9255 |
| 560 | Ga0307407_10001328 | 3300031903 | Bacteria | 8855 |
| 561 | Ga0307407_10006912 | 3300031903 | Bacteria | 5096 |
| 562 | Ga0307407_10109429 | 3300031903 | Bacteria | 1732 |
| 563 | Ga0307407_10123466 | 3300031903 | Bacteria | 1645 |
| 564 | Ga0307412_10009692 | 3300031911 | Bacteria | 5531 |
| 565 | Ga0307412_10017391 | 3300031911 | Bacteria | 4304 |
| 566 | Ga0307412_10044131 | 3300031911 | Bacteria | 2908 |
| 567 | Ga0307409_100000982 | 3300031995 | Bacteria | 13335 |
| 568 | Ga0307409_100001176 | 3300031995 | Bacteria | 12507 |
| 569 | Ga0307409_100002347 | 3300031995 | Bacteria | 9838 |
| 570 | Ga0307409_100020403 | 3300031995 | Bacteria | 4515 |
| 571 | Ga0307409_100074360 | 3300031995 | Bacteria | 2715 |
| 572 | Ga0307409_100084490 | 3300031995 | Bacteria | 2577 |
| 573 | Ga0307416_100010539 | 3300032002 | Bacteria | 6111 |
| 574 | Ga0307416_100035230 | 3300032002 | Bacteria | 3820 |
| 575 | Ga0307416_100100138 | 3300032002 | Bacteria | 2519 |
| 576 | Ga0307416_100124621 | 3300032002 | Bacteria | 2305 |
| 577 | Ga0307416_100132452 | 3300032002 | Bacteria | 2247 |
| 578 | Ga0307416_100140149 | 3300032002 | Bacteria | 2196 |
| 579 | Ga0307414_10002980 | 3300032004 | Bacteria | 8963 |
| 580 | Ga0307414_10004745 | 3300032004 | Bacteria | 7420 |
| 581 | Ga0307414_10023014 | 3300032004 | Bacteria | 3942 |
| 582 | Ga0307414_10031315 | 3300032004 | Bacteria | 3488 |
| 583 | Ga0307414_10124028 | 3300032004 | Bacteria | 1992 |
| 584 | Ga0307411_10001476 | 3300032005 | Bacteria | 9660 |
| 585 | Ga0307411_10002611 | 3300032005 | Bacteria | 8056 |
| 586 | Ga0307411_10005035 | 3300032005 | Bacteria | 6429 |
| 587 | Ga0307411_10013394 | 3300032005 | Bacteria | 4524 |
| 588 | Ga0307411_10025193 | 3300032005 | Bacteria | 3560 |
| 589 | Ga0307411_10117202 | 3300032005 | Bacteria | 1918 |
| 590 | Ga0307411_10210960 | 3300032005 | Bacteria | 1499 |
| 591 | Ga0307411_10361126 | 3300032005 | Bacteria | 1188 |
| 592 | Ga0307415_100005212 | 3300032126 | Bacteria | 6870 |
| 593 | Ga0307415_100009537 | 3300032126 | Bacteria | 5448 |
| 594 | Ga0307415_100015237 | 3300032126 | Bacteria | 4545 |
| 595 | Ga0307415_100024724 | 3300032126 | Bacteria | 3757 |
| 596 | Ga0307415_100242859 | 3300032126 | Bacteria | 1458 |
| 597 | Ga0373954_0034286 | 3300035118 | Bacteria | 2351 |
| 598 | Ga0373955_0001138 | 3300035172 | Bacteria | 11284 |
| 599 | Ga0373931_0014195 | 3300035691 | Bacteria | 3890 |
| 600 | Ga0373935_0005979 | 3300035692 | Bacteria | 7223 |
| 601 | Ga0373927_0174894 | 3300035695 | Bacteria | 1408 |
| 602 | Ga0373947_0006172 | 3300035725 | Bacteria | 6970 |
| 603 | Ga0373947_0082289 | 3300035725 | Bacteria | 1995 |
| 604 | Ga0373925_0009801 | 3300037068 | Bacteria | 6955 |
| 605 | Ga0373925_0023221 | 3300037068 | Bacteria | 4526 |
| 606 | Ga0395899_0000258 | 3300037312 | Bacteria | 69644 |
| 607 | Ga0395899_0000756 | 3300037312 | Bacteria | 32002 |
| 608 | Ga0395899_0014976 | 3300037312 | Bacteria | 5915 |
| 609 | Ga0395899_0018801 | 3300037312 | Bacteria | 5250 |
| 610 | Ga0395899_0041621 | 3300037312 | Bacteria | 3432 |
| 611 | Ga0395899_0042901 | 3300037312 | Bacteria | 3375 |
| 612 | Ga0395899_0083978 | 3300037312 | Bacteria | 2315 |
| 613 | Ga0395899_0147345 | 3300037312 | Bacteria | 1670 |
| 614 | Ga0395900_0000254 | 3300037418 | Bacteria | 83296 |
| 615 | Ga0395900_0007133 | 3300037418 | Bacteria | 11578 |
| 616 | Ga0395900_0008644 | 3300037418 | Bacteria | 10464 |
| 617 | Ga0395900_0009104 | 3300037418 | Bacteria | 10173 |
| 618 | Ga0395900_0011097 | 3300037418 | Bacteria | 9208 |
| 619 | Ga0395900_0013457 | 3300037418 | Bacteria | 8359 |
| 620 | Ga0395900_0018682 | 3300037418 | Bacteria | 7069 |
| 621 | Ga0395900_0025252 | 3300037418 | Bacteria | 6082 |
| 622 | Ga0395900_0029639 | 3300037418 | Bacteria | 5614 |
| 623 | Ga0395900_0043697 | 3300037418 | Bacteria | 4619 |
| 624 | Ga0395900_0061786 | 3300037418 | Bacteria | 3851 |
| 625 | Ga0395900_0062981 | 3300037418 | Bacteria | 3812 |
| 626 | Ga0395900_0067482 | 3300037418 | Bacteria | 3674 |
| 627 | Ga0395900_0094714 | 3300037418 | Bacteria | 3067 |
| 628 | Ga0395900_0160998 | 3300037418 | Bacteria | 2289 |
| 629 | Ga0395900_0308400 | 3300037418 | Bacteria | 1566 |
| 630 | Ga0395900_0328359 | 3300037418 | Unclassified | 1508 |
| 631 | Ga0395900_0394911 | 3300037418 | Bacteria | 1348 |
| 632 | Ga0395900_0428833 | 3300037418 | Bacteria | 1282 |
| 633 | Ga0395900_0589267 | 3300037418 | Bacteria | 1053 |
| 634 | Ga0395898_0019198 | 3300037466 | Bacteria | 6959 |
| 635 | Ga0395898_0026343 | 3300037466 | Bacteria | 5853 |
| 636 | Ga0395898_0027557 | 3300037466 | Bacteria | 5701 |
| 637 | Ga0395898_0037633 | 3300037466 | Bacteria | 4798 |
| 638 | Ga0395898_0040032 | 3300037466 | Bacteria | 4637 |
| 639 | Ga0395898_0081811 | 3300037466 | Bacteria | 3113 |
| 640 | Ga0395898_0087537 | 3300037466 | Bacteria | 3000 |
| 641 | Ga0395898_0229502 | 3300037466 | Bacteria | 1770 |
| 642 | Ga0395898_0271871 | 3300037466 | Bacteria | 1616 |
| 643 | Ga0395898_0275711 | 3300037466 | Bacteria | 1604 |
| 644 | Ga0395898_0352878 | 3300037466 | Bacteria | 1402 |
| 645 | Ga0395905_0001268 | 3300037471 | Bacteria | 31200 |
| 646 | Ga0395905_0002525 | 3300037471 | Bacteria | 20191 |
| 647 | Ga0395905_0003297 | 3300037471 | Bacteria | 17333 |
| 648 | Ga0395905_0007050 | 3300037471 | Bacteria | 11234 |
| 649 | Ga0395905_0009508 | 3300037471 | Bacteria | 9498 |
| 650 | Ga0395905_0011492 | 3300037471 | Bacteria | 8555 |
| 651 | Ga0395905_0013797 | 3300037471 | Bacteria | 7732 |
| 652 | Ga0395905_0013981 | 3300037471 | Bacteria | 7679 |
| 653 | Ga0395905_0016148 | 3300037471 | Bacteria | 7097 |
| 654 | Ga0395905_0020800 | 3300037471 | Bacteria | 6213 |
| 655 | Ga0395905_0027698 | 3300037471 | Bacteria | 5344 |
| 656 | Ga0395905_0029744 | 3300037471 | Bacteria | 5148 |
| 657 | Ga0395905_0039070 | 3300037471 | Bacteria | 4452 |
| 658 | Ga0395905_0051336 | 3300037471 | Bacteria | 3862 |
| 659 | Ga0395905_0051994 | 3300037471 | Bacteria | 3837 |
| 660 | Ga0395905_0062151 | 3300037471 | Bacteria | 3493 |
| 661 | Ga0395905_0068691 | 3300037471 | Bacteria | 3319 |
| 662 | Ga0395905_0110604 | 3300037471 | Bacteria | 2580 |
| 663 | Ga0395905_0111048 | 3300037471 | Bacteria | 2574 |
| 664 | Ga0395905_0134746 | 3300037471 | Unclassified | 2323 |
| 665 | Ga0395905_0143265 | 3300037471 | Bacteria | 2248 |
| 666 | Ga0395905_0195512 | 3300037471 | Bacteria | 1896 |
| 667 | Ga0395905_0205182 | 3300037471 | Bacteria | 1847 |
| 668 | Ga0395905_0238348 | 3300037471 | Bacteria | 1700 |
| 669 | Ga0436364_1113588 | 3300037853 | Bacteria | 2029 |
| 670 | Ga0395901_0000030 | 3300038443 | Bacteria | 241916 |
| 671 | Ga0395901_0004476 | 3300038443 | Bacteria | 14099 |
| 672 | Ga0395901_0012481 | 3300038443 | Bacteria | 8621 |
| 673 | Ga0395901_0014222 | 3300038443 | Bacteria | 8102 |
| 674 | Ga0395901_0019013 | 3300038443 | Bacteria | 7023 |
| 675 | Ga0395901_0019472 | 3300038443 | Bacteria | 6940 |
| 676 | Ga0395901_0022957 | 3300038443 | Bacteria | 6395 |
| 677 | Ga0395901_0027336 | 3300038443 | Bacteria | 5860 |
| 678 | Ga0395901_0040197 | 3300038443 | Bacteria | 4843 |
| 679 | Ga0395901_0046352 | 3300038443 | Bacteria | 4515 |
| 680 | Ga0395901_0047640 | 3300038443 | Bacteria | 4450 |
| 681 | Ga0395901_0067486 | 3300038443 | Bacteria | 3725 |
| 682 | Ga0395901_0073961 | 3300038443 | Bacteria | 3555 |
| 683 | Ga0395901_0077000 | 3300038443 | Bacteria | 3481 |
| 684 | Ga0395901_0078597 | 3300038443 | Bacteria | 3444 |
| 685 | Ga0395901_0100497 | 3300038443 | Bacteria | 3034 |
| 686 | Ga0395901_0135498 | 3300038443 | Bacteria | 2588 |
| 687 | Ga0395901_0147233 | 3300038443 | Bacteria | 2475 |
| 688 | Ga0395901_0151992 | 3300038443 | Bacteria | 2432 |
| 689 | Ga0395901_0155955 | 3300038443 | Bacteria | 2398 |
| 690 | Ga0395901_0184853 | 3300038443 | Bacteria | 2186 |
| 691 | Ga0395901_0298533 | 3300038443 | Bacteria | 1670 |
| 692 | Ga0436365_0126786 | 3300039437 | Bacteria | 6071 |
| 693 | Ga0436365_1104251 | 3300039437 | Bacteria | 95104 |
| 694 | Ga0436365_1355541 | 3300039437 | Bacteria | 7967 |
| 695 | Ga0436365_1476024 | 3300039437 | Bacteria | 12711 |
| 696 | Ga0436365_1579660 | 3300039437 | Bacteria | 78435 |
| 697 | Ga0436365_1812310 | 3300039437 | Bacteria | 1479 |
| 698 | Ga0436365_1867062 | 3300039437 | Bacteria | 44331 |
| 699 | Ga0436361_0468825 | 3300039447 | Bacteria | 2530 |
| 700 | Ga0436361_1207323 | 3300039447 | Bacteria | 1525 |
| 701 | Ga0436363_0458213 | 3300039450 | Bacteria | 4699 |
| 702 | Ga0436363_0750735 | 3300039450 | Bacteria | 2928 |
| 703 | Ga0436363_1226947 | 3300039450 | Bacteria | 1450 |
| 704 | Ga0436362_0368701 | 3300039453 | Bacteria | 10447 |
| 705 | Ga0439448_0020723 | 3300042005 | Bacteria | 2037 |
| 706 | Ga0439449_0041385 | 3300042007 | Bacteria | 1713 |
| 707 | Ga0439455_0006806 | 3300042012 | Bacteria | 2391 |
| 708 | Ga0450912_000426 | 3300042116 | Bacteria | 2035 |
| 709 | Ga0450889_001175 | 3300042144 | Bacteria | 2725 |
| 710 | Ga0439458_0000217 | 3300042157 | Bacteria | 13567 |
| 711 | Ga0466969_0011487 | 3300044656 | Bacteria | 4688 |
| 712 | Ga0466969_0074562 | 3300044656 | Unclassified | 1627 |
| 713 | Ga0466969_0080013 | 3300044656 | Bacteria | 1561 |
| 714 | Ga0466966_0000040 | 3300044684 | Bacteria | 97159 |
| 715 | Ga0466966_0004335 | 3300044684 | Bacteria | 9351 |
| 716 | Ga0466966_0010962 | 3300044684 | Bacteria | 6016 |
| 717 | Ga0466961_0006392 | 3300044693 | Bacteria | 7481 |
| 718 | Ga0466961_0086795 | 3300044693 | Bacteria | 1977 |
| 719 | Ga0466963_0009390 | 3300044694 | Bacteria | 5892 |
| 720 | Ga0466963_0028783 | 3300044694 | Bacteria | 3571 |
| 721 | Ga0466963_0031163 | 3300044694 | Bacteria | 3445 |
| 722 | Ga0466963_0033043 | 3300044694 | Bacteria | 3355 |
| 723 | Ga0466963_0063197 | 3300044694 | Bacteria | 2477 |
| 724 | Ga0466963_0070586 | 3300044694 | Bacteria | 2350 |
| 725 | Ga0466964_0051014 | 3300044706 | Bacteria | 1698 |
| 726 | Ga0466971_0053818 | 3300044719 | Bacteria | 1814 |
| 727 | Ga0466970_0051900 | 3300044765 | Bacteria | 2189 |
| 728 | Ga0466970_0056181 | 3300044765 | Bacteria | 2104 |
| 729 | Ga0466970_0064849 | 3300044765 | Bacteria | 1959 |
| 730 | Ga0466957_0003417 | 3300044842 | Bacteria | 8717 |
| 731 | Ga0466957_0019654 | 3300044842 | Bacteria | 3973 |
| 732 | Ga0466957_0029485 | 3300044842 | Bacteria | 3272 |
| 733 | Ga0466957_0029692 | 3300044842 | Bacteria | 3261 |
| 734 | Ga0466957_0090700 | 3300044842 | Bacteria | 1914 |
| 735 | Ga0466957_0182719 | 3300044842 | Bacteria | 1370 |
| 736 | Ga0466959_0004031 | 3300045049 | Bacteria | 9763 |
| 737 | Ga0466959_0031814 | 3300045049 | Bacteria | 3905 |
| 738 | Ga0466959_0032422 | 3300045049 | Bacteria | 3867 |
| 739 | Ga0466958_0000227 | 3300045836 | Bacteria | 21319 |
| 740 | Ga0466958_0000911 | 3300045836 | Bacteria | 13275 |
| 741 | Ga0466958_0004118 | 3300045836 | Bacteria | 7633 |
| 742 | Ga0466958_0075864 | 3300045836 | Bacteria | 2063 |
| 743 | Ga0466958_0115779 | 3300045836 | Bacteria | 1675 |
| 744 | Ga0466958_0225789 | 3300045836 | Bacteria | 1195 |
| 745 | Ga0466967_0034699 | 3300045976 | Bacteria | 4286 |
| 746 | Ga0466967_0038877 | 3300045976 | Bacteria | 4084 |
| 747 | Ga0466967_0039607 | 3300045976 | Bacteria | 4052 |
| 748 | Ga0466967_0044996 | 3300045976 | Bacteria | 3833 |
| 749 | Ga0466967_0062758 | 3300045976 | Bacteria | 3299 |
| 750 | Ga0466967_0068401 | 3300045976 | Bacteria | 3171 |
| 751 | Ga0466967_0229391 | 3300045976 | Bacteria | 1767 |
| 752 | Ga0495580_0004083 | 3300046472 | Bacteria | 12310 |
| 753 | Ga0495582_0005892 | 3300046473 | Bacteria | 6829 |
| 754 | Ga0495664_0065703 | 3300046477 | Bacteria | 2163 |
| 755 | Ga0495642_0053256 | 3300046528 | Bacteria | 1667 |
| 756 | Ga0495652_0040539 | 3300046529 | Bacteria | 4025 |
| 757 | Ga0495587_0155226 | 3300046536 | Bacteria | 1304 |
| 758 | Ga0495598_0003370 | 3300046537 | Bacteria | 3389 |
| 759 | Ga0495621_0006665 | 3300046539 | Bacteria | 3382 |
| 760 | Ga0495645_0010386 | 3300046543 | Bacteria | 6525 |
| 761 | Ga0495633_0010653 | 3300046558 | Bacteria | 5009 |
| 762 | Ga0495623_0012640 | 3300046679 | Bacteria | 5465 |
| 763 | Ga0495658_0003415 | 3300046683 | Bacteria | 7862 |
| 764 | Ga0495669_0000046 | 3300046684 | Bacteria | 83405 |
| 765 | Ga0495669_0004180 | 3300046684 | Bacteria | 5939 |
| 766 | Ga0495669_0004846 | 3300046684 | Bacteria | 5585 |
| 767 | Ga0495669_0025617 | 3300046684 | Bacteria | 2572 |
| 768 | Ga0495669_0117688 | 3300046684 | Bacteria | 1244 |
| 769 | Ga0495670_0051653 | 3300046691 | Bacteria | 2057 |
| 770 | Ga0495677_0017404 | 3300047445 | Bacteria | 2606 |
| 771 | Ga0495684_0125635 | 3300047471 | Bacteria | 1930 |
| 772 | Ga0496100_0159425 | 3300048903 | Unclassified | 1616 |
| 773 | Ga0496102_0136167 | 3300048905 | Bacteria | 2301 |
| 774 | Ga0496104_0373722 | 3300048907 | Bacteria | 1338 |
| 775 | Ga0496105_0314008 | 3300048908 | Bacteria | 1258 |
| 776 | Ga0496107_0022302 | 3300048910 | Bacteria | 4475 |
| 777 | Ga0496107_0117175 | 3300048910 | Bacteria | 1961 |
| 778 | Ga0496107_0167768 | 3300048910 | Bacteria | 1628 |
| 779 | Ga0496108_0006554 | 3300048911 | Bacteria | 9443 |
| 780 | Ga0496108_0009931 | 3300048911 | Bacteria | 7717 |
| 781 | Ga0496109_0013073 | 3300048912 | Bacteria | 7181 |
| 782 | Ga0496109_0031162 | 3300048912 | Bacteria | 4783 |
| 783 | Ga0496109_0109597 | 3300048912 | Bacteria | 2567 |
| 784 | Ga0496109_0321652 | 3300048912 | Bacteria | 1460 |
| 785 | Ga0496110_0001993 | 3300048913 | Bacteria | 15185 |
| 786 | Ga0496110_0017853 | 3300048913 | Bacteria | 5939 |
| 787 | Ga0496110_0021098 | 3300048913 | Bacteria | 5506 |
| 788 | Ga0496110_0388558 | 3300048913 | Bacteria | 1272 |
| 789 | Ga0496111_0000518 | 3300048914 | Bacteria | 19932 |
| 790 | Ga0496111_0023084 | 3300048914 | Bacteria | 4363 |
| 791 | Ga0496111_0127537 | 3300048914 | Bacteria | 1881 |
| 792 | Ga0496112_0040303 | 3300048915 | Bacteria | 4566 |
| 793 | Ga0496113_0001577 | 3300048916 | Bacteria | 12805 |
| 794 | Ga0496114_0009753 | 3300048917 | Bacteria | 7631 |
| 795 | Ga0496114_0054593 | 3300048917 | Bacteria | 3332 |
| 796 | Ga0496115_0000775 | 3300048918 | Bacteria | 23430 |
| 797 | Ga0495682_0004176 | 3300049460 | Bacteria | 6254 |
| 798 | Ga0501031_0171929 | 3300049568 | Bacteria | 1416 |
| 799 | Ga0501033_0262050 | 3300049570 | Bacteria | 1223 |
| 800 | Ga0501036_0297042 | 3300049572 | Bacteria | 1351 |
| 801 | Ga0501043_0112572 | 3300049579 | Bacteria | 2137 |
| 802 | Ga0501047_0011910 | 3300049581 | Bacteria | 8231 |
| 803 | Ga0501047_0087954 | 3300049581 | Bacteria | 2984 |
| 804 | Ga0501047_0324243 | 3300049581 | Bacteria | 1379 |
| 805 | Ga0501067_0001907 | 3300049583 | Bacteria | 11469 |
| 806 | Ga0501067_0073494 | 3300049583 | Bacteria | 1894 |
| 807 | Ga0501069_0008826 | 3300049585 | Bacteria | 5312 |
| 808 | Ga0501069_0158041 | 3300049585 | Bacteria | 1305 |
| 809 | Ga0501070_0000020 | 3300049586 | Bacteria | 169025 |
| 810 | Ga0501070_0004228 | 3300049586 | Bacteria | 12346 |
| 811 | Ga0501072_0150046 | 3300049588 | Unclassified | 1858 |
| 812 | Ga0501073_0009881 | 3300049589 | Bacteria | 7022 |
| 813 | Ga0501073_0120720 | 3300049589 | Bacteria | 1816 |
| 814 | Ga0501074_0006370 | 3300049590 | Bacteria | 8521 |
| 815 | Ga0501077_0051049 | 3300049593 | Bacteria | 2629 |
| 816 | Ga0501079_0008849 | 3300049741 | Bacteria | 7623 |
| 817 | Ga0501080_0005901 | 3300049742 | Bacteria | 10969 |
| 818 | Ga0501080_0150625 | 3300049742 | Bacteria | 2150 |
| 819 | Ga0501080_0168398 | 3300049742 | Bacteria | 2021 |
| 820 | Ga0501268_019884 | 3300049765 | Bacteria | 1140 |
| 821 | Ga0501035_0000349 | 3300049822 | Bacteria | 53020 |
| 822 | Ga0501035_0082375 | 3300049822 | Bacteria | 2839 |
| 823 | Ga0501044_0008968 | 3300049823 | Bacteria | 10936 |
| 824 | Ga0501044_0013044 | 3300049823 | Bacteria | 8991 |
| 825 | Ga0501044_0035726 | 3300049823 | Bacteria | 5202 |
| 826 | Ga0500646_0011144 | 3300053090 | Bacteria | 2309 |
| 827 | Ga0500641_0081023 | 3300053096 | Bacteria | 1378 |
| 828 | Ga0500608_000458 | 3300053122 | Bacteria | 15296 |
| 829 | Ga0500655_014869 | 3300053133 | Bacteria | 1425 |
| 830 | Ga0500568_0014797 | 3300053139 | Bacteria | 3510 |
| 831 | Ga0500604_0000058 | 3300053151 | Bacteria | 40241 |
| 832 | Ga0500616_0000087 | 3300053153 | Bacteria | 192225 |
| 833 | Ga0500645_031655 | 3300053730 | Bacteria | 1589 |
| 834 | Ga0500587_000147 | 3300053739 | Bacteria | 6749 |
| 835 | Ga0501084_0000533 | 3300054114 | Bacteria | 29046 |
| 836 | Ga0501084_0198140 | 3300054114 | Bacteria | 1694 |
| 837 | Ga0501082_0137767 | 3300060353 | Bacteria | 2118 |
| 838 | Ga0466962_0017481 | 3300061719 | Bacteria | 3452 |
| 839 | Ga0466962_0023228 | 3300061719 | Bacteria | 2980 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10721671 | Ga0157370_107216711 | 288 |
| 2 | 3300037418 | Ga0395900_0589267 | Ga0395900_0589267_169_1035 | 288 |
| 3 | 3300046684 | Ga0495669_0117688 | Ga0495669_0117688_49_915 | 288 |
| 4 | 3300048910 | Ga0496107_0117175 | Ga0496107_0117175_51_965 | 291 |
| 5 | 3300042007 | Ga0439449_0041385 | Ga0439449_0041385_439_1380 | 298 |
| 6 | 3300005329 | Ga0070683_100324654 | Ga0070683_1003246541 | 316 |
| 7 | 3300005344 | Ga0070661_100113016 | Ga0070661_1001130162 | 316 |
| 8 | 3300005616 | Ga0068852_100020151 | Ga0068852_1000201517 | 316 |
| 9 | 3300009093 | Ga0105240_10142920 | Ga0105240_101429202 | 316 |
| 10 | 3300009174 | Ga0105241_10025842 | Ga0105241_100258425 | 316 |
| 11 | 3300009545 | Ga0105237_10044058 | Ga0105237_100440583 | 316 |
| 12 | 3300025911 | Ga0207654_10008443 | Ga0207654_100084433 | 316 |
| 13 | 3300025944 | Ga0207661_10042830 | Ga0207661_100428304 | 316 |
| 14 | 3300026041 | Ga0207639_10012930 | Ga0207639_100129304 | 316 |
| 15 | 3300026142 | Ga0207698_10006034 | Ga0207698_100060344 | 316 |
| 16 | 3300025927 | Ga0207687_10029658 | Ga0207687_100296583 | 322 |
| 17 | 3300013307 | Ga0157372_10009318 | Ga0157372_1000931811 | 325 |
| 18 | 3300038443 | Ga0395901_0100497 | Ga0395901_0100497_1475_2512 | 325 |
| 19 | 3300009093 | Ga0105240_10328846 | Ga0105240_103288461 | 326 |
| 20 | 3300009174 | Ga0105241_10043775 | Ga0105241_100437751 | 326 |
| 21 | 3300009545 | Ga0105237_10092892 | Ga0105237_100928922 | 326 |
| 22 | 3300010375 | Ga0105239_10000300 | Ga0105239_1000030022 | 326 |
| 23 | 3300025911 | Ga0207654_10022070 | Ga0207654_100220704 | 326 |
| 24 | 3300025914 | Ga0207671_10292514 | Ga0207671_102925141 | 326 |
| 25 | 3300045836 | Ga0466958_0000911 | Ga0466958_0000911_3875_4951 | 326 |
| 26 | 3300053730 | Ga0500645_031655 | Ga0500645_031655_208_1284 | 328 |
| 27 | 3300005439 | Ga0070711_100063493 | Ga0070711_1000634932 | 331 |
| 28 | 3300025916 | Ga0207663_10106260 | Ga0207663_101062602 | 331 |
| 29 | 3300031824 | Ga0307413_10011026 | Ga0307413_100110263 | 331 |
| 30 | 3300032004 | Ga0307414_10124028 | Ga0307414_101240282 | 331 |
| 31 | 3300031995 | Ga0307409_100074360 | Ga0307409_1000743602 | 333 |
| 32 | 3300005327 | Ga0070658_10046477 | Ga0070658_100464774 | 335 |
| 33 | 3300005345 | Ga0070692_10001068 | Ga0070692_100010686 | 335 |
| 34 | 3300005455 | Ga0070663_100021154 | Ga0070663_1000211544 | 335 |
| 35 | 3300025909 | Ga0207705_10056246 | Ga0207705_100562462 | 335 |
| 36 | 3300025949 | Ga0207667_10196794 | Ga0207667_101967941 | 335 |
| 37 | 3300026067 | Ga0207678_10031207 | Ga0207678_100312073 | 335 |
| 38 | 3300037471 | Ga0395905_0051994 | Ga0395905_0051994_2279_3331 | 337 |
| 39 | 3300021384 | Ga0213876_10000690 | Ga0213876_1000069025 | 338 |
| 40 | 3300032002 | Ga0307416_100100138 | Ga0307416_1001001383 | 338 |
| 41 | 3300039437 | Ga0436365_1104251 | Ga0436365_1104251_61720_62796 | 338 |
| 42 | 3300039450 | Ga0436363_1226947 | Ga0436363_1226947_312_1388 | 338 |
| 43 | 3300005333 | Ga0070677_10000261 | Ga0070677_1000026112 | 339 |
| 44 | 3300005544 | Ga0070686_100000194 | Ga0070686_10000019421 | 339 |
| 45 | 3300009098 | Ga0105245_10147928 | Ga0105245_101479282 | 339 |
| 46 | 3300021384 | Ga0213876_10006225 | Ga0213876_100062255 | 339 |
| 47 | 3300025893 | Ga0207682_10040071 | Ga0207682_100400713 | 339 |
| 48 | 3300039437 | Ga0436365_1355541 | Ga0436365_1355541_4474_5550 | 339 |
| 49 | 3300046528 | Ga0495642_0053256 | Ga0495642_0053256_28_1104 | 339 |
| 50 | 3300010375 | Ga0105239_10070459 | Ga0105239_100704593 | 340 |
| 51 | 3300028577 | Ga0265318_10000017 | Ga0265318_10000017151 | 340 |
| 52 | 3300005985 | Ga0081539_10015018 | Ga0081539_100150181 | 341 |
| 53 | 3300009094 | Ga0111539_10426741 | Ga0111539_104267412 | 341 |
| 54 | 3300009177 | Ga0105248_10029417 | Ga0105248_100294176 | 341 |
| 55 | 3300020081 | Ga0206354_10790246 | Ga0206354_107902463 | 341 |
| 56 | 3300020082 | Ga0206353_11349930 | Ga0206353_113499303 | 341 |
| 57 | 3300025925 | Ga0207650_10002447 | Ga0207650_1000244710 | 341 |
| 58 | 3300031824 | Ga0307413_10001065 | Ga0307413_100010653 | 341 |
| 59 | 3300031852 | Ga0307410_10000440 | Ga0307410_100004403 | 341 |
| 60 | 3300031901 | Ga0307406_10253894 | Ga0307406_102538941 | 341 |
| 61 | 3300031903 | Ga0307407_10001328 | Ga0307407_100013288 | 341 |
| 62 | 3300031903 | Ga0307407_10123466 | Ga0307407_101234662 | 341 |
| 63 | 3300031911 | Ga0307412_10017391 | Ga0307412_100173914 | 341 |
| 64 | 3300031995 | Ga0307409_100002347 | Ga0307409_1000023479 | 341 |
| 65 | 3300032002 | Ga0307416_100035230 | Ga0307416_1000352302 | 341 |
| 66 | 3300032004 | Ga0307414_10002980 | Ga0307414_100029802 | 341 |
| 67 | 3300032005 | Ga0307411_10210960 | Ga0307411_102109602 | 341 |
| 68 | 3300046684 | Ga0495669_0000046 | Ga0495669_0000046_60585_61658 | 341 |
| 69 | 3300005290 | Ga0065712_10097408 | Ga0065712_100974082 | 342 |
| 70 | 3300005327 | Ga0070658_10045883 | Ga0070658_100458833 | 342 |
| 71 | 3300005331 | Ga0070670_100000388 | Ga0070670_10000038819 | 342 |
| 72 | 3300005333 | Ga0070677_10029338 | Ga0070677_100293382 | 342 |
| 73 | 3300005339 | Ga0070660_100001087 | Ga0070660_1000010877 | 342 |
| 74 | 3300005344 | Ga0070661_100010425 | Ga0070661_1000104252 | 342 |
| 75 | 3300005345 | Ga0070692_10003352 | Ga0070692_100033527 | 342 |
| 76 | 3300005353 | Ga0070669_100130651 | Ga0070669_1001306512 | 342 |
| 77 | 3300005354 | Ga0070675_100000603 | Ga0070675_1000006032 | 342 |
| 78 | 3300005355 | Ga0070671_100000659 | Ga0070671_10000065910 | 342 |
| 79 | 3300005366 | Ga0070659_100004372 | Ga0070659_1000043729 | 342 |
| 80 | 3300005456 | Ga0070678_100054895 | Ga0070678_1000548953 | 342 |
| 81 | 3300005457 | Ga0070662_100049545 | Ga0070662_1000495453 | 342 |
| 82 | 3300005543 | Ga0070672_100024460 | Ga0070672_1000244602 | 342 |
| 83 | 3300005564 | Ga0070664_100001431 | Ga0070664_10000143119 | 342 |
| 84 | 3300013105 | Ga0157369_10003259 | Ga0157369_1000325914 | 342 |
| 85 | 3300013308 | Ga0157375_10090811 | Ga0157375_100908114 | 342 |
| 86 | 3300017792 | Ga0163161_10043603 | Ga0163161_100436032 | 342 |
| 87 | 3300021358 | Ga0213873_10000008 | Ga0213873_1000000820 | 342 |
| 88 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005584 | 342 |
| 89 | 3300025919 | Ga0207657_10008443 | Ga0207657_100084433 | 342 |
| 90 | 3300025920 | Ga0207649_10138628 | Ga0207649_101386282 | 342 |
| 91 | 3300025923 | Ga0207681_10046810 | Ga0207681_100468104 | 342 |
| 92 | 3300025926 | Ga0207659_10087823 | Ga0207659_100878232 | 342 |
| 93 | 3300025931 | Ga0207644_10006246 | Ga0207644_100062462 | 342 |
| 94 | 3300025932 | Ga0207690_10003045 | Ga0207690_100030459 | 342 |
| 95 | 3300025933 | Ga0207706_10023055 | Ga0207706_100230554 | 342 |
| 96 | 3300025940 | Ga0207691_10108516 | Ga0207691_101085162 | 342 |
| 97 | 3300025941 | Ga0207711_10011871 | Ga0207711_100118712 | 342 |
| 98 | 3300025986 | Ga0207658_10005506 | Ga0207658_1000550610 | 342 |
| 99 | 3300031548 | Ga0307408_100222018 | Ga0307408_1002220182 | 342 |
| 100 | 3300037471 | Ga0395905_0003297 | Ga0395905_0003297_15556_16629 | 342 |
| 101 | 3300037471 | Ga0395905_0013981 | Ga0395905_0013981_2743_3810 | 342 |
| 102 | 3300039437 | Ga0436365_1476024 | Ga0436365_1476024_174_1250 | 342 |
| 103 | 3300039453 | Ga0436362_0368701 | Ga0436362_0368701_9198_10274 | 342 |
| 104 | 3300044842 | Ga0466957_0090700 | Ga0466957_0090700_396_1469 | 342 |
| 105 | 3300048913 | Ga0496110_0001993 | Ga0496110_0001993_5282_6355 | 342 |
| 106 | 3300053096 | Ga0500641_0081023 | Ga0500641_0081023_19_1095 | 342 |
| 107 | 3300002067 | JGI24735J21928_10035395 | JGI24735J21928_100353952 | 343 |
| 108 | 3300005328 | Ga0070676_10062332 | Ga0070676_100623322 | 343 |
| 109 | 3300005331 | Ga0070670_100163433 | Ga0070670_1001634331 | 343 |
| 110 | 3300005347 | Ga0070668_100280608 | Ga0070668_1002806081 | 343 |
| 111 | 3300005353 | Ga0070669_100210718 | Ga0070669_1002107182 | 343 |
| 112 | 3300005367 | Ga0070667_100452124 | Ga0070667_1004521241 | 343 |
| 113 | 3300005441 | Ga0070700_100296018 | Ga0070700_1002960181 | 343 |
| 114 | 3300005457 | Ga0070662_100022953 | Ga0070662_1000229534 | 343 |
| 115 | 3300005564 | Ga0070664_100111150 | Ga0070664_1001111502 | 343 |
| 116 | 3300005577 | Ga0068857_100178947 | Ga0068857_1001789472 | 343 |
| 117 | 3300005616 | Ga0068852_100044626 | Ga0068852_1000446262 | 343 |
| 118 | 3300005618 | Ga0068864_100188983 | Ga0068864_1001889832 | 343 |
| 119 | 3300005844 | Ga0068862_100104836 | Ga0068862_1001048363 | 343 |
| 120 | 3300009148 | Ga0105243_10098445 | Ga0105243_100984453 | 343 |
| 121 | 3300009177 | Ga0105248_10093967 | Ga0105248_100939672 | 343 |
| 122 | 3300014326 | Ga0157380_10047066 | Ga0157380_100470664 | 343 |
| 123 | 3300025907 | Ga0207645_10079400 | Ga0207645_100794002 | 343 |
| 124 | 3300025908 | Ga0207643_10058822 | Ga0207643_100588221 | 343 |
| 125 | 3300025933 | Ga0207706_10033822 | Ga0207706_100338223 | 343 |
| 126 | 3300025945 | Ga0207679_10279840 | Ga0207679_102798402 | 343 |
| 127 | 3300026116 | Ga0207674_10069778 | Ga0207674_100697783 | 343 |
| 128 | 3300026118 | Ga0207675_100085879 | Ga0207675_1000858792 | 343 |
| 129 | 3300031548 | Ga0307408_100200373 | Ga0307408_1002003732 | 343 |
| 130 | 3300031852 | Ga0307410_10045602 | Ga0307410_100456023 | 343 |
| 131 | 3300031852 | Ga0307410_10069236 | Ga0307410_100692362 | 343 |
| 132 | 3300031852 | Ga0307410_10086714 | Ga0307410_100867142 | 343 |
| 133 | 3300031903 | Ga0307407_10109429 | Ga0307407_101094291 | 343 |
| 134 | 3300031911 | Ga0307412_10009692 | Ga0307412_100096924 | 343 |
| 135 | 3300031995 | Ga0307409_100000982 | Ga0307409_10000098218 | 343 |
| 136 | 3300031995 | Ga0307409_100020403 | Ga0307409_1000204032 | 343 |
| 137 | 3300032002 | Ga0307416_100124621 | Ga0307416_1001246212 | 343 |
| 138 | 3300032005 | Ga0307411_10001476 | Ga0307411_100014761 | 343 |
| 139 | 3300032005 | Ga0307411_10013394 | Ga0307411_100133943 | 343 |
| 140 | 3300032005 | Ga0307411_10361126 | Ga0307411_103611261 | 343 |
| 141 | 3300032126 | Ga0307415_100015237 | Ga0307415_1000152374 | 343 |
| 142 | 3300032126 | Ga0307415_100024724 | Ga0307415_1000247242 | 343 |
| 143 | 3300042005 | Ga0439448_0020723 | Ga0439448_0020723_684_1757 | 343 |
| 144 | 3300042012 | Ga0439455_0006806 | Ga0439455_0006806_947_2020 | 343 |
| 145 | 3300042116 | Ga0450912_000426 | Ga0450912_000426_665_1738 | 343 |
| 146 | 3300042157 | Ga0439458_0000217 | Ga0439458_0000217_10956_12029 | 343 |
| 147 | 3300046537 | Ga0495598_0003370 | Ga0495598_0003370_828_1901 | 343 |
| 148 | 3300046539 | Ga0495621_0006665 | Ga0495621_0006665_1886_2959 | 343 |
| 149 | 3300046558 | Ga0495633_0010653 | Ga0495633_0010653_148_1221 | 343 |
| 150 | 3300046691 | Ga0495670_0051653 | Ga0495670_0051653_130_1203 | 343 |
| 151 | 3300048912 | Ga0496109_0321652 | Ga0496109_0321652_254_1327 | 343 |
| 152 | 3300048913 | Ga0496110_0388558 | Ga0496110_0388558_123_1196 | 343 |
| 153 | 3300005327 | Ga0070658_10039138 | Ga0070658_100391382 | 344 |
| 154 | 3300005355 | Ga0070671_100000356 | Ga0070671_10000035626 | 344 |
| 155 | 3300005455 | Ga0070663_100028204 | Ga0070663_1000282044 | 344 |
| 156 | 3300005539 | Ga0068853_100025600 | Ga0068853_1000256003 | 344 |
| 157 | 3300005563 | Ga0068855_100000907 | Ga0068855_1000009074 | 344 |
| 158 | 3300005578 | Ga0068854_100004180 | Ga0068854_1000041802 | 344 |
| 159 | 3300005578 | Ga0068854_100180479 | Ga0068854_1001804792 | 344 |
| 160 | 3300009551 | Ga0105238_10006284 | Ga0105238_100062843 | 344 |
| 161 | 3300013104 | Ga0157370_10115040 | Ga0157370_101150402 | 344 |
| 162 | 3300013105 | Ga0157369_10004144 | Ga0157369_1000414417 | 344 |
| 163 | 3300025904 | Ga0207647_10007269 | Ga0207647_100072696 | 344 |
| 164 | 3300025909 | Ga0207705_10000050 | Ga0207705_1000005043 | 344 |
| 165 | 3300025909 | Ga0207705_10018504 | Ga0207705_100185043 | 344 |
| 166 | 3300025913 | Ga0207695_10003088 | Ga0207695_100030886 | 344 |
| 167 | 3300025919 | Ga0207657_10000210 | Ga0207657_1000021043 | 344 |
| 168 | 3300025919 | Ga0207657_10000301 | Ga0207657_1000030127 | 344 |
| 169 | 3300025923 | Ga0207681_10052122 | Ga0207681_100521222 | 344 |
| 170 | 3300025924 | Ga0207694_10027420 | Ga0207694_100274204 | 344 |
| 171 | 3300025949 | Ga0207667_10000327 | Ga0207667_1000032741 | 344 |
| 172 | 3300025981 | Ga0207640_10000668 | Ga0207640_100006682 | 344 |
| 173 | 3300025981 | Ga0207640_10148347 | Ga0207640_101483472 | 344 |
| 174 | 3300026041 | Ga0207639_10017987 | Ga0207639_100179873 | 344 |
| 175 | 3300026041 | Ga0207639_10234789 | Ga0207639_102347891 | 344 |
| 176 | 3300026067 | Ga0207678_10040503 | Ga0207678_100405033 | 344 |
| 177 | 3300032126 | Ga0307415_100242859 | Ga0307415_1002428592 | 344 |
| 178 | 3300035118 | Ga0373954_0034286 | Ga0373954_0034286_366_1439 | 344 |
| 179 | 3300035172 | Ga0373955_0001138 | Ga0373955_0001138_792_1865 | 344 |
| 180 | 3300037312 | Ga0395899_0000756 | Ga0395899_0000756_1126_2199 | 344 |
| 181 | 3300037312 | Ga0395899_0014976 | Ga0395899_0014976_1693_2766 | 344 |
| 182 | 3300037312 | Ga0395899_0083978 | Ga0395899_0083978_773_1846 | 344 |
| 183 | 3300037418 | Ga0395900_0008644 | Ga0395900_0008644_5418_6491 | 344 |
| 184 | 3300037418 | Ga0395900_0011097 | Ga0395900_0011097_7426_8499 | 344 |
| 185 | 3300037418 | Ga0395900_0018682 | Ga0395900_0018682_5466_6539 | 344 |
| 186 | 3300037418 | Ga0395900_0025252 | Ga0395900_0025252_1514_2587 | 344 |
| 187 | 3300037418 | Ga0395900_0029639 | Ga0395900_0029639_4250_5323 | 344 |
| 188 | 3300037418 | Ga0395900_0061786 | Ga0395900_0061786_2706_3779 | 344 |
| 189 | 3300037418 | Ga0395900_0394911 | Ga0395900_0394911_132_1205 | 344 |
| 190 | 3300037418 | Ga0395900_0428833 | Ga0395900_0428833_95_1168 | 344 |
| 191 | 3300037466 | Ga0395898_0026343 | Ga0395898_0026343_1500_2573 | 344 |
| 192 | 3300037466 | Ga0395898_0037633 | Ga0395898_0037633_1413_2486 | 344 |
| 193 | 3300037466 | Ga0395898_0081811 | Ga0395898_0081811_1756_2829 | 344 |
| 194 | 3300037466 | Ga0395898_0087537 | Ga0395898_0087537_102_1175 | 344 |
| 195 | 3300037471 | Ga0395905_0001268 | Ga0395905_0001268_17451_18524 | 344 |
| 196 | 3300037471 | Ga0395905_0002525 | Ga0395905_0002525_16996_18069 | 344 |
| 197 | 3300037471 | Ga0395905_0007050 | Ga0395905_0007050_9361_10434 | 344 |
| 198 | 3300037471 | Ga0395905_0011492 | Ga0395905_0011492_6194_7267 | 344 |
| 199 | 3300037471 | Ga0395905_0013797 | Ga0395905_0013797_67_1140 | 344 |
| 200 | 3300037471 | Ga0395905_0029744 | Ga0395905_0029744_1261_2334 | 344 |
| 201 | 3300037471 | Ga0395905_0039070 | Ga0395905_0039070_1321_2394 | 344 |
| 202 | 3300037471 | Ga0395905_0051336 | Ga0395905_0051336_1627_2700 | 344 |
| 203 | 3300037471 | Ga0395905_0134746 | Ga0395905_0134746_914_1987 | 344 |
| 204 | 3300037471 | Ga0395905_0195512 | Ga0395905_0195512_196_1269 | 344 |
| 205 | 3300038443 | Ga0395901_0012481 | Ga0395901_0012481_7028_8101 | 344 |
| 206 | 3300038443 | Ga0395901_0014222 | Ga0395901_0014222_6980_8053 | 344 |
| 207 | 3300038443 | Ga0395901_0019013 | Ga0395901_0019013_4410_5483 | 344 |
| 208 | 3300038443 | Ga0395901_0022957 | Ga0395901_0022957_1120_2193 | 344 |
| 209 | 3300038443 | Ga0395901_0027336 | Ga0395901_0027336_2482_3555 | 344 |
| 210 | 3300038443 | Ga0395901_0040197 | Ga0395901_0040197_1275_2348 | 344 |
| 211 | 3300038443 | Ga0395901_0046352 | Ga0395901_0046352_1399_2472 | 344 |
| 212 | 3300038443 | Ga0395901_0047640 | Ga0395901_0047640_284_1357 | 344 |
| 213 | 3300038443 | Ga0395901_0078597 | Ga0395901_0078597_1209_2282 | 344 |
| 214 | 3300044706 | Ga0466964_0051014 | Ga0466964_0051014_575_1648 | 344 |
| 215 | 3300045836 | Ga0466958_0075864 | Ga0466958_0075864_704_1777 | 344 |
| 216 | 3300045976 | Ga0466967_0039607 | Ga0466967_0039607_2200_3273 | 344 |
| 217 | 3300046679 | Ga0495623_0012640 | Ga0495623_0012640_3452_4525 | 344 |
| 218 | 3300046684 | Ga0495669_0004846 | Ga0495669_0004846_380_1453 | 344 |
| 219 | 3300048908 | Ga0496105_0314008 | Ga0496105_0314008_143_1216 | 344 |
| 220 | 3300048917 | Ga0496114_0054593 | Ga0496114_0054593_373_1446 | 344 |
| 221 | 3300048918 | Ga0496115_0000775 | Ga0496115_0000775_2135_3208 | 344 |
| 222 | 3300005355 | Ga0070671_100026134 | Ga0070671_1000261342 | 345 |
| 223 | 3300005548 | Ga0070665_100159605 | Ga0070665_1001596052 | 345 |
| 224 | 3300025972 | Ga0207668_10131930 | Ga0207668_101319302 | 345 |
| 225 | 3300031548 | Ga0307408_100072666 | Ga0307408_1000726664 | 345 |
| 226 | 3300031852 | Ga0307410_10031443 | Ga0307410_100314433 | 345 |
| 227 | 3300031901 | Ga0307406_10143013 | Ga0307406_101430131 | 345 |
| 228 | 3300031911 | Ga0307412_10044131 | Ga0307412_100441312 | 345 |
| 229 | 3300032002 | Ga0307416_100140149 | Ga0307416_1001401493 | 345 |
| 230 | 3300005336 | Ga0070680_100000210 | Ga0070680_1000002108 | 346 |
| 231 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001694 | 346 |
| 232 | 3300005530 | Ga0070679_100000037 | Ga0070679_10000003767 | 346 |
| 233 | 3300005548 | Ga0070665_100000038 | Ga0070665_100000038130 | 346 |
| 234 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001378 | 346 |
| 235 | 3300025917 | Ga0207660_10000029 | Ga0207660_100000293 | 346 |
| 236 | 3300025921 | Ga0207652_10000190 | Ga0207652_1000019016 | 346 |
| 237 | 3300028379 | Ga0268266_10000118 | Ga0268266_10000118115 | 346 |
| 238 | 3300038443 | Ga0395901_0184853 | Ga0395901_0184853_631_1704 | 346 |
| 239 | 3300053090 | Ga0500646_0011144 | Ga0500646_0011144_1097_2173 | 346 |
| 240 | 3300053151 | Ga0500604_0000058 | Ga0500604_0000058_14177_15253 | 346 |
| 241 | 3300013105 | Ga0157369_10019337 | Ga0157369_100193373 | 347 |
| 242 | 3300044656 | Ga0466969_0080013 | Ga0466969_0080013_410_1483 | 347 |
| 243 | 3300044684 | Ga0466966_0010962 | Ga0466966_0010962_2569_3642 | 347 |
| 244 | 3300044765 | Ga0466970_0051900 | Ga0466970_0051900_214_1287 | 347 |
| 245 | 3300013100 | Ga0157373_10061732 | Ga0157373_100617324 | 348 |
| 246 | 3300013102 | Ga0157371_10000705 | Ga0157371_1000070526 | 348 |
| 247 | 3300037418 | Ga0395900_0308400 | Ga0395900_0308400_33_1079 | 348 |
| 248 | 3300037466 | Ga0395898_0271871 | Ga0395898_0271871_484_1530 | 348 |
| 249 | 3300037471 | Ga0395905_0205182 | Ga0395905_0205182_518_1564 | 348 |
| 250 | 3300005563 | Ga0068855_100000006 | Ga0068855_100000006152 | 349 |
| 251 | 3300005616 | Ga0068852_100030143 | Ga0068852_1000301434 | 349 |
| 252 | 3300009093 | Ga0105240_10000080 | Ga0105240_10000080141 | 349 |
| 253 | 3300009551 | Ga0105238_10009334 | Ga0105238_1000933410 | 349 |
| 254 | 3300013105 | Ga0157369_10016020 | Ga0157369_100160203 | 349 |
| 255 | 3300025913 | Ga0207695_10000004 | Ga0207695_10000004721 | 349 |
| 256 | 3300025924 | Ga0207694_10000014 | Ga0207694_10000014240 | 349 |
| 257 | 3300025949 | Ga0207667_10000051 | Ga0207667_10000051210 | 349 |
| 258 | 3300026142 | Ga0207698_10019087 | Ga0207698_100190873 | 349 |
| 259 | 3300049460 | Ga0495682_0004176 | Ga0495682_0004176_1285_2367 | 349 |
| 260 | 3300053133 | Ga0500655_014869 | Ga0500655_014869_111_1193 | 349 |
| 261 | 3300009176 | Ga0105242_10048655 | Ga0105242_100486553 | 353 |
| 262 | 3300021384 | Ga0213876_10001060 | Ga0213876_100010608 | 353 |
| 263 | 3300025934 | Ga0207686_10006977 | Ga0207686_100069774 | 353 |
| 264 | 3300039437 | Ga0436365_1867062 | Ga0436365_1867062_34_1107 | 353 |
| 265 | 3300054114 | Ga0501084_0000533 | Ga0501084_0000533_17949_19022 | 353 |
| 266 | 3300060353 | Ga0501082_0137767 | Ga0501082_0137767_898_1971 | 353 |
| 267 | 3300049593 | Ga0501077_0051049 | Ga0501077_0051049_117_1193 | 354 |
| 268 | 3300014969 | Ga0157376_10098265 | Ga0157376_100982652 | 355 |
| 269 | 3300021377 | Ga0213874_10001849 | Ga0213874_100018496 | 355 |
| 270 | 3300039450 | Ga0436363_0458213 | Ga0436363_0458213_3481_4560 | 355 |
| 271 | 3300046543 | Ga0495645_0010386 | Ga0495645_0010386_656_1735 | 355 |
| 272 | 3300049568 | Ga0501031_0171929 | Ga0501031_0171929_285_1364 | 355 |
| 273 | 3300049572 | Ga0501036_0297042 | Ga0501036_0297042_186_1265 | 355 |
| 274 | 3300049579 | Ga0501043_0112572 | Ga0501043_0112572_232_1311 | 355 |
| 275 | 3300049581 | Ga0501047_0324243 | Ga0501047_0324243_36_1115 | 355 |
| 276 | 3300049583 | Ga0501067_0073494 | Ga0501067_0073494_199_1278 | 355 |
| 277 | 3300049585 | Ga0501069_0008826 | Ga0501069_0008826_172_1251 | 355 |
| 278 | 3300049586 | Ga0501070_0004228 | Ga0501070_0004228_9696_10775 | 355 |
| 279 | 3300049589 | Ga0501073_0120720 | Ga0501073_0120720_248_1327 | 355 |
| 280 | 3300049590 | Ga0501074_0006370 | Ga0501074_0006370_78_1157 | 355 |
| 281 | 3300049741 | Ga0501079_0008849 | Ga0501079_0008849_175_1254 | 355 |
| 282 | 3300049742 | Ga0501080_0168398 | Ga0501080_0168398_618_1697 | 355 |
| 283 | 3300049822 | Ga0501035_0082375 | Ga0501035_0082375_201_1280 | 355 |
| 284 | 3300049823 | Ga0501044_0013044 | Ga0501044_0013044_194_1273 | 355 |
| 285 | 3300054114 | Ga0501084_0198140 | Ga0501084_0198140_475_1554 | 355 |
| 286 | 3300003320 | rootH2_10000496 | rootH2_100004965 | 356 |
| 287 | 3300005339 | Ga0070660_100026000 | Ga0070660_1000260002 | 356 |
| 288 | 3300005366 | Ga0070659_100016282 | Ga0070659_1000162822 | 356 |
| 289 | 3300005539 | Ga0068853_100002174 | Ga0068853_1000021746 | 356 |
| 290 | 3300005614 | Ga0068856_100186209 | Ga0068856_1001862092 | 356 |
| 291 | 3300006358 | Ga0068871_100112633 | Ga0068871_1001126332 | 356 |
| 292 | 3300009177 | Ga0105248_10000005 | Ga0105248_10000005419 | 356 |
| 293 | 3300009551 | Ga0105238_10033370 | Ga0105238_100333703 | 356 |
| 294 | 3300010375 | Ga0105239_10003501 | Ga0105239_1000350114 | 356 |
| 295 | 3300013307 | Ga0157372_10011503 | Ga0157372_100115037 | 356 |
| 296 | 3300021377 | Ga0213874_10005538 | Ga0213874_100055383 | 356 |
| 297 | 3300021384 | Ga0213876_10000613 | Ga0213876_1000061328 | 356 |
| 298 | 3300025909 | Ga0207705_10000274 | Ga0207705_1000027417 | 356 |
| 299 | 3300025912 | Ga0207707_10001960 | Ga0207707_100019609 | 356 |
| 300 | 3300025917 | Ga0207660_10001572 | Ga0207660_100015723 | 356 |
| 301 | 3300025919 | Ga0207657_10000543 | Ga0207657_100005433 | 356 |
| 302 | 3300025919 | Ga0207657_10035936 | Ga0207657_100359362 | 356 |
| 303 | 3300025921 | Ga0207652_10006721 | Ga0207652_1000672110 | 356 |
| 304 | 3300025924 | Ga0207694_10024885 | Ga0207694_100248852 | 356 |
| 305 | 3300025932 | Ga0207690_10051616 | Ga0207690_100516162 | 356 |
| 306 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002417 | 356 |
| 307 | 3300026041 | Ga0207639_10003483 | Ga0207639_100034835 | 356 |
| 308 | 3300028379 | Ga0268266_10002147 | Ga0268266_1000214712 | 356 |
| 309 | 3300028800 | Ga0265338_10000007 | Ga0265338_10000007497 | 356 |
| 310 | 3300031241 | Ga0265325_10000001 | Ga0265325_10000001289 | 356 |
| 311 | 3300031242 | Ga0265329_10024903 | Ga0265329_100249033 | 356 |
| 312 | 3300031249 | Ga0265339_10000769 | Ga0265339_1000076915 | 356 |
| 313 | 3300031250 | Ga0265331_10011069 | Ga0265331_100110695 | 356 |
| 314 | 3300031595 | Ga0265313_10002115 | Ga0265313_1000211519 | 356 |
| 315 | 3300031711 | Ga0265314_10008637 | Ga0265314_100086376 | 356 |
| 316 | 3300031711 | Ga0265314_10015067 | Ga0265314_100150677 | 356 |
| 317 | 3300031712 | Ga0265342_10047385 | Ga0265342_100473852 | 356 |
| 318 | 3300035692 | Ga0373935_0005979 | Ga0373935_0005979_1002_2084 | 356 |
| 319 | 3300035725 | Ga0373947_0006172 | Ga0373947_0006172_5022_6104 | 356 |
| 320 | 3300035725 | Ga0373947_0082289 | Ga0373947_0082289_690_1772 | 356 |
| 321 | 3300037068 | Ga0373925_0023221 | Ga0373925_0023221_2490_3572 | 356 |
| 322 | 3300037853 | Ga0436364_1113588 | Ga0436364_1113588_567_1649 | 356 |
| 323 | 3300039437 | Ga0436365_1579660 | Ga0436365_1579660_69492_70574 | 356 |
| 324 | 3300039437 | Ga0436365_1812310 | Ga0436365_1812310_272_1354 | 356 |
| 325 | 3300039447 | Ga0436361_0468825 | Ga0436361_0468825_965_2041 | 356 |
| 326 | 3300039447 | Ga0436361_1207323 | Ga0436361_1207323_300_1376 | 356 |
| 327 | 3300039450 | Ga0436363_0750735 | Ga0436363_0750735_506_1588 | 356 |
| 328 | 3300046472 | Ga0495580_0004083 | Ga0495580_0004083_2182_3264 | 356 |
| 329 | 3300046473 | Ga0495582_0005892 | Ga0495582_0005892_732_1814 | 356 |
| 330 | 3300046477 | Ga0495664_0065703 | Ga0495664_0065703_757_1839 | 356 |
| 331 | 3300046529 | Ga0495652_0040539 | Ga0495652_0040539_1922_3004 | 356 |
| 332 | 3300046536 | Ga0495587_0155226 | Ga0495587_0155226_75_1157 | 356 |
| 333 | 3300046683 | Ga0495658_0003415 | Ga0495658_0003415_5760_6842 | 356 |
| 334 | 3300047471 | Ga0495684_0125635 | Ga0495684_0125635_580_1662 | 356 |
| 335 | 3300049570 | Ga0501033_0262050 | Ga0501033_0262050_21_1103 | 356 |
| 336 | 3300049581 | Ga0501047_0011910 | Ga0501047_0011910_488_1570 | 356 |
| 337 | 3300049581 | Ga0501047_0087954 | Ga0501047_0087954_1713_2795 | 356 |
| 338 | 3300049583 | Ga0501067_0001907 | Ga0501067_0001907_564_1646 | 356 |
| 339 | 3300049586 | Ga0501070_0000020 | Ga0501070_0000020_145432_146541 | 356 |
| 340 | 3300049588 | Ga0501072_0150046 | Ga0501072_0150046_663_1745 | 356 |
| 341 | 3300049589 | Ga0501073_0009881 | Ga0501073_0009881_527_1609 | 356 |
| 342 | 3300049742 | Ga0501080_0005901 | Ga0501080_0005901_1106_2215 | 356 |
| 343 | 3300049742 | Ga0501080_0150625 | Ga0501080_0150625_369_1451 | 356 |
| 344 | 3300049822 | Ga0501035_0000349 | Ga0501035_0000349_10002_11111 | 356 |
| 345 | 3300049823 | Ga0501044_0008968 | Ga0501044_0008968_805_1914 | 356 |
| 346 | 3300049823 | Ga0501044_0035726 | Ga0501044_0035726_1399_2481 | 356 |
| 347 | 3300053122 | Ga0500608_000458 | Ga0500608_000458_13664_14740 | 356 |
| 348 | 3300053139 | Ga0500568_0014797 | Ga0500568_0014797_627_1703 | 356 |
| 349 | 3300053153 | Ga0500616_0000087 | Ga0500616_0000087_52145_53221 | 356 |
| 350 | 3300053739 | Ga0500587_000147 | Ga0500587_000147_3576_4652 | 356 |
| 351 | 3300001904 | JGI24736J21556_1006675 | JGI24736J21556_10066752 | 357 |
| 352 | 3300001979 | JGI24740J21852_10015235 | JGI24740J21852_100152352 | 357 |
| 353 | 3300001979 | JGI24740J21852_10021560 | JGI24740J21852_100215602 | 357 |
| 354 | 3300001989 | JGI24739J22299_10002585 | JGI24739J22299_100025852 | 357 |
| 355 | 3300001989 | JGI24739J22299_10018333 | JGI24739J22299_100183333 | 357 |
| 356 | 3300001990 | JGI24737J22298_10001425 | JGI24737J22298_100014258 | 357 |
| 357 | 3300001990 | JGI24737J22298_10002822 | JGI24737J22298_100028224 | 357 |
| 358 | 3300002073 | JGI24745J21846_1001648 | JGI24745J21846_10016481 | 357 |
| 359 | 3300002075 | JGI24738J21930_10000935 | JGI24738J21930_100009351 | 357 |
| 360 | 3300002075 | JGI24738J21930_10004197 | JGI24738J21930_100041973 | 357 |
| 361 | 3300002075 | JGI24738J21930_10011075 | JGI24738J21930_100110751 | 357 |
| 362 | 3300005293 | Ga0065715_10101666 | Ga0065715_101016662 | 357 |
| 363 | 3300005327 | Ga0070658_10001352 | Ga0070658_1000135211 | 357 |
| 364 | 3300005327 | Ga0070658_10033393 | Ga0070658_100333932 | 357 |
| 365 | 3300005327 | Ga0070658_10080745 | Ga0070658_100807452 | 357 |
| 366 | 3300005327 | Ga0070658_10154884 | Ga0070658_101548842 | 357 |
| 367 | 3300005327 | Ga0070658_10184105 | Ga0070658_101841052 | 357 |
| 368 | 3300005327 | Ga0070658_10248653 | Ga0070658_102486532 | 357 |
| 369 | 3300005328 | Ga0070676_10013596 | Ga0070676_100135963 | 357 |
| 370 | 3300005329 | Ga0070683_100154301 | Ga0070683_1001543012 | 357 |
| 371 | 3300005329 | Ga0070683_100257611 | Ga0070683_1002576112 | 357 |
| 372 | 3300005331 | Ga0070670_100005434 | Ga0070670_1000054344 | 357 |
| 373 | 3300005331 | Ga0070670_100019494 | Ga0070670_1000194943 | 357 |
| 374 | 3300005331 | Ga0070670_100027696 | Ga0070670_1000276965 | 357 |
| 375 | 3300005333 | Ga0070677_10043353 | Ga0070677_100433532 | 357 |
| 376 | 3300005334 | Ga0068869_100000651 | Ga0068869_10000065114 | 357 |
| 377 | 3300005335 | Ga0070666_10003451 | Ga0070666_100034514 | 357 |
| 378 | 3300005335 | Ga0070666_10007885 | Ga0070666_100078852 | 357 |
| 379 | 3300005336 | Ga0070680_100050386 | Ga0070680_1000503865 | 357 |
| 380 | 3300005336 | Ga0070680_100125076 | Ga0070680_1001250762 | 357 |
| 381 | 3300005337 | Ga0070682_100249915 | Ga0070682_1002499152 | 357 |
| 382 | 3300005338 | Ga0068868_100005456 | Ga0068868_1000054561 | 357 |
| 383 | 3300005338 | Ga0068868_100112512 | Ga0068868_1001125122 | 357 |
| 384 | 3300005339 | Ga0070660_100000012 | Ga0070660_10000001275 | 357 |
| 385 | 3300005339 | Ga0070660_100000184 | Ga0070660_10000018416 | 357 |
| 386 | 3300005339 | Ga0070660_100014232 | Ga0070660_1000142322 | 357 |
| 387 | 3300005339 | Ga0070660_100088051 | Ga0070660_1000880513 | 357 |
| 388 | 3300005339 | Ga0070660_100118990 | Ga0070660_1001189902 | 357 |
| 389 | 3300005339 | Ga0070660_100264666 | Ga0070660_1002646662 | 357 |
| 390 | 3300005339 | Ga0070660_100288143 | Ga0070660_1002881431 | 357 |
| 391 | 3300005344 | Ga0070661_100000251 | Ga0070661_1000002516 | 357 |
| 392 | 3300005344 | Ga0070661_100093457 | Ga0070661_1000934572 | 357 |
| 393 | 3300005345 | Ga0070692_10053613 | Ga0070692_100536132 | 357 |
| 394 | 3300005353 | Ga0070669_100000319 | Ga0070669_1000003198 | 357 |
| 395 | 3300005353 | Ga0070669_100104940 | Ga0070669_1001049402 | 357 |
| 396 | 3300005354 | Ga0070675_100004372 | Ga0070675_1000043728 | 357 |
| 397 | 3300005354 | Ga0070675_100008839 | Ga0070675_1000088392 | 357 |
| 398 | 3300005354 | Ga0070675_100079735 | Ga0070675_1000797352 | 357 |
| 399 | 3300005354 | Ga0070675_100270921 | Ga0070675_1002709212 | 357 |
| 400 | 3300005355 | Ga0070671_100001617 | Ga0070671_10000161715 | 357 |
| 401 | 3300005355 | Ga0070671_100042974 | Ga0070671_1000429742 | 357 |
| 402 | 3300005355 | Ga0070671_100047417 | Ga0070671_1000474173 | 357 |
| 403 | 3300005356 | Ga0070674_100076700 | Ga0070674_1000767002 | 357 |
| 404 | 3300005364 | Ga0070673_100000675 | Ga0070673_10000067510 | 357 |
| 405 | 3300005364 | Ga0070673_100009692 | Ga0070673_1000096924 | 357 |
| 406 | 3300005364 | Ga0070673_100072884 | Ga0070673_1000728842 | 357 |
| 407 | 3300005366 | Ga0070659_100000254 | Ga0070659_10000025415 | 357 |
| 408 | 3300005366 | Ga0070659_100001722 | Ga0070659_10000172210 | 357 |
| 409 | 3300005366 | Ga0070659_100008405 | Ga0070659_1000084051 | 357 |
| 410 | 3300005366 | Ga0070659_100022101 | Ga0070659_1000221013 | 357 |
| 411 | 3300005366 | Ga0070659_100118184 | Ga0070659_1001181841 | 357 |
| 412 | 3300005366 | Ga0070659_100214898 | Ga0070659_1002148981 | 357 |
| 413 | 3300005367 | Ga0070667_100004784 | Ga0070667_1000047848 | 357 |
| 414 | 3300005367 | Ga0070667_100022125 | Ga0070667_1000221252 | 357 |
| 415 | 3300005367 | Ga0070667_100060499 | Ga0070667_1000604992 | 357 |
| 416 | 3300005367 | Ga0070667_100304973 | Ga0070667_1003049731 | 357 |
| 417 | 3300005435 | Ga0070714_100033443 | Ga0070714_1000334432 | 357 |
| 418 | 3300005435 | Ga0070714_100033859 | Ga0070714_1000338594 | 357 |
| 419 | 3300005444 | Ga0070694_100087830 | Ga0070694_1000878302 | 357 |
| 420 | 3300005455 | Ga0070663_100000089 | Ga0070663_10000008919 | 357 |
| 421 | 3300005455 | Ga0070663_100011503 | Ga0070663_1000115033 | 357 |
| 422 | 3300005455 | Ga0070663_100050002 | Ga0070663_1000500022 | 357 |
| 423 | 3300005455 | Ga0070663_100152034 | Ga0070663_1001520342 | 357 |
| 424 | 3300005455 | Ga0070663_100188663 | Ga0070663_1001886631 | 357 |
| 425 | 3300005455 | Ga0070663_100362044 | Ga0070663_1003620441 | 357 |
| 426 | 3300005456 | Ga0070678_100097762 | Ga0070678_1000977622 | 357 |
| 427 | 3300005457 | Ga0070662_100000023 | Ga0070662_10000002341 | 357 |
| 428 | 3300005457 | Ga0070662_100000934 | Ga0070662_1000009349 | 357 |
| 429 | 3300005457 | Ga0070662_100005820 | Ga0070662_1000058201 | 357 |
| 430 | 3300005457 | Ga0070662_100022871 | Ga0070662_1000228713 | 357 |
| 431 | 3300005457 | Ga0070662_100062257 | Ga0070662_1000622572 | 357 |
| 432 | 3300005457 | Ga0070662_100115991 | Ga0070662_1001159912 | 357 |
| 433 | 3300005457 | Ga0070662_100198940 | Ga0070662_1001989402 | 357 |
| 434 | 3300005458 | Ga0070681_10109637 | Ga0070681_101096374 | 357 |
| 435 | 3300005458 | Ga0070681_10128720 | Ga0070681_101287203 | 357 |
| 436 | 3300005458 | Ga0070681_10205840 | Ga0070681_102058402 | 357 |
| 437 | 3300005458 | Ga0070681_10408852 | Ga0070681_104088521 | 357 |
| 438 | 3300005459 | Ga0068867_100003550 | Ga0068867_1000035501 | 357 |
| 439 | 3300005459 | Ga0068867_100222577 | Ga0068867_1002225771 | 357 |
| 440 | 3300005530 | Ga0070679_100015465 | Ga0070679_1000154652 | 357 |
| 441 | 3300005530 | Ga0070679_100086549 | Ga0070679_1000865492 | 357 |
| 442 | 3300005535 | Ga0070684_100165230 | Ga0070684_1001652302 | 357 |
| 443 | 3300005539 | Ga0068853_100000491 | Ga0068853_1000004916 | 357 |
| 444 | 3300005539 | Ga0068853_100015019 | Ga0068853_1000150194 | 357 |
| 445 | 3300005539 | Ga0068853_100445949 | Ga0068853_1004459491 | 357 |
| 446 | 3300005543 | Ga0070672_100027109 | Ga0070672_1000271094 | 357 |
| 447 | 3300005543 | Ga0070672_100056233 | Ga0070672_1000562333 | 357 |
| 448 | 3300005543 | Ga0070672_100086467 | Ga0070672_1000864673 | 357 |
| 449 | 3300005546 | Ga0070696_100006262 | Ga0070696_1000062628 | 357 |
| 450 | 3300005547 | Ga0070693_100001473 | Ga0070693_1000014734 | 357 |
| 451 | 3300005547 | Ga0070693_100087214 | Ga0070693_1000872142 | 357 |
| 452 | 3300005548 | Ga0070665_100029805 | Ga0070665_1000298053 | 357 |
| 453 | 3300005563 | Ga0068855_100003914 | Ga0068855_1000039144 | 357 |
| 454 | 3300005563 | Ga0068855_100010483 | Ga0068855_10001048312 | 357 |
| 455 | 3300005563 | Ga0068855_100063810 | Ga0068855_1000638104 | 357 |
| 456 | 3300005563 | Ga0068855_100075717 | Ga0068855_1000757172 | 357 |
| 457 | 3300005563 | Ga0068855_100124556 | Ga0068855_1001245562 | 357 |
| 458 | 3300005564 | Ga0070664_100000951 | Ga0070664_10000095116 | 357 |
| 459 | 3300005564 | Ga0070664_100003472 | Ga0070664_10000347212 | 357 |
| 460 | 3300005564 | Ga0070664_100005277 | Ga0070664_10000527713 | 357 |
| 461 | 3300005564 | Ga0070664_100016044 | Ga0070664_1000160446 | 357 |
| 462 | 3300005564 | Ga0070664_100046538 | Ga0070664_1000465383 | 357 |
| 463 | 3300005564 | Ga0070664_100137329 | Ga0070664_1001373292 | 357 |
| 464 | 3300005564 | Ga0070664_100328277 | Ga0070664_1003282772 | 357 |
| 465 | 3300005577 | Ga0068857_100000246 | Ga0068857_10000024630 | 357 |
| 466 | 3300005577 | Ga0068857_100027732 | Ga0068857_1000277323 | 357 |
| 467 | 3300005577 | Ga0068857_100108328 | Ga0068857_1001083282 | 357 |
| 468 | 3300005578 | Ga0068854_100000337 | Ga0068854_10000033728 | 357 |
| 469 | 3300005578 | Ga0068854_100063584 | Ga0068854_1000635843 | 357 |
| 470 | 3300005614 | Ga0068856_100000128 | Ga0068856_10000012853 | 357 |
| 471 | 3300005614 | Ga0068856_100011043 | Ga0068856_1000110435 | 357 |
| 472 | 3300005614 | Ga0068856_100038399 | Ga0068856_1000383992 | 357 |
| 473 | 3300005614 | Ga0068856_100261939 | Ga0068856_1002619392 | 357 |
| 474 | 3300005614 | Ga0068856_100342438 | Ga0068856_1003424382 | 357 |
| 475 | 3300005616 | Ga0068852_100004492 | Ga0068852_1000044921 | 357 |
| 476 | 3300005616 | Ga0068852_100004895 | Ga0068852_1000048958 | 357 |
| 477 | 3300005616 | Ga0068852_100012155 | Ga0068852_1000121554 | 357 |
| 478 | 3300005616 | Ga0068852_100081452 | Ga0068852_1000814522 | 357 |
| 479 | 3300005617 | Ga0068859_100026636 | Ga0068859_1000266363 | 357 |
| 480 | 3300005617 | Ga0068859_100041454 | Ga0068859_1000414543 | 357 |
| 481 | 3300005617 | Ga0068859_100068911 | Ga0068859_1000689113 | 357 |
| 482 | 3300005618 | Ga0068864_100000810 | Ga0068864_10000081030 | 357 |
| 483 | 3300005618 | Ga0068864_100031779 | Ga0068864_1000317793 | 357 |
| 484 | 3300005618 | Ga0068864_100080580 | Ga0068864_1000805804 | 357 |
| 485 | 3300005618 | Ga0068864_100208010 | Ga0068864_1002080102 | 357 |
| 486 | 3300005718 | Ga0068866_10089172 | Ga0068866_100891722 | 357 |
| 487 | 3300005719 | Ga0068861_100020531 | Ga0068861_1000205313 | 357 |
| 488 | 3300005834 | Ga0068851_10007344 | Ga0068851_100073445 | 357 |
| 489 | 3300005834 | Ga0068851_10039294 | Ga0068851_100392943 | 357 |
| 490 | 3300005841 | Ga0068863_100011456 | Ga0068863_1000114567 | 357 |
| 491 | 3300005841 | Ga0068863_100014813 | Ga0068863_1000148134 | 357 |
| 492 | 3300005841 | Ga0068863_100083752 | Ga0068863_1000837524 | 357 |
| 493 | 3300005841 | Ga0068863_100122058 | Ga0068863_1001220582 | 357 |
| 494 | 3300005842 | Ga0068858_100001398 | Ga0068858_1000013989 | 357 |
| 495 | 3300005842 | Ga0068858_100028428 | Ga0068858_1000284284 | 357 |
| 496 | 3300005842 | Ga0068858_100090284 | Ga0068858_1000902844 | 357 |
| 497 | 3300005842 | Ga0068858_100196695 | Ga0068858_1001966951 | 357 |
| 498 | 3300005842 | Ga0068858_100246666 | Ga0068858_1002466662 | 357 |
| 499 | 3300005843 | Ga0068860_100008870 | Ga0068860_1000088707 | 357 |
| 500 | 3300005843 | Ga0068860_100042173 | Ga0068860_1000421734 | 357 |
| 501 | 3300005843 | Ga0068860_100248486 | Ga0068860_1002484862 | 357 |
| 502 | 3300005844 | Ga0068862_100012502 | Ga0068862_1000125028 | 357 |
| 503 | 3300006028 | Ga0070717_10002429 | Ga0070717_1000242914 | 357 |
| 504 | 3300006237 | Ga0097621_100163904 | Ga0097621_1001639042 | 357 |
| 505 | 3300006358 | Ga0068871_100039311 | Ga0068871_1000393113 | 357 |
| 506 | 3300006358 | Ga0068871_100059672 | Ga0068871_1000596723 | 357 |
| 507 | 3300006358 | Ga0068871_100071988 | Ga0068871_1000719882 | 357 |
| 508 | 3300006358 | Ga0068871_100096756 | Ga0068871_1000967562 | 357 |
| 509 | 3300006881 | Ga0068865_100000374 | Ga0068865_10000037428 | 357 |
| 510 | 3300006881 | Ga0068865_100029172 | Ga0068865_1000291722 | 357 |
| 511 | 3300006931 | Ga0097620_100026636 | Ga0097620_1000266363 | 357 |
| 512 | 3300006931 | Ga0097620_100041460 | Ga0097620_1000414603 | 357 |
| 513 | 3300006931 | Ga0097620_100068911 | Ga0097620_1000689112 | 357 |
| 514 | 3300009093 | Ga0105240_10042396 | Ga0105240_100423962 | 357 |
| 515 | 3300009098 | Ga0105245_10000275 | Ga0105245_1000027545 | 357 |
| 516 | 3300009147 | Ga0114129_10482387 | Ga0114129_104823872 | 357 |
| 517 | 3300009148 | Ga0105243_10097274 | Ga0105243_100972742 | 357 |
| 518 | 3300009174 | Ga0105241_10068303 | Ga0105241_100683034 | 357 |
| 519 | 3300009177 | Ga0105248_10000168 | Ga0105248_1000016856 | 357 |
| 520 | 3300009177 | Ga0105248_10017719 | Ga0105248_100177196 | 357 |
| 521 | 3300009177 | Ga0105248_10050687 | Ga0105248_100506872 | 357 |
| 522 | 3300009177 | Ga0105248_10051898 | Ga0105248_100518986 | 357 |
| 523 | 3300009177 | Ga0105248_10270326 | Ga0105248_102703262 | 357 |
| 524 | 3300009545 | Ga0105237_10067428 | Ga0105237_100674283 | 357 |
| 525 | 3300009551 | Ga0105238_10105763 | Ga0105238_101057633 | 357 |
| 526 | 3300013100 | Ga0157373_10033941 | Ga0157373_100339412 | 357 |
| 527 | 3300013100 | Ga0157373_10047551 | Ga0157373_100475512 | 357 |
| 528 | 3300013100 | Ga0157373_10100804 | Ga0157373_101008042 | 357 |
| 529 | 3300013102 | Ga0157371_10000637 | Ga0157371_100006373 | 357 |
| 530 | 3300013102 | Ga0157371_10000765 | Ga0157371_1000076536 | 357 |
| 531 | 3300013102 | Ga0157371_10015562 | Ga0157371_100155626 | 357 |
| 532 | 3300013104 | Ga0157370_10023121 | Ga0157370_100231218 | 357 |
| 533 | 3300013104 | Ga0157370_10102693 | Ga0157370_101026933 | 357 |
| 534 | 3300013104 | Ga0157370_10215942 | Ga0157370_102159422 | 357 |
| 535 | 3300013105 | Ga0157369_10000553 | Ga0157369_1000055337 | 357 |
| 536 | 3300013105 | Ga0157369_10009186 | Ga0157369_100091866 | 357 |
| 537 | 3300013105 | Ga0157369_10012679 | Ga0157369_100126798 | 357 |
| 538 | 3300013105 | Ga0157369_10209745 | Ga0157369_102097452 | 357 |
| 539 | 3300013296 | Ga0157374_10029566 | Ga0157374_100295663 | 357 |
| 540 | 3300013296 | Ga0157374_10046825 | Ga0157374_100468254 | 357 |
| 541 | 3300013296 | Ga0157374_10057287 | Ga0157374_100572873 | 357 |
| 542 | 3300013297 | Ga0157378_10002341 | Ga0157378_1000234113 | 357 |
| 543 | 3300013306 | Ga0163162_10041315 | Ga0163162_100413153 | 357 |
| 544 | 3300013306 | Ga0163162_10114624 | Ga0163162_101146242 | 357 |
| 545 | 3300013307 | Ga0157372_10044309 | Ga0157372_100443093 | 357 |
| 546 | 3300013307 | Ga0157372_10191366 | Ga0157372_101913662 | 357 |
| 547 | 3300013307 | Ga0157372_10222507 | Ga0157372_102225073 | 357 |
| 548 | 3300013307 | Ga0157372_10338003 | Ga0157372_103380032 | 357 |
| 549 | 3300013307 | Ga0157372_10470850 | Ga0157372_104708502 | 357 |
| 550 | 3300013308 | Ga0157375_10024591 | Ga0157375_100245913 | 357 |
| 551 | 3300013308 | Ga0157375_10234854 | Ga0157375_102348542 | 357 |
| 552 | 3300014325 | Ga0163163_10000151 | Ga0163163_1000015136 | 357 |
| 553 | 3300014325 | Ga0163163_10020309 | Ga0163163_100203094 | 357 |
| 554 | 3300014325 | Ga0163163_10219782 | Ga0163163_102197821 | 357 |
| 555 | 3300014968 | Ga0157379_10001085 | Ga0157379_1000108514 | 357 |
| 556 | 3300014968 | Ga0157379_10157663 | Ga0157379_101576633 | 357 |
| 557 | 3300017792 | Ga0163161_10061084 | Ga0163161_100610842 | 357 |
| 558 | 3300017792 | Ga0163161_10334649 | Ga0163161_103346492 | 357 |
| 559 | 3300025315 | Ga0207697_10000112 | Ga0207697_100001121 | 357 |
| 560 | 3300025315 | Ga0207697_10046664 | Ga0207697_100466642 | 357 |
| 561 | 3300025321 | Ga0207656_10013006 | Ga0207656_100130063 | 357 |
| 562 | 3300025893 | Ga0207682_10006022 | Ga0207682_100060223 | 357 |
| 563 | 3300025893 | Ga0207682_10038635 | Ga0207682_100386352 | 357 |
| 564 | 3300025899 | Ga0207642_10080653 | Ga0207642_100806532 | 357 |
| 565 | 3300025899 | Ga0207642_10166195 | Ga0207642_101661951 | 357 |
| 566 | 3300025903 | Ga0207680_10005882 | Ga0207680_100058822 | 357 |
| 567 | 3300025903 | Ga0207680_10009163 | Ga0207680_100091635 | 357 |
| 568 | 3300025904 | Ga0207647_10000101 | Ga0207647_1000010157 | 357 |
| 569 | 3300025904 | Ga0207647_10008288 | Ga0207647_100082887 | 357 |
| 570 | 3300025904 | Ga0207647_10049733 | Ga0207647_100497333 | 357 |
| 571 | 3300025907 | Ga0207645_10021817 | Ga0207645_100218173 | 357 |
| 572 | 3300025907 | Ga0207645_10130488 | Ga0207645_101304882 | 357 |
| 573 | 3300025909 | Ga0207705_10000060 | Ga0207705_100000602 | 357 |
| 574 | 3300025909 | Ga0207705_10004174 | Ga0207705_100041747 | 357 |
| 575 | 3300025909 | Ga0207705_10012399 | Ga0207705_100123994 | 357 |
| 576 | 3300025909 | Ga0207705_10020161 | Ga0207705_100201614 | 357 |
| 577 | 3300025909 | Ga0207705_10020570 | Ga0207705_100205703 | 357 |
| 578 | 3300025909 | Ga0207705_10023256 | Ga0207705_100232563 | 357 |
| 579 | 3300025912 | Ga0207707_10055094 | Ga0207707_100550942 | 357 |
| 580 | 3300025912 | Ga0207707_10154428 | Ga0207707_101544282 | 357 |
| 581 | 3300025914 | Ga0207671_10059259 | Ga0207671_100592592 | 357 |
| 582 | 3300025917 | Ga0207660_10036898 | Ga0207660_100368983 | 357 |
| 583 | 3300025918 | Ga0207662_10160548 | Ga0207662_101605482 | 357 |
| 584 | 3300025919 | Ga0207657_10000038 | Ga0207657_1000003862 | 357 |
| 585 | 3300025919 | Ga0207657_10001185 | Ga0207657_100011852 | 357 |
| 586 | 3300025919 | Ga0207657_10003350 | Ga0207657_100033504 | 357 |
| 587 | 3300025919 | Ga0207657_10005535 | Ga0207657_100055353 | 357 |
| 588 | 3300025919 | Ga0207657_10020141 | Ga0207657_100201415 | 357 |
| 589 | 3300025919 | Ga0207657_10022376 | Ga0207657_100223764 | 357 |
| 590 | 3300025919 | Ga0207657_10030396 | Ga0207657_100303963 | 357 |
| 591 | 3300025919 | Ga0207657_10048813 | Ga0207657_100488132 | 357 |
| 592 | 3300025919 | Ga0207657_10101526 | Ga0207657_101015262 | 357 |
| 593 | 3300025919 | Ga0207657_10122573 | Ga0207657_101225733 | 357 |
| 594 | 3300025920 | Ga0207649_10000826 | Ga0207649_1000082614 | 357 |
| 595 | 3300025920 | Ga0207649_10003264 | Ga0207649_100032644 | 357 |
| 596 | 3300025920 | Ga0207649_10008313 | Ga0207649_100083133 | 357 |
| 597 | 3300025920 | Ga0207649_10072670 | Ga0207649_100726702 | 357 |
| 598 | 3300025920 | Ga0207649_10143278 | Ga0207649_101432782 | 357 |
| 599 | 3300025920 | Ga0207649_10201601 | Ga0207649_102016012 | 357 |
| 600 | 3300025921 | Ga0207652_10120543 | Ga0207652_101205434 | 357 |
| 601 | 3300025921 | Ga0207652_10167716 | Ga0207652_101677162 | 357 |
| 602 | 3300025923 | Ga0207681_10001255 | Ga0207681_100012559 | 357 |
| 603 | 3300025925 | Ga0207650_10019995 | Ga0207650_100199951 | 357 |
| 604 | 3300025925 | Ga0207650_10027155 | Ga0207650_100271552 | 357 |
| 605 | 3300025925 | Ga0207650_10033921 | Ga0207650_100339213 | 357 |
| 606 | 3300025925 | Ga0207650_10085683 | Ga0207650_100856832 | 357 |
| 607 | 3300025925 | Ga0207650_10175154 | Ga0207650_101751542 | 357 |
| 608 | 3300025926 | Ga0207659_10002669 | Ga0207659_1000266914 | 357 |
| 609 | 3300025926 | Ga0207659_10049227 | Ga0207659_100492274 | 357 |
| 610 | 3300025926 | Ga0207659_10230410 | Ga0207659_102304102 | 357 |
| 611 | 3300025927 | Ga0207687_10001375 | Ga0207687_1000137511 | 357 |
| 612 | 3300025929 | Ga0207664_10021997 | Ga0207664_100219972 | 357 |
| 613 | 3300025929 | Ga0207664_10155231 | Ga0207664_101552311 | 357 |
| 614 | 3300025931 | Ga0207644_10008084 | Ga0207644_100080846 | 357 |
| 615 | 3300025931 | Ga0207644_10019570 | Ga0207644_100195704 | 357 |
| 616 | 3300025931 | Ga0207644_10024637 | Ga0207644_100246375 | 357 |
| 617 | 3300025931 | Ga0207644_10070024 | Ga0207644_100700244 | 357 |
| 618 | 3300025931 | Ga0207644_10108199 | Ga0207644_101081992 | 357 |
| 619 | 3300025931 | Ga0207644_10244357 | Ga0207644_102443571 | 357 |
| 620 | 3300025932 | Ga0207690_10000149 | Ga0207690_1000014924 | 357 |
| 621 | 3300025932 | Ga0207690_10000830 | Ga0207690_1000083015 | 357 |
| 622 | 3300025932 | Ga0207690_10069801 | Ga0207690_100698012 | 357 |
| 623 | 3300025933 | Ga0207706_10000061 | Ga0207706_1000006160 | 357 |
| 624 | 3300025933 | Ga0207706_10000318 | Ga0207706_1000031814 | 357 |
| 625 | 3300025933 | Ga0207706_10000675 | Ga0207706_1000067530 | 357 |
| 626 | 3300025933 | Ga0207706_10001971 | Ga0207706_1000197119 | 357 |
| 627 | 3300025933 | Ga0207706_10030488 | Ga0207706_100304882 | 357 |
| 628 | 3300025933 | Ga0207706_10031942 | Ga0207706_100319423 | 357 |
| 629 | 3300025933 | Ga0207706_10049774 | Ga0207706_100497744 | 357 |
| 630 | 3300025933 | Ga0207706_10076561 | Ga0207706_100765614 | 357 |
| 631 | 3300025933 | Ga0207706_10392287 | Ga0207706_103922871 | 357 |
| 632 | 3300025938 | Ga0207704_10014755 | Ga0207704_100147554 | 357 |
| 633 | 3300025938 | Ga0207704_10019113 | Ga0207704_100191132 | 357 |
| 634 | 3300025939 | Ga0207665_10054385 | Ga0207665_100543853 | 357 |
| 635 | 3300025940 | Ga0207691_10000593 | Ga0207691_100005933 | 357 |
| 636 | 3300025940 | Ga0207691_10005337 | Ga0207691_1000533711 | 357 |
| 637 | 3300025940 | Ga0207691_10042460 | Ga0207691_100424605 | 357 |
| 638 | 3300025940 | Ga0207691_10075765 | Ga0207691_100757654 | 357 |
| 639 | 3300025940 | Ga0207691_10102686 | Ga0207691_101026862 | 357 |
| 640 | 3300025941 | Ga0207711_10001606 | Ga0207711_1000160623 | 357 |
| 641 | 3300025941 | Ga0207711_10003620 | Ga0207711_100036204 | 357 |
| 642 | 3300025941 | Ga0207711_10008250 | Ga0207711_100082502 | 357 |
| 643 | 3300025941 | Ga0207711_10013967 | Ga0207711_100139674 | 357 |
| 644 | 3300025941 | Ga0207711_10101095 | Ga0207711_101010953 | 357 |
| 645 | 3300025942 | Ga0207689_10000016 | Ga0207689_1000001646 | 357 |
| 646 | 3300025944 | Ga0207661_10005095 | Ga0207661_100050953 | 357 |
| 647 | 3300025945 | Ga0207679_10009735 | Ga0207679_100097352 | 357 |
| 648 | 3300025945 | Ga0207679_10017177 | Ga0207679_100171774 | 357 |
| 649 | 3300025945 | Ga0207679_10028236 | Ga0207679_100282363 | 357 |
| 650 | 3300025945 | Ga0207679_10093663 | Ga0207679_100936632 | 357 |
| 651 | 3300025949 | Ga0207667_10006609 | Ga0207667_100066095 | 357 |
| 652 | 3300025949 | Ga0207667_10020597 | Ga0207667_100205972 | 357 |
| 653 | 3300025949 | Ga0207667_10036525 | Ga0207667_100365252 | 357 |
| 654 | 3300025949 | Ga0207667_10058591 | Ga0207667_100585913 | 357 |
| 655 | 3300025949 | Ga0207667_10168865 | Ga0207667_101688652 | 357 |
| 656 | 3300025949 | Ga0207667_10206345 | Ga0207667_102063451 | 357 |
| 657 | 3300025960 | Ga0207651_10000500 | Ga0207651_1000050014 | 357 |
| 658 | 3300025960 | Ga0207651_10012043 | Ga0207651_100120433 | 357 |
| 659 | 3300025981 | Ga0207640_10002516 | Ga0207640_100025166 | 357 |
| 660 | 3300025981 | Ga0207640_10056924 | Ga0207640_100569242 | 357 |
| 661 | 3300025981 | Ga0207640_10087960 | Ga0207640_100879601 | 357 |
| 662 | 3300025981 | Ga0207640_10093582 | Ga0207640_100935822 | 357 |
| 663 | 3300025981 | Ga0207640_10130643 | Ga0207640_101306432 | 357 |
| 664 | 3300025986 | Ga0207658_10029888 | Ga0207658_100298882 | 357 |
| 665 | 3300025986 | Ga0207658_10072673 | Ga0207658_100726732 | 357 |
| 666 | 3300026023 | Ga0207677_10001192 | Ga0207677_1000119212 | 357 |
| 667 | 3300026023 | Ga0207677_10078027 | Ga0207677_100780272 | 357 |
| 668 | 3300026035 | Ga0207703_10003151 | Ga0207703_1000315112 | 357 |
| 669 | 3300026035 | Ga0207703_10047376 | Ga0207703_100473762 | 357 |
| 670 | 3300026035 | Ga0207703_10077075 | Ga0207703_100770752 | 357 |
| 671 | 3300026041 | Ga0207639_10004735 | Ga0207639_100047353 | 357 |
| 672 | 3300026041 | Ga0207639_10005405 | Ga0207639_100054054 | 357 |
| 673 | 3300026067 | Ga0207678_10001868 | Ga0207678_100018688 | 357 |
| 674 | 3300026067 | Ga0207678_10002362 | Ga0207678_1000236217 | 357 |
| 675 | 3300026067 | Ga0207678_10003447 | Ga0207678_1000344711 | 357 |
| 676 | 3300026067 | Ga0207678_10012117 | Ga0207678_100121171 | 357 |
| 677 | 3300026067 | Ga0207678_10025662 | Ga0207678_100256622 | 357 |
| 678 | 3300026067 | Ga0207678_10031537 | Ga0207678_100315372 | 357 |
| 679 | 3300026067 | Ga0207678_10177641 | Ga0207678_101776412 | 357 |
| 680 | 3300026078 | Ga0207702_10000323 | Ga0207702_1000032311 | 357 |
| 681 | 3300026078 | Ga0207702_10007957 | Ga0207702_100079578 | 357 |
| 682 | 3300026078 | Ga0207702_10017016 | Ga0207702_100170166 | 357 |
| 683 | 3300026078 | Ga0207702_10337392 | Ga0207702_103373921 | 357 |
| 684 | 3300026088 | Ga0207641_10010383 | Ga0207641_100103835 | 357 |
| 685 | 3300026088 | Ga0207641_10017437 | Ga0207641_100174373 | 357 |
| 686 | 3300026088 | Ga0207641_10217422 | Ga0207641_102174221 | 357 |
| 687 | 3300026089 | Ga0207648_10007206 | Ga0207648_1000720614 | 357 |
| 688 | 3300026095 | Ga0207676_10001961 | Ga0207676_100019618 | 357 |
| 689 | 3300026095 | Ga0207676_10025146 | Ga0207676_100251463 | 357 |
| 690 | 3300026095 | Ga0207676_10030880 | Ga0207676_100308803 | 357 |
| 691 | 3300026095 | Ga0207676_10097809 | Ga0207676_100978093 | 357 |
| 692 | 3300026095 | Ga0207676_10134383 | Ga0207676_101343832 | 357 |
| 693 | 3300026116 | Ga0207674_10000114 | Ga0207674_1000011494 | 357 |
| 694 | 3300026116 | Ga0207674_10003420 | Ga0207674_1000342012 | 357 |
| 695 | 3300026116 | Ga0207674_10038316 | Ga0207674_100383162 | 357 |
| 696 | 3300026116 | Ga0207674_10073446 | Ga0207674_100734462 | 357 |
| 697 | 3300026118 | Ga0207675_100087559 | Ga0207675_1000875594 | 357 |
| 698 | 3300026121 | Ga0207683_10035193 | Ga0207683_100351932 | 357 |
| 699 | 3300026121 | Ga0207683_10073276 | Ga0207683_100732762 | 357 |
| 700 | 3300026142 | Ga0207698_10004921 | Ga0207698_100049217 | 357 |
| 701 | 3300026142 | Ga0207698_10035723 | Ga0207698_100357231 | 357 |
| 702 | 3300026142 | Ga0207698_10073286 | Ga0207698_100732862 | 357 |
| 703 | 3300026142 | Ga0207698_10091421 | Ga0207698_100914212 | 357 |
| 704 | 3300026142 | Ga0207698_10339995 | Ga0207698_103399951 | 357 |
| 705 | 3300028379 | Ga0268266_10021267 | Ga0268266_100212675 | 357 |
| 706 | 3300028379 | Ga0268266_10150457 | Ga0268266_101504572 | 357 |
| 707 | 3300028380 | Ga0268265_10005379 | Ga0268265_100053794 | 357 |
| 708 | 3300028380 | Ga0268265_10040259 | Ga0268265_100402592 | 357 |
| 709 | 3300031548 | Ga0307408_100003245 | Ga0307408_1000032453 | 357 |
| 710 | 3300031548 | Ga0307408_100258195 | Ga0307408_1002581952 | 357 |
| 711 | 3300031731 | Ga0307405_10004008 | Ga0307405_100040082 | 357 |
| 712 | 3300031824 | Ga0307413_10002155 | Ga0307413_100021559 | 357 |
| 713 | 3300031824 | Ga0307413_10003599 | Ga0307413_100035997 | 357 |
| 714 | 3300031824 | Ga0307413_10027746 | Ga0307413_100277462 | 357 |
| 715 | 3300031852 | Ga0307410_10016223 | Ga0307410_100162232 | 357 |
| 716 | 3300031852 | Ga0307410_10027400 | Ga0307410_100274002 | 357 |
| 717 | 3300031852 | Ga0307410_10148273 | Ga0307410_101482732 | 357 |
| 718 | 3300031901 | Ga0307406_10006909 | Ga0307406_100069095 | 357 |
| 719 | 3300031901 | Ga0307406_10029115 | Ga0307406_100291152 | 357 |
| 720 | 3300031903 | Ga0307407_10001159 | Ga0307407_100011593 | 357 |
| 721 | 3300031903 | Ga0307407_10006912 | Ga0307407_100069125 | 357 |
| 722 | 3300031995 | Ga0307409_100001176 | Ga0307409_10000117610 | 357 |
| 723 | 3300031995 | Ga0307409_100084490 | Ga0307409_1000844903 | 357 |
| 724 | 3300032002 | Ga0307416_100010539 | Ga0307416_1000105393 | 357 |
| 725 | 3300032002 | Ga0307416_100132452 | Ga0307416_1001324522 | 357 |
| 726 | 3300032004 | Ga0307414_10004745 | Ga0307414_100047459 | 357 |
| 727 | 3300032004 | Ga0307414_10023014 | Ga0307414_100230142 | 357 |
| 728 | 3300032004 | Ga0307414_10031315 | Ga0307414_100313152 | 357 |
| 729 | 3300032005 | Ga0307411_10002611 | Ga0307411_100026118 | 357 |
| 730 | 3300032005 | Ga0307411_10005035 | Ga0307411_100050353 | 357 |
| 731 | 3300032005 | Ga0307411_10025193 | Ga0307411_100251934 | 357 |
| 732 | 3300032005 | Ga0307411_10117202 | Ga0307411_101172021 | 357 |
| 733 | 3300032126 | Ga0307415_100005212 | Ga0307415_1000052123 | 357 |
| 734 | 3300032126 | Ga0307415_100009537 | Ga0307415_1000095372 | 357 |
| 735 | 3300035691 | Ga0373931_0014195 | Ga0373931_0014195_1341_2414 | 357 |
| 736 | 3300035695 | Ga0373927_0174894 | Ga0373927_0174894_41_1114 | 357 |
| 737 | 3300037068 | Ga0373925_0009801 | Ga0373925_0009801_200_1273 | 357 |
| 738 | 3300037312 | Ga0395899_0000258 | Ga0395899_0000258_54582_55655 | 357 |
| 739 | 3300037312 | Ga0395899_0018801 | Ga0395899_0018801_1373_2446 | 357 |
| 740 | 3300037312 | Ga0395899_0041621 | Ga0395899_0041621_959_2032 | 357 |
| 741 | 3300037312 | Ga0395899_0042901 | Ga0395899_0042901_410_1483 | 357 |
| 742 | 3300037312 | Ga0395899_0147345 | Ga0395899_0147345_333_1406 | 357 |
| 743 | 3300037418 | Ga0395900_0000254 | Ga0395900_0000254_11628_12701 | 357 |
| 744 | 3300037418 | Ga0395900_0007133 | Ga0395900_0007133_9103_10176 | 357 |
| 745 | 3300037418 | Ga0395900_0009104 | Ga0395900_0009104_5036_6109 | 357 |
| 746 | 3300037418 | Ga0395900_0013457 | Ga0395900_0013457_292_1365 | 357 |
| 747 | 3300037418 | Ga0395900_0043697 | Ga0395900_0043697_1768_2841 | 357 |
| 748 | 3300037418 | Ga0395900_0062981 | Ga0395900_0062981_1274_2347 | 357 |
| 749 | 3300037418 | Ga0395900_0067482 | Ga0395900_0067482_110_1183 | 357 |
| 750 | 3300037418 | Ga0395900_0094714 | Ga0395900_0094714_509_1582 | 357 |
| 751 | 3300037418 | Ga0395900_0160998 | Ga0395900_0160998_251_1324 | 357 |
| 752 | 3300037418 | Ga0395900_0328359 | Ga0395900_0328359_391_1464 | 357 |
| 753 | 3300037466 | Ga0395898_0019198 | Ga0395898_0019198_3194_4267 | 357 |
| 754 | 3300037466 | Ga0395898_0027557 | Ga0395898_0027557_644_1717 | 357 |
| 755 | 3300037466 | Ga0395898_0040032 | Ga0395898_0040032_1115_2188 | 357 |
| 756 | 3300037466 | Ga0395898_0229502 | Ga0395898_0229502_618_1691 | 357 |
| 757 | 3300037466 | Ga0395898_0275711 | Ga0395898_0275711_14_1087 | 357 |
| 758 | 3300037466 | Ga0395898_0352878 | Ga0395898_0352878_99_1172 | 357 |
| 759 | 3300037471 | Ga0395905_0009508 | Ga0395905_0009508_3932_5005 | 357 |
| 760 | 3300037471 | Ga0395905_0016148 | Ga0395905_0016148_137_1210 | 357 |
| 761 | 3300037471 | Ga0395905_0020800 | Ga0395905_0020800_2686_3759 | 357 |
| 762 | 3300037471 | Ga0395905_0027698 | Ga0395905_0027698_2899_3972 | 357 |
| 763 | 3300037471 | Ga0395905_0062151 | Ga0395905_0062151_2135_3208 | 357 |
| 764 | 3300037471 | Ga0395905_0068691 | Ga0395905_0068691_1729_2802 | 357 |
| 765 | 3300037471 | Ga0395905_0110604 | Ga0395905_0110604_401_1474 | 357 |
| 766 | 3300037471 | Ga0395905_0111048 | Ga0395905_0111048_1356_2429 | 357 |
| 767 | 3300037471 | Ga0395905_0143265 | Ga0395905_0143265_868_1941 | 357 |
| 768 | 3300037471 | Ga0395905_0238348 | Ga0395905_0238348_133_1206 | 357 |
| 769 | 3300038443 | Ga0395901_0000030 | Ga0395901_0000030_70596_71669 | 357 |
| 770 | 3300038443 | Ga0395901_0004476 | Ga0395901_0004476_1840_2913 | 357 |
| 771 | 3300038443 | Ga0395901_0019472 | Ga0395901_0019472_332_1405 | 357 |
| 772 | 3300038443 | Ga0395901_0067486 | Ga0395901_0067486_841_1914 | 357 |
| 773 | 3300038443 | Ga0395901_0073961 | Ga0395901_0073961_1667_2740 | 357 |
| 774 | 3300038443 | Ga0395901_0077000 | Ga0395901_0077000_1593_2666 | 357 |
| 775 | 3300038443 | Ga0395901_0135498 | Ga0395901_0135498_978_2051 | 357 |
| 776 | 3300038443 | Ga0395901_0147233 | Ga0395901_0147233_182_1255 | 357 |
| 777 | 3300038443 | Ga0395901_0151992 | Ga0395901_0151992_244_1317 | 357 |
| 778 | 3300038443 | Ga0395901_0155955 | Ga0395901_0155955_46_1119 | 357 |
| 779 | 3300038443 | Ga0395901_0298533 | Ga0395901_0298533_265_1338 | 357 |
| 780 | 3300039437 | Ga0436365_0126786 | Ga0436365_0126786_3837_4910 | 357 |
| 781 | 3300042144 | Ga0450889_001175 | Ga0450889_001175_708_1781 | 357 |
| 782 | 3300044656 | Ga0466969_0011487 | Ga0466969_0011487_1999_3072 | 357 |
| 783 | 3300044656 | Ga0466969_0074562 | Ga0466969_0074562_429_1502 | 357 |
| 784 | 3300044684 | Ga0466966_0000040 | Ga0466966_0000040_33007_34080 | 357 |
| 785 | 3300044684 | Ga0466966_0004335 | Ga0466966_0004335_5327_6400 | 357 |
| 786 | 3300044693 | Ga0466961_0006392 | Ga0466961_0006392_2373_3446 | 357 |
| 787 | 3300044693 | Ga0466961_0086795 | Ga0466961_0086795_798_1871 | 357 |
| 788 | 3300044694 | Ga0466963_0009390 | Ga0466963_0009390_2841_3914 | 357 |
| 789 | 3300044694 | Ga0466963_0028783 | Ga0466963_0028783_704_1777 | 357 |
| 790 | 3300044694 | Ga0466963_0031163 | Ga0466963_0031163_2118_3191 | 357 |
| 791 | 3300044694 | Ga0466963_0033043 | Ga0466963_0033043_895_1968 | 357 |
| 792 | 3300044694 | Ga0466963_0063197 | Ga0466963_0063197_647_1720 | 357 |
| 793 | 3300044694 | Ga0466963_0070586 | Ga0466963_0070586_409_1482 | 357 |
| 794 | 3300044719 | Ga0466971_0053818 | Ga0466971_0053818_508_1581 | 357 |
| 795 | 3300044765 | Ga0466970_0056181 | Ga0466970_0056181_35_1108 | 357 |
| 796 | 3300044765 | Ga0466970_0064849 | Ga0466970_0064849_53_1126 | 357 |
| 797 | 3300044842 | Ga0466957_0003417 | Ga0466957_0003417_7500_8573 | 357 |
| 798 | 3300044842 | Ga0466957_0019654 | Ga0466957_0019654_2309_3382 | 357 |
| 799 | 3300044842 | Ga0466957_0029485 | Ga0466957_0029485_1681_2754 | 357 |
| 800 | 3300044842 | Ga0466957_0029692 | Ga0466957_0029692_1499_2572 | 357 |
| 801 | 3300044842 | Ga0466957_0182719 | Ga0466957_0182719_118_1191 | 357 |
| 802 | 3300045049 | Ga0466959_0004031 | Ga0466959_0004031_6216_7289 | 357 |
| 803 | 3300045049 | Ga0466959_0031814 | Ga0466959_0031814_999_2072 | 357 |
| 804 | 3300045049 | Ga0466959_0032422 | Ga0466959_0032422_2749_3822 | 357 |
| 805 | 3300045836 | Ga0466958_0000227 | Ga0466958_0000227_17755_18828 | 357 |
| 806 | 3300045836 | Ga0466958_0004118 | Ga0466958_0004118_5566_6639 | 357 |
| 807 | 3300045836 | Ga0466958_0115779 | Ga0466958_0115779_552_1625 | 357 |
| 808 | 3300045836 | Ga0466958_0225789 | Ga0466958_0225789_83_1156 | 357 |
| 809 | 3300045976 | Ga0466967_0034699 | Ga0466967_0034699_1703_2776 | 357 |
| 810 | 3300045976 | Ga0466967_0038877 | Ga0466967_0038877_945_2018 | 357 |
| 811 | 3300045976 | Ga0466967_0044996 | Ga0466967_0044996_989_2062 | 357 |
| 812 | 3300045976 | Ga0466967_0062758 | Ga0466967_0062758_1860_2933 | 357 |
| 813 | 3300045976 | Ga0466967_0068401 | Ga0466967_0068401_650_1723 | 357 |
| 814 | 3300045976 | Ga0466967_0229391 | Ga0466967_0229391_38_1111 | 357 |
| 815 | 3300046684 | Ga0495669_0004180 | Ga0495669_0004180_1480_2553 | 357 |
| 816 | 3300046684 | Ga0495669_0025617 | Ga0495669_0025617_556_1629 | 357 |
| 817 | 3300047445 | Ga0495677_0017404 | Ga0495677_0017404_1103_2176 | 357 |
| 818 | 3300048903 | Ga0496100_0159425 | Ga0496100_0159425_168_1241 | 357 |
| 819 | 3300048905 | Ga0496102_0136167 | Ga0496102_0136167_604_1677 | 357 |
| 820 | 3300048907 | Ga0496104_0373722 | Ga0496104_0373722_121_1194 | 357 |
| 821 | 3300048910 | Ga0496107_0022302 | Ga0496107_0022302_128_1201 | 357 |
| 822 | 3300048910 | Ga0496107_0167768 | Ga0496107_0167768_356_1429 | 357 |
| 823 | 3300048911 | Ga0496108_0006554 | Ga0496108_0006554_5285_6358 | 357 |
| 824 | 3300048911 | Ga0496108_0009931 | Ga0496108_0009931_1694_2767 | 357 |
| 825 | 3300048912 | Ga0496109_0013073 | Ga0496109_0013073_2205_3278 | 357 |
| 826 | 3300048912 | Ga0496109_0031162 | Ga0496109_0031162_1915_2988 | 357 |
| 827 | 3300048912 | Ga0496109_0109597 | Ga0496109_0109597_808_1881 | 357 |
| 828 | 3300048913 | Ga0496110_0017853 | Ga0496110_0017853_4285_5358 | 357 |
| 829 | 3300048913 | Ga0496110_0021098 | Ga0496110_0021098_2468_3541 | 357 |
| 830 | 3300048914 | Ga0496111_0000518 | Ga0496111_0000518_6195_7268 | 357 |
| 831 | 3300048914 | Ga0496111_0023084 | Ga0496111_0023084_451_1524 | 357 |
| 832 | 3300048914 | Ga0496111_0127537 | Ga0496111_0127537_155_1228 | 357 |
| 833 | 3300048915 | Ga0496112_0040303 | Ga0496112_0040303_1372_2445 | 357 |
| 834 | 3300048916 | Ga0496113_0001577 | Ga0496113_0001577_4486_5559 | 357 |
| 835 | 3300048917 | Ga0496114_0009753 | Ga0496114_0009753_3300_4373 | 357 |
| 836 | 3300049585 | Ga0501069_0158041 | Ga0501069_0158041_109_1182 | 357 |
| 837 | 3300049765 | Ga0501268_019884 | Ga0501268_019884_20_1093 | 357 |
| 838 | 3300061719 | Ga0466962_0017481 | Ga0466962_0017481_359_1432 | 357 |
| 839 | 3300061719 | Ga0466962_0023228 | Ga0466962_0023228_1498_2571 | 357 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wcq-assembly1.cif.gz_A | crystal structure analysis of cyanidioschyzon melorae ferredoxin d58n mutant | 0.8931 | 269 | 352 |
| 1off-assembly1.cif.gz_A | 2fe-2s ferredoxin from synechocystis sp. pcc 6803 | 0.8887 | 269 | 352 |
| 1frd-assembly1.cif.gz_A | molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution | 0.8886 | 269 | 352 |
| 1qob-assembly2.cif.gz_B | ferredoxin mutation d62k | 0.8854 | 269 | 352 |
| 3ab5-assembly2.cif.gz_B | crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae | 0.8844 | 269 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71846_339_440_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9866 | 5 | 104 | 2.40.30.10 |
| af_P76081_101_242_3.40.50.80 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module | 0.9706 | 102 | 244 | 3.40.50.80 |
| af_P76081_101_242_3.40.50.80 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module | 0.964 | 102 | 244 | 3.40.50.80 |
| af_P71846_447_583_3.40.50.80 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module | 0.9602 | 112 | 249 | 3.40.50.80 |
| af_P71846_339_440_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9582 | 5 | 104 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1TLK3-F1-model_v4 | deleted | 0.9946 | 4 | 171 |
|
| AF-A0A2N2ZKM1-F1-model_v4 | FAD-binding FR-type domain-containing protein | 0.9889 | 1 | 84 |
GO:0016491
GO:0050660 GO:0051537 |
| AF-A0A3B8YF48-F1-model_v4 | deleted | 0.985 | 1 | 93 |
|
| AF-A0A090PR40-F1-model_v4 | deleted | 0.9832 | 4 | 188 |
|
| AF-A0A3B0TAC2-F1-model_v4 | FAD-binding FR-type domain-containing protein | 0.9772 | 1 | 150 |
GO:0016491
GO:0050660 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar