F483040

General Info

Members Datasets Scaffolds Average Seq Length
840 245 840 57

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1031894|JGI24736J21556_10318942
Length 59
Sequence MATQDRIYFAQRAAEEQELAISSDDPDVAEAHRKLQRAYLERASVGERPAIQLPAQPIA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
195 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
196 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
197 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
198 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
231 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
232 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
233 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
234 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
235 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
236 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
239 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
240 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
241 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
242 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
243 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.76
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1031894 3300001904 Bacteria 814
2 JGI24741J21665_1035010 3300001915 Bacteria 746
3 JGI24741J21665_1067737 3300001915 Bacteria 528
4 JGI24740J21852_10011555 3300001979 Bacteria 3359
5 JGI24740J21852_10015401 3300001979 Bacteria 2793
6 JGI24740J21852_10074816 3300001979 Bacteria 898
7 JGI24740J21852_10084697 3300001979 Bacteria 825
8 JGI24739J22299_10007851 3300001989 Bacteria 3992
9 JGI24737J22298_10000832 3300001990 Bacteria 10982
10 JGI24737J22298_10036820 3300001990 Bacteria 1510
11 JGI24737J22298_10089095 3300001990 Bacteria 915
12 JGI24735J21928_10004365 3300002067 Bacteria 4759
13 JGI24738J21930_10001094 3300002075 Bacteria 7665
14 JGI24034J26672_10083741 3300002239 Bacteria 585
15 rootH1_10019858 3300003323 Bacteria 1083
16 Ga0070658_10000453 3300005327 Bacteria 35538
17 Ga0070658_10021750 3300005327 Bacteria 5141
18 Ga0070658_10032398 3300005327 Bacteria 4201
19 Ga0070658_10052796 3300005327 Bacteria 3297
20 Ga0070658_10074834 3300005327 Bacteria 2777
21 Ga0070658_10134112 3300005327 Bacteria 2065
22 Ga0070658_10179207 3300005327 Bacteria 1783
23 Ga0070658_10269566 3300005327 Bacteria 1447
24 Ga0070658_10279940 3300005327 Bacteria 1420
25 Ga0070658_10316630 3300005327 Bacteria 1332
26 Ga0070658_10325594 3300005327 Bacteria 1313
27 Ga0070658_11439996 3300005327 Bacteria 598
28 Ga0070683_100011627 3300005329 Bacteria 7619
29 Ga0070683_100019423 3300005329 Bacteria 6036
30 Ga0070683_100101421 3300005329 Bacteria 2710
31 Ga0070683_100423572 3300005329 Bacteria 1270
32 Ga0070683_100895421 3300005329 Bacteria 851
33 Ga0070683_100931072 3300005329 Bacteria 834
34 Ga0070683_102011379 3300005329 Unclassified 555
35 Ga0070690_100001152 3300005330 Bacteria 13610
36 Ga0070690_100318396 3300005330 Bacteria 1120
37 Ga0070690_100486886 3300005330 Bacteria 920
38 Ga0070670_100005622 3300005331 Bacteria 10577
39 Ga0070670_100031334 3300005331 Bacteria 4579
40 Ga0070670_100175019 3300005331 Bacteria 1862
41 Ga0070670_100409845 3300005331 Bacteria 1197
42 Ga0070670_100712289 3300005331 Bacteria 903
43 Ga0070670_100767140 3300005331 Bacteria 870
44 Ga0070670_100892285 3300005331 Bacteria 806
45 Ga0070670_101668958 3300005331 Bacteria 586
46 Ga0070670_101992042 3300005331 Bacteria 535
47 Ga0070677_10179546 3300005333 Bacteria 1007
48 Ga0070677_10602095 3300005333 Bacteria 609
49 Ga0070666_10000215 3300005335 Bacteria 39675
50 Ga0070666_10001156 3300005335 Bacteria 16024
51 Ga0070666_10016884 3300005335 Bacteria 4674
52 Ga0070666_10159798 3300005335 Bacteria 1575
53 Ga0070666_11010514 3300005335 Bacteria 617
54 Ga0070680_100032551 3300005336 Bacteria 4197
55 Ga0070680_100126344 3300005336 Bacteria 2137
56 Ga0070680_100452584 3300005336 Bacteria 1097
57 Ga0070680_100551589 3300005336 Bacteria 988
58 Ga0070680_100660329 3300005336 Bacteria 899
59 Ga0070680_100941569 3300005336 Bacteria 745
60 Ga0070680_101389410 3300005336 Bacteria 608
61 Ga0070682_100036603 3300005337 Bacteria 3001
62 Ga0070682_100346490 3300005337 Bacteria 1106
63 Ga0068868_100003281 3300005338 Bacteria 11260
64 Ga0068868_100104592 3300005338 Bacteria 2295
65 Ga0068868_100294037 3300005338 Bacteria 1378
66 Ga0070660_100000488 3300005339 Bacteria 26536
67 Ga0070660_100000678 3300005339 Bacteria 22503
68 Ga0070660_100029505 3300005339 Bacteria 4111
69 Ga0070660_100039840 3300005339 Bacteria 3572
70 Ga0070660_100072300 3300005339 Bacteria 2695
71 Ga0070660_100138170 3300005339 Bacteria 1953
72 Ga0070660_100164935 3300005339 Bacteria 1787
73 Ga0070660_100232619 3300005339 Bacteria 1500
74 Ga0070660_101069563 3300005339 Bacteria 682
75 Ga0070689_100082305 3300005340 Bacteria 2528
76 Ga0070691_11072063 3300005341 Unclassified 506
77 Ga0070687_100115377 3300005343 Bacteria 1527
78 Ga0070661_100000311 3300005344 Bacteria 39261
79 Ga0070661_100009119 3300005344 Bacteria 6857
80 Ga0070661_100019093 3300005344 Bacteria 4881
81 Ga0070661_100034471 3300005344 Bacteria 3670
82 Ga0070661_100083455 3300005344 Bacteria 2360
83 Ga0070661_100221201 3300005344 Bacteria 1452
84 Ga0070661_100280495 3300005344 Bacteria 1292
85 Ga0070661_100386994 3300005344 Bacteria 1103
86 Ga0070661_100604439 3300005344 Bacteria 887
87 Ga0070661_101156747 3300005344 Unclassified 646
88 Ga0070661_101213872 3300005344 Bacteria 631
89 Ga0070692_10032892 3300005345 Bacteria 2611
90 Ga0070692_10141619 3300005345 Bacteria 1361
91 Ga0070692_11139777 3300005345 Unclassified 552
92 Ga0070668_100083764 3300005347 Bacteria 2504
93 Ga0070668_100376342 3300005347 Bacteria 1207
94 Ga0070669_100517922 3300005353 Bacteria 991
95 Ga0070669_101875985 3300005353 Unclassified 523
96 Ga0070675_100457032 3300005354 Unclassified 1146
97 Ga0070675_100704312 3300005354 Bacteria 920
98 Ga0070671_100013021 3300005355 Bacteria 6704
99 Ga0070671_100026186 3300005355 Bacteria 4792
100 Ga0070671_100274093 3300005355 Bacteria 1434
101 Ga0070671_100349159 3300005355 Bacteria 1262
102 Ga0070671_100767129 3300005355 Bacteria 839
103 Ga0070674_100017266 3300005356 Bacteria 4536
104 Ga0070674_100308488 3300005356 Bacteria 1264
105 Ga0070673_100013350 3300005364 Bacteria 5678
106 Ga0070673_100097879 3300005364 Bacteria 2410
107 Ga0070673_102233371 3300005364 Unclassified 520
108 Ga0070688_100290560 3300005365 Bacteria 1178
109 Ga0070659_100000594 3300005366 Bacteria 26514
110 Ga0070659_100008920 3300005366 Bacteria 7350
111 Ga0070659_100021739 3300005366 Bacteria 4892
112 Ga0070659_100024090 3300005366 Bacteria 4664
113 Ga0070659_100032050 3300005366 Bacteria 4074
114 Ga0070659_100048299 3300005366 Bacteria 3343
115 Ga0070659_100059160 3300005366 Bacteria 3025
116 Ga0070659_100106737 3300005366 Bacteria 2258
117 Ga0070659_100187115 3300005366 Bacteria 1701
118 Ga0070659_100304191 3300005366 Bacteria 1330
119 Ga0070659_100369752 3300005366 Bacteria 1206
120 Ga0070659_100920631 3300005366 Bacteria 765
121 Ga0070667_100000842 3300005367 Bacteria 28434
122 Ga0070667_100006873 3300005367 Bacteria 9455
123 Ga0070667_100288724 3300005367 Bacteria 1474
124 Ga0070667_100891502 3300005367 Bacteria 828
125 Ga0070667_102071338 3300005367 Bacteria 536
126 Ga0070714_100271398 3300005435 Bacteria 1573
127 Ga0070714_100383278 3300005435 Bacteria 1326
128 Ga0070714_100447321 3300005435 Bacteria 1227
129 Ga0070714_101058393 3300005435 Unclassified 790
130 Ga0070713_100058014 3300005436 Bacteria 3226
131 Ga0070713_100977396 3300005436 Unclassified 816
132 Ga0070713_101581598 3300005436 Bacteria 636
133 Ga0070705_100639262 3300005440 Bacteria 828
134 Ga0070694_100021107 3300005444 Bacteria 4159
135 Ga0070663_100000936 3300005455 Bacteria 15858
136 Ga0070663_100003876 3300005455 Bacteria 8716
137 Ga0070663_100240881 3300005455 Bacteria 1427
138 Ga0070663_100402770 3300005455 Bacteria 1119
139 Ga0070663_100517971 3300005455 Bacteria 993
140 Ga0070663_100525254 3300005455 Bacteria 986
141 Ga0070663_100759149 3300005455 Bacteria 829
142 Ga0070663_101398270 3300005455 Bacteria 620
143 Ga0070678_100136929 3300005456 Bacteria 1954
144 Ga0070678_100238809 3300005456 Bacteria 1518
145 Ga0070662_100000198 3300005457 Bacteria 35360
146 Ga0070662_100003839 3300005457 Bacteria 9411
147 Ga0070662_100013241 3300005457 Bacteria 5484
148 Ga0070662_100097939 3300005457 Bacteria 2214
149 Ga0070662_100131087 3300005457 Bacteria 1933
150 Ga0070662_100218208 3300005457 Bacteria 1520
151 Ga0070662_100359167 3300005457 Bacteria 1195
152 Ga0070662_100611683 3300005457 Bacteria 917
153 Ga0070662_100726714 3300005457 Bacteria 841
154 Ga0070662_101083660 3300005457 Bacteria 687
155 Ga0070662_101517800 3300005457 Bacteria 578
156 Ga0070662_101898125 3300005457 Bacteria 515
157 Ga0070681_10063375 3300005458 Bacteria 3669
158 Ga0070681_10308950 3300005458 Bacteria 1491
159 Ga0070681_10391506 3300005458 Bacteria 1301
160 Ga0070681_10689912 3300005458 Bacteria 937
161 Ga0068867_100385815 3300005459 Bacteria 1178
162 Ga0068867_100708830 3300005459 Bacteria 889
163 Ga0070685_10222170 3300005466 Bacteria 1238
164 Ga0070685_10351389 3300005466 Bacteria 1008
165 Ga0070679_100001182 3300005530 Bacteria 22889
166 Ga0070679_100241495 3300005530 Bacteria 1763
167 Ga0070679_101153839 3300005530 Bacteria 720
168 Ga0070679_101458392 3300005530 Bacteria 631
169 Ga0070679_101480400 3300005530 Bacteria 626
170 Ga0070684_100074316 3300005535 Bacteria 2996
171 Ga0070684_100215259 3300005535 Bacteria 1752
172 Ga0070684_100519069 3300005535 Bacteria 1104
173 Ga0068853_100000154 3300005539 Bacteria 47200
174 Ga0068853_100000655 3300005539 Bacteria 23770
175 Ga0068853_100010924 3300005539 Bacteria 7359
176 Ga0068853_100042011 3300005539 Bacteria 3907
177 Ga0068853_100078309 3300005539 Bacteria 2888
178 Ga0068853_100177096 3300005539 Bacteria 1932
179 Ga0068853_100509301 3300005539 Bacteria 1137
180 Ga0068853_101264986 3300005539 Bacteria 713
181 Ga0070672_100001167 3300005543 Bacteria 16035
182 Ga0070672_100446963 3300005543 Bacteria 1113
183 Ga0070686_100296780 3300005544 Bacteria 1197
184 Ga0070686_100580363 3300005544 Bacteria 881
185 Ga0070686_101445854 3300005544 Bacteria 578
186 Ga0070695_100123928 3300005545 Bacteria 1772
187 Ga0070696_100022165 3300005546 Bacteria 4314
188 Ga0070693_100000578 3300005547 Bacteria 16207
189 Ga0070693_100310100 3300005547 Unclassified 1067
190 Ga0070665_100147557 3300005548 Bacteria 2355
191 Ga0070665_100423473 3300005548 Bacteria 1340
192 Ga0070665_100778654 3300005548 Bacteria 970
193 Ga0070665_101507548 3300005548 Unclassified 681
194 Ga0070665_102533970 3300005548 Bacteria 514
195 Ga0068855_100003204 3300005563 Bacteria 20024
196 Ga0068855_100014297 3300005563 Bacteria 9557
197 Ga0068855_100040366 3300005563 Bacteria 5540
198 Ga0068855_100079821 3300005563 Bacteria 3794
199 Ga0068855_100284249 3300005563 Bacteria 1836
200 Ga0068855_100469504 3300005563 Bacteria 1371
201 Ga0068855_100482620 3300005563 Bacteria 1349
202 Ga0068855_100653960 3300005563 Bacteria 1128
203 Ga0068855_101321209 3300005563 Bacteria 746
204 Ga0070664_100000259 3300005564 Bacteria 38210
205 Ga0070664_100007923 3300005564 Bacteria 8580
206 Ga0070664_100012706 3300005564 Bacteria 6855
207 Ga0070664_100016401 3300005564 Bacteria 6072
208 Ga0070664_100045101 3300005564 Bacteria 3723
209 Ga0070664_100056667 3300005564 Bacteria 3329
210 Ga0070664_100202083 3300005564 Bacteria 1773
211 Ga0070664_100644078 3300005564 Bacteria 985
212 Ga0070664_100675247 3300005564 Bacteria 961
213 Ga0070664_101818241 3300005564 Bacteria 578
214 Ga0070664_102043169 3300005564 Bacteria 544
215 Ga0068857_100031303 3300005577 Bacteria 4700
216 Ga0068857_100065387 3300005577 Bacteria 3233
217 Ga0068857_100139426 3300005577 Bacteria 2191
218 Ga0068857_100150057 3300005577 Bacteria 2111
219 Ga0068857_101065504 3300005577 Bacteria 780
220 Ga0068857_101976446 3300005577 Bacteria 572
221 Ga0068854_100008271 3300005578 Bacteria 6678
222 Ga0068854_100039387 3300005578 Bacteria 3329
223 Ga0068854_100089476 3300005578 Bacteria 2288
224 Ga0068854_100169923 3300005578 Bacteria 1696
225 Ga0068854_100272825 3300005578 Bacteria 1359
226 Ga0068854_100504347 3300005578 Bacteria 1019
227 Ga0068854_101087755 3300005578 Bacteria 712
228 Ga0068854_101145879 3300005578 Bacteria 695
229 Ga0068854_102191990 3300005578 Bacteria 511
230 Ga0068856_100000315 3300005614 Bacteria 53098
231 Ga0068856_100321799 3300005614 Bacteria 1564
232 Ga0068856_100373702 3300005614 Bacteria 1444
233 Ga0068856_100513395 3300005614 Bacteria 1219
234 Ga0068856_100548682 3300005614 Bacteria 1177
235 Ga0068856_100965982 3300005614 Bacteria 870
236 Ga0068856_101983622 3300005614 Bacteria 592
237 Ga0068852_100000548 3300005616 Bacteria 24613
238 Ga0068852_100003431 3300005616 Bacteria 11074
239 Ga0068852_100005054 3300005616 Bacteria 9383
240 Ga0068852_100021395 3300005616 Bacteria 5164
241 Ga0068852_100141960 3300005616 Bacteria 2224
242 Ga0068852_100142505 3300005616 Bacteria 2219
243 Ga0068852_100208794 3300005616 Bacteria 1851
244 Ga0068852_100300469 3300005616 Bacteria 1554
245 Ga0068852_101834029 3300005616 Bacteria 629
246 Ga0068852_102630340 3300005616 Bacteria 523
247 Ga0068859_100554978 3300005617 Bacteria 1243
248 Ga0068864_100006944 3300005618 Bacteria 9290
249 Ga0068864_100014407 3300005618 Bacteria 6567
250 Ga0068864_100372834 3300005618 Bacteria 1351
251 Ga0068864_101113886 3300005618 Bacteria 786
252 Ga0068866_10013515 3300005718 Bacteria 3585
253 Ga0068866_10258846 3300005718 Unclassified 1068
254 Ga0068851_10043922 3300005834 Bacteria 2254
255 Ga0068851_10080552 3300005834 Bacteria 1700
256 Ga0068851_10185285 3300005834 Bacteria 1155
257 Ga0068851_10375388 3300005834 Bacteria 832
258 Ga0068870_10181017 3300005840 Bacteria 1265
259 Ga0068863_100048408 3300005841 Bacteria 4031
260 Ga0068863_100217068 3300005841 Bacteria 1842
261 Ga0068863_100311741 3300005841 Bacteria 1527
262 Ga0068863_102082722 3300005841 Bacteria 577
263 Ga0068858_100001703 3300005842 Bacteria 22460
264 Ga0068858_100037069 3300005842 Bacteria 4520
265 Ga0068858_100145934 3300005842 Bacteria 2222
266 Ga0068860_100405559 3300005843 Bacteria 1349
267 Ga0068862_100473240 3300005844 Bacteria 1185
268 Ga0070717_10470206 3300006028 Bacteria 1135
269 Ga0070717_10888671 3300006028 Bacteria 811
270 Ga0097621_100041877 3300006237 Bacteria 3688
271 Ga0097621_100132776 3300006237 Bacteria 2120
272 Ga0097621_100160527 3300006237 Bacteria 1932
273 Ga0068871_100049909 3300006358 Bacteria 3384
274 Ga0068871_100061563 3300006358 Bacteria 3066
275 Ga0068871_100155086 3300006358 Bacteria 1955
276 Ga0068871_100440671 3300006358 Bacteria 1166
277 Ga0075428_102518008 3300006844 Bacteria 527
278 Ga0068865_100422592 3300006881 Bacteria 1096
279 Ga0097620_100554989 3300006931 Bacteria 1243
280 Ga0105240_10045821 3300009093 Bacteria 5546
281 Ga0105240_11103936 3300009093 Bacteria 844
282 Ga0111539_10171535 3300009094 Bacteria 2534
283 Ga0105245_10326666 3300009098 Bacteria 1513
284 Ga0105247_10637957 3300009101 Bacteria 794
285 Ga0105243_11060782 3300009148 Bacteria 816
286 Ga0105243_12539711 3300009148 Bacteria 552
287 Ga0105241_10115466 3300009174 Bacteria 2155
288 Ga0105241_10486671 3300009174 Bacteria 1098
289 Ga0105241_11397245 3300009174 Bacteria 670
290 Ga0105241_12261586 3300009174 Bacteria 540
291 Ga0105248_10000362 3300009177 Bacteria 53018
292 Ga0105248_10000395 3300009177 Bacteria 50389
293 Ga0105248_10004830 3300009177 Bacteria 14916
294 Ga0105248_10015449 3300009177 Bacteria 8414
295 Ga0105248_10084821 3300009177 Bacteria 3564
296 Ga0105248_10154280 3300009177 Bacteria 2591
297 Ga0105237_11218392 3300009545 Unclassified 759
298 Ga0105238_10025019 3300009551 Bacteria 6086
299 Ga0105238_10329376 3300009551 Bacteria 1514
300 Ga0105249_11215731 3300009553 Bacteria 825
301 Ga0105246_11716056 3300011119 Bacteria 597
302 Ga0157373_10019290 3300013100 Bacteria 4967
303 Ga0157373_10055148 3300013100 Bacteria 2823
304 Ga0157373_10205018 3300013100 Bacteria 1390
305 Ga0157373_10242214 3300013100 Bacteria 1275
306 Ga0157373_10448359 3300013100 Bacteria 928
307 Ga0157373_10505265 3300013100 Bacteria 874
308 Ga0157373_10589686 3300013100 Bacteria 808
309 Ga0157373_10993881 3300013100 Bacteria 626
310 Ga0157371_10179963 3300013102 Bacteria 1512
311 Ga0157371_10195429 3300013102 Bacteria 1449
312 Ga0157371_10317038 3300013102 Bacteria 1131
313 Ga0157371_10878755 3300013102 Bacteria 679
314 Ga0157371_11061688 3300013102 Bacteria 620
315 Ga0157371_11108085 3300013102 Bacteria 607
316 Ga0157371_11140433 3300013102 Unclassified 599
317 Ga0157371_11488222 3300013102 Bacteria 528
318 Ga0157370_10008396 3300013104 Bacteria 11140
319 Ga0157370_10009840 3300013104 Bacteria 10133
320 Ga0157370_10036438 3300013104 Bacteria 4773
321 Ga0157370_10182775 3300013104 Bacteria 1948
322 Ga0157370_10292334 3300013104 Bacteria 1505
323 Ga0157370_10476072 3300013104 Bacteria 1147
324 Ga0157370_10629320 3300013104 Bacteria 981
325 Ga0157370_10770082 3300013104 Bacteria 876
326 Ga0157369_10005829 3300013105 Bacteria 14326
327 Ga0157369_10050842 3300013105 Bacteria 4487
328 Ga0157369_10084502 3300013105 Bacteria 3393
329 Ga0157369_10268072 3300013105 Bacteria 1780
330 Ga0157369_10405068 3300013105 Bacteria 1415
331 Ga0157369_10494599 3300013105 Bacteria 1265
332 Ga0157369_11517645 3300013105 Bacteria 682
333 Ga0157369_12481169 3300013105 Bacteria 525
334 Ga0157374_10077668 3300013296 Bacteria 3142
335 Ga0157374_10181221 3300013296 Bacteria 2058
336 Ga0157374_11104556 3300013296 Bacteria 813
337 Ga0163162_10223770 3300013306 Bacteria 2011
338 Ga0163162_10572582 3300013306 Bacteria 1257
339 Ga0163162_10918524 3300013306 Bacteria 988
340 Ga0157372_10011276 3300013307 Bacteria 9508
341 Ga0157372_10663215 3300013307 Bacteria 1214
342 Ga0157372_10865199 3300013307 Bacteria 1049
343 Ga0157372_12219650 3300013307 Bacteria 631
344 Ga0157372_12539293 3300013307 Bacteria 588
345 Ga0157375_10013944 3300013308 Bacteria 7165
346 Ga0157375_10177423 3300013308 Bacteria 2281
347 Ga0157375_10330959 3300013308 Bacteria 1688
348 Ga0163163_10001203 3300014325 Bacteria 21898
349 Ga0163163_10045299 3300014325 Bacteria 4317
350 Ga0182008_10255520 3300014497 Bacteria 905
351 Ga0182008_10366285 3300014497 Bacteria 767
352 Ga0157377_10593147 3300014745 Bacteria 789
353 Ga0157379_10208696 3300014968 Bacteria 1768
354 Ga0157379_10823366 3300014968 Bacteria 877
355 Ga0157379_11899559 3300014968 Unclassified 587
356 Ga0157376_11302703 3300014969 Bacteria 756
357 Ga0206356_10946257 3300020070 Bacteria 796
358 Ga0206354_10972652 3300020081 Bacteria 1103
359 Ga0206353_10319710 3300020082 Bacteria 581
360 Ga0206353_11417362 3300020082 Bacteria 1267
361 Ga0206353_11687510 3300020082 Bacteria 949
362 Ga0207697_10165847 3300025315 Bacteria 965
363 Ga0207656_10088593 3300025321 Bacteria 1402
364 Ga0207656_10157274 3300025321 Bacteria 1080
365 Ga0207656_10220316 3300025321 Bacteria 922
366 Ga0207656_10532257 3300025321 Bacteria 598
367 Ga0207656_10668172 3300025321 Unclassified 531
368 Ga0207642_10007456 3300025899 Bacteria 3698
369 Ga0207642_10951380 3300025899 Bacteria 552
370 Ga0207688_10060376 3300025901 Bacteria 2135
371 Ga0207688_10408952 3300025901 Bacteria 842
372 Ga0207680_10000267 3300025903 Bacteria 24862
373 Ga0207680_10000626 3300025903 Bacteria 16644
374 Ga0207680_10145480 3300025903 Bacteria 1575
375 Ga0207680_10228228 3300025903 Bacteria 1279
376 Ga0207647_10006403 3300025904 Bacteria 8558
377 Ga0207647_10009933 3300025904 Bacteria 6743
378 Ga0207647_10045794 3300025904 Bacteria 2728
379 Ga0207647_10047161 3300025904 Bacteria 2681
380 Ga0207647_10048856 3300025904 Bacteria 2626
381 Ga0207647_10215638 3300025904 Bacteria 1107
382 Ga0207647_10381492 3300025904 Bacteria 796
383 Ga0207645_10423616 3300025907 Bacteria 897
384 Ga0207643_10395860 3300025908 Bacteria 873
385 Ga0207705_10000205 3300025909 Bacteria 59773
386 Ga0207705_10000449 3300025909 Bacteria 35420
387 Ga0207705_10029143 3300025909 Bacteria 3935
388 Ga0207705_10033148 3300025909 Bacteria 3691
389 Ga0207705_10117988 3300025909 Bacteria 1966
390 Ga0207705_10626484 3300025909 Bacteria 836
391 Ga0207705_10922477 3300025909 Bacteria 676
392 Ga0207705_11017606 3300025909 Bacteria 640
393 Ga0207705_11224692 3300025909 Bacteria 575
394 Ga0207654_10065206 3300025911 Bacteria 2143
395 Ga0207654_11165591 3300025911 Unclassified 562
396 Ga0207707_10069959 3300025912 Bacteria 3058
397 Ga0207707_10357671 3300025912 Bacteria 1257
398 Ga0207707_10949402 3300025912 Bacteria 708
399 Ga0207695_10078613 3300025913 Bacteria 3346
400 Ga0207671_10103235 3300025914 Bacteria 2162
401 Ga0207693_10920348 3300025915 Bacteria 670
402 Ga0207660_10001386 3300025917 Bacteria 16272
403 Ga0207660_10516928 3300025917 Bacteria 969
404 Ga0207660_11224645 3300025917 Bacteria 610
405 Ga0207662_10085881 3300025918 Bacteria 1927
406 Ga0207657_10001304 3300025919 Bacteria 26485
407 Ga0207657_10003566 3300025919 Bacteria 16604
408 Ga0207657_10007910 3300025919 Bacteria 10842
409 Ga0207657_10011594 3300025919 Bacteria 8744
410 Ga0207657_10023947 3300025919 Bacteria 5668
411 Ga0207657_10039954 3300025919 Bacteria 4161
412 Ga0207657_10041186 3300025919 Bacteria 4086
413 Ga0207657_10142321 3300025919 Bacteria 1959
414 Ga0207657_10162031 3300025919 Bacteria 1816
415 Ga0207657_10185328 3300025919 Bacteria 1681
416 Ga0207657_10300715 3300025919 Bacteria 1271
417 Ga0207657_10673461 3300025919 Bacteria 805
418 Ga0207657_10852948 3300025919 Bacteria 703
419 Ga0207657_11464349 3300025919 Unclassified 511
420 Ga0207649_10000942 3300025920 Bacteria 18202
421 Ga0207649_10019857 3300025920 Bacteria 3846
422 Ga0207649_10047985 3300025920 Bacteria 2631
423 Ga0207649_10077821 3300025920 Bacteria 2138
424 Ga0207649_10124012 3300025920 Bacteria 1746
425 Ga0207649_10165897 3300025920 Bacteria 1534
426 Ga0207649_10192535 3300025920 Bacteria 1435
427 Ga0207649_10333002 3300025920 Bacteria 1119
428 Ga0207649_10390110 3300025920 Bacteria 1040
429 Ga0207649_10581622 3300025920 Bacteria 860
430 Ga0207649_10689902 3300025920 Bacteria 791
431 Ga0207649_11412181 3300025920 Unclassified 551
432 Ga0207652_10000270 3300025921 Bacteria 54010
433 Ga0207652_10324428 3300025921 Bacteria 1390
434 Ga0207652_11123503 3300025921 Bacteria 687
435 Ga0207694_10002320 3300025924 Bacteria 15552
436 Ga0207694_10089196 3300025924 Bacteria 2432
437 Ga0207694_11505638 3300025924 Bacteria 568
438 Ga0207650_10028035 3300025925 Bacteria 4035
439 Ga0207650_10038230 3300025925 Bacteria 3503
440 Ga0207650_10197418 3300025925 Bacteria 1610
441 Ga0207650_10390706 3300025925 Bacteria 1150
442 Ga0207650_10644129 3300025925 Bacteria 893
443 Ga0207650_10897746 3300025925 Bacteria 752
444 Ga0207650_11038171 3300025925 Bacteria 697
445 Ga0207650_11328403 3300025925 Bacteria 612
446 Ga0207650_11474793 3300025925 Bacteria 578
447 Ga0207650_11679380 3300025925 Bacteria 538
448 Ga0207659_10014421 3300025926 Bacteria 5097
449 Ga0207659_10560970 3300025926 Bacteria 971
450 Ga0207687_11376811 3300025927 Unclassified 606
451 Ga0207700_10755064 3300025928 Bacteria 869
452 Ga0207664_10868960 3300025929 Bacteria 810
453 Ga0207664_11392867 3300025929 Unclassified 622
454 Ga0207644_10005695 3300025931 Bacteria 8111
455 Ga0207644_10120776 3300025931 Bacteria 1994
456 Ga0207644_10274315 3300025931 Bacteria 1352
457 Ga0207644_11175350 3300025931 Bacteria 645
458 Ga0207690_10000257 3300025932 Bacteria 38401
459 Ga0207690_10009242 3300025932 Bacteria 5854
460 Ga0207690_10013935 3300025932 Bacteria 4845
461 Ga0207690_10068654 3300025932 Bacteria 2436
462 Ga0207690_10241226 3300025932 Bacteria 1392
463 Ga0207690_10269552 3300025932 Bacteria 1322
464 Ga0207690_10545639 3300025932 Bacteria 942
465 Ga0207690_10916474 3300025932 Bacteria 727
466 Ga0207706_10001176 3300025933 Bacteria 26479
467 Ga0207706_10006135 3300025933 Bacteria 11160
468 Ga0207706_10042422 3300025933 Bacteria 4032
469 Ga0207706_10088152 3300025933 Bacteria 2728
470 Ga0207706_10157347 3300025933 Bacteria 1998
471 Ga0207706_10188380 3300025933 Bacteria 1811
472 Ga0207706_10237420 3300025933 Bacteria 1594
473 Ga0207706_11140165 3300025933 Unclassified 650
474 Ga0207706_11512504 3300025933 Bacteria 547
475 Ga0207709_10710384 3300025935 Bacteria 805
476 Ga0207670_10036600 3300025936 Bacteria 3193
477 Ga0207669_10002475 3300025937 Bacteria 7880
478 Ga0207669_10409457 3300025937 Bacteria 1064
479 Ga0207704_11842489 3300025938 Bacteria 520
480 Ga0207691_10004833 3300025940 Bacteria 13034
481 Ga0207691_10155884 3300025940 Bacteria 2005
482 Ga0207711_10000427 3300025941 Bacteria 44194
483 Ga0207711_10000610 3300025941 Bacteria 36080
484 Ga0207711_10029458 3300025941 Bacteria 4631
485 Ga0207711_10034390 3300025941 Bacteria 4292
486 Ga0207711_10047172 3300025941 Bacteria 3682
487 Ga0207711_10108999 3300025941 Bacteria 2460
488 Ga0207661_10000918 3300025944 Bacteria 19348
489 Ga0207661_10035672 3300025944 Bacteria 3877
490 Ga0207661_10092895 3300025944 Bacteria 2516
491 Ga0207661_10174405 3300025944 Bacteria 1874
492 Ga0207661_10281857 3300025944 Bacteria 1486
493 Ga0207661_11115504 3300025944 Bacteria 726
494 Ga0207661_11866792 3300025944 Unclassified 546
495 Ga0207679_10000463 3300025945 Bacteria 28581
496 Ga0207679_10003835 3300025945 Bacteria 9319
497 Ga0207679_10092671 3300025945 Bacteria 2341
498 Ga0207679_10237494 3300025945 Bacteria 1542
499 Ga0207679_10273154 3300025945 Bacteria 1446
500 Ga0207679_10336713 3300025945 Bacteria 1311
501 Ga0207679_10521531 3300025945 Unclassified 1063
502 Ga0207679_10732012 3300025945 Bacteria 899
503 Ga0207679_10933021 3300025945 Bacteria 795
504 Ga0207679_11128305 3300025945 Bacteria 719
505 Ga0207667_10005298 3300025949 Bacteria 15727
506 Ga0207667_10031169 3300025949 Bacteria 5759
507 Ga0207667_10092876 3300025949 Bacteria 3117
508 Ga0207667_10117241 3300025949 Bacteria 2744
509 Ga0207667_10459662 3300025949 Bacteria 1293
510 Ga0207667_10486653 3300025949 Bacteria 1252
511 Ga0207667_10592858 3300025949 Bacteria 1118
512 Ga0207667_10965854 3300025949 Bacteria 841
513 Ga0207667_11053064 3300025949 Bacteria 798
514 Ga0207667_11446050 3300025949 Bacteria 660
515 Ga0207651_10027626 3300025960 Bacteria 3567
516 Ga0207651_10036114 3300025960 Bacteria 3222
517 Ga0207651_11023616 3300025960 Bacteria 739
518 Ga0207712_10157123 3300025961 Bacteria 1763
519 Ga0207668_10065390 3300025972 Bacteria 2574
520 Ga0207668_10427699 3300025972 Bacteria 1125
521 Ga0207640_10057088 3300025981 Bacteria 2566
522 Ga0207640_10109823 3300025981 Bacteria 1952
523 Ga0207640_10175751 3300025981 Bacteria 1600
524 Ga0207640_10274531 3300025981 Bacteria 1321
525 Ga0207640_10648041 3300025981 Bacteria 900
526 Ga0207640_10719177 3300025981 Bacteria 858
527 Ga0207640_11927692 3300025981 Unclassified 535
528 Ga0207640_12128530 3300025981 Bacteria 509
529 Ga0207640_12180355 3300025981 Bacteria 503
530 Ga0207658_10005525 3300025986 Bacteria 8664
531 Ga0207658_10142548 3300025986 Bacteria 1941
532 Ga0207658_10274113 3300025986 Bacteria 1443
533 Ga0207658_10967702 3300025986 Bacteria 776
534 Ga0207677_10003982 3300026023 Bacteria 7879
535 Ga0207677_10075441 3300026023 Bacteria 2397
536 Ga0207703_10006106 3300026035 Bacteria 9638
537 Ga0207703_10056018 3300026035 Bacteria 3209
538 Ga0207703_10197852 3300026035 Bacteria 1784
539 Ga0207703_12376262 3300026035 Bacteria 506
540 Ga0207639_10000899 3300026041 Bacteria 20185
541 Ga0207639_10036236 3300026041 Bacteria 3654
542 Ga0207639_10084907 3300026041 Bacteria 2516
543 Ga0207639_10207711 3300026041 Bacteria 1684
544 Ga0207639_10304903 3300026041 Bacteria 1409
545 Ga0207639_10401038 3300026041 Bacteria 1235
546 Ga0207639_10411625 3300026041 Bacteria 1220
547 Ga0207639_10927817 3300026041 Bacteria 814
548 Ga0207639_11826009 3300026041 Bacteria 568
549 Ga0207678_10000766 3300026067 Bacteria 29323
550 Ga0207678_10009100 3300026067 Bacteria 8744
551 Ga0207678_10073610 3300026067 Bacteria 2928
552 Ga0207678_10105549 3300026067 Bacteria 2404
553 Ga0207678_10210123 3300026067 Bacteria 1665
554 Ga0207678_10325503 3300026067 Bacteria 1323
555 Ga0207678_10347446 3300026067 Bacteria 1279
556 Ga0207678_10564039 3300026067 Bacteria 996
557 Ga0207702_10002140 3300026078 Bacteria 18992
558 Ga0207702_10061009 3300026078 Bacteria 3215
559 Ga0207702_10307882 3300026078 Bacteria 1505
560 Ga0207702_10334089 3300026078 Bacteria 1446
561 Ga0207702_10348925 3300026078 Bacteria 1415
562 Ga0207702_10520496 3300026078 Bacteria 1161
563 Ga0207702_10545875 3300026078 Bacteria 1133
564 Ga0207641_10043334 3300026088 Bacteria 3779
565 Ga0207641_10111213 3300026088 Bacteria 2429
566 Ga0207641_10117465 3300026088 Bacteria 2368
567 Ga0207648_10464460 3300026089 Bacteria 1154
568 Ga0207676_10005201 3300026095 Bacteria 9209
569 Ga0207676_10012479 3300026095 Bacteria 6089
570 Ga0207676_10019201 3300026095 Bacteria 4982
571 Ga0207676_10098779 3300026095 Bacteria 2414
572 Ga0207674_10005522 3300026116 Bacteria 15018
573 Ga0207674_10037696 3300026116 Bacteria 5024
574 Ga0207674_10113335 3300026116 Bacteria 2685
575 Ga0207674_10296822 3300026116 Bacteria 1565
576 Ga0207674_11201913 3300026116 Bacteria 728
577 Ga0207674_11375886 3300026116 Bacteria 675
578 Ga0207683_10009640 3300026121 Bacteria 8229
579 Ga0207683_10161003 3300026121 Bacteria 2029
580 Ga0207698_10000435 3300026142 Bacteria 24060
581 Ga0207698_10000560 3300026142 Bacteria 21687
582 Ga0207698_10004591 3300026142 Bacteria 8430
583 Ga0207698_10004812 3300026142 Bacteria 8270
584 Ga0207698_10010929 3300026142 Bacteria 5863
585 Ga0207698_10036882 3300026142 Bacteria 3594
586 Ga0207698_10923718 3300026142 Bacteria 881
587 Ga0207698_11164902 3300026142 Bacteria 784
588 Ga0207698_12120547 3300026142 Bacteria 575
589 Ga0268266_10083621 3300028379 Bacteria 2786
590 Ga0268266_10108623 3300028379 Bacteria 2455
591 Ga0268266_10701224 3300028379 Bacteria 976
592 Ga0268266_12185213 3300028379 Bacteria 525
593 Ga0268265_10029948 3300028380 Bacteria 3916
594 Ga0268264_10293205 3300028381 Bacteria 1528
595 Ga0268264_10541117 3300028381 Bacteria 1141
596 Ga0316182_1086040 3300030745 Bacteria 804
597 Ga0307408_100161243 3300031548 Bacteria 1781
598 Ga0307408_100320899 3300031548 Bacteria 1305
599 Ga0307408_101890301 3300031548 Bacteria 572
600 Ga0307405_10027152 3300031731 Bacteria 3314
601 Ga0307405_10038617 3300031731 Bacteria 2880
602 Ga0307405_10433949 3300031731 Bacteria 1037
603 Ga0307405_11379822 3300031731 Bacteria 615
604 Ga0307405_11987780 3300031731 Unclassified 520
605 Ga0307413_10304826 3300031824 Bacteria 1209
606 Ga0307413_11048306 3300031824 Bacteria 701
607 Ga0307410_10016738 3300031852 Bacteria 4382
608 Ga0307410_10021687 3300031852 Bacteria 3954
609 Ga0307410_10111275 3300031852 Bacteria 1981
610 Ga0307410_10127807 3300031852 Bacteria 1863
611 Ga0307410_10193983 3300031852 Bacteria 1546
612 Ga0307406_10031393 3300031901 Bacteria 3234
613 Ga0307406_11304834 3300031901 Bacteria 633
614 Ga0307406_12057372 3300031901 Bacteria 511
615 Ga0307407_10105864 3300031903 Bacteria 1756
616 Ga0307407_10254180 3300031903 Bacteria 1205
617 Ga0307407_10330289 3300031903 Bacteria 1073
618 Ga0307412_10022002 3300031911 Bacteria 3902
619 Ga0307412_10041018 3300031911 Bacteria 2997
620 Ga0307412_10169511 3300031911 Bacteria 1631
621 Ga0307412_10974681 3300031911 Bacteria 748
622 Ga0307409_100047085 3300031995 Bacteria 3270
623 Ga0307409_100055516 3300031995 Bacteria 3058
624 Ga0307409_100273382 3300031995 Bacteria 1557
625 Ga0307409_101517804 3300031995 Bacteria 697
626 Ga0307409_101531280 3300031995 Bacteria 694
627 Ga0307416_100014810 3300032002 Bacteria 5361
628 Ga0307416_100060676 3300032002 Bacteria 3081
629 Ga0307416_100205117 3300032002 Bacteria 1874
630 Ga0307416_100670824 3300032002 Bacteria 1123
631 Ga0307416_100707317 3300032002 Bacteria 1097
632 Ga0307414_10033242 3300032004 Bacteria 3407
633 Ga0307414_11300883 3300032004 Bacteria 674
634 Ga0307414_11467893 3300032004 Bacteria 634
635 Ga0307411_10001101 3300032005 Bacteria 10532
636 Ga0307411_10017670 3300032005 Bacteria 4072
637 Ga0307411_10466265 3300032005 Bacteria 1060
638 Ga0307411_10642535 3300032005 Bacteria 918
639 Ga0307415_100036128 3300032126 Bacteria 3234
640 Ga0307415_100077367 3300032126 Bacteria 2362
641 Ga0307415_100355808 3300032126 Bacteria 1234
642 Ga0307415_100496136 3300032126 Bacteria 1066
643 Ga0373930_0163397 3300034816 Bacteria 564
644 Ga0373950_0032043 3300034818 Bacteria 977
645 Ga0373944_0422555 3300035089 Bacteria 516
646 Ga0373939_0086535 3300035114 Bacteria 1051
647 Ga0373941_0015662 3300035115 Bacteria 2049
648 Ga0373941_0208531 3300035115 Bacteria 746
649 Ga0373941_0291262 3300035115 Bacteria 649
650 Ga0373943_0002387 3300035170 Bacteria 8516
651 Ga0373946_0004744 3300035171 Bacteria 4887
652 Ga0373961_0008248 3300035241 Bacteria 2532
653 Ga0373962_0289297 3300035242 Bacteria 578
654 Ga0373931_0116666 3300035691 Bacteria 1521
655 Ga0373935_0042878 3300035692 Bacteria 2846
656 Ga0373927_0052303 3300035695 Bacteria 2642
657 Ga0373937_0236204 3300036401 Bacteria 1722
658 Ga0373925_0061658 3300037068 Bacteria 2817
659 Ga0395899_0000387 3300037312 Bacteria 52472
660 Ga0395899_0001750 3300037312 Bacteria 18054
661 Ga0395899_0004293 3300037312 Bacteria 11136
662 Ga0395899_0011077 3300037312 Bacteria 6906
663 Ga0395899_0024278 3300037312 Bacteria 4585
664 Ga0395899_0047348 3300037312 Bacteria 3202
665 Ga0395899_0048289 3300037312 Bacteria 3168
666 Ga0395899_0050207 3300037312 Bacteria 3098
667 Ga0395899_0098320 3300037312 Bacteria 2114
668 Ga0395899_0165787 3300037312 Bacteria 1559
669 Ga0395899_0593732 3300037312 Bacteria 706
670 Ga0395899_0703402 3300037312 Bacteria 633
671 Ga0395899_0981287 3300037312 Bacteria 510
672 Ga0395900_0000130 3300037418 Bacteria 126231
673 Ga0395900_0006337 3300037418 Bacteria 12335
674 Ga0395900_0019755 3300037418 Bacteria 6866
675 Ga0395900_0034078 3300037418 Bacteria 5241
676 Ga0395900_0050595 3300037418 Bacteria 4279
677 Ga0395900_0060173 3300037418 Bacteria 3909
678 Ga0395900_0064510 3300037418 Bacteria 3763
679 Ga0395900_0070709 3300037418 Bacteria 3587
680 Ga0395900_0111023 3300037418 Bacteria 2816
681 Ga0395900_0111453 3300037418 Bacteria 2810
682 Ga0395900_0161969 3300037418 Bacteria 2281
683 Ga0395900_0182805 3300037418 Bacteria 2130
684 Ga0395900_0314084 3300037418 Bacteria 1549
685 Ga0395900_0915297 3300037418 Bacteria 800
686 Ga0395900_1112744 3300037418 Bacteria 707
687 Ga0395900_1280988 3300037418 Bacteria 647
688 Ga0395900_1437226 3300037418 Bacteria 602
689 Ga0395900_1463565 3300037418 Bacteria 595
690 Ga0395898_0000274 3300037466 Bacteria 125922
691 Ga0395898_0001594 3300037466 Bacteria 30951
692 Ga0395898_0004865 3300037466 Bacteria 14585
693 Ga0395898_0029190 3300037466 Bacteria 5526
694 Ga0395898_0042473 3300037466 Bacteria 4485
695 Ga0395898_0053112 3300037466 Bacteria 3958
696 Ga0395898_0108818 3300037466 Bacteria 2657
697 Ga0395898_0167258 3300037466 Bacteria 2102
698 Ga0395898_0259181 3300037466 Bacteria 1658
699 Ga0395898_0270220 3300037466 Bacteria 1622
700 Ga0395905_0000287 3300037471 Bacteria 73803
701 Ga0395905_0001408 3300037471 Bacteria 29105
702 Ga0395905_0008347 3300037471 Bacteria 10214
703 Ga0395905_0009393 3300037471 Bacteria 9563
704 Ga0395905_0010680 3300037471 Bacteria 8905
705 Ga0395905_0019454 3300037471 Bacteria 6436
706 Ga0395905_0019534 3300037471 Bacteria 6423
707 Ga0395905_0022556 3300037471 Bacteria 5954
708 Ga0395905_0041942 3300037471 Bacteria 4294
709 Ga0395905_0043388 3300037471 Bacteria 4219
710 Ga0395905_0050279 3300037471 Bacteria 3905
711 Ga0395905_0051282 3300037471 Bacteria 3864
712 Ga0395905_0051372 3300037471 Bacteria 3861
713 Ga0395905_0076037 3300037471 Bacteria 3146
714 Ga0395905_0122356 3300037471 Bacteria 2446
715 Ga0395905_0140054 3300037471 Bacteria 2276
716 Ga0395905_0146626 3300037471 Bacteria 2220
717 Ga0395905_0235254 3300037471 Bacteria 1712
718 Ga0395905_0306403 3300037471 Bacteria 1476
719 Ga0395905_0324861 3300037471 Bacteria 1429
720 Ga0395905_0338299 3300037471 Bacteria 1396
721 Ga0395905_0384558 3300037471 Bacteria 1297
722 Ga0395905_0412885 3300037471 Bacteria 1245
723 Ga0395905_0583012 3300037471 Bacteria 1020
724 Ga0395905_0646301 3300037471 Bacteria 960
725 Ga0395905_0648975 3300037471 Bacteria 957
726 Ga0395905_0883429 3300037471 Unclassified 797
727 Ga0395905_0995427 3300037471 Bacteria 741
728 Ga0395905_1634907 3300037471 Unclassified 549
729 Ga0395901_0014759 3300038443 Bacteria 7937
730 Ga0395901_0018835 3300038443 Bacteria 7056
731 Ga0395901_0028662 3300038443 Bacteria 5727
732 Ga0395901_0059419 3300038443 Bacteria 3977
733 Ga0395901_0110482 3300038443 Bacteria 2886
734 Ga0395901_0120095 3300038443 Bacteria 2762
735 Ga0395901_0130566 3300038443 Bacteria 2640
736 Ga0395901_0142529 3300038443 Bacteria 2518
737 Ga0395901_0150193 3300038443 Bacteria 2448
738 Ga0395901_0156682 3300038443 Bacteria 2392
739 Ga0395901_0251584 3300038443 Bacteria 1840
740 Ga0395901_0442414 3300038443 Bacteria 1330
741 Ga0395901_0512005 3300038443 Unclassified 1220
742 Ga0395901_0557540 3300038443 Bacteria 1160
743 Ga0395901_0686819 3300038443 Bacteria 1023
744 Ga0395901_0729428 3300038443 Bacteria 986
745 Ga0395901_0751606 3300038443 Bacteria 968
746 Ga0395901_1577988 3300038443 Bacteria 610
747 Ga0439465_0058319 3300041413 Bacteria 1276
748 Ga0451849_0795203 3300041505 Unclassified 520
749 Ga0439448_0004596 3300042005 Bacteria 3903
750 Ga0439432_222939 3300042006 Bacteria 544
751 Ga0439449_0235685 3300042007 Bacteria 687
752 Ga0439455_0120683 3300042012 Bacteria 734
753 Ga0450914_000440 3300042118 Bacteria 1928
754 Ga0450890_005968 3300042127 Bacteria 1566
755 Ga0450905_001095 3300042142 Bacteria 3402
756 Ga0450889_000275 3300042144 Bacteria 5731
757 Ga0439458_0000405 3300042157 Bacteria 10803
758 Ga0439458_0054816 3300042157 Bacteria 988
759 Ga0439458_0071267 3300042157 Bacteria 878
760 Ga0439459_0130688 3300042438 Bacteria 641
761 Ga0466966_0841087 3300044684 Bacteria 553
762 Ga0466963_0011272 3300044694 Bacteria 5440
763 Ga0466963_0520371 3300044694 Bacteria 840
764 Ga0466963_0603338 3300044694 Bacteria 775
765 Ga0466964_0061663 3300044706 Bacteria 1562
766 Ga0466964_0602646 3300044706 Bacteria 603
767 Ga0466970_0765966 3300044765 Bacteria 564
768 Ga0466957_0003051 3300044842 Bacteria 9106
769 Ga0466957_0071580 3300044842 Bacteria 2145
770 Ga0466967_0000053 3300045976 Bacteria 41252
771 Ga0466967_0117666 3300045976 Bacteria 2450
772 Ga0466967_0152078 3300045976 Bacteria 2164
773 Ga0466967_0244335 3300045976 Bacteria 1713
774 Ga0466967_0283260 3300045976 Unclassified 1591
775 Ga0466967_0389784 3300045976 Bacteria 1354
776 Ga0466967_0592188 3300045976 Bacteria 1094
777 Ga0466967_2215042 3300045976 Bacteria 545
778 Ga0495629_0710345 3300046459 Unclassified 667
779 Ga0495647_0044685 3300046681 Bacteria 1700
780 Ga0495677_0073261 3300047445 Bacteria 1278
781 Ga0495685_258333 3300047447 Bacteria 552
782 Ga0496100_0056386 3300048903 Bacteria 2570
783 Ga0496101_0018340 3300048904 Bacteria 4756
784 Ga0496101_0544940 3300048904 Bacteria 917
785 Ga0496101_0704361 3300048904 Bacteria 797
786 Ga0496101_0842522 3300048904 Bacteria 723
787 Ga0496102_0671464 3300048905 Bacteria 959
788 Ga0496103_0152161 3300048906 Bacteria 1482
789 Ga0496103_0309545 3300048906 Bacteria 1016
790 Ga0496104_0344529 3300048907 Bacteria 1403
791 Ga0496105_1287102 3300048908 Bacteria 534
792 Ga0496106_0200985 3300048909 Bacteria 1586
793 Ga0496106_0292314 3300048909 Bacteria 1306
794 Ga0496106_0427041 3300048909 Bacteria 1065
795 Ga0496106_0683911 3300048909 Bacteria 818
796 Ga0496107_0098795 3300048910 Bacteria 2138
797 Ga0496107_0124754 3300048910 Bacteria 1898
798 Ga0496107_0148922 3300048910 Bacteria 1731
799 Ga0496107_0875417 3300048910 Bacteria 655
800 Ga0496108_0043524 3300048911 Bacteria 3750
801 Ga0496108_0114552 3300048911 Bacteria 2308
802 Ga0496108_0613750 3300048911 Bacteria 947
803 Ga0496108_1084218 3300048911 Bacteria 681
804 Ga0496109_0010711 3300048912 Bacteria 7845
805 Ga0496109_0026042 3300048912 Bacteria 5213
806 Ga0496109_0118552 3300048912 Bacteria 2464
807 Ga0496109_1107593 3300048912 Bacteria 729
808 Ga0496110_0033088 3300048913 Bacteria 4470
809 Ga0496110_1565033 3300048913 Bacteria 569
810 Ga0496110_1857347 3300048913 Bacteria 512
811 Ga0496111_0057303 3300048914 Bacteria 2821
812 Ga0496111_0121862 3300048914 Bacteria 1926
813 Ga0496112_0021480 3300048915 Bacteria 6139
814 Ga0496112_0057861 3300048915 Bacteria 3817
815 Ga0496112_0064275 3300048915 Bacteria 3621
816 Ga0496112_0072589 3300048915 Bacteria 3402
817 Ga0496113_0113283 3300048916 Bacteria 2114
818 Ga0496113_0159089 3300048916 Bacteria 1785
819 Ga0496113_0207635 3300048916 Bacteria 1558
820 Ga0496114_0063559 3300048917 Bacteria 3090
821 Ga0496115_0058860 3300048918 Bacteria 3093
822 Ga0501034_0526388 3300049571 Bacteria 1094
823 Ga0501046_0766886 3300049580 Bacteria 677
824 Ga0501068_0184571 3300049584 Bacteria 1320
825 Ga0501202_038346 3300049652 Bacteria 1027
826 Ga0501214_020059 3300049659 Bacteria 841
827 Ga0501224_014860 3300049664 Bacteria 1153
828 Ga0501230_079417 3300049667 Bacteria 685
829 Ga0501249_077708 3300049679 Bacteria 778
830 Ga0501252_033881 3300049682 Bacteria 718
831 Ga0501221_025277 3300049704 Bacteria 1199
832 Ga0501225_0159470 3300049705 Bacteria 693
833 Ga0501229_022774 3300049706 Bacteria 835
834 Ga0501262_011795 3300049759 Bacteria 1111
835 Ga0501268_004007 3300049765 Bacteria 2054
836 Ga0501270_044554 3300049767 Bacteria 784
837 Ga0501272_018225 3300049769 Bacteria 831
838 Ga0501273_042440 3300049770 Bacteria 676
839 nmdc:mga05p37_1150221_c1 3300050507 Bacteria 807
840 nmdc:mga08y16_224427_c1 3300050511 Bacteria 1944

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0520371 Ga0466963_0520371_339_512 49
2 3300044842 Ga0466957_0071580 Ga0466957_0071580_546_719 49
3 3300045976 Ga0466967_2215042 Ga0466967_2215042_355_528 49
4 3300003323 rootH1_10019858 rootH1_100198582 51
5 3300045976 Ga0466967_0389784 Ga0466967_0389784_499_654 51
6 3300005367 Ga0070667_102071338 Ga0070667_1020713381 52
7 3300005841 Ga0068863_102082722 Ga0068863_1020827222 52
8 3300006358 Ga0068871_100155086 Ga0068871_1001550863 52
9 3300013308 Ga0157375_10177423 Ga0157375_101774234 52
10 3300025941 Ga0207711_10034390 Ga0207711_100343904 52
11 3300037312 Ga0395899_0703402 Ga0395899_0703402_391_549 52
12 3300037418 Ga0395900_0034078 Ga0395900_0034078_3049_3207 52
13 3300037418 Ga0395900_0111453 Ga0395900_0111453_1294_1452 52
14 3300037418 Ga0395900_1437226 Ga0395900_1437226_367_525 52
15 3300037418 Ga0395900_1463565 Ga0395900_1463565_40_198 52
16 3300037466 Ga0395898_0167258 Ga0395898_0167258_899_1057 52
17 3300037466 Ga0395898_0259181 Ga0395898_0259181_318_476 52
18 3300037471 Ga0395905_0050279 Ga0395905_0050279_2563_2721 52
19 3300037471 Ga0395905_0051372 Ga0395905_0051372_823_981 52
20 3300038443 Ga0395901_0251584 Ga0395901_0251584_1154_1312 52
21 3300038443 Ga0395901_0557540 Ga0395901_0557540_453_611 52
22 3300045976 Ga0466967_0244335 Ga0466967_0244335_599_757 52
23 3300048904 Ga0496101_0544940 Ga0496101_0544940_681_839 52
24 3300048904 Ga0496101_0704361 Ga0496101_0704361_594_752 52
25 3300048911 Ga0496108_0613750 Ga0496108_0613750_99_257 52
26 3300048912 Ga0496109_0118552 Ga0496109_0118552_481_639 52
27 3300048912 Ga0496109_1107593 Ga0496109_1107593_275_433 52
28 3300048913 Ga0496110_1565033 Ga0496110_1565033_116_274 52
29 3300048915 Ga0496112_0057861 Ga0496112_0057861_889_1047 52
30 3300005331 Ga0070670_100031334 Ga0070670_1000313341 53
31 3300005335 Ga0070666_10159798 Ga0070666_101597981 53
32 3300005347 Ga0070668_100083764 Ga0070668_1000837644 53
33 3300005455 Ga0070663_101398270 Ga0070663_1013982702 53
34 3300005564 Ga0070664_100016401 Ga0070664_1000164015 53
35 3300005844 Ga0068862_100473240 Ga0068862_1004732402 53
36 3300009177 Ga0105248_10004830 Ga0105248_1000483012 53
37 3300009553 Ga0105249_11215731 Ga0105249_112157311 53
38 3300011119 Ga0105246_11716056 Ga0105246_117160562 53
39 3300013104 Ga0157370_10008396 Ga0157370_1000839610 53
40 3300025903 Ga0207680_10145480 Ga0207680_101454804 53
41 3300025925 Ga0207650_10390706 Ga0207650_103907062 53
42 3300025945 Ga0207679_10003835 Ga0207679_100038357 53
43 3300025945 Ga0207679_10732012 Ga0207679_107320122 53
44 3300025961 Ga0207712_10157123 Ga0207712_101571231 53
45 3300025972 Ga0207668_10065390 Ga0207668_100653903 53
46 3300028379 Ga0268266_10701224 Ga0268266_107012242 53
47 3300028380 Ga0268265_10029948 Ga0268265_100299484 53
48 3300041505 Ga0451849_0795203 Ga0451849_0795203_89_250 53
49 3300001979 JGI24740J21852_10015401 JGI24740J21852_100154014 57
50 3300001990 JGI24737J22298_10089095 JGI24737J22298_100890953 57
51 3300005327 Ga0070658_10032398 Ga0070658_100323985 57
52 3300005327 Ga0070658_10052796 Ga0070658_100527963 57
53 3300005327 Ga0070658_10074834 Ga0070658_100748344 57
54 3300005327 Ga0070658_10134112 Ga0070658_101341123 57
55 3300005327 Ga0070658_10179207 Ga0070658_101792072 57
56 3300005327 Ga0070658_11439996 Ga0070658_114399962 57
57 3300005329 Ga0070683_100011627 Ga0070683_1000116278 57
58 3300005329 Ga0070683_100423572 Ga0070683_1004235722 57
59 3300005329 Ga0070683_102011379 Ga0070683_1020113791 57
60 3300005330 Ga0070690_100001152 Ga0070690_10000115214 57
61 3300005330 Ga0070690_100318396 Ga0070690_1003183962 57
62 3300005331 Ga0070670_100005622 Ga0070670_10000562211 57
63 3300005331 Ga0070670_100175019 Ga0070670_1001750191 57
64 3300005331 Ga0070670_100409845 Ga0070670_1004098452 57
65 3300005331 Ga0070670_100712289 Ga0070670_1007122892 57
66 3300005331 Ga0070670_100767140 Ga0070670_1007671402 57
67 3300005331 Ga0070670_100892285 Ga0070670_1008922852 57
68 3300005331 Ga0070670_101992042 Ga0070670_1019920422 57
69 3300005333 Ga0070677_10179546 Ga0070677_101795462 57
70 3300005333 Ga0070677_10602095 Ga0070677_106020952 57
71 3300005335 Ga0070666_10000215 Ga0070666_1000021522 57
72 3300005335 Ga0070666_10016884 Ga0070666_100168842 57
73 3300005335 Ga0070666_11010514 Ga0070666_110105142 57
74 3300005336 Ga0070680_100032551 Ga0070680_1000325514 57
75 3300005338 Ga0068868_100003281 Ga0068868_10000328113 57
76 3300005338 Ga0068868_100104592 Ga0068868_1001045923 57
77 3300005339 Ga0070660_100000678 Ga0070660_1000006785 57
78 3300005339 Ga0070660_100029505 Ga0070660_1000295054 57
79 3300005339 Ga0070660_100039840 Ga0070660_1000398402 57
80 3300005339 Ga0070660_100138170 Ga0070660_1001381702 57
81 3300005340 Ga0070689_100082305 Ga0070689_1000823052 57
82 3300005343 Ga0070687_100115377 Ga0070687_1001153773 57
83 3300005344 Ga0070661_100019093 Ga0070661_1000190934 57
84 3300005344 Ga0070661_100034471 Ga0070661_1000344713 57
85 3300005344 Ga0070661_100083455 Ga0070661_1000834551 57
86 3300005344 Ga0070661_100221201 Ga0070661_1002212013 57
87 3300005344 Ga0070661_100280495 Ga0070661_1002804952 57
88 3300005344 Ga0070661_100604439 Ga0070661_1006044392 57
89 3300005344 Ga0070661_101156747 Ga0070661_1011567472 57
90 3300005345 Ga0070692_10032892 Ga0070692_100328924 57
91 3300005347 Ga0070668_100376342 Ga0070668_1003763423 57
92 3300005353 Ga0070669_100517922 Ga0070669_1005179222 57
93 3300005353 Ga0070669_101875985 Ga0070669_1018759852 57
94 3300005354 Ga0070675_100457032 Ga0070675_1004570322 57
95 3300005354 Ga0070675_100704312 Ga0070675_1007043122 57
96 3300005355 Ga0070671_100026186 Ga0070671_1000261862 57
97 3300005355 Ga0070671_100274093 Ga0070671_1002740932 57
98 3300005355 Ga0070671_100349159 Ga0070671_1003491592 57
99 3300005356 Ga0070674_100017266 Ga0070674_1000172665 57
100 3300005356 Ga0070674_100308488 Ga0070674_1003084882 57
101 3300005364 Ga0070673_100013350 Ga0070673_1000133504 57
102 3300005364 Ga0070673_100097879 Ga0070673_1000978792 57
103 3300005365 Ga0070688_100290560 Ga0070688_1002905602 57
104 3300005366 Ga0070659_100008920 Ga0070659_1000089207 57
105 3300005366 Ga0070659_100024090 Ga0070659_1000240903 57
106 3300005366 Ga0070659_100032050 Ga0070659_1000320502 57
107 3300005366 Ga0070659_100048299 Ga0070659_1000482994 57
108 3300005366 Ga0070659_100106737 Ga0070659_1001067374 57
109 3300005366 Ga0070659_100920631 Ga0070659_1009206312 57
110 3300005367 Ga0070667_100000842 Ga0070667_1000008424 57
111 3300005367 Ga0070667_100288724 Ga0070667_1002887242 57
112 3300005367 Ga0070667_100891502 Ga0070667_1008915022 57
113 3300005435 Ga0070714_100271398 Ga0070714_1002713983 57
114 3300005435 Ga0070714_101058393 Ga0070714_1010583932 57
115 3300005436 Ga0070713_100058014 Ga0070713_1000580145 57
116 3300005436 Ga0070713_100977396 Ga0070713_1009773961 57
117 3300005436 Ga0070713_101581598 Ga0070713_1015815982 57
118 3300005440 Ga0070705_100639262 Ga0070705_1006392621 57
119 3300005444 Ga0070694_100021107 Ga0070694_1000211074 57
120 3300005455 Ga0070663_100000936 Ga0070663_1000009363 57
121 3300005455 Ga0070663_100240881 Ga0070663_1002408813 57
122 3300005455 Ga0070663_100402770 Ga0070663_1004027702 57
123 3300005455 Ga0070663_100517971 Ga0070663_1005179712 57
124 3300005456 Ga0070678_100136929 Ga0070678_1001369293 57
125 3300005456 Ga0070678_100238809 Ga0070678_1002388092 57
126 3300005457 Ga0070662_100003839 Ga0070662_10000383910 57
127 3300005457 Ga0070662_100013241 Ga0070662_1000132414 57
128 3300005457 Ga0070662_100097939 Ga0070662_1000979393 57
129 3300005457 Ga0070662_100131087 Ga0070662_1001310873 57
130 3300005457 Ga0070662_100218208 Ga0070662_1002182083 57
131 3300005457 Ga0070662_100726714 Ga0070662_1007267142 57
132 3300005457 Ga0070662_101083660 Ga0070662_1010836601 57
133 3300005457 Ga0070662_101517800 Ga0070662_1015178002 57
134 3300005457 Ga0070662_101898125 Ga0070662_1018981251 57
135 3300005458 Ga0070681_10063375 Ga0070681_100633754 57
136 3300005458 Ga0070681_10391506 Ga0070681_103915062 57
137 3300005459 Ga0068867_100385815 Ga0068867_1003858152 57
138 3300005459 Ga0068867_100708830 Ga0068867_1007088302 57
139 3300005466 Ga0070685_10222170 Ga0070685_102221703 57
140 3300005466 Ga0070685_10351389 Ga0070685_103513892 57
141 3300005530 Ga0070679_100001182 Ga0070679_10000118210 57
142 3300005530 Ga0070679_101480400 Ga0070679_1014804002 57
143 3300005535 Ga0070684_100215259 Ga0070684_1002152593 57
144 3300005539 Ga0068853_100010924 Ga0068853_1000109245 57
145 3300005539 Ga0068853_100042011 Ga0068853_1000420114 57
146 3300005539 Ga0068853_100509301 Ga0068853_1005093012 57
147 3300005539 Ga0068853_101264986 Ga0068853_1012649861 57
148 3300005543 Ga0070672_100001167 Ga0070672_10000116718 57
149 3300005543 Ga0070672_100446963 Ga0070672_1004469632 57
150 3300005544 Ga0070686_100580363 Ga0070686_1005803632 57
151 3300005544 Ga0070686_101445854 Ga0070686_1014458541 57
152 3300005545 Ga0070695_100123928 Ga0070695_1001239284 57
153 3300005546 Ga0070696_100022165 Ga0070696_1000221655 57
154 3300005547 Ga0070693_100310100 Ga0070693_1003101001 57
155 3300005548 Ga0070665_100423473 Ga0070665_1004234732 57
156 3300005548 Ga0070665_100778654 Ga0070665_1007786542 57
157 3300005548 Ga0070665_101507548 Ga0070665_1015075482 57
158 3300005548 Ga0070665_102533970 Ga0070665_1025339702 57
159 3300005563 Ga0068855_100014297 Ga0068855_10001429710 57
160 3300005563 Ga0068855_100482620 Ga0068855_1004826202 57
161 3300005564 Ga0070664_100007923 Ga0070664_1000079237 57
162 3300005564 Ga0070664_100012706 Ga0070664_1000127063 57
163 3300005564 Ga0070664_100045101 Ga0070664_1000451013 57
164 3300005564 Ga0070664_100056667 Ga0070664_1000566674 57
165 3300005564 Ga0070664_100644078 Ga0070664_1006440781 57
166 3300005577 Ga0068857_100065387 Ga0068857_1000653873 57
167 3300005577 Ga0068857_100150057 Ga0068857_1001500574 57
168 3300005577 Ga0068857_101065504 Ga0068857_1010655042 57
169 3300005578 Ga0068854_100089476 Ga0068854_1000894762 57
170 3300005578 Ga0068854_100504347 Ga0068854_1005043472 57
171 3300005578 Ga0068854_101087755 Ga0068854_1010877552 57
172 3300005578 Ga0068854_101145879 Ga0068854_1011458792 57
173 3300005578 Ga0068854_102191990 Ga0068854_1021919902 57
174 3300005614 Ga0068856_100321799 Ga0068856_1003217992 57
175 3300005614 Ga0068856_100965982 Ga0068856_1009659822 57
176 3300005616 Ga0068852_100141960 Ga0068852_1001419604 57
177 3300005616 Ga0068852_100142505 Ga0068852_1001425051 57
178 3300005616 Ga0068852_100208794 Ga0068852_1002087943 57
179 3300005616 Ga0068852_101834029 Ga0068852_1018340292 57
180 3300005618 Ga0068864_100014407 Ga0068864_1000144078 57
181 3300005618 Ga0068864_101113886 Ga0068864_1011138862 57
182 3300005718 Ga0068866_10013515 Ga0068866_100135153 57
183 3300005718 Ga0068866_10258846 Ga0068866_102588462 57
184 3300005834 Ga0068851_10080552 Ga0068851_100805523 57
185 3300005834 Ga0068851_10185285 Ga0068851_101852853 57
186 3300005840 Ga0068870_10181017 Ga0068870_101810172 57
187 3300005841 Ga0068863_100048408 Ga0068863_1000484082 57
188 3300005841 Ga0068863_100217068 Ga0068863_1002170683 57
189 3300005841 Ga0068863_100311741 Ga0068863_1003117412 57
190 3300005842 Ga0068858_100001703 Ga0068858_1000017035 57
191 3300005842 Ga0068858_100037069 Ga0068858_1000370695 57
192 3300005843 Ga0068860_100405559 Ga0068860_1004055592 57
193 3300006028 Ga0070717_10470206 Ga0070717_104702062 57
194 3300006028 Ga0070717_10888671 Ga0070717_108886712 57
195 3300006237 Ga0097621_100041877 Ga0097621_1000418774 57
196 3300006237 Ga0097621_100132776 Ga0097621_1001327763 57
197 3300006358 Ga0068871_100049909 Ga0068871_1000499092 57
198 3300006358 Ga0068871_100061563 Ga0068871_1000615634 57
199 3300006358 Ga0068871_100440671 Ga0068871_1004406712 57
200 3300006844 Ga0075428_102518008 Ga0075428_1025180082 57
201 3300006881 Ga0068865_100422592 Ga0068865_1004225922 57
202 3300009094 Ga0111539_10171535 Ga0111539_101715353 57
203 3300009098 Ga0105245_10326666 Ga0105245_103266662 57
204 3300009148 Ga0105243_11060782 Ga0105243_110607822 57
205 3300009148 Ga0105243_12539711 Ga0105243_125397112 57
206 3300009174 Ga0105241_11397245 Ga0105241_113972452 57
207 3300009177 Ga0105248_10000362 Ga0105248_1000036233 57
208 3300009177 Ga0105248_10015449 Ga0105248_100154494 57
209 3300009177 Ga0105248_10154280 Ga0105248_101542804 57
210 3300013100 Ga0157373_10448359 Ga0157373_104483592 57
211 3300013100 Ga0157373_10505265 Ga0157373_105052652 57
212 3300013100 Ga0157373_10589686 Ga0157373_105896862 57
213 3300013102 Ga0157371_11488222 Ga0157371_114882222 57
214 3300013104 Ga0157370_10009840 Ga0157370_100098405 57
215 3300013105 Ga0157369_10084502 Ga0157369_100845024 57
216 3300013105 Ga0157369_10494599 Ga0157369_104945992 57
217 3300013296 Ga0157374_10181221 Ga0157374_101812214 57
218 3300013296 Ga0157374_11104556 Ga0157374_111045562 57
219 3300013306 Ga0163162_10223770 Ga0163162_102237702 57
220 3300013306 Ga0163162_10572582 Ga0163162_105725823 57
221 3300013306 Ga0163162_10918524 Ga0163162_109185242 57
222 3300013307 Ga0157372_12219650 Ga0157372_122196502 57
223 3300013308 Ga0157375_10013944 Ga0157375_100139445 57
224 3300013308 Ga0157375_10330959 Ga0157375_103309592 57
225 3300014325 Ga0163163_10045299 Ga0163163_100452995 57
226 3300014497 Ga0182008_10255520 Ga0182008_102555202 57
227 3300014497 Ga0182008_10366285 Ga0182008_103662852 57
228 3300014745 Ga0157377_10593147 Ga0157377_105931472 57
229 3300014968 Ga0157379_10823366 Ga0157379_108233662 57
230 3300014968 Ga0157379_11899559 Ga0157379_118995592 57
231 3300020082 Ga0206353_11417362 Ga0206353_114173622 57
232 3300025315 Ga0207697_10165847 Ga0207697_101658472 57
233 3300025321 Ga0207656_10088593 Ga0207656_100885933 57
234 3300025321 Ga0207656_10157274 Ga0207656_101572742 57
235 3300025321 Ga0207656_10220316 Ga0207656_102203162 57
236 3300025899 Ga0207642_10007456 Ga0207642_100074563 57
237 3300025899 Ga0207642_10951380 Ga0207642_109513802 57
238 3300025901 Ga0207688_10060376 Ga0207688_100603764 57
239 3300025901 Ga0207688_10408952 Ga0207688_104089522 57
240 3300025903 Ga0207680_10000626 Ga0207680_100006269 57
241 3300025903 Ga0207680_10228228 Ga0207680_102282282 57
242 3300025904 Ga0207647_10009933 Ga0207647_100099336 57
243 3300025904 Ga0207647_10047161 Ga0207647_100471613 57
244 3300025904 Ga0207647_10215638 Ga0207647_102156382 57
245 3300025907 Ga0207645_10423616 Ga0207645_104236162 57
246 3300025908 Ga0207643_10395860 Ga0207643_103958602 57
247 3300025909 Ga0207705_10000205 Ga0207705_1000020544 57
248 3300025909 Ga0207705_10029143 Ga0207705_100291434 57
249 3300025909 Ga0207705_10626484 Ga0207705_106264842 57
250 3300025909 Ga0207705_10922477 Ga0207705_109224772 57
251 3300025912 Ga0207707_10069959 Ga0207707_100699594 57
252 3300025912 Ga0207707_10357671 Ga0207707_103576712 57
253 3300025915 Ga0207693_10920348 Ga0207693_109203481 57
254 3300025917 Ga0207660_10001386 Ga0207660_100013869 57
255 3300025918 Ga0207662_10085881 Ga0207662_100858814 57
256 3300025919 Ga0207657_10003566 Ga0207657_1000356616 57
257 3300025919 Ga0207657_10007910 Ga0207657_100079109 57
258 3300025919 Ga0207657_10011594 Ga0207657_100115945 57
259 3300025919 Ga0207657_10041186 Ga0207657_100411866 57
260 3300025919 Ga0207657_10142321 Ga0207657_101423213 57
261 3300025919 Ga0207657_10673461 Ga0207657_106734612 57
262 3300025919 Ga0207657_11464349 Ga0207657_114643492 57
263 3300025920 Ga0207649_10019857 Ga0207649_100198575 57
264 3300025920 Ga0207649_10077821 Ga0207649_100778212 57
265 3300025920 Ga0207649_10124012 Ga0207649_101240124 57
266 3300025920 Ga0207649_10192535 Ga0207649_101925354 57
267 3300025920 Ga0207649_10333002 Ga0207649_103330022 57
268 3300025920 Ga0207649_10689902 Ga0207649_106899022 57
269 3300025921 Ga0207652_10000270 Ga0207652_1000027011 57
270 3300025921 Ga0207652_11123503 Ga0207652_111235032 57
271 3300025924 Ga0207694_11505638 Ga0207694_115056382 57
272 3300025925 Ga0207650_10028035 Ga0207650_100280353 57
273 3300025925 Ga0207650_10038230 Ga0207650_100382303 57
274 3300025925 Ga0207650_10197418 Ga0207650_101974182 57
275 3300025925 Ga0207650_10644129 Ga0207650_106441292 57
276 3300025925 Ga0207650_10897746 Ga0207650_108977462 57
277 3300025925 Ga0207650_11038171 Ga0207650_110381712 57
278 3300025925 Ga0207650_11474793 Ga0207650_114747932 57
279 3300025925 Ga0207650_11679380 Ga0207650_116793802 57
280 3300025926 Ga0207659_10014421 Ga0207659_100144212 57
281 3300025926 Ga0207659_10560970 Ga0207659_105609702 57
282 3300025927 Ga0207687_11376811 Ga0207687_113768112 57
283 3300025928 Ga0207700_10755064 Ga0207700_107550642 57
284 3300025929 Ga0207664_11392867 Ga0207664_113928672 57
285 3300025931 Ga0207644_10120776 Ga0207644_101207762 57
286 3300025931 Ga0207644_10274315 Ga0207644_102743152 57
287 3300025931 Ga0207644_11175350 Ga0207644_111753502 57
288 3300025932 Ga0207690_10009242 Ga0207690_100092423 57
289 3300025932 Ga0207690_10241226 Ga0207690_102412262 57
290 3300025932 Ga0207690_10916474 Ga0207690_109164742 57
291 3300025933 Ga0207706_10006135 Ga0207706_100061355 57
292 3300025933 Ga0207706_10088152 Ga0207706_100881523 57
293 3300025933 Ga0207706_10157347 Ga0207706_101573472 57
294 3300025933 Ga0207706_10188380 Ga0207706_101883802 57
295 3300025933 Ga0207706_10237420 Ga0207706_102374202 57
296 3300025933 Ga0207706_11512504 Ga0207706_115125042 57
297 3300025935 Ga0207709_10710384 Ga0207709_107103842 57
298 3300025936 Ga0207670_10036600 Ga0207670_100366003 57
299 3300025937 Ga0207669_10002475 Ga0207669_100024759 57
300 3300025937 Ga0207669_10409457 Ga0207669_104094572 57
301 3300025938 Ga0207704_11842489 Ga0207704_118424892 57
302 3300025940 Ga0207691_10004833 Ga0207691_100048336 57
303 3300025940 Ga0207691_10155884 Ga0207691_101558843 57
304 3300025941 Ga0207711_10000610 Ga0207711_1000061033 57
305 3300025941 Ga0207711_10029458 Ga0207711_100294584 57
306 3300025941 Ga0207711_10108999 Ga0207711_101089992 57
307 3300025944 Ga0207661_10035672 Ga0207661_100356724 57
308 3300025944 Ga0207661_10281857 Ga0207661_102818572 57
309 3300025944 Ga0207661_11866792 Ga0207661_118667922 57
310 3300025945 Ga0207679_10092671 Ga0207679_100926712 57
311 3300025945 Ga0207679_10237494 Ga0207679_102374943 57
312 3300025945 Ga0207679_10273154 Ga0207679_102731542 57
313 3300025945 Ga0207679_10336713 Ga0207679_103367133 57
314 3300025949 Ga0207667_10092876 Ga0207667_100928764 57
315 3300025949 Ga0207667_10459662 Ga0207667_104596623 57
316 3300025949 Ga0207667_10965854 Ga0207667_109658541 57
317 3300025960 Ga0207651_10027626 Ga0207651_100276265 57
318 3300025960 Ga0207651_10036114 Ga0207651_100361142 57
319 3300025960 Ga0207651_11023616 Ga0207651_110236162 57
320 3300025972 Ga0207668_10427699 Ga0207668_104276993 57
321 3300025981 Ga0207640_10274531 Ga0207640_102745312 57
322 3300025981 Ga0207640_10648041 Ga0207640_106480412 57
323 3300025981 Ga0207640_10719177 Ga0207640_107191772 57
324 3300025981 Ga0207640_11927692 Ga0207640_119276921 57
325 3300025981 Ga0207640_12128530 Ga0207640_121285302 57
326 3300025986 Ga0207658_10005525 Ga0207658_100055255 57
327 3300025986 Ga0207658_10274113 Ga0207658_102741133 57
328 3300025986 Ga0207658_10967702 Ga0207658_109677022 57
329 3300026023 Ga0207677_10003982 Ga0207677_100039826 57
330 3300026023 Ga0207677_10075441 Ga0207677_100754414 57
331 3300026035 Ga0207703_10006106 Ga0207703_100061064 57
332 3300026035 Ga0207703_10197852 Ga0207703_101978522 57
333 3300026035 Ga0207703_12376262 Ga0207703_123762622 57
334 3300026041 Ga0207639_10036236 Ga0207639_100362363 57
335 3300026041 Ga0207639_10207711 Ga0207639_102077112 57
336 3300026041 Ga0207639_10411625 Ga0207639_104116252 57
337 3300026041 Ga0207639_10927817 Ga0207639_109278172 57
338 3300026041 Ga0207639_11826009 Ga0207639_118260092 57
339 3300026067 Ga0207678_10000766 Ga0207678_1000076611 57
340 3300026067 Ga0207678_10105549 Ga0207678_101055493 57
341 3300026067 Ga0207678_10210123 Ga0207678_102101232 57
342 3300026067 Ga0207678_10347446 Ga0207678_103474461 57
343 3300026067 Ga0207678_10564039 Ga0207678_105640392 57
344 3300026078 Ga0207702_10307882 Ga0207702_103078823 57
345 3300026078 Ga0207702_10334089 Ga0207702_103340892 57
346 3300026078 Ga0207702_10545875 Ga0207702_105458752 57
347 3300026088 Ga0207641_10043334 Ga0207641_100433342 57
348 3300026088 Ga0207641_10117465 Ga0207641_101174654 57
349 3300026089 Ga0207648_10464460 Ga0207648_104644602 57
350 3300026095 Ga0207676_10005201 Ga0207676_100052012 57
351 3300026095 Ga0207676_10098779 Ga0207676_100987792 57
352 3300026116 Ga0207674_10037696 Ga0207674_100376964 57
353 3300026116 Ga0207674_10113335 Ga0207674_101133353 57
354 3300026121 Ga0207683_10009640 Ga0207683_100096408 57
355 3300026121 Ga0207683_10161003 Ga0207683_101610032 57
356 3300026142 Ga0207698_10036882 Ga0207698_100368823 57
357 3300026142 Ga0207698_10923718 Ga0207698_109237182 57
358 3300026142 Ga0207698_11164902 Ga0207698_111649022 57
359 3300026142 Ga0207698_12120547 Ga0207698_121205472 57
360 3300028379 Ga0268266_10108623 Ga0268266_101086234 57
361 3300028379 Ga0268266_12185213 Ga0268266_121852132 57
362 3300028381 Ga0268264_10293205 Ga0268264_102932053 57
363 3300028381 Ga0268264_10541117 Ga0268264_105411173 57
364 3300030745 Ga0316182_1086040 Ga0316182_10860402 57
365 3300031548 Ga0307408_100161243 Ga0307408_1001612433 57
366 3300031548 Ga0307408_100320899 Ga0307408_1003208992 57
367 3300031548 Ga0307408_101890301 Ga0307408_1018903012 57
368 3300031731 Ga0307405_10027152 Ga0307405_100271523 57
369 3300031731 Ga0307405_10038617 Ga0307405_100386174 57
370 3300031731 Ga0307405_10433949 Ga0307405_104339493 57
371 3300031731 Ga0307405_11379822 Ga0307405_113798222 57
372 3300031731 Ga0307405_11987780 Ga0307405_119877802 57
373 3300031824 Ga0307413_10304826 Ga0307413_103048261 57
374 3300031824 Ga0307413_11048306 Ga0307413_110483062 57
375 3300031852 Ga0307410_10016738 Ga0307410_100167383 57
376 3300031852 Ga0307410_10021687 Ga0307410_100216873 57
377 3300031852 Ga0307410_10111275 Ga0307410_101112752 57
378 3300031852 Ga0307410_10127807 Ga0307410_101278072 57
379 3300031852 Ga0307410_10193983 Ga0307410_101939833 57
380 3300031901 Ga0307406_10031393 Ga0307406_100313933 57
381 3300031901 Ga0307406_11304834 Ga0307406_113048342 57
382 3300031901 Ga0307406_12057372 Ga0307406_120573722 57
383 3300031903 Ga0307407_10105864 Ga0307407_101058642 57
384 3300031903 Ga0307407_10254180 Ga0307407_102541802 57
385 3300031903 Ga0307407_10330289 Ga0307407_103302892 57
386 3300031911 Ga0307412_10022002 Ga0307412_100220023 57
387 3300031911 Ga0307412_10041018 Ga0307412_100410184 57
388 3300031911 Ga0307412_10169511 Ga0307412_101695113 57
389 3300031911 Ga0307412_10974681 Ga0307412_109746812 57
390 3300031995 Ga0307409_100047085 Ga0307409_1000470852 57
391 3300031995 Ga0307409_100055516 Ga0307409_1000555161 57
392 3300031995 Ga0307409_100273382 Ga0307409_1002733823 57
393 3300031995 Ga0307409_101517804 Ga0307409_1015178042 57
394 3300031995 Ga0307409_101531280 Ga0307409_1015312802 57
395 3300032002 Ga0307416_100014810 Ga0307416_1000148107 57
396 3300032002 Ga0307416_100060676 Ga0307416_1000606763 57
397 3300032002 Ga0307416_100205117 Ga0307416_1002051172 57
398 3300032002 Ga0307416_100670824 Ga0307416_1006708243 57
399 3300032002 Ga0307416_100707317 Ga0307416_1007073171 57
400 3300032004 Ga0307414_10033242 Ga0307414_100332422 57
401 3300032004 Ga0307414_11300883 Ga0307414_113008831 57
402 3300032004 Ga0307414_11467893 Ga0307414_114678932 57
403 3300032005 Ga0307411_10001101 Ga0307411_100011019 57
404 3300032005 Ga0307411_10017670 Ga0307411_100176703 57
405 3300032005 Ga0307411_10466265 Ga0307411_104662652 57
406 3300032005 Ga0307411_10642535 Ga0307411_106425352 57
407 3300032126 Ga0307415_100036128 Ga0307415_1000361282 57
408 3300032126 Ga0307415_100077367 Ga0307415_1000773672 57
409 3300032126 Ga0307415_100355808 Ga0307415_1003558082 57
410 3300032126 Ga0307415_100496136 Ga0307415_1004961362 57
411 3300035089 Ga0373944_0422555 Ga0373944_0422555_175_348 57
412 3300035115 Ga0373941_0208531 Ga0373941_0208531_563_736 57
413 3300035115 Ga0373941_0291262 Ga0373941_0291262_68_241 57
414 3300035170 Ga0373943_0002387 Ga0373943_0002387_3634_3807 57
415 3300035171 Ga0373946_0004744 Ga0373946_0004744_4107_4280 57
416 3300035692 Ga0373935_0042878 Ga0373935_0042878_389_562 57
417 3300035695 Ga0373927_0052303 Ga0373927_0052303_2215_2388 57
418 3300036401 Ga0373937_0236204 Ga0373937_0236204_742_915 57
419 3300037068 Ga0373925_0061658 Ga0373925_0061658_1955_2128 57
420 3300037312 Ga0395899_0000387 Ga0395899_0000387_36869_37042 57
421 3300037312 Ga0395899_0001750 Ga0395899_0001750_3290_3463 57
422 3300037312 Ga0395899_0004293 Ga0395899_0004293_8991_9164 57
423 3300037312 Ga0395899_0024278 Ga0395899_0024278_2471_2644 57
424 3300037312 Ga0395899_0047348 Ga0395899_0047348_2777_2950 57
425 3300037312 Ga0395899_0048289 Ga0395899_0048289_2009_2182 57
426 3300037312 Ga0395899_0050207 Ga0395899_0050207_578_751 57
427 3300037312 Ga0395899_0981287 Ga0395899_0981287_323_496 57
428 3300037418 Ga0395900_0000130 Ga0395900_0000130_90341_90514 57
429 3300037418 Ga0395900_0006337 Ga0395900_0006337_8306_8479 57
430 3300037418 Ga0395900_0050595 Ga0395900_0050595_3640_3813 57
431 3300037418 Ga0395900_0060173 Ga0395900_0060173_1308_1481 57
432 3300037418 Ga0395900_0070709 Ga0395900_0070709_155_328 57
433 3300037418 Ga0395900_0111023 Ga0395900_0111023_20_193 57
434 3300037418 Ga0395900_0161969 Ga0395900_0161969_1853_2026 57
435 3300037418 Ga0395900_0915297 Ga0395900_0915297_142_315 57
436 3300037418 Ga0395900_1280988 Ga0395900_1280988_463_636 57
437 3300037466 Ga0395898_0000274 Ga0395898_0000274_68545_68718 57
438 3300037466 Ga0395898_0001594 Ga0395898_0001594_7546_7719 57
439 3300037466 Ga0395898_0004865 Ga0395898_0004865_1112_1285 57
440 3300037466 Ga0395898_0029190 Ga0395898_0029190_2334_2507 57
441 3300037466 Ga0395898_0108818 Ga0395898_0108818_152_325 57
442 3300037471 Ga0395905_0000287 Ga0395905_0000287_58200_58373 57
443 3300037471 Ga0395905_0001408 Ga0395905_0001408_3633_3806 57
444 3300037471 Ga0395905_0008347 Ga0395905_0008347_24_197 57
445 3300037471 Ga0395905_0009393 Ga0395905_0009393_2437_2610 57
446 3300037471 Ga0395905_0010680 Ga0395905_0010680_5738_5911 57
447 3300037471 Ga0395905_0019454 Ga0395905_0019454_5597_5770 57
448 3300037471 Ga0395905_0019534 Ga0395905_0019534_3980_4153 57
449 3300037471 Ga0395905_0022556 Ga0395905_0022556_1261_1434 57
450 3300037471 Ga0395905_0041942 Ga0395905_0041942_3726_3899 57
451 3300037471 Ga0395905_0043388 Ga0395905_0043388_3506_3679 57
452 3300037471 Ga0395905_0076037 Ga0395905_0076037_350_523 57
453 3300037471 Ga0395905_0122356 Ga0395905_0122356_2161_2334 57
454 3300037471 Ga0395905_0140054 Ga0395905_0140054_2022_2195 57
455 3300037471 Ga0395905_0146626 Ga0395905_0146626_1363_1536 57
456 3300037471 Ga0395905_0235254 Ga0395905_0235254_878_1051 57
457 3300037471 Ga0395905_0306403 Ga0395905_0306403_1236_1409 57
458 3300037471 Ga0395905_0338299 Ga0395905_0338299_756_929 57
459 3300037471 Ga0395905_0384558 Ga0395905_0384558_962_1135 57
460 3300037471 Ga0395905_0583012 Ga0395905_0583012_40_213 57
461 3300037471 Ga0395905_0648975 Ga0395905_0648975_185_358 57
462 3300037471 Ga0395905_1634907 Ga0395905_1634907_230_403 57
463 3300038443 Ga0395901_0018835 Ga0395901_0018835_6729_6902 57
464 3300038443 Ga0395901_0028662 Ga0395901_0028662_3786_3959 57
465 3300038443 Ga0395901_0059419 Ga0395901_0059419_3780_3953 57
466 3300038443 Ga0395901_0110482 Ga0395901_0110482_32_205 57
467 3300038443 Ga0395901_0120095 Ga0395901_0120095_1189_1362 57
468 3300038443 Ga0395901_0130566 Ga0395901_0130566_160_333 57
469 3300038443 Ga0395901_0150193 Ga0395901_0150193_303_476 57
470 3300038443 Ga0395901_0156682 Ga0395901_0156682_613_786 57
471 3300038443 Ga0395901_0512005 Ga0395901_0512005_985_1158 57
472 3300038443 Ga0395901_0686819 Ga0395901_0686819_351_524 57
473 3300038443 Ga0395901_0729428 Ga0395901_0729428_467_640 57
474 3300038443 Ga0395901_0751606 Ga0395901_0751606_643_816 57
475 3300041413 Ga0439465_0058319 Ga0439465_0058319_587_760 57
476 3300042005 Ga0439448_0004596 Ga0439448_0004596_3028_3201 57
477 3300042006 Ga0439432_222939 Ga0439432_222939_250_423 57
478 3300042007 Ga0439449_0235685 Ga0439449_0235685_17_190 57
479 3300042012 Ga0439455_0120683 Ga0439455_0120683_231_404 57
480 3300042118 Ga0450914_000440 Ga0450914_000440_111_284 57
481 3300042127 Ga0450890_005968 Ga0450890_005968_504_677 57
482 3300042142 Ga0450905_001095 Ga0450905_001095_2367_2540 57
483 3300042144 Ga0450889_000275 Ga0450889_000275_2298_2471 57
484 3300042157 Ga0439458_0000405 Ga0439458_0000405_4615_4788 57
485 3300042157 Ga0439458_0054816 Ga0439458_0054816_382_555 57
486 3300042157 Ga0439458_0071267 Ga0439458_0071267_44_217 57
487 3300042438 Ga0439459_0130688 Ga0439459_0130688_382_555 57
488 3300044684 Ga0466966_0841087 Ga0466966_0841087_341_514 57
489 3300044706 Ga0466964_0602646 Ga0466964_0602646_408_581 57
490 3300044765 Ga0466970_0765966 Ga0466970_0765966_283_456 57
491 3300046459 Ga0495629_0710345 Ga0495629_0710345_383_556 57
492 3300046681 Ga0495647_0044685 Ga0495647_0044685_1088_1261 57
493 3300048903 Ga0496100_0056386 Ga0496100_0056386_464_637 57
494 3300048904 Ga0496101_0018340 Ga0496101_0018340_3604_3777 57
495 3300048904 Ga0496101_0842522 Ga0496101_0842522_298_471 57
496 3300048905 Ga0496102_0671464 Ga0496102_0671464_553_726 57
497 3300048906 Ga0496103_0152161 Ga0496103_0152161_274_447 57
498 3300048909 Ga0496106_0292314 Ga0496106_0292314_550_723 57
499 3300048909 Ga0496106_0427041 Ga0496106_0427041_558_731 57
500 3300048910 Ga0496107_0124754 Ga0496107_0124754_1262_1435 57
501 3300048910 Ga0496107_0875417 Ga0496107_0875417_246_419 57
502 3300048911 Ga0496108_0114552 Ga0496108_0114552_1687_1860 57
503 3300048912 Ga0496109_0010711 Ga0496109_0010711_6436_6609 57
504 3300048913 Ga0496110_0033088 Ga0496110_0033088_3225_3398 57
505 3300048915 Ga0496112_0021480 Ga0496112_0021480_1881_2054 57
506 3300048915 Ga0496112_0072589 Ga0496112_0072589_1659_1832 57
507 3300048916 Ga0496113_0159089 Ga0496113_0159089_1164_1337 57
508 3300048916 Ga0496113_0207635 Ga0496113_0207635_1342_1515 57
509 3300048917 Ga0496114_0063559 Ga0496114_0063559_1190_1363 57
510 3300048918 Ga0496115_0058860 Ga0496115_0058860_2622_2795 57
511 3300049652 Ga0501202_038346 Ga0501202_038346_145_318 57
512 3300049659 Ga0501214_020059 Ga0501214_020059_649_822 57
513 3300049664 Ga0501224_014860 Ga0501224_014860_932_1105 57
514 3300049667 Ga0501230_079417 Ga0501230_079417_36_209 57
515 3300049679 Ga0501249_077708 Ga0501249_077708_565_738 57
516 3300049682 Ga0501252_033881 Ga0501252_033881_281_454 57
517 3300049704 Ga0501221_025277 Ga0501221_025277_687_860 57
518 3300049705 Ga0501225_0159470 Ga0501225_0159470_125_298 57
519 3300049706 Ga0501229_022774 Ga0501229_022774_509_682 57
520 3300049759 Ga0501262_011795 Ga0501262_011795_704_877 57
521 3300049765 Ga0501268_004007 Ga0501268_004007_1776_1949 57
522 3300049767 Ga0501270_044554 Ga0501270_044554_139_312 57
523 3300049769 Ga0501272_018225 Ga0501272_018225_180_353 57
524 3300049770 Ga0501273_042440 Ga0501273_042440_327_500 57
525 3300050507 nmdc:mga05p37_1150221_c1 nmdc:mga05p37_1150221_c1_39_212 57
526 3300050511 nmdc:mga08y16_224427_c1 nmdc:mga08y16_224427_c1_1192_1365 57
527 3300001915 JGI24741J21665_1035010 JGI24741J21665_10350102 58
528 3300001979 JGI24740J21852_10084697 JGI24740J21852_100846972 58
529 3300001990 JGI24737J22298_10036820 JGI24737J22298_100368202 58
530 3300005327 Ga0070658_10269566 Ga0070658_102695662 58
531 3300005329 Ga0070683_100101421 Ga0070683_1001014212 58
532 3300005336 Ga0070680_100452584 Ga0070680_1004525842 58
533 3300005337 Ga0070682_100346490 Ga0070682_1003464902 58
534 3300005338 Ga0068868_100294037 Ga0068868_1002940372 58
535 3300005339 Ga0070660_101069563 Ga0070660_1010695632 58
536 3300005355 Ga0070671_100767129 Ga0070671_1007671291 58
537 3300005366 Ga0070659_100187115 Ga0070659_1001871154 58
538 3300005366 Ga0070659_100304191 Ga0070659_1003041912 58
539 3300005435 Ga0070714_100447321 Ga0070714_1004473212 58
540 3300005455 Ga0070663_100525254 Ga0070663_1005252542 58
541 3300005457 Ga0070662_100359167 Ga0070662_1003591671 58
542 3300005530 Ga0070679_100241495 Ga0070679_1002414953 58
543 3300005535 Ga0070684_100074316 Ga0070684_1000743164 58
544 3300005539 Ga0068853_100177096 Ga0068853_1001770963 58
545 3300005563 Ga0068855_100469504 Ga0068855_1004695042 58
546 3300005563 Ga0068855_100653960 Ga0068855_1006539602 58
547 3300005564 Ga0070664_100202083 Ga0070664_1002020832 58
548 3300005564 Ga0070664_101818241 Ga0070664_1018182412 58
549 3300005577 Ga0068857_100139426 Ga0068857_1001394264 58
550 3300005578 Ga0068854_100039387 Ga0068854_1000393873 58
551 3300005614 Ga0068856_100373702 Ga0068856_1003737022 58
552 3300005616 Ga0068852_100300469 Ga0068852_1003004691 58
553 3300005618 Ga0068864_100006944 Ga0068864_1000069445 58
554 3300009093 Ga0105240_11103936 Ga0105240_111039362 58
555 3300009174 Ga0105241_12261586 Ga0105241_122615861 58
556 3300009177 Ga0105248_10084821 Ga0105248_100848212 58
557 3300009551 Ga0105238_10329376 Ga0105238_103293763 58
558 3300013100 Ga0157373_10055148 Ga0157373_100551482 58
559 3300013102 Ga0157371_11061688 Ga0157371_110616882 58
560 3300013102 Ga0157371_11140433 Ga0157371_111404331 58
561 3300013104 Ga0157370_10182775 Ga0157370_101827752 58
562 3300013105 Ga0157369_11517645 Ga0157369_115176452 58
563 3300020070 Ga0206356_10946257 Ga0206356_109462572 58
564 3300025904 Ga0207647_10048856 Ga0207647_100488564 58
565 3300025911 Ga0207654_11165591 Ga0207654_111655912 58
566 3300025917 Ga0207660_10516928 Ga0207660_105169282 58
567 3300025919 Ga0207657_10023947 Ga0207657_100239472 58
568 3300025920 Ga0207649_10165897 Ga0207649_101658972 58
569 3300025921 Ga0207652_10324428 Ga0207652_103244283 58
570 3300025929 Ga0207664_10868960 Ga0207664_108689602 58
571 3300025932 Ga0207690_10068654 Ga0207690_100686542 58
572 3300025933 Ga0207706_10042422 Ga0207706_100424224 58
573 3300025941 Ga0207711_10047172 Ga0207711_100471722 58
574 3300025944 Ga0207661_10092895 Ga0207661_100928952 58
575 3300025945 Ga0207679_10521531 Ga0207679_105215312 58
576 3300025949 Ga0207667_10486653 Ga0207667_104866531 58
577 3300025949 Ga0207667_10592858 Ga0207667_105928582 58
578 3300025981 Ga0207640_10057088 Ga0207640_100570884 58
579 3300026041 Ga0207639_10084907 Ga0207639_100849071 58
580 3300026067 Ga0207678_10325503 Ga0207678_103255032 58
581 3300026078 Ga0207702_10061009 Ga0207702_100610094 58
582 3300026088 Ga0207641_10111213 Ga0207641_101112134 58
583 3300026095 Ga0207676_10019201 Ga0207676_100192013 58
584 3300026116 Ga0207674_10005522 Ga0207674_1000552216 58
585 3300026142 Ga0207698_10010929 Ga0207698_100109294 58
586 3300037471 Ga0395905_0883429 Ga0395905_0883429_451_627 58
587 3300047445 Ga0495677_0073261 Ga0495677_0073261_387_563 58
588 3300047447 Ga0495685_258333 Ga0495685_258333_213_389 58
589 3300048907 Ga0496104_0344529 Ga0496104_0344529_42_218 58
590 3300048909 Ga0496106_0683911 Ga0496106_0683911_269_445 58
591 3300048910 Ga0496107_0098795 Ga0496107_0098795_300_476 58
592 3300048911 Ga0496108_0043524 Ga0496108_0043524_2416_2592 58
593 3300048912 Ga0496109_0026042 Ga0496109_0026042_1862_2038 58
594 3300048913 Ga0496110_1857347 Ga0496110_1857347_251_427 58
595 3300048914 Ga0496111_0121862 Ga0496111_0121862_1152_1328 58
596 3300048915 Ga0496112_0064275 Ga0496112_0064275_1575_1751 58
597 3300048916 Ga0496113_0113283 Ga0496113_0113283_1495_1671 58
598 3300001904 JGI24736J21556_1031894 JGI24736J21556_10318942 59
599 3300001915 JGI24741J21665_1067737 JGI24741J21665_10677371 59
600 3300001979 JGI24740J21852_10011555 JGI24740J21852_100115555 59
601 3300001979 JGI24740J21852_10074816 JGI24740J21852_100748162 59
602 3300001989 JGI24739J22299_10007851 JGI24739J22299_100078513 59
603 3300001990 JGI24737J22298_10000832 JGI24737J22298_100008328 59
604 3300002067 JGI24735J21928_10004365 JGI24735J21928_100043656 59
605 3300002075 JGI24738J21930_10001094 JGI24738J21930_100010942 59
606 3300002239 JGI24034J26672_10083741 JGI24034J26672_100837411 59
607 3300005327 Ga0070658_10000453 Ga0070658_1000045316 59
608 3300005327 Ga0070658_10021750 Ga0070658_100217505 59
609 3300005327 Ga0070658_10279940 Ga0070658_102799403 59
610 3300005327 Ga0070658_10316630 Ga0070658_103166302 59
611 3300005327 Ga0070658_10325594 Ga0070658_103255941 59
612 3300005329 Ga0070683_100019423 Ga0070683_1000194236 59
613 3300005329 Ga0070683_100895421 Ga0070683_1008954212 59
614 3300005329 Ga0070683_100931072 Ga0070683_1009310722 59
615 3300005330 Ga0070690_100486886 Ga0070690_1004868862 59
616 3300005331 Ga0070670_101668958 Ga0070670_1016689582 59
617 3300005335 Ga0070666_10001156 Ga0070666_1000115612 59
618 3300005336 Ga0070680_100126344 Ga0070680_1001263443 59
619 3300005336 Ga0070680_100551589 Ga0070680_1005515892 59
620 3300005336 Ga0070680_100660329 Ga0070680_1006603291 59
621 3300005336 Ga0070680_100941569 Ga0070680_1009415692 59
622 3300005336 Ga0070680_101389410 Ga0070680_1013894102 59
623 3300005337 Ga0070682_100036603 Ga0070682_1000366033 59
624 3300005339 Ga0070660_100000488 Ga0070660_10000048821 59
625 3300005339 Ga0070660_100072300 Ga0070660_1000723002 59
626 3300005339 Ga0070660_100164935 Ga0070660_1001649352 59
627 3300005339 Ga0070660_100232619 Ga0070660_1002326193 59
628 3300005341 Ga0070691_11072063 Ga0070691_110720631 59
629 3300005344 Ga0070661_100000311 Ga0070661_10000031121 59
630 3300005344 Ga0070661_100009119 Ga0070661_1000091194 59
631 3300005344 Ga0070661_100386994 Ga0070661_1003869942 59
632 3300005344 Ga0070661_101213872 Ga0070661_1012138722 59
633 3300005345 Ga0070692_10141619 Ga0070692_101416193 59
634 3300005345 Ga0070692_11139777 Ga0070692_111397771 59
635 3300005355 Ga0070671_100013021 Ga0070671_1000130214 59
636 3300005364 Ga0070673_102233371 Ga0070673_1022333712 59
637 3300005366 Ga0070659_100000594 Ga0070659_10000059410 59
638 3300005366 Ga0070659_100021739 Ga0070659_1000217392 59
639 3300005366 Ga0070659_100059160 Ga0070659_1000591604 59
640 3300005366 Ga0070659_100369752 Ga0070659_1003697522 59
641 3300005367 Ga0070667_100006873 Ga0070667_1000068731 59
642 3300005435 Ga0070714_100383278 Ga0070714_1003832782 59
643 3300005455 Ga0070663_100003876 Ga0070663_1000038762 59
644 3300005455 Ga0070663_100759149 Ga0070663_1007591492 59
645 3300005457 Ga0070662_100000198 Ga0070662_10000019821 59
646 3300005457 Ga0070662_100611683 Ga0070662_1006116831 59
647 3300005458 Ga0070681_10308950 Ga0070681_103089503 59
648 3300005458 Ga0070681_10689912 Ga0070681_106899122 59
649 3300005530 Ga0070679_101153839 Ga0070679_1011538392 59
650 3300005530 Ga0070679_101458392 Ga0070679_1014583922 59
651 3300005535 Ga0070684_100519069 Ga0070684_1005190692 59
652 3300005539 Ga0068853_100000154 Ga0068853_1000001542 59
653 3300005539 Ga0068853_100000655 Ga0068853_1000006557 59
654 3300005539 Ga0068853_100078309 Ga0068853_1000783093 59
655 3300005544 Ga0070686_100296780 Ga0070686_1002967802 59
656 3300005547 Ga0070693_100000578 Ga0070693_10000057814 59
657 3300005548 Ga0070665_100147557 Ga0070665_1001475572 59
658 3300005563 Ga0068855_100003204 Ga0068855_10000320410 59
659 3300005563 Ga0068855_100040366 Ga0068855_1000403664 59
660 3300005563 Ga0068855_100079821 Ga0068855_1000798215 59
661 3300005563 Ga0068855_100284249 Ga0068855_1002842492 59
662 3300005563 Ga0068855_101321209 Ga0068855_1013212092 59
663 3300005564 Ga0070664_100000259 Ga0070664_10000025922 59
664 3300005564 Ga0070664_100675247 Ga0070664_1006752472 59
665 3300005564 Ga0070664_102043169 Ga0070664_1020431692 59
666 3300005577 Ga0068857_100031303 Ga0068857_1000313035 59
667 3300005577 Ga0068857_101976446 Ga0068857_1019764462 59
668 3300005578 Ga0068854_100008271 Ga0068854_1000082718 59
669 3300005578 Ga0068854_100169923 Ga0068854_1001699232 59
670 3300005578 Ga0068854_100272825 Ga0068854_1002728252 59
671 3300005614 Ga0068856_100000315 Ga0068856_10000031517 59
672 3300005614 Ga0068856_100513395 Ga0068856_1005133952 59
673 3300005614 Ga0068856_100548682 Ga0068856_1005486822 59
674 3300005614 Ga0068856_101983622 Ga0068856_1019836222 59
675 3300005616 Ga0068852_100000548 Ga0068852_1000005488 59
676 3300005616 Ga0068852_100003431 Ga0068852_1000034316 59
677 3300005616 Ga0068852_100005054 Ga0068852_1000050546 59
678 3300005616 Ga0068852_100021395 Ga0068852_1000213953 59
679 3300005616 Ga0068852_102630340 Ga0068852_1026303402 59
680 3300005617 Ga0068859_100554978 Ga0068859_1005549782 59
681 3300005618 Ga0068864_100372834 Ga0068864_1003728343 59
682 3300005834 Ga0068851_10043922 Ga0068851_100439223 59
683 3300005834 Ga0068851_10375388 Ga0068851_103753881 59
684 3300005842 Ga0068858_100145934 Ga0068858_1001459343 59
685 3300006237 Ga0097621_100160527 Ga0097621_1001605273 59
686 3300006931 Ga0097620_100554989 Ga0097620_1005549892 59
687 3300009093 Ga0105240_10045821 Ga0105240_100458214 59
688 3300009101 Ga0105247_10637957 Ga0105247_106379572 59
689 3300009174 Ga0105241_10115466 Ga0105241_101154664 59
690 3300009174 Ga0105241_10486671 Ga0105241_104866712 59
691 3300009177 Ga0105248_10000395 Ga0105248_1000039516 59
692 3300009545 Ga0105237_11218392 Ga0105237_112183922 59
693 3300009551 Ga0105238_10025019 Ga0105238_100250193 59
694 3300013100 Ga0157373_10019290 Ga0157373_100192906 59
695 3300013100 Ga0157373_10205018 Ga0157373_102050182 59
696 3300013100 Ga0157373_10242214 Ga0157373_102422142 59
697 3300013100 Ga0157373_10993881 Ga0157373_109938811 59
698 3300013102 Ga0157371_10179963 Ga0157371_101799634 59
699 3300013102 Ga0157371_10195429 Ga0157371_101954292 59
700 3300013102 Ga0157371_10317038 Ga0157371_103170383 59
701 3300013102 Ga0157371_10878755 Ga0157371_108787552 59
702 3300013102 Ga0157371_11108085 Ga0157371_111080852 59
703 3300013104 Ga0157370_10036438 Ga0157370_100364384 59
704 3300013104 Ga0157370_10292334 Ga0157370_102923342 59
705 3300013104 Ga0157370_10476072 Ga0157370_104760721 59
706 3300013104 Ga0157370_10629320 Ga0157370_106293202 59
707 3300013104 Ga0157370_10770082 Ga0157370_107700822 59
708 3300013105 Ga0157369_10005829 Ga0157369_100058293 59
709 3300013105 Ga0157369_10050842 Ga0157369_100508423 59
710 3300013105 Ga0157369_10268072 Ga0157369_102680722 59
711 3300013105 Ga0157369_10405068 Ga0157369_104050683 59
712 3300013105 Ga0157369_12481169 Ga0157369_124811692 59
713 3300013296 Ga0157374_10077668 Ga0157374_100776684 59
714 3300013307 Ga0157372_10011276 Ga0157372_100112769 59
715 3300013307 Ga0157372_10663215 Ga0157372_106632153 59
716 3300013307 Ga0157372_10865199 Ga0157372_108651992 59
717 3300013307 Ga0157372_12539293 Ga0157372_125392932 59
718 3300014325 Ga0163163_10001203 Ga0163163_100012035 59
719 3300014968 Ga0157379_10208696 Ga0157379_102086962 59
720 3300014969 Ga0157376_11302703 Ga0157376_113027032 59
721 3300020081 Ga0206354_10972652 Ga0206354_109726522 59
722 3300020082 Ga0206353_10319710 Ga0206353_103197102 59
723 3300020082 Ga0206353_11687510 Ga0206353_116875102 59
724 3300025321 Ga0207656_10532257 Ga0207656_105322571 59
725 3300025321 Ga0207656_10668172 Ga0207656_106681722 59
726 3300025903 Ga0207680_10000267 Ga0207680_1000026711 59
727 3300025904 Ga0207647_10006403 Ga0207647_100064039 59
728 3300025904 Ga0207647_10045794 Ga0207647_100457943 59
729 3300025904 Ga0207647_10381492 Ga0207647_103814921 59
730 3300025909 Ga0207705_10000449 Ga0207705_1000044922 59
731 3300025909 Ga0207705_10033148 Ga0207705_100331486 59
732 3300025909 Ga0207705_10117988 Ga0207705_101179881 59
733 3300025909 Ga0207705_11017606 Ga0207705_110176062 59
734 3300025909 Ga0207705_11224692 Ga0207705_112246922 59
735 3300025911 Ga0207654_10065206 Ga0207654_100652062 59
736 3300025912 Ga0207707_10949402 Ga0207707_109494022 59
737 3300025913 Ga0207695_10078613 Ga0207695_100786133 59
738 3300025914 Ga0207671_10103235 Ga0207671_101032353 59
739 3300025917 Ga0207660_11224645 Ga0207660_112246452 59
740 3300025919 Ga0207657_10001304 Ga0207657_1000130410 59
741 3300025919 Ga0207657_10039954 Ga0207657_100399543 59
742 3300025919 Ga0207657_10162031 Ga0207657_101620315 59
743 3300025919 Ga0207657_10185328 Ga0207657_101853283 59
744 3300025919 Ga0207657_10300715 Ga0207657_103007152 59
745 3300025919 Ga0207657_10852948 Ga0207657_108529482 59
746 3300025920 Ga0207649_10000942 Ga0207649_1000094211 59
747 3300025920 Ga0207649_10047985 Ga0207649_100479854 59
748 3300025920 Ga0207649_10390110 Ga0207649_103901102 59
749 3300025920 Ga0207649_10581622 Ga0207649_105816221 59
750 3300025920 Ga0207649_11412181 Ga0207649_114121812 59
751 3300025924 Ga0207694_10002320 Ga0207694_100023202 59
752 3300025924 Ga0207694_10089196 Ga0207694_100891963 59
753 3300025925 Ga0207650_11328403 Ga0207650_113284032 59
754 3300025931 Ga0207644_10005695 Ga0207644_100056955 59
755 3300025932 Ga0207690_10000257 Ga0207690_1000025731 59
756 3300025932 Ga0207690_10013935 Ga0207690_100139353 59
757 3300025932 Ga0207690_10269552 Ga0207690_102695522 59
758 3300025932 Ga0207690_10545639 Ga0207690_105456392 59
759 3300025933 Ga0207706_10001176 Ga0207706_1000117621 59
760 3300025933 Ga0207706_11140165 Ga0207706_111401652 59
761 3300025941 Ga0207711_10000427 Ga0207711_1000042717 59
762 3300025944 Ga0207661_10000918 Ga0207661_1000091812 59
763 3300025944 Ga0207661_10174405 Ga0207661_101744052 59
764 3300025944 Ga0207661_11115504 Ga0207661_111155041 59
765 3300025945 Ga0207679_10000463 Ga0207679_100004634 59
766 3300025945 Ga0207679_10933021 Ga0207679_109330212 59
767 3300025945 Ga0207679_11128305 Ga0207679_111283052 59
768 3300025949 Ga0207667_10005298 Ga0207667_100052988 59
769 3300025949 Ga0207667_10031169 Ga0207667_100311697 59
770 3300025949 Ga0207667_10117241 Ga0207667_101172412 59
771 3300025949 Ga0207667_11053064 Ga0207667_110530642 59
772 3300025949 Ga0207667_11446050 Ga0207667_114460502 59
773 3300025981 Ga0207640_10109823 Ga0207640_101098232 59
774 3300025981 Ga0207640_10175751 Ga0207640_101757512 59
775 3300025981 Ga0207640_12180355 Ga0207640_121803551 59
776 3300025986 Ga0207658_10142548 Ga0207658_101425481 59
777 3300026035 Ga0207703_10056018 Ga0207703_100560182 59
778 3300026041 Ga0207639_10000899 Ga0207639_100008998 59
779 3300026041 Ga0207639_10304903 Ga0207639_103049031 59
780 3300026041 Ga0207639_10401038 Ga0207639_104010382 59
781 3300026067 Ga0207678_10009100 Ga0207678_1000910010 59
782 3300026067 Ga0207678_10073610 Ga0207678_100736103 59
783 3300026078 Ga0207702_10002140 Ga0207702_100021405 59
784 3300026078 Ga0207702_10348925 Ga0207702_103489252 59
785 3300026078 Ga0207702_10520496 Ga0207702_105204962 59
786 3300026095 Ga0207676_10012479 Ga0207676_100124797 59
787 3300026116 Ga0207674_10296822 Ga0207674_102968224 59
788 3300026116 Ga0207674_11201913 Ga0207674_112019132 59
789 3300026116 Ga0207674_11375886 Ga0207674_113758861 59
790 3300026142 Ga0207698_10000435 Ga0207698_1000043518 59
791 3300026142 Ga0207698_10000560 Ga0207698_1000056017 59
792 3300026142 Ga0207698_10004591 Ga0207698_100045918 59
793 3300026142 Ga0207698_10004812 Ga0207698_100048125 59
794 3300028379 Ga0268266_10083621 Ga0268266_100836213 59
795 3300034816 Ga0373930_0163397 Ga0373930_0163397_358_537 59
796 3300034818 Ga0373950_0032043 Ga0373950_0032043_577_756 59
797 3300035114 Ga0373939_0086535 Ga0373939_0086535_624_803 59
798 3300035115 Ga0373941_0015662 Ga0373941_0015662_66_245 59
799 3300035241 Ga0373961_0008248 Ga0373961_0008248_1989_2168 59
800 3300035242 Ga0373962_0289297 Ga0373962_0289297_241_420 59
801 3300035691 Ga0373931_0116666 Ga0373931_0116666_463_642 59
802 3300037312 Ga0395899_0011077 Ga0395899_0011077_1775_1954 59
803 3300037312 Ga0395899_0098320 Ga0395899_0098320_1219_1398 59
804 3300037312 Ga0395899_0165787 Ga0395899_0165787_229_408 59
805 3300037312 Ga0395899_0593732 Ga0395899_0593732_225_404 59
806 3300037418 Ga0395900_0019755 Ga0395900_0019755_1943_2122 59
807 3300037418 Ga0395900_0064510 Ga0395900_0064510_1691_1870 59
808 3300037418 Ga0395900_0182805 Ga0395900_0182805_1388_1567 59
809 3300037418 Ga0395900_0314084 Ga0395900_0314084_472_651 59
810 3300037418 Ga0395900_1112744 Ga0395900_1112744_267_446 59
811 3300037466 Ga0395898_0042473 Ga0395898_0042473_2153_2332 59
812 3300037466 Ga0395898_0053112 Ga0395898_0053112_3343_3522 59
813 3300037466 Ga0395898_0270220 Ga0395898_0270220_798_977 59
814 3300037471 Ga0395905_0051282 Ga0395905_0051282_3423_3602 59
815 3300037471 Ga0395905_0324861 Ga0395905_0324861_770_949 59
816 3300037471 Ga0395905_0412885 Ga0395905_0412885_218_397 59
817 3300037471 Ga0395905_0646301 Ga0395905_0646301_302_481 59
818 3300037471 Ga0395905_0995427 Ga0395905_0995427_262_441 59
819 3300038443 Ga0395901_0014759 Ga0395901_0014759_2332_2511 59
820 3300038443 Ga0395901_0142529 Ga0395901_0142529_575_754 59
821 3300038443 Ga0395901_0442414 Ga0395901_0442414_136_315 59
822 3300038443 Ga0395901_1577988 Ga0395901_1577988_193_372 59
823 3300044694 Ga0466963_0011272 Ga0466963_0011272_4840_5019 59
824 3300044694 Ga0466963_0603338 Ga0466963_0603338_538_717 59
825 3300044706 Ga0466964_0061663 Ga0466964_0061663_39_218 59
826 3300044842 Ga0466957_0003051 Ga0466957_0003051_682_861 59
827 3300045976 Ga0466967_0000053 Ga0466967_0000053_32358_32537 59
828 3300045976 Ga0466967_0117666 Ga0466967_0117666_1007_1186 59
829 3300045976 Ga0466967_0152078 Ga0466967_0152078_359_538 59
830 3300045976 Ga0466967_0283260 Ga0466967_0283260_1374_1553 59
831 3300045976 Ga0466967_0592188 Ga0466967_0592188_429_608 59
832 3300048906 Ga0496103_0309545 Ga0496103_0309545_372_551 59
833 3300048908 Ga0496105_1287102 Ga0496105_1287102_327_506 59
834 3300048909 Ga0496106_0200985 Ga0496106_0200985_763_942 59
835 3300048910 Ga0496107_0148922 Ga0496107_0148922_1273_1452 59
836 3300048911 Ga0496108_1084218 Ga0496108_1084218_278_457 59
837 3300048914 Ga0496111_0057303 Ga0496111_0057303_830_1009 59
838 3300049571 Ga0501034_0526388 Ga0501034_0526388_357_536 59
839 3300049580 Ga0501046_0766886 Ga0501046_0766886_400_579 59
840 3300049584 Ga0501068_0184571 Ga0501068_0184571_745_924 59

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fay-assembly1.cif.gz_A y208f mutant of choline tma-lyase 1 5 40
5fau-assembly2.cif.gz_D wild-type choline tma lyase in complex with choline 0.9996 5 40
5fav-assembly1.cif.gz_B e491q mutant of choline tma-lyase 0.998 5 40
5faw-assembly1.cif.gz_B t502a mutant of choline tma-lyase 0.9975 5 40
5kdp-assembly1.cif.gz_A e491a mutant of choline tma-lyase 0.9957 5 40
ID Description Score Start End Superfamily
af_D9PTP5_274_476_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 1.006 4 43 1.20.1270.60
af_Q9FFY4_132_273_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 1.006 3 43 1.20.1070.10
af_I1K9S1_1_128_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 1.005 3 43 1.25.40.10
af_Q9URX8_818_968_1.25.40.450 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Nucleoporin, helical domain, N-terminal subdomain 1 9 43 1.25.40.450
af_Q54CX7_116_196_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9958 6 43 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A4V2E7K4-F1-model_v4 Uncharacterized protein 1.017 6 43
AF-A0A7Y4H666-F1-model_v4 Uncharacterized protein 1.015 5 43
AF-A0A1Q7BPX4-F1-model_v4 HTH tetR-type domain-containing protein 1.014 6 43
AF-A0A1A8XS35-F1-model_v4 Phasin domain-containing protein 1.014 3 43
AF-A0A017HJJ8-F1-model_v4 Uncharacterized protein 1.013 4 43

Feature Viewer

pLDDT pTM Quality
82.93 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map