F483040
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 840 | 245 | 840 | 57 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1031894|JGI24736J21556_10318942 |
| Length | 59 |
| Sequence | MATQDRIYFAQRAAEEQELAISSDDPDVAEAHRKLQRAYLERASVGERPAIQLPAQPIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 191 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 192 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 193 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 194 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 195 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 196 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 197 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 198 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 199 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 200 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 231 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 232 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 234 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 235 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 237 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 239 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 240 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 241 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 242 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.76 |
| Rhizosphere | 95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1031894 | 3300001904 | Bacteria | 814 |
| 2 | JGI24741J21665_1035010 | 3300001915 | Bacteria | 746 |
| 3 | JGI24741J21665_1067737 | 3300001915 | Bacteria | 528 |
| 4 | JGI24740J21852_10011555 | 3300001979 | Bacteria | 3359 |
| 5 | JGI24740J21852_10015401 | 3300001979 | Bacteria | 2793 |
| 6 | JGI24740J21852_10074816 | 3300001979 | Bacteria | 898 |
| 7 | JGI24740J21852_10084697 | 3300001979 | Bacteria | 825 |
| 8 | JGI24739J22299_10007851 | 3300001989 | Bacteria | 3992 |
| 9 | JGI24737J22298_10000832 | 3300001990 | Bacteria | 10982 |
| 10 | JGI24737J22298_10036820 | 3300001990 | Bacteria | 1510 |
| 11 | JGI24737J22298_10089095 | 3300001990 | Bacteria | 915 |
| 12 | JGI24735J21928_10004365 | 3300002067 | Bacteria | 4759 |
| 13 | JGI24738J21930_10001094 | 3300002075 | Bacteria | 7665 |
| 14 | JGI24034J26672_10083741 | 3300002239 | Bacteria | 585 |
| 15 | rootH1_10019858 | 3300003323 | Bacteria | 1083 |
| 16 | Ga0070658_10000453 | 3300005327 | Bacteria | 35538 |
| 17 | Ga0070658_10021750 | 3300005327 | Bacteria | 5141 |
| 18 | Ga0070658_10032398 | 3300005327 | Bacteria | 4201 |
| 19 | Ga0070658_10052796 | 3300005327 | Bacteria | 3297 |
| 20 | Ga0070658_10074834 | 3300005327 | Bacteria | 2777 |
| 21 | Ga0070658_10134112 | 3300005327 | Bacteria | 2065 |
| 22 | Ga0070658_10179207 | 3300005327 | Bacteria | 1783 |
| 23 | Ga0070658_10269566 | 3300005327 | Bacteria | 1447 |
| 24 | Ga0070658_10279940 | 3300005327 | Bacteria | 1420 |
| 25 | Ga0070658_10316630 | 3300005327 | Bacteria | 1332 |
| 26 | Ga0070658_10325594 | 3300005327 | Bacteria | 1313 |
| 27 | Ga0070658_11439996 | 3300005327 | Bacteria | 598 |
| 28 | Ga0070683_100011627 | 3300005329 | Bacteria | 7619 |
| 29 | Ga0070683_100019423 | 3300005329 | Bacteria | 6036 |
| 30 | Ga0070683_100101421 | 3300005329 | Bacteria | 2710 |
| 31 | Ga0070683_100423572 | 3300005329 | Bacteria | 1270 |
| 32 | Ga0070683_100895421 | 3300005329 | Bacteria | 851 |
| 33 | Ga0070683_100931072 | 3300005329 | Bacteria | 834 |
| 34 | Ga0070683_102011379 | 3300005329 | Unclassified | 555 |
| 35 | Ga0070690_100001152 | 3300005330 | Bacteria | 13610 |
| 36 | Ga0070690_100318396 | 3300005330 | Bacteria | 1120 |
| 37 | Ga0070690_100486886 | 3300005330 | Bacteria | 920 |
| 38 | Ga0070670_100005622 | 3300005331 | Bacteria | 10577 |
| 39 | Ga0070670_100031334 | 3300005331 | Bacteria | 4579 |
| 40 | Ga0070670_100175019 | 3300005331 | Bacteria | 1862 |
| 41 | Ga0070670_100409845 | 3300005331 | Bacteria | 1197 |
| 42 | Ga0070670_100712289 | 3300005331 | Bacteria | 903 |
| 43 | Ga0070670_100767140 | 3300005331 | Bacteria | 870 |
| 44 | Ga0070670_100892285 | 3300005331 | Bacteria | 806 |
| 45 | Ga0070670_101668958 | 3300005331 | Bacteria | 586 |
| 46 | Ga0070670_101992042 | 3300005331 | Bacteria | 535 |
| 47 | Ga0070677_10179546 | 3300005333 | Bacteria | 1007 |
| 48 | Ga0070677_10602095 | 3300005333 | Bacteria | 609 |
| 49 | Ga0070666_10000215 | 3300005335 | Bacteria | 39675 |
| 50 | Ga0070666_10001156 | 3300005335 | Bacteria | 16024 |
| 51 | Ga0070666_10016884 | 3300005335 | Bacteria | 4674 |
| 52 | Ga0070666_10159798 | 3300005335 | Bacteria | 1575 |
| 53 | Ga0070666_11010514 | 3300005335 | Bacteria | 617 |
| 54 | Ga0070680_100032551 | 3300005336 | Bacteria | 4197 |
| 55 | Ga0070680_100126344 | 3300005336 | Bacteria | 2137 |
| 56 | Ga0070680_100452584 | 3300005336 | Bacteria | 1097 |
| 57 | Ga0070680_100551589 | 3300005336 | Bacteria | 988 |
| 58 | Ga0070680_100660329 | 3300005336 | Bacteria | 899 |
| 59 | Ga0070680_100941569 | 3300005336 | Bacteria | 745 |
| 60 | Ga0070680_101389410 | 3300005336 | Bacteria | 608 |
| 61 | Ga0070682_100036603 | 3300005337 | Bacteria | 3001 |
| 62 | Ga0070682_100346490 | 3300005337 | Bacteria | 1106 |
| 63 | Ga0068868_100003281 | 3300005338 | Bacteria | 11260 |
| 64 | Ga0068868_100104592 | 3300005338 | Bacteria | 2295 |
| 65 | Ga0068868_100294037 | 3300005338 | Bacteria | 1378 |
| 66 | Ga0070660_100000488 | 3300005339 | Bacteria | 26536 |
| 67 | Ga0070660_100000678 | 3300005339 | Bacteria | 22503 |
| 68 | Ga0070660_100029505 | 3300005339 | Bacteria | 4111 |
| 69 | Ga0070660_100039840 | 3300005339 | Bacteria | 3572 |
| 70 | Ga0070660_100072300 | 3300005339 | Bacteria | 2695 |
| 71 | Ga0070660_100138170 | 3300005339 | Bacteria | 1953 |
| 72 | Ga0070660_100164935 | 3300005339 | Bacteria | 1787 |
| 73 | Ga0070660_100232619 | 3300005339 | Bacteria | 1500 |
| 74 | Ga0070660_101069563 | 3300005339 | Bacteria | 682 |
| 75 | Ga0070689_100082305 | 3300005340 | Bacteria | 2528 |
| 76 | Ga0070691_11072063 | 3300005341 | Unclassified | 506 |
| 77 | Ga0070687_100115377 | 3300005343 | Bacteria | 1527 |
| 78 | Ga0070661_100000311 | 3300005344 | Bacteria | 39261 |
| 79 | Ga0070661_100009119 | 3300005344 | Bacteria | 6857 |
| 80 | Ga0070661_100019093 | 3300005344 | Bacteria | 4881 |
| 81 | Ga0070661_100034471 | 3300005344 | Bacteria | 3670 |
| 82 | Ga0070661_100083455 | 3300005344 | Bacteria | 2360 |
| 83 | Ga0070661_100221201 | 3300005344 | Bacteria | 1452 |
| 84 | Ga0070661_100280495 | 3300005344 | Bacteria | 1292 |
| 85 | Ga0070661_100386994 | 3300005344 | Bacteria | 1103 |
| 86 | Ga0070661_100604439 | 3300005344 | Bacteria | 887 |
| 87 | Ga0070661_101156747 | 3300005344 | Unclassified | 646 |
| 88 | Ga0070661_101213872 | 3300005344 | Bacteria | 631 |
| 89 | Ga0070692_10032892 | 3300005345 | Bacteria | 2611 |
| 90 | Ga0070692_10141619 | 3300005345 | Bacteria | 1361 |
| 91 | Ga0070692_11139777 | 3300005345 | Unclassified | 552 |
| 92 | Ga0070668_100083764 | 3300005347 | Bacteria | 2504 |
| 93 | Ga0070668_100376342 | 3300005347 | Bacteria | 1207 |
| 94 | Ga0070669_100517922 | 3300005353 | Bacteria | 991 |
| 95 | Ga0070669_101875985 | 3300005353 | Unclassified | 523 |
| 96 | Ga0070675_100457032 | 3300005354 | Unclassified | 1146 |
| 97 | Ga0070675_100704312 | 3300005354 | Bacteria | 920 |
| 98 | Ga0070671_100013021 | 3300005355 | Bacteria | 6704 |
| 99 | Ga0070671_100026186 | 3300005355 | Bacteria | 4792 |
| 100 | Ga0070671_100274093 | 3300005355 | Bacteria | 1434 |
| 101 | Ga0070671_100349159 | 3300005355 | Bacteria | 1262 |
| 102 | Ga0070671_100767129 | 3300005355 | Bacteria | 839 |
| 103 | Ga0070674_100017266 | 3300005356 | Bacteria | 4536 |
| 104 | Ga0070674_100308488 | 3300005356 | Bacteria | 1264 |
| 105 | Ga0070673_100013350 | 3300005364 | Bacteria | 5678 |
| 106 | Ga0070673_100097879 | 3300005364 | Bacteria | 2410 |
| 107 | Ga0070673_102233371 | 3300005364 | Unclassified | 520 |
| 108 | Ga0070688_100290560 | 3300005365 | Bacteria | 1178 |
| 109 | Ga0070659_100000594 | 3300005366 | Bacteria | 26514 |
| 110 | Ga0070659_100008920 | 3300005366 | Bacteria | 7350 |
| 111 | Ga0070659_100021739 | 3300005366 | Bacteria | 4892 |
| 112 | Ga0070659_100024090 | 3300005366 | Bacteria | 4664 |
| 113 | Ga0070659_100032050 | 3300005366 | Bacteria | 4074 |
| 114 | Ga0070659_100048299 | 3300005366 | Bacteria | 3343 |
| 115 | Ga0070659_100059160 | 3300005366 | Bacteria | 3025 |
| 116 | Ga0070659_100106737 | 3300005366 | Bacteria | 2258 |
| 117 | Ga0070659_100187115 | 3300005366 | Bacteria | 1701 |
| 118 | Ga0070659_100304191 | 3300005366 | Bacteria | 1330 |
| 119 | Ga0070659_100369752 | 3300005366 | Bacteria | 1206 |
| 120 | Ga0070659_100920631 | 3300005366 | Bacteria | 765 |
| 121 | Ga0070667_100000842 | 3300005367 | Bacteria | 28434 |
| 122 | Ga0070667_100006873 | 3300005367 | Bacteria | 9455 |
| 123 | Ga0070667_100288724 | 3300005367 | Bacteria | 1474 |
| 124 | Ga0070667_100891502 | 3300005367 | Bacteria | 828 |
| 125 | Ga0070667_102071338 | 3300005367 | Bacteria | 536 |
| 126 | Ga0070714_100271398 | 3300005435 | Bacteria | 1573 |
| 127 | Ga0070714_100383278 | 3300005435 | Bacteria | 1326 |
| 128 | Ga0070714_100447321 | 3300005435 | Bacteria | 1227 |
| 129 | Ga0070714_101058393 | 3300005435 | Unclassified | 790 |
| 130 | Ga0070713_100058014 | 3300005436 | Bacteria | 3226 |
| 131 | Ga0070713_100977396 | 3300005436 | Unclassified | 816 |
| 132 | Ga0070713_101581598 | 3300005436 | Bacteria | 636 |
| 133 | Ga0070705_100639262 | 3300005440 | Bacteria | 828 |
| 134 | Ga0070694_100021107 | 3300005444 | Bacteria | 4159 |
| 135 | Ga0070663_100000936 | 3300005455 | Bacteria | 15858 |
| 136 | Ga0070663_100003876 | 3300005455 | Bacteria | 8716 |
| 137 | Ga0070663_100240881 | 3300005455 | Bacteria | 1427 |
| 138 | Ga0070663_100402770 | 3300005455 | Bacteria | 1119 |
| 139 | Ga0070663_100517971 | 3300005455 | Bacteria | 993 |
| 140 | Ga0070663_100525254 | 3300005455 | Bacteria | 986 |
| 141 | Ga0070663_100759149 | 3300005455 | Bacteria | 829 |
| 142 | Ga0070663_101398270 | 3300005455 | Bacteria | 620 |
| 143 | Ga0070678_100136929 | 3300005456 | Bacteria | 1954 |
| 144 | Ga0070678_100238809 | 3300005456 | Bacteria | 1518 |
| 145 | Ga0070662_100000198 | 3300005457 | Bacteria | 35360 |
| 146 | Ga0070662_100003839 | 3300005457 | Bacteria | 9411 |
| 147 | Ga0070662_100013241 | 3300005457 | Bacteria | 5484 |
| 148 | Ga0070662_100097939 | 3300005457 | Bacteria | 2214 |
| 149 | Ga0070662_100131087 | 3300005457 | Bacteria | 1933 |
| 150 | Ga0070662_100218208 | 3300005457 | Bacteria | 1520 |
| 151 | Ga0070662_100359167 | 3300005457 | Bacteria | 1195 |
| 152 | Ga0070662_100611683 | 3300005457 | Bacteria | 917 |
| 153 | Ga0070662_100726714 | 3300005457 | Bacteria | 841 |
| 154 | Ga0070662_101083660 | 3300005457 | Bacteria | 687 |
| 155 | Ga0070662_101517800 | 3300005457 | Bacteria | 578 |
| 156 | Ga0070662_101898125 | 3300005457 | Bacteria | 515 |
| 157 | Ga0070681_10063375 | 3300005458 | Bacteria | 3669 |
| 158 | Ga0070681_10308950 | 3300005458 | Bacteria | 1491 |
| 159 | Ga0070681_10391506 | 3300005458 | Bacteria | 1301 |
| 160 | Ga0070681_10689912 | 3300005458 | Bacteria | 937 |
| 161 | Ga0068867_100385815 | 3300005459 | Bacteria | 1178 |
| 162 | Ga0068867_100708830 | 3300005459 | Bacteria | 889 |
| 163 | Ga0070685_10222170 | 3300005466 | Bacteria | 1238 |
| 164 | Ga0070685_10351389 | 3300005466 | Bacteria | 1008 |
| 165 | Ga0070679_100001182 | 3300005530 | Bacteria | 22889 |
| 166 | Ga0070679_100241495 | 3300005530 | Bacteria | 1763 |
| 167 | Ga0070679_101153839 | 3300005530 | Bacteria | 720 |
| 168 | Ga0070679_101458392 | 3300005530 | Bacteria | 631 |
| 169 | Ga0070679_101480400 | 3300005530 | Bacteria | 626 |
| 170 | Ga0070684_100074316 | 3300005535 | Bacteria | 2996 |
| 171 | Ga0070684_100215259 | 3300005535 | Bacteria | 1752 |
| 172 | Ga0070684_100519069 | 3300005535 | Bacteria | 1104 |
| 173 | Ga0068853_100000154 | 3300005539 | Bacteria | 47200 |
| 174 | Ga0068853_100000655 | 3300005539 | Bacteria | 23770 |
| 175 | Ga0068853_100010924 | 3300005539 | Bacteria | 7359 |
| 176 | Ga0068853_100042011 | 3300005539 | Bacteria | 3907 |
| 177 | Ga0068853_100078309 | 3300005539 | Bacteria | 2888 |
| 178 | Ga0068853_100177096 | 3300005539 | Bacteria | 1932 |
| 179 | Ga0068853_100509301 | 3300005539 | Bacteria | 1137 |
| 180 | Ga0068853_101264986 | 3300005539 | Bacteria | 713 |
| 181 | Ga0070672_100001167 | 3300005543 | Bacteria | 16035 |
| 182 | Ga0070672_100446963 | 3300005543 | Bacteria | 1113 |
| 183 | Ga0070686_100296780 | 3300005544 | Bacteria | 1197 |
| 184 | Ga0070686_100580363 | 3300005544 | Bacteria | 881 |
| 185 | Ga0070686_101445854 | 3300005544 | Bacteria | 578 |
| 186 | Ga0070695_100123928 | 3300005545 | Bacteria | 1772 |
| 187 | Ga0070696_100022165 | 3300005546 | Bacteria | 4314 |
| 188 | Ga0070693_100000578 | 3300005547 | Bacteria | 16207 |
| 189 | Ga0070693_100310100 | 3300005547 | Unclassified | 1067 |
| 190 | Ga0070665_100147557 | 3300005548 | Bacteria | 2355 |
| 191 | Ga0070665_100423473 | 3300005548 | Bacteria | 1340 |
| 192 | Ga0070665_100778654 | 3300005548 | Bacteria | 970 |
| 193 | Ga0070665_101507548 | 3300005548 | Unclassified | 681 |
| 194 | Ga0070665_102533970 | 3300005548 | Bacteria | 514 |
| 195 | Ga0068855_100003204 | 3300005563 | Bacteria | 20024 |
| 196 | Ga0068855_100014297 | 3300005563 | Bacteria | 9557 |
| 197 | Ga0068855_100040366 | 3300005563 | Bacteria | 5540 |
| 198 | Ga0068855_100079821 | 3300005563 | Bacteria | 3794 |
| 199 | Ga0068855_100284249 | 3300005563 | Bacteria | 1836 |
| 200 | Ga0068855_100469504 | 3300005563 | Bacteria | 1371 |
| 201 | Ga0068855_100482620 | 3300005563 | Bacteria | 1349 |
| 202 | Ga0068855_100653960 | 3300005563 | Bacteria | 1128 |
| 203 | Ga0068855_101321209 | 3300005563 | Bacteria | 746 |
| 204 | Ga0070664_100000259 | 3300005564 | Bacteria | 38210 |
| 205 | Ga0070664_100007923 | 3300005564 | Bacteria | 8580 |
| 206 | Ga0070664_100012706 | 3300005564 | Bacteria | 6855 |
| 207 | Ga0070664_100016401 | 3300005564 | Bacteria | 6072 |
| 208 | Ga0070664_100045101 | 3300005564 | Bacteria | 3723 |
| 209 | Ga0070664_100056667 | 3300005564 | Bacteria | 3329 |
| 210 | Ga0070664_100202083 | 3300005564 | Bacteria | 1773 |
| 211 | Ga0070664_100644078 | 3300005564 | Bacteria | 985 |
| 212 | Ga0070664_100675247 | 3300005564 | Bacteria | 961 |
| 213 | Ga0070664_101818241 | 3300005564 | Bacteria | 578 |
| 214 | Ga0070664_102043169 | 3300005564 | Bacteria | 544 |
| 215 | Ga0068857_100031303 | 3300005577 | Bacteria | 4700 |
| 216 | Ga0068857_100065387 | 3300005577 | Bacteria | 3233 |
| 217 | Ga0068857_100139426 | 3300005577 | Bacteria | 2191 |
| 218 | Ga0068857_100150057 | 3300005577 | Bacteria | 2111 |
| 219 | Ga0068857_101065504 | 3300005577 | Bacteria | 780 |
| 220 | Ga0068857_101976446 | 3300005577 | Bacteria | 572 |
| 221 | Ga0068854_100008271 | 3300005578 | Bacteria | 6678 |
| 222 | Ga0068854_100039387 | 3300005578 | Bacteria | 3329 |
| 223 | Ga0068854_100089476 | 3300005578 | Bacteria | 2288 |
| 224 | Ga0068854_100169923 | 3300005578 | Bacteria | 1696 |
| 225 | Ga0068854_100272825 | 3300005578 | Bacteria | 1359 |
| 226 | Ga0068854_100504347 | 3300005578 | Bacteria | 1019 |
| 227 | Ga0068854_101087755 | 3300005578 | Bacteria | 712 |
| 228 | Ga0068854_101145879 | 3300005578 | Bacteria | 695 |
| 229 | Ga0068854_102191990 | 3300005578 | Bacteria | 511 |
| 230 | Ga0068856_100000315 | 3300005614 | Bacteria | 53098 |
| 231 | Ga0068856_100321799 | 3300005614 | Bacteria | 1564 |
| 232 | Ga0068856_100373702 | 3300005614 | Bacteria | 1444 |
| 233 | Ga0068856_100513395 | 3300005614 | Bacteria | 1219 |
| 234 | Ga0068856_100548682 | 3300005614 | Bacteria | 1177 |
| 235 | Ga0068856_100965982 | 3300005614 | Bacteria | 870 |
| 236 | Ga0068856_101983622 | 3300005614 | Bacteria | 592 |
| 237 | Ga0068852_100000548 | 3300005616 | Bacteria | 24613 |
| 238 | Ga0068852_100003431 | 3300005616 | Bacteria | 11074 |
| 239 | Ga0068852_100005054 | 3300005616 | Bacteria | 9383 |
| 240 | Ga0068852_100021395 | 3300005616 | Bacteria | 5164 |
| 241 | Ga0068852_100141960 | 3300005616 | Bacteria | 2224 |
| 242 | Ga0068852_100142505 | 3300005616 | Bacteria | 2219 |
| 243 | Ga0068852_100208794 | 3300005616 | Bacteria | 1851 |
| 244 | Ga0068852_100300469 | 3300005616 | Bacteria | 1554 |
| 245 | Ga0068852_101834029 | 3300005616 | Bacteria | 629 |
| 246 | Ga0068852_102630340 | 3300005616 | Bacteria | 523 |
| 247 | Ga0068859_100554978 | 3300005617 | Bacteria | 1243 |
| 248 | Ga0068864_100006944 | 3300005618 | Bacteria | 9290 |
| 249 | Ga0068864_100014407 | 3300005618 | Bacteria | 6567 |
| 250 | Ga0068864_100372834 | 3300005618 | Bacteria | 1351 |
| 251 | Ga0068864_101113886 | 3300005618 | Bacteria | 786 |
| 252 | Ga0068866_10013515 | 3300005718 | Bacteria | 3585 |
| 253 | Ga0068866_10258846 | 3300005718 | Unclassified | 1068 |
| 254 | Ga0068851_10043922 | 3300005834 | Bacteria | 2254 |
| 255 | Ga0068851_10080552 | 3300005834 | Bacteria | 1700 |
| 256 | Ga0068851_10185285 | 3300005834 | Bacteria | 1155 |
| 257 | Ga0068851_10375388 | 3300005834 | Bacteria | 832 |
| 258 | Ga0068870_10181017 | 3300005840 | Bacteria | 1265 |
| 259 | Ga0068863_100048408 | 3300005841 | Bacteria | 4031 |
| 260 | Ga0068863_100217068 | 3300005841 | Bacteria | 1842 |
| 261 | Ga0068863_100311741 | 3300005841 | Bacteria | 1527 |
| 262 | Ga0068863_102082722 | 3300005841 | Bacteria | 577 |
| 263 | Ga0068858_100001703 | 3300005842 | Bacteria | 22460 |
| 264 | Ga0068858_100037069 | 3300005842 | Bacteria | 4520 |
| 265 | Ga0068858_100145934 | 3300005842 | Bacteria | 2222 |
| 266 | Ga0068860_100405559 | 3300005843 | Bacteria | 1349 |
| 267 | Ga0068862_100473240 | 3300005844 | Bacteria | 1185 |
| 268 | Ga0070717_10470206 | 3300006028 | Bacteria | 1135 |
| 269 | Ga0070717_10888671 | 3300006028 | Bacteria | 811 |
| 270 | Ga0097621_100041877 | 3300006237 | Bacteria | 3688 |
| 271 | Ga0097621_100132776 | 3300006237 | Bacteria | 2120 |
| 272 | Ga0097621_100160527 | 3300006237 | Bacteria | 1932 |
| 273 | Ga0068871_100049909 | 3300006358 | Bacteria | 3384 |
| 274 | Ga0068871_100061563 | 3300006358 | Bacteria | 3066 |
| 275 | Ga0068871_100155086 | 3300006358 | Bacteria | 1955 |
| 276 | Ga0068871_100440671 | 3300006358 | Bacteria | 1166 |
| 277 | Ga0075428_102518008 | 3300006844 | Bacteria | 527 |
| 278 | Ga0068865_100422592 | 3300006881 | Bacteria | 1096 |
| 279 | Ga0097620_100554989 | 3300006931 | Bacteria | 1243 |
| 280 | Ga0105240_10045821 | 3300009093 | Bacteria | 5546 |
| 281 | Ga0105240_11103936 | 3300009093 | Bacteria | 844 |
| 282 | Ga0111539_10171535 | 3300009094 | Bacteria | 2534 |
| 283 | Ga0105245_10326666 | 3300009098 | Bacteria | 1513 |
| 284 | Ga0105247_10637957 | 3300009101 | Bacteria | 794 |
| 285 | Ga0105243_11060782 | 3300009148 | Bacteria | 816 |
| 286 | Ga0105243_12539711 | 3300009148 | Bacteria | 552 |
| 287 | Ga0105241_10115466 | 3300009174 | Bacteria | 2155 |
| 288 | Ga0105241_10486671 | 3300009174 | Bacteria | 1098 |
| 289 | Ga0105241_11397245 | 3300009174 | Bacteria | 670 |
| 290 | Ga0105241_12261586 | 3300009174 | Bacteria | 540 |
| 291 | Ga0105248_10000362 | 3300009177 | Bacteria | 53018 |
| 292 | Ga0105248_10000395 | 3300009177 | Bacteria | 50389 |
| 293 | Ga0105248_10004830 | 3300009177 | Bacteria | 14916 |
| 294 | Ga0105248_10015449 | 3300009177 | Bacteria | 8414 |
| 295 | Ga0105248_10084821 | 3300009177 | Bacteria | 3564 |
| 296 | Ga0105248_10154280 | 3300009177 | Bacteria | 2591 |
| 297 | Ga0105237_11218392 | 3300009545 | Unclassified | 759 |
| 298 | Ga0105238_10025019 | 3300009551 | Bacteria | 6086 |
| 299 | Ga0105238_10329376 | 3300009551 | Bacteria | 1514 |
| 300 | Ga0105249_11215731 | 3300009553 | Bacteria | 825 |
| 301 | Ga0105246_11716056 | 3300011119 | Bacteria | 597 |
| 302 | Ga0157373_10019290 | 3300013100 | Bacteria | 4967 |
| 303 | Ga0157373_10055148 | 3300013100 | Bacteria | 2823 |
| 304 | Ga0157373_10205018 | 3300013100 | Bacteria | 1390 |
| 305 | Ga0157373_10242214 | 3300013100 | Bacteria | 1275 |
| 306 | Ga0157373_10448359 | 3300013100 | Bacteria | 928 |
| 307 | Ga0157373_10505265 | 3300013100 | Bacteria | 874 |
| 308 | Ga0157373_10589686 | 3300013100 | Bacteria | 808 |
| 309 | Ga0157373_10993881 | 3300013100 | Bacteria | 626 |
| 310 | Ga0157371_10179963 | 3300013102 | Bacteria | 1512 |
| 311 | Ga0157371_10195429 | 3300013102 | Bacteria | 1449 |
| 312 | Ga0157371_10317038 | 3300013102 | Bacteria | 1131 |
| 313 | Ga0157371_10878755 | 3300013102 | Bacteria | 679 |
| 314 | Ga0157371_11061688 | 3300013102 | Bacteria | 620 |
| 315 | Ga0157371_11108085 | 3300013102 | Bacteria | 607 |
| 316 | Ga0157371_11140433 | 3300013102 | Unclassified | 599 |
| 317 | Ga0157371_11488222 | 3300013102 | Bacteria | 528 |
| 318 | Ga0157370_10008396 | 3300013104 | Bacteria | 11140 |
| 319 | Ga0157370_10009840 | 3300013104 | Bacteria | 10133 |
| 320 | Ga0157370_10036438 | 3300013104 | Bacteria | 4773 |
| 321 | Ga0157370_10182775 | 3300013104 | Bacteria | 1948 |
| 322 | Ga0157370_10292334 | 3300013104 | Bacteria | 1505 |
| 323 | Ga0157370_10476072 | 3300013104 | Bacteria | 1147 |
| 324 | Ga0157370_10629320 | 3300013104 | Bacteria | 981 |
| 325 | Ga0157370_10770082 | 3300013104 | Bacteria | 876 |
| 326 | Ga0157369_10005829 | 3300013105 | Bacteria | 14326 |
| 327 | Ga0157369_10050842 | 3300013105 | Bacteria | 4487 |
| 328 | Ga0157369_10084502 | 3300013105 | Bacteria | 3393 |
| 329 | Ga0157369_10268072 | 3300013105 | Bacteria | 1780 |
| 330 | Ga0157369_10405068 | 3300013105 | Bacteria | 1415 |
| 331 | Ga0157369_10494599 | 3300013105 | Bacteria | 1265 |
| 332 | Ga0157369_11517645 | 3300013105 | Bacteria | 682 |
| 333 | Ga0157369_12481169 | 3300013105 | Bacteria | 525 |
| 334 | Ga0157374_10077668 | 3300013296 | Bacteria | 3142 |
| 335 | Ga0157374_10181221 | 3300013296 | Bacteria | 2058 |
| 336 | Ga0157374_11104556 | 3300013296 | Bacteria | 813 |
| 337 | Ga0163162_10223770 | 3300013306 | Bacteria | 2011 |
| 338 | Ga0163162_10572582 | 3300013306 | Bacteria | 1257 |
| 339 | Ga0163162_10918524 | 3300013306 | Bacteria | 988 |
| 340 | Ga0157372_10011276 | 3300013307 | Bacteria | 9508 |
| 341 | Ga0157372_10663215 | 3300013307 | Bacteria | 1214 |
| 342 | Ga0157372_10865199 | 3300013307 | Bacteria | 1049 |
| 343 | Ga0157372_12219650 | 3300013307 | Bacteria | 631 |
| 344 | Ga0157372_12539293 | 3300013307 | Bacteria | 588 |
| 345 | Ga0157375_10013944 | 3300013308 | Bacteria | 7165 |
| 346 | Ga0157375_10177423 | 3300013308 | Bacteria | 2281 |
| 347 | Ga0157375_10330959 | 3300013308 | Bacteria | 1688 |
| 348 | Ga0163163_10001203 | 3300014325 | Bacteria | 21898 |
| 349 | Ga0163163_10045299 | 3300014325 | Bacteria | 4317 |
| 350 | Ga0182008_10255520 | 3300014497 | Bacteria | 905 |
| 351 | Ga0182008_10366285 | 3300014497 | Bacteria | 767 |
| 352 | Ga0157377_10593147 | 3300014745 | Bacteria | 789 |
| 353 | Ga0157379_10208696 | 3300014968 | Bacteria | 1768 |
| 354 | Ga0157379_10823366 | 3300014968 | Bacteria | 877 |
| 355 | Ga0157379_11899559 | 3300014968 | Unclassified | 587 |
| 356 | Ga0157376_11302703 | 3300014969 | Bacteria | 756 |
| 357 | Ga0206356_10946257 | 3300020070 | Bacteria | 796 |
| 358 | Ga0206354_10972652 | 3300020081 | Bacteria | 1103 |
| 359 | Ga0206353_10319710 | 3300020082 | Bacteria | 581 |
| 360 | Ga0206353_11417362 | 3300020082 | Bacteria | 1267 |
| 361 | Ga0206353_11687510 | 3300020082 | Bacteria | 949 |
| 362 | Ga0207697_10165847 | 3300025315 | Bacteria | 965 |
| 363 | Ga0207656_10088593 | 3300025321 | Bacteria | 1402 |
| 364 | Ga0207656_10157274 | 3300025321 | Bacteria | 1080 |
| 365 | Ga0207656_10220316 | 3300025321 | Bacteria | 922 |
| 366 | Ga0207656_10532257 | 3300025321 | Bacteria | 598 |
| 367 | Ga0207656_10668172 | 3300025321 | Unclassified | 531 |
| 368 | Ga0207642_10007456 | 3300025899 | Bacteria | 3698 |
| 369 | Ga0207642_10951380 | 3300025899 | Bacteria | 552 |
| 370 | Ga0207688_10060376 | 3300025901 | Bacteria | 2135 |
| 371 | Ga0207688_10408952 | 3300025901 | Bacteria | 842 |
| 372 | Ga0207680_10000267 | 3300025903 | Bacteria | 24862 |
| 373 | Ga0207680_10000626 | 3300025903 | Bacteria | 16644 |
| 374 | Ga0207680_10145480 | 3300025903 | Bacteria | 1575 |
| 375 | Ga0207680_10228228 | 3300025903 | Bacteria | 1279 |
| 376 | Ga0207647_10006403 | 3300025904 | Bacteria | 8558 |
| 377 | Ga0207647_10009933 | 3300025904 | Bacteria | 6743 |
| 378 | Ga0207647_10045794 | 3300025904 | Bacteria | 2728 |
| 379 | Ga0207647_10047161 | 3300025904 | Bacteria | 2681 |
| 380 | Ga0207647_10048856 | 3300025904 | Bacteria | 2626 |
| 381 | Ga0207647_10215638 | 3300025904 | Bacteria | 1107 |
| 382 | Ga0207647_10381492 | 3300025904 | Bacteria | 796 |
| 383 | Ga0207645_10423616 | 3300025907 | Bacteria | 897 |
| 384 | Ga0207643_10395860 | 3300025908 | Bacteria | 873 |
| 385 | Ga0207705_10000205 | 3300025909 | Bacteria | 59773 |
| 386 | Ga0207705_10000449 | 3300025909 | Bacteria | 35420 |
| 387 | Ga0207705_10029143 | 3300025909 | Bacteria | 3935 |
| 388 | Ga0207705_10033148 | 3300025909 | Bacteria | 3691 |
| 389 | Ga0207705_10117988 | 3300025909 | Bacteria | 1966 |
| 390 | Ga0207705_10626484 | 3300025909 | Bacteria | 836 |
| 391 | Ga0207705_10922477 | 3300025909 | Bacteria | 676 |
| 392 | Ga0207705_11017606 | 3300025909 | Bacteria | 640 |
| 393 | Ga0207705_11224692 | 3300025909 | Bacteria | 575 |
| 394 | Ga0207654_10065206 | 3300025911 | Bacteria | 2143 |
| 395 | Ga0207654_11165591 | 3300025911 | Unclassified | 562 |
| 396 | Ga0207707_10069959 | 3300025912 | Bacteria | 3058 |
| 397 | Ga0207707_10357671 | 3300025912 | Bacteria | 1257 |
| 398 | Ga0207707_10949402 | 3300025912 | Bacteria | 708 |
| 399 | Ga0207695_10078613 | 3300025913 | Bacteria | 3346 |
| 400 | Ga0207671_10103235 | 3300025914 | Bacteria | 2162 |
| 401 | Ga0207693_10920348 | 3300025915 | Bacteria | 670 |
| 402 | Ga0207660_10001386 | 3300025917 | Bacteria | 16272 |
| 403 | Ga0207660_10516928 | 3300025917 | Bacteria | 969 |
| 404 | Ga0207660_11224645 | 3300025917 | Bacteria | 610 |
| 405 | Ga0207662_10085881 | 3300025918 | Bacteria | 1927 |
| 406 | Ga0207657_10001304 | 3300025919 | Bacteria | 26485 |
| 407 | Ga0207657_10003566 | 3300025919 | Bacteria | 16604 |
| 408 | Ga0207657_10007910 | 3300025919 | Bacteria | 10842 |
| 409 | Ga0207657_10011594 | 3300025919 | Bacteria | 8744 |
| 410 | Ga0207657_10023947 | 3300025919 | Bacteria | 5668 |
| 411 | Ga0207657_10039954 | 3300025919 | Bacteria | 4161 |
| 412 | Ga0207657_10041186 | 3300025919 | Bacteria | 4086 |
| 413 | Ga0207657_10142321 | 3300025919 | Bacteria | 1959 |
| 414 | Ga0207657_10162031 | 3300025919 | Bacteria | 1816 |
| 415 | Ga0207657_10185328 | 3300025919 | Bacteria | 1681 |
| 416 | Ga0207657_10300715 | 3300025919 | Bacteria | 1271 |
| 417 | Ga0207657_10673461 | 3300025919 | Bacteria | 805 |
| 418 | Ga0207657_10852948 | 3300025919 | Bacteria | 703 |
| 419 | Ga0207657_11464349 | 3300025919 | Unclassified | 511 |
| 420 | Ga0207649_10000942 | 3300025920 | Bacteria | 18202 |
| 421 | Ga0207649_10019857 | 3300025920 | Bacteria | 3846 |
| 422 | Ga0207649_10047985 | 3300025920 | Bacteria | 2631 |
| 423 | Ga0207649_10077821 | 3300025920 | Bacteria | 2138 |
| 424 | Ga0207649_10124012 | 3300025920 | Bacteria | 1746 |
| 425 | Ga0207649_10165897 | 3300025920 | Bacteria | 1534 |
| 426 | Ga0207649_10192535 | 3300025920 | Bacteria | 1435 |
| 427 | Ga0207649_10333002 | 3300025920 | Bacteria | 1119 |
| 428 | Ga0207649_10390110 | 3300025920 | Bacteria | 1040 |
| 429 | Ga0207649_10581622 | 3300025920 | Bacteria | 860 |
| 430 | Ga0207649_10689902 | 3300025920 | Bacteria | 791 |
| 431 | Ga0207649_11412181 | 3300025920 | Unclassified | 551 |
| 432 | Ga0207652_10000270 | 3300025921 | Bacteria | 54010 |
| 433 | Ga0207652_10324428 | 3300025921 | Bacteria | 1390 |
| 434 | Ga0207652_11123503 | 3300025921 | Bacteria | 687 |
| 435 | Ga0207694_10002320 | 3300025924 | Bacteria | 15552 |
| 436 | Ga0207694_10089196 | 3300025924 | Bacteria | 2432 |
| 437 | Ga0207694_11505638 | 3300025924 | Bacteria | 568 |
| 438 | Ga0207650_10028035 | 3300025925 | Bacteria | 4035 |
| 439 | Ga0207650_10038230 | 3300025925 | Bacteria | 3503 |
| 440 | Ga0207650_10197418 | 3300025925 | Bacteria | 1610 |
| 441 | Ga0207650_10390706 | 3300025925 | Bacteria | 1150 |
| 442 | Ga0207650_10644129 | 3300025925 | Bacteria | 893 |
| 443 | Ga0207650_10897746 | 3300025925 | Bacteria | 752 |
| 444 | Ga0207650_11038171 | 3300025925 | Bacteria | 697 |
| 445 | Ga0207650_11328403 | 3300025925 | Bacteria | 612 |
| 446 | Ga0207650_11474793 | 3300025925 | Bacteria | 578 |
| 447 | Ga0207650_11679380 | 3300025925 | Bacteria | 538 |
| 448 | Ga0207659_10014421 | 3300025926 | Bacteria | 5097 |
| 449 | Ga0207659_10560970 | 3300025926 | Bacteria | 971 |
| 450 | Ga0207687_11376811 | 3300025927 | Unclassified | 606 |
| 451 | Ga0207700_10755064 | 3300025928 | Bacteria | 869 |
| 452 | Ga0207664_10868960 | 3300025929 | Bacteria | 810 |
| 453 | Ga0207664_11392867 | 3300025929 | Unclassified | 622 |
| 454 | Ga0207644_10005695 | 3300025931 | Bacteria | 8111 |
| 455 | Ga0207644_10120776 | 3300025931 | Bacteria | 1994 |
| 456 | Ga0207644_10274315 | 3300025931 | Bacteria | 1352 |
| 457 | Ga0207644_11175350 | 3300025931 | Bacteria | 645 |
| 458 | Ga0207690_10000257 | 3300025932 | Bacteria | 38401 |
| 459 | Ga0207690_10009242 | 3300025932 | Bacteria | 5854 |
| 460 | Ga0207690_10013935 | 3300025932 | Bacteria | 4845 |
| 461 | Ga0207690_10068654 | 3300025932 | Bacteria | 2436 |
| 462 | Ga0207690_10241226 | 3300025932 | Bacteria | 1392 |
| 463 | Ga0207690_10269552 | 3300025932 | Bacteria | 1322 |
| 464 | Ga0207690_10545639 | 3300025932 | Bacteria | 942 |
| 465 | Ga0207690_10916474 | 3300025932 | Bacteria | 727 |
| 466 | Ga0207706_10001176 | 3300025933 | Bacteria | 26479 |
| 467 | Ga0207706_10006135 | 3300025933 | Bacteria | 11160 |
| 468 | Ga0207706_10042422 | 3300025933 | Bacteria | 4032 |
| 469 | Ga0207706_10088152 | 3300025933 | Bacteria | 2728 |
| 470 | Ga0207706_10157347 | 3300025933 | Bacteria | 1998 |
| 471 | Ga0207706_10188380 | 3300025933 | Bacteria | 1811 |
| 472 | Ga0207706_10237420 | 3300025933 | Bacteria | 1594 |
| 473 | Ga0207706_11140165 | 3300025933 | Unclassified | 650 |
| 474 | Ga0207706_11512504 | 3300025933 | Bacteria | 547 |
| 475 | Ga0207709_10710384 | 3300025935 | Bacteria | 805 |
| 476 | Ga0207670_10036600 | 3300025936 | Bacteria | 3193 |
| 477 | Ga0207669_10002475 | 3300025937 | Bacteria | 7880 |
| 478 | Ga0207669_10409457 | 3300025937 | Bacteria | 1064 |
| 479 | Ga0207704_11842489 | 3300025938 | Bacteria | 520 |
| 480 | Ga0207691_10004833 | 3300025940 | Bacteria | 13034 |
| 481 | Ga0207691_10155884 | 3300025940 | Bacteria | 2005 |
| 482 | Ga0207711_10000427 | 3300025941 | Bacteria | 44194 |
| 483 | Ga0207711_10000610 | 3300025941 | Bacteria | 36080 |
| 484 | Ga0207711_10029458 | 3300025941 | Bacteria | 4631 |
| 485 | Ga0207711_10034390 | 3300025941 | Bacteria | 4292 |
| 486 | Ga0207711_10047172 | 3300025941 | Bacteria | 3682 |
| 487 | Ga0207711_10108999 | 3300025941 | Bacteria | 2460 |
| 488 | Ga0207661_10000918 | 3300025944 | Bacteria | 19348 |
| 489 | Ga0207661_10035672 | 3300025944 | Bacteria | 3877 |
| 490 | Ga0207661_10092895 | 3300025944 | Bacteria | 2516 |
| 491 | Ga0207661_10174405 | 3300025944 | Bacteria | 1874 |
| 492 | Ga0207661_10281857 | 3300025944 | Bacteria | 1486 |
| 493 | Ga0207661_11115504 | 3300025944 | Bacteria | 726 |
| 494 | Ga0207661_11866792 | 3300025944 | Unclassified | 546 |
| 495 | Ga0207679_10000463 | 3300025945 | Bacteria | 28581 |
| 496 | Ga0207679_10003835 | 3300025945 | Bacteria | 9319 |
| 497 | Ga0207679_10092671 | 3300025945 | Bacteria | 2341 |
| 498 | Ga0207679_10237494 | 3300025945 | Bacteria | 1542 |
| 499 | Ga0207679_10273154 | 3300025945 | Bacteria | 1446 |
| 500 | Ga0207679_10336713 | 3300025945 | Bacteria | 1311 |
| 501 | Ga0207679_10521531 | 3300025945 | Unclassified | 1063 |
| 502 | Ga0207679_10732012 | 3300025945 | Bacteria | 899 |
| 503 | Ga0207679_10933021 | 3300025945 | Bacteria | 795 |
| 504 | Ga0207679_11128305 | 3300025945 | Bacteria | 719 |
| 505 | Ga0207667_10005298 | 3300025949 | Bacteria | 15727 |
| 506 | Ga0207667_10031169 | 3300025949 | Bacteria | 5759 |
| 507 | Ga0207667_10092876 | 3300025949 | Bacteria | 3117 |
| 508 | Ga0207667_10117241 | 3300025949 | Bacteria | 2744 |
| 509 | Ga0207667_10459662 | 3300025949 | Bacteria | 1293 |
| 510 | Ga0207667_10486653 | 3300025949 | Bacteria | 1252 |
| 511 | Ga0207667_10592858 | 3300025949 | Bacteria | 1118 |
| 512 | Ga0207667_10965854 | 3300025949 | Bacteria | 841 |
| 513 | Ga0207667_11053064 | 3300025949 | Bacteria | 798 |
| 514 | Ga0207667_11446050 | 3300025949 | Bacteria | 660 |
| 515 | Ga0207651_10027626 | 3300025960 | Bacteria | 3567 |
| 516 | Ga0207651_10036114 | 3300025960 | Bacteria | 3222 |
| 517 | Ga0207651_11023616 | 3300025960 | Bacteria | 739 |
| 518 | Ga0207712_10157123 | 3300025961 | Bacteria | 1763 |
| 519 | Ga0207668_10065390 | 3300025972 | Bacteria | 2574 |
| 520 | Ga0207668_10427699 | 3300025972 | Bacteria | 1125 |
| 521 | Ga0207640_10057088 | 3300025981 | Bacteria | 2566 |
| 522 | Ga0207640_10109823 | 3300025981 | Bacteria | 1952 |
| 523 | Ga0207640_10175751 | 3300025981 | Bacteria | 1600 |
| 524 | Ga0207640_10274531 | 3300025981 | Bacteria | 1321 |
| 525 | Ga0207640_10648041 | 3300025981 | Bacteria | 900 |
| 526 | Ga0207640_10719177 | 3300025981 | Bacteria | 858 |
| 527 | Ga0207640_11927692 | 3300025981 | Unclassified | 535 |
| 528 | Ga0207640_12128530 | 3300025981 | Bacteria | 509 |
| 529 | Ga0207640_12180355 | 3300025981 | Bacteria | 503 |
| 530 | Ga0207658_10005525 | 3300025986 | Bacteria | 8664 |
| 531 | Ga0207658_10142548 | 3300025986 | Bacteria | 1941 |
| 532 | Ga0207658_10274113 | 3300025986 | Bacteria | 1443 |
| 533 | Ga0207658_10967702 | 3300025986 | Bacteria | 776 |
| 534 | Ga0207677_10003982 | 3300026023 | Bacteria | 7879 |
| 535 | Ga0207677_10075441 | 3300026023 | Bacteria | 2397 |
| 536 | Ga0207703_10006106 | 3300026035 | Bacteria | 9638 |
| 537 | Ga0207703_10056018 | 3300026035 | Bacteria | 3209 |
| 538 | Ga0207703_10197852 | 3300026035 | Bacteria | 1784 |
| 539 | Ga0207703_12376262 | 3300026035 | Bacteria | 506 |
| 540 | Ga0207639_10000899 | 3300026041 | Bacteria | 20185 |
| 541 | Ga0207639_10036236 | 3300026041 | Bacteria | 3654 |
| 542 | Ga0207639_10084907 | 3300026041 | Bacteria | 2516 |
| 543 | Ga0207639_10207711 | 3300026041 | Bacteria | 1684 |
| 544 | Ga0207639_10304903 | 3300026041 | Bacteria | 1409 |
| 545 | Ga0207639_10401038 | 3300026041 | Bacteria | 1235 |
| 546 | Ga0207639_10411625 | 3300026041 | Bacteria | 1220 |
| 547 | Ga0207639_10927817 | 3300026041 | Bacteria | 814 |
| 548 | Ga0207639_11826009 | 3300026041 | Bacteria | 568 |
| 549 | Ga0207678_10000766 | 3300026067 | Bacteria | 29323 |
| 550 | Ga0207678_10009100 | 3300026067 | Bacteria | 8744 |
| 551 | Ga0207678_10073610 | 3300026067 | Bacteria | 2928 |
| 552 | Ga0207678_10105549 | 3300026067 | Bacteria | 2404 |
| 553 | Ga0207678_10210123 | 3300026067 | Bacteria | 1665 |
| 554 | Ga0207678_10325503 | 3300026067 | Bacteria | 1323 |
| 555 | Ga0207678_10347446 | 3300026067 | Bacteria | 1279 |
| 556 | Ga0207678_10564039 | 3300026067 | Bacteria | 996 |
| 557 | Ga0207702_10002140 | 3300026078 | Bacteria | 18992 |
| 558 | Ga0207702_10061009 | 3300026078 | Bacteria | 3215 |
| 559 | Ga0207702_10307882 | 3300026078 | Bacteria | 1505 |
| 560 | Ga0207702_10334089 | 3300026078 | Bacteria | 1446 |
| 561 | Ga0207702_10348925 | 3300026078 | Bacteria | 1415 |
| 562 | Ga0207702_10520496 | 3300026078 | Bacteria | 1161 |
| 563 | Ga0207702_10545875 | 3300026078 | Bacteria | 1133 |
| 564 | Ga0207641_10043334 | 3300026088 | Bacteria | 3779 |
| 565 | Ga0207641_10111213 | 3300026088 | Bacteria | 2429 |
| 566 | Ga0207641_10117465 | 3300026088 | Bacteria | 2368 |
| 567 | Ga0207648_10464460 | 3300026089 | Bacteria | 1154 |
| 568 | Ga0207676_10005201 | 3300026095 | Bacteria | 9209 |
| 569 | Ga0207676_10012479 | 3300026095 | Bacteria | 6089 |
| 570 | Ga0207676_10019201 | 3300026095 | Bacteria | 4982 |
| 571 | Ga0207676_10098779 | 3300026095 | Bacteria | 2414 |
| 572 | Ga0207674_10005522 | 3300026116 | Bacteria | 15018 |
| 573 | Ga0207674_10037696 | 3300026116 | Bacteria | 5024 |
| 574 | Ga0207674_10113335 | 3300026116 | Bacteria | 2685 |
| 575 | Ga0207674_10296822 | 3300026116 | Bacteria | 1565 |
| 576 | Ga0207674_11201913 | 3300026116 | Bacteria | 728 |
| 577 | Ga0207674_11375886 | 3300026116 | Bacteria | 675 |
| 578 | Ga0207683_10009640 | 3300026121 | Bacteria | 8229 |
| 579 | Ga0207683_10161003 | 3300026121 | Bacteria | 2029 |
| 580 | Ga0207698_10000435 | 3300026142 | Bacteria | 24060 |
| 581 | Ga0207698_10000560 | 3300026142 | Bacteria | 21687 |
| 582 | Ga0207698_10004591 | 3300026142 | Bacteria | 8430 |
| 583 | Ga0207698_10004812 | 3300026142 | Bacteria | 8270 |
| 584 | Ga0207698_10010929 | 3300026142 | Bacteria | 5863 |
| 585 | Ga0207698_10036882 | 3300026142 | Bacteria | 3594 |
| 586 | Ga0207698_10923718 | 3300026142 | Bacteria | 881 |
| 587 | Ga0207698_11164902 | 3300026142 | Bacteria | 784 |
| 588 | Ga0207698_12120547 | 3300026142 | Bacteria | 575 |
| 589 | Ga0268266_10083621 | 3300028379 | Bacteria | 2786 |
| 590 | Ga0268266_10108623 | 3300028379 | Bacteria | 2455 |
| 591 | Ga0268266_10701224 | 3300028379 | Bacteria | 976 |
| 592 | Ga0268266_12185213 | 3300028379 | Bacteria | 525 |
| 593 | Ga0268265_10029948 | 3300028380 | Bacteria | 3916 |
| 594 | Ga0268264_10293205 | 3300028381 | Bacteria | 1528 |
| 595 | Ga0268264_10541117 | 3300028381 | Bacteria | 1141 |
| 596 | Ga0316182_1086040 | 3300030745 | Bacteria | 804 |
| 597 | Ga0307408_100161243 | 3300031548 | Bacteria | 1781 |
| 598 | Ga0307408_100320899 | 3300031548 | Bacteria | 1305 |
| 599 | Ga0307408_101890301 | 3300031548 | Bacteria | 572 |
| 600 | Ga0307405_10027152 | 3300031731 | Bacteria | 3314 |
| 601 | Ga0307405_10038617 | 3300031731 | Bacteria | 2880 |
| 602 | Ga0307405_10433949 | 3300031731 | Bacteria | 1037 |
| 603 | Ga0307405_11379822 | 3300031731 | Bacteria | 615 |
| 604 | Ga0307405_11987780 | 3300031731 | Unclassified | 520 |
| 605 | Ga0307413_10304826 | 3300031824 | Bacteria | 1209 |
| 606 | Ga0307413_11048306 | 3300031824 | Bacteria | 701 |
| 607 | Ga0307410_10016738 | 3300031852 | Bacteria | 4382 |
| 608 | Ga0307410_10021687 | 3300031852 | Bacteria | 3954 |
| 609 | Ga0307410_10111275 | 3300031852 | Bacteria | 1981 |
| 610 | Ga0307410_10127807 | 3300031852 | Bacteria | 1863 |
| 611 | Ga0307410_10193983 | 3300031852 | Bacteria | 1546 |
| 612 | Ga0307406_10031393 | 3300031901 | Bacteria | 3234 |
| 613 | Ga0307406_11304834 | 3300031901 | Bacteria | 633 |
| 614 | Ga0307406_12057372 | 3300031901 | Bacteria | 511 |
| 615 | Ga0307407_10105864 | 3300031903 | Bacteria | 1756 |
| 616 | Ga0307407_10254180 | 3300031903 | Bacteria | 1205 |
| 617 | Ga0307407_10330289 | 3300031903 | Bacteria | 1073 |
| 618 | Ga0307412_10022002 | 3300031911 | Bacteria | 3902 |
| 619 | Ga0307412_10041018 | 3300031911 | Bacteria | 2997 |
| 620 | Ga0307412_10169511 | 3300031911 | Bacteria | 1631 |
| 621 | Ga0307412_10974681 | 3300031911 | Bacteria | 748 |
| 622 | Ga0307409_100047085 | 3300031995 | Bacteria | 3270 |
| 623 | Ga0307409_100055516 | 3300031995 | Bacteria | 3058 |
| 624 | Ga0307409_100273382 | 3300031995 | Bacteria | 1557 |
| 625 | Ga0307409_101517804 | 3300031995 | Bacteria | 697 |
| 626 | Ga0307409_101531280 | 3300031995 | Bacteria | 694 |
| 627 | Ga0307416_100014810 | 3300032002 | Bacteria | 5361 |
| 628 | Ga0307416_100060676 | 3300032002 | Bacteria | 3081 |
| 629 | Ga0307416_100205117 | 3300032002 | Bacteria | 1874 |
| 630 | Ga0307416_100670824 | 3300032002 | Bacteria | 1123 |
| 631 | Ga0307416_100707317 | 3300032002 | Bacteria | 1097 |
| 632 | Ga0307414_10033242 | 3300032004 | Bacteria | 3407 |
| 633 | Ga0307414_11300883 | 3300032004 | Bacteria | 674 |
| 634 | Ga0307414_11467893 | 3300032004 | Bacteria | 634 |
| 635 | Ga0307411_10001101 | 3300032005 | Bacteria | 10532 |
| 636 | Ga0307411_10017670 | 3300032005 | Bacteria | 4072 |
| 637 | Ga0307411_10466265 | 3300032005 | Bacteria | 1060 |
| 638 | Ga0307411_10642535 | 3300032005 | Bacteria | 918 |
| 639 | Ga0307415_100036128 | 3300032126 | Bacteria | 3234 |
| 640 | Ga0307415_100077367 | 3300032126 | Bacteria | 2362 |
| 641 | Ga0307415_100355808 | 3300032126 | Bacteria | 1234 |
| 642 | Ga0307415_100496136 | 3300032126 | Bacteria | 1066 |
| 643 | Ga0373930_0163397 | 3300034816 | Bacteria | 564 |
| 644 | Ga0373950_0032043 | 3300034818 | Bacteria | 977 |
| 645 | Ga0373944_0422555 | 3300035089 | Bacteria | 516 |
| 646 | Ga0373939_0086535 | 3300035114 | Bacteria | 1051 |
| 647 | Ga0373941_0015662 | 3300035115 | Bacteria | 2049 |
| 648 | Ga0373941_0208531 | 3300035115 | Bacteria | 746 |
| 649 | Ga0373941_0291262 | 3300035115 | Bacteria | 649 |
| 650 | Ga0373943_0002387 | 3300035170 | Bacteria | 8516 |
| 651 | Ga0373946_0004744 | 3300035171 | Bacteria | 4887 |
| 652 | Ga0373961_0008248 | 3300035241 | Bacteria | 2532 |
| 653 | Ga0373962_0289297 | 3300035242 | Bacteria | 578 |
| 654 | Ga0373931_0116666 | 3300035691 | Bacteria | 1521 |
| 655 | Ga0373935_0042878 | 3300035692 | Bacteria | 2846 |
| 656 | Ga0373927_0052303 | 3300035695 | Bacteria | 2642 |
| 657 | Ga0373937_0236204 | 3300036401 | Bacteria | 1722 |
| 658 | Ga0373925_0061658 | 3300037068 | Bacteria | 2817 |
| 659 | Ga0395899_0000387 | 3300037312 | Bacteria | 52472 |
| 660 | Ga0395899_0001750 | 3300037312 | Bacteria | 18054 |
| 661 | Ga0395899_0004293 | 3300037312 | Bacteria | 11136 |
| 662 | Ga0395899_0011077 | 3300037312 | Bacteria | 6906 |
| 663 | Ga0395899_0024278 | 3300037312 | Bacteria | 4585 |
| 664 | Ga0395899_0047348 | 3300037312 | Bacteria | 3202 |
| 665 | Ga0395899_0048289 | 3300037312 | Bacteria | 3168 |
| 666 | Ga0395899_0050207 | 3300037312 | Bacteria | 3098 |
| 667 | Ga0395899_0098320 | 3300037312 | Bacteria | 2114 |
| 668 | Ga0395899_0165787 | 3300037312 | Bacteria | 1559 |
| 669 | Ga0395899_0593732 | 3300037312 | Bacteria | 706 |
| 670 | Ga0395899_0703402 | 3300037312 | Bacteria | 633 |
| 671 | Ga0395899_0981287 | 3300037312 | Bacteria | 510 |
| 672 | Ga0395900_0000130 | 3300037418 | Bacteria | 126231 |
| 673 | Ga0395900_0006337 | 3300037418 | Bacteria | 12335 |
| 674 | Ga0395900_0019755 | 3300037418 | Bacteria | 6866 |
| 675 | Ga0395900_0034078 | 3300037418 | Bacteria | 5241 |
| 676 | Ga0395900_0050595 | 3300037418 | Bacteria | 4279 |
| 677 | Ga0395900_0060173 | 3300037418 | Bacteria | 3909 |
| 678 | Ga0395900_0064510 | 3300037418 | Bacteria | 3763 |
| 679 | Ga0395900_0070709 | 3300037418 | Bacteria | 3587 |
| 680 | Ga0395900_0111023 | 3300037418 | Bacteria | 2816 |
| 681 | Ga0395900_0111453 | 3300037418 | Bacteria | 2810 |
| 682 | Ga0395900_0161969 | 3300037418 | Bacteria | 2281 |
| 683 | Ga0395900_0182805 | 3300037418 | Bacteria | 2130 |
| 684 | Ga0395900_0314084 | 3300037418 | Bacteria | 1549 |
| 685 | Ga0395900_0915297 | 3300037418 | Bacteria | 800 |
| 686 | Ga0395900_1112744 | 3300037418 | Bacteria | 707 |
| 687 | Ga0395900_1280988 | 3300037418 | Bacteria | 647 |
| 688 | Ga0395900_1437226 | 3300037418 | Bacteria | 602 |
| 689 | Ga0395900_1463565 | 3300037418 | Bacteria | 595 |
| 690 | Ga0395898_0000274 | 3300037466 | Bacteria | 125922 |
| 691 | Ga0395898_0001594 | 3300037466 | Bacteria | 30951 |
| 692 | Ga0395898_0004865 | 3300037466 | Bacteria | 14585 |
| 693 | Ga0395898_0029190 | 3300037466 | Bacteria | 5526 |
| 694 | Ga0395898_0042473 | 3300037466 | Bacteria | 4485 |
| 695 | Ga0395898_0053112 | 3300037466 | Bacteria | 3958 |
| 696 | Ga0395898_0108818 | 3300037466 | Bacteria | 2657 |
| 697 | Ga0395898_0167258 | 3300037466 | Bacteria | 2102 |
| 698 | Ga0395898_0259181 | 3300037466 | Bacteria | 1658 |
| 699 | Ga0395898_0270220 | 3300037466 | Bacteria | 1622 |
| 700 | Ga0395905_0000287 | 3300037471 | Bacteria | 73803 |
| 701 | Ga0395905_0001408 | 3300037471 | Bacteria | 29105 |
| 702 | Ga0395905_0008347 | 3300037471 | Bacteria | 10214 |
| 703 | Ga0395905_0009393 | 3300037471 | Bacteria | 9563 |
| 704 | Ga0395905_0010680 | 3300037471 | Bacteria | 8905 |
| 705 | Ga0395905_0019454 | 3300037471 | Bacteria | 6436 |
| 706 | Ga0395905_0019534 | 3300037471 | Bacteria | 6423 |
| 707 | Ga0395905_0022556 | 3300037471 | Bacteria | 5954 |
| 708 | Ga0395905_0041942 | 3300037471 | Bacteria | 4294 |
| 709 | Ga0395905_0043388 | 3300037471 | Bacteria | 4219 |
| 710 | Ga0395905_0050279 | 3300037471 | Bacteria | 3905 |
| 711 | Ga0395905_0051282 | 3300037471 | Bacteria | 3864 |
| 712 | Ga0395905_0051372 | 3300037471 | Bacteria | 3861 |
| 713 | Ga0395905_0076037 | 3300037471 | Bacteria | 3146 |
| 714 | Ga0395905_0122356 | 3300037471 | Bacteria | 2446 |
| 715 | Ga0395905_0140054 | 3300037471 | Bacteria | 2276 |
| 716 | Ga0395905_0146626 | 3300037471 | Bacteria | 2220 |
| 717 | Ga0395905_0235254 | 3300037471 | Bacteria | 1712 |
| 718 | Ga0395905_0306403 | 3300037471 | Bacteria | 1476 |
| 719 | Ga0395905_0324861 | 3300037471 | Bacteria | 1429 |
| 720 | Ga0395905_0338299 | 3300037471 | Bacteria | 1396 |
| 721 | Ga0395905_0384558 | 3300037471 | Bacteria | 1297 |
| 722 | Ga0395905_0412885 | 3300037471 | Bacteria | 1245 |
| 723 | Ga0395905_0583012 | 3300037471 | Bacteria | 1020 |
| 724 | Ga0395905_0646301 | 3300037471 | Bacteria | 960 |
| 725 | Ga0395905_0648975 | 3300037471 | Bacteria | 957 |
| 726 | Ga0395905_0883429 | 3300037471 | Unclassified | 797 |
| 727 | Ga0395905_0995427 | 3300037471 | Bacteria | 741 |
| 728 | Ga0395905_1634907 | 3300037471 | Unclassified | 549 |
| 729 | Ga0395901_0014759 | 3300038443 | Bacteria | 7937 |
| 730 | Ga0395901_0018835 | 3300038443 | Bacteria | 7056 |
| 731 | Ga0395901_0028662 | 3300038443 | Bacteria | 5727 |
| 732 | Ga0395901_0059419 | 3300038443 | Bacteria | 3977 |
| 733 | Ga0395901_0110482 | 3300038443 | Bacteria | 2886 |
| 734 | Ga0395901_0120095 | 3300038443 | Bacteria | 2762 |
| 735 | Ga0395901_0130566 | 3300038443 | Bacteria | 2640 |
| 736 | Ga0395901_0142529 | 3300038443 | Bacteria | 2518 |
| 737 | Ga0395901_0150193 | 3300038443 | Bacteria | 2448 |
| 738 | Ga0395901_0156682 | 3300038443 | Bacteria | 2392 |
| 739 | Ga0395901_0251584 | 3300038443 | Bacteria | 1840 |
| 740 | Ga0395901_0442414 | 3300038443 | Bacteria | 1330 |
| 741 | Ga0395901_0512005 | 3300038443 | Unclassified | 1220 |
| 742 | Ga0395901_0557540 | 3300038443 | Bacteria | 1160 |
| 743 | Ga0395901_0686819 | 3300038443 | Bacteria | 1023 |
| 744 | Ga0395901_0729428 | 3300038443 | Bacteria | 986 |
| 745 | Ga0395901_0751606 | 3300038443 | Bacteria | 968 |
| 746 | Ga0395901_1577988 | 3300038443 | Bacteria | 610 |
| 747 | Ga0439465_0058319 | 3300041413 | Bacteria | 1276 |
| 748 | Ga0451849_0795203 | 3300041505 | Unclassified | 520 |
| 749 | Ga0439448_0004596 | 3300042005 | Bacteria | 3903 |
| 750 | Ga0439432_222939 | 3300042006 | Bacteria | 544 |
| 751 | Ga0439449_0235685 | 3300042007 | Bacteria | 687 |
| 752 | Ga0439455_0120683 | 3300042012 | Bacteria | 734 |
| 753 | Ga0450914_000440 | 3300042118 | Bacteria | 1928 |
| 754 | Ga0450890_005968 | 3300042127 | Bacteria | 1566 |
| 755 | Ga0450905_001095 | 3300042142 | Bacteria | 3402 |
| 756 | Ga0450889_000275 | 3300042144 | Bacteria | 5731 |
| 757 | Ga0439458_0000405 | 3300042157 | Bacteria | 10803 |
| 758 | Ga0439458_0054816 | 3300042157 | Bacteria | 988 |
| 759 | Ga0439458_0071267 | 3300042157 | Bacteria | 878 |
| 760 | Ga0439459_0130688 | 3300042438 | Bacteria | 641 |
| 761 | Ga0466966_0841087 | 3300044684 | Bacteria | 553 |
| 762 | Ga0466963_0011272 | 3300044694 | Bacteria | 5440 |
| 763 | Ga0466963_0520371 | 3300044694 | Bacteria | 840 |
| 764 | Ga0466963_0603338 | 3300044694 | Bacteria | 775 |
| 765 | Ga0466964_0061663 | 3300044706 | Bacteria | 1562 |
| 766 | Ga0466964_0602646 | 3300044706 | Bacteria | 603 |
| 767 | Ga0466970_0765966 | 3300044765 | Bacteria | 564 |
| 768 | Ga0466957_0003051 | 3300044842 | Bacteria | 9106 |
| 769 | Ga0466957_0071580 | 3300044842 | Bacteria | 2145 |
| 770 | Ga0466967_0000053 | 3300045976 | Bacteria | 41252 |
| 771 | Ga0466967_0117666 | 3300045976 | Bacteria | 2450 |
| 772 | Ga0466967_0152078 | 3300045976 | Bacteria | 2164 |
| 773 | Ga0466967_0244335 | 3300045976 | Bacteria | 1713 |
| 774 | Ga0466967_0283260 | 3300045976 | Unclassified | 1591 |
| 775 | Ga0466967_0389784 | 3300045976 | Bacteria | 1354 |
| 776 | Ga0466967_0592188 | 3300045976 | Bacteria | 1094 |
| 777 | Ga0466967_2215042 | 3300045976 | Bacteria | 545 |
| 778 | Ga0495629_0710345 | 3300046459 | Unclassified | 667 |
| 779 | Ga0495647_0044685 | 3300046681 | Bacteria | 1700 |
| 780 | Ga0495677_0073261 | 3300047445 | Bacteria | 1278 |
| 781 | Ga0495685_258333 | 3300047447 | Bacteria | 552 |
| 782 | Ga0496100_0056386 | 3300048903 | Bacteria | 2570 |
| 783 | Ga0496101_0018340 | 3300048904 | Bacteria | 4756 |
| 784 | Ga0496101_0544940 | 3300048904 | Bacteria | 917 |
| 785 | Ga0496101_0704361 | 3300048904 | Bacteria | 797 |
| 786 | Ga0496101_0842522 | 3300048904 | Bacteria | 723 |
| 787 | Ga0496102_0671464 | 3300048905 | Bacteria | 959 |
| 788 | Ga0496103_0152161 | 3300048906 | Bacteria | 1482 |
| 789 | Ga0496103_0309545 | 3300048906 | Bacteria | 1016 |
| 790 | Ga0496104_0344529 | 3300048907 | Bacteria | 1403 |
| 791 | Ga0496105_1287102 | 3300048908 | Bacteria | 534 |
| 792 | Ga0496106_0200985 | 3300048909 | Bacteria | 1586 |
| 793 | Ga0496106_0292314 | 3300048909 | Bacteria | 1306 |
| 794 | Ga0496106_0427041 | 3300048909 | Bacteria | 1065 |
| 795 | Ga0496106_0683911 | 3300048909 | Bacteria | 818 |
| 796 | Ga0496107_0098795 | 3300048910 | Bacteria | 2138 |
| 797 | Ga0496107_0124754 | 3300048910 | Bacteria | 1898 |
| 798 | Ga0496107_0148922 | 3300048910 | Bacteria | 1731 |
| 799 | Ga0496107_0875417 | 3300048910 | Bacteria | 655 |
| 800 | Ga0496108_0043524 | 3300048911 | Bacteria | 3750 |
| 801 | Ga0496108_0114552 | 3300048911 | Bacteria | 2308 |
| 802 | Ga0496108_0613750 | 3300048911 | Bacteria | 947 |
| 803 | Ga0496108_1084218 | 3300048911 | Bacteria | 681 |
| 804 | Ga0496109_0010711 | 3300048912 | Bacteria | 7845 |
| 805 | Ga0496109_0026042 | 3300048912 | Bacteria | 5213 |
| 806 | Ga0496109_0118552 | 3300048912 | Bacteria | 2464 |
| 807 | Ga0496109_1107593 | 3300048912 | Bacteria | 729 |
| 808 | Ga0496110_0033088 | 3300048913 | Bacteria | 4470 |
| 809 | Ga0496110_1565033 | 3300048913 | Bacteria | 569 |
| 810 | Ga0496110_1857347 | 3300048913 | Bacteria | 512 |
| 811 | Ga0496111_0057303 | 3300048914 | Bacteria | 2821 |
| 812 | Ga0496111_0121862 | 3300048914 | Bacteria | 1926 |
| 813 | Ga0496112_0021480 | 3300048915 | Bacteria | 6139 |
| 814 | Ga0496112_0057861 | 3300048915 | Bacteria | 3817 |
| 815 | Ga0496112_0064275 | 3300048915 | Bacteria | 3621 |
| 816 | Ga0496112_0072589 | 3300048915 | Bacteria | 3402 |
| 817 | Ga0496113_0113283 | 3300048916 | Bacteria | 2114 |
| 818 | Ga0496113_0159089 | 3300048916 | Bacteria | 1785 |
| 819 | Ga0496113_0207635 | 3300048916 | Bacteria | 1558 |
| 820 | Ga0496114_0063559 | 3300048917 | Bacteria | 3090 |
| 821 | Ga0496115_0058860 | 3300048918 | Bacteria | 3093 |
| 822 | Ga0501034_0526388 | 3300049571 | Bacteria | 1094 |
| 823 | Ga0501046_0766886 | 3300049580 | Bacteria | 677 |
| 824 | Ga0501068_0184571 | 3300049584 | Bacteria | 1320 |
| 825 | Ga0501202_038346 | 3300049652 | Bacteria | 1027 |
| 826 | Ga0501214_020059 | 3300049659 | Bacteria | 841 |
| 827 | Ga0501224_014860 | 3300049664 | Bacteria | 1153 |
| 828 | Ga0501230_079417 | 3300049667 | Bacteria | 685 |
| 829 | Ga0501249_077708 | 3300049679 | Bacteria | 778 |
| 830 | Ga0501252_033881 | 3300049682 | Bacteria | 718 |
| 831 | Ga0501221_025277 | 3300049704 | Bacteria | 1199 |
| 832 | Ga0501225_0159470 | 3300049705 | Bacteria | 693 |
| 833 | Ga0501229_022774 | 3300049706 | Bacteria | 835 |
| 834 | Ga0501262_011795 | 3300049759 | Bacteria | 1111 |
| 835 | Ga0501268_004007 | 3300049765 | Bacteria | 2054 |
| 836 | Ga0501270_044554 | 3300049767 | Bacteria | 784 |
| 837 | Ga0501272_018225 | 3300049769 | Bacteria | 831 |
| 838 | Ga0501273_042440 | 3300049770 | Bacteria | 676 |
| 839 | nmdc:mga05p37_1150221_c1 | 3300050507 | Bacteria | 807 |
| 840 | nmdc:mga08y16_224427_c1 | 3300050511 | Bacteria | 1944 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0520371 | Ga0466963_0520371_339_512 | 49 |
| 2 | 3300044842 | Ga0466957_0071580 | Ga0466957_0071580_546_719 | 49 |
| 3 | 3300045976 | Ga0466967_2215042 | Ga0466967_2215042_355_528 | 49 |
| 4 | 3300003323 | rootH1_10019858 | rootH1_100198582 | 51 |
| 5 | 3300045976 | Ga0466967_0389784 | Ga0466967_0389784_499_654 | 51 |
| 6 | 3300005367 | Ga0070667_102071338 | Ga0070667_1020713381 | 52 |
| 7 | 3300005841 | Ga0068863_102082722 | Ga0068863_1020827222 | 52 |
| 8 | 3300006358 | Ga0068871_100155086 | Ga0068871_1001550863 | 52 |
| 9 | 3300013308 | Ga0157375_10177423 | Ga0157375_101774234 | 52 |
| 10 | 3300025941 | Ga0207711_10034390 | Ga0207711_100343904 | 52 |
| 11 | 3300037312 | Ga0395899_0703402 | Ga0395899_0703402_391_549 | 52 |
| 12 | 3300037418 | Ga0395900_0034078 | Ga0395900_0034078_3049_3207 | 52 |
| 13 | 3300037418 | Ga0395900_0111453 | Ga0395900_0111453_1294_1452 | 52 |
| 14 | 3300037418 | Ga0395900_1437226 | Ga0395900_1437226_367_525 | 52 |
| 15 | 3300037418 | Ga0395900_1463565 | Ga0395900_1463565_40_198 | 52 |
| 16 | 3300037466 | Ga0395898_0167258 | Ga0395898_0167258_899_1057 | 52 |
| 17 | 3300037466 | Ga0395898_0259181 | Ga0395898_0259181_318_476 | 52 |
| 18 | 3300037471 | Ga0395905_0050279 | Ga0395905_0050279_2563_2721 | 52 |
| 19 | 3300037471 | Ga0395905_0051372 | Ga0395905_0051372_823_981 | 52 |
| 20 | 3300038443 | Ga0395901_0251584 | Ga0395901_0251584_1154_1312 | 52 |
| 21 | 3300038443 | Ga0395901_0557540 | Ga0395901_0557540_453_611 | 52 |
| 22 | 3300045976 | Ga0466967_0244335 | Ga0466967_0244335_599_757 | 52 |
| 23 | 3300048904 | Ga0496101_0544940 | Ga0496101_0544940_681_839 | 52 |
| 24 | 3300048904 | Ga0496101_0704361 | Ga0496101_0704361_594_752 | 52 |
| 25 | 3300048911 | Ga0496108_0613750 | Ga0496108_0613750_99_257 | 52 |
| 26 | 3300048912 | Ga0496109_0118552 | Ga0496109_0118552_481_639 | 52 |
| 27 | 3300048912 | Ga0496109_1107593 | Ga0496109_1107593_275_433 | 52 |
| 28 | 3300048913 | Ga0496110_1565033 | Ga0496110_1565033_116_274 | 52 |
| 29 | 3300048915 | Ga0496112_0057861 | Ga0496112_0057861_889_1047 | 52 |
| 30 | 3300005331 | Ga0070670_100031334 | Ga0070670_1000313341 | 53 |
| 31 | 3300005335 | Ga0070666_10159798 | Ga0070666_101597981 | 53 |
| 32 | 3300005347 | Ga0070668_100083764 | Ga0070668_1000837644 | 53 |
| 33 | 3300005455 | Ga0070663_101398270 | Ga0070663_1013982702 | 53 |
| 34 | 3300005564 | Ga0070664_100016401 | Ga0070664_1000164015 | 53 |
| 35 | 3300005844 | Ga0068862_100473240 | Ga0068862_1004732402 | 53 |
| 36 | 3300009177 | Ga0105248_10004830 | Ga0105248_1000483012 | 53 |
| 37 | 3300009553 | Ga0105249_11215731 | Ga0105249_112157311 | 53 |
| 38 | 3300011119 | Ga0105246_11716056 | Ga0105246_117160562 | 53 |
| 39 | 3300013104 | Ga0157370_10008396 | Ga0157370_1000839610 | 53 |
| 40 | 3300025903 | Ga0207680_10145480 | Ga0207680_101454804 | 53 |
| 41 | 3300025925 | Ga0207650_10390706 | Ga0207650_103907062 | 53 |
| 42 | 3300025945 | Ga0207679_10003835 | Ga0207679_100038357 | 53 |
| 43 | 3300025945 | Ga0207679_10732012 | Ga0207679_107320122 | 53 |
| 44 | 3300025961 | Ga0207712_10157123 | Ga0207712_101571231 | 53 |
| 45 | 3300025972 | Ga0207668_10065390 | Ga0207668_100653903 | 53 |
| 46 | 3300028379 | Ga0268266_10701224 | Ga0268266_107012242 | 53 |
| 47 | 3300028380 | Ga0268265_10029948 | Ga0268265_100299484 | 53 |
| 48 | 3300041505 | Ga0451849_0795203 | Ga0451849_0795203_89_250 | 53 |
| 49 | 3300001979 | JGI24740J21852_10015401 | JGI24740J21852_100154014 | 57 |
| 50 | 3300001990 | JGI24737J22298_10089095 | JGI24737J22298_100890953 | 57 |
| 51 | 3300005327 | Ga0070658_10032398 | Ga0070658_100323985 | 57 |
| 52 | 3300005327 | Ga0070658_10052796 | Ga0070658_100527963 | 57 |
| 53 | 3300005327 | Ga0070658_10074834 | Ga0070658_100748344 | 57 |
| 54 | 3300005327 | Ga0070658_10134112 | Ga0070658_101341123 | 57 |
| 55 | 3300005327 | Ga0070658_10179207 | Ga0070658_101792072 | 57 |
| 56 | 3300005327 | Ga0070658_11439996 | Ga0070658_114399962 | 57 |
| 57 | 3300005329 | Ga0070683_100011627 | Ga0070683_1000116278 | 57 |
| 58 | 3300005329 | Ga0070683_100423572 | Ga0070683_1004235722 | 57 |
| 59 | 3300005329 | Ga0070683_102011379 | Ga0070683_1020113791 | 57 |
| 60 | 3300005330 | Ga0070690_100001152 | Ga0070690_10000115214 | 57 |
| 61 | 3300005330 | Ga0070690_100318396 | Ga0070690_1003183962 | 57 |
| 62 | 3300005331 | Ga0070670_100005622 | Ga0070670_10000562211 | 57 |
| 63 | 3300005331 | Ga0070670_100175019 | Ga0070670_1001750191 | 57 |
| 64 | 3300005331 | Ga0070670_100409845 | Ga0070670_1004098452 | 57 |
| 65 | 3300005331 | Ga0070670_100712289 | Ga0070670_1007122892 | 57 |
| 66 | 3300005331 | Ga0070670_100767140 | Ga0070670_1007671402 | 57 |
| 67 | 3300005331 | Ga0070670_100892285 | Ga0070670_1008922852 | 57 |
| 68 | 3300005331 | Ga0070670_101992042 | Ga0070670_1019920422 | 57 |
| 69 | 3300005333 | Ga0070677_10179546 | Ga0070677_101795462 | 57 |
| 70 | 3300005333 | Ga0070677_10602095 | Ga0070677_106020952 | 57 |
| 71 | 3300005335 | Ga0070666_10000215 | Ga0070666_1000021522 | 57 |
| 72 | 3300005335 | Ga0070666_10016884 | Ga0070666_100168842 | 57 |
| 73 | 3300005335 | Ga0070666_11010514 | Ga0070666_110105142 | 57 |
| 74 | 3300005336 | Ga0070680_100032551 | Ga0070680_1000325514 | 57 |
| 75 | 3300005338 | Ga0068868_100003281 | Ga0068868_10000328113 | 57 |
| 76 | 3300005338 | Ga0068868_100104592 | Ga0068868_1001045923 | 57 |
| 77 | 3300005339 | Ga0070660_100000678 | Ga0070660_1000006785 | 57 |
| 78 | 3300005339 | Ga0070660_100029505 | Ga0070660_1000295054 | 57 |
| 79 | 3300005339 | Ga0070660_100039840 | Ga0070660_1000398402 | 57 |
| 80 | 3300005339 | Ga0070660_100138170 | Ga0070660_1001381702 | 57 |
| 81 | 3300005340 | Ga0070689_100082305 | Ga0070689_1000823052 | 57 |
| 82 | 3300005343 | Ga0070687_100115377 | Ga0070687_1001153773 | 57 |
| 83 | 3300005344 | Ga0070661_100019093 | Ga0070661_1000190934 | 57 |
| 84 | 3300005344 | Ga0070661_100034471 | Ga0070661_1000344713 | 57 |
| 85 | 3300005344 | Ga0070661_100083455 | Ga0070661_1000834551 | 57 |
| 86 | 3300005344 | Ga0070661_100221201 | Ga0070661_1002212013 | 57 |
| 87 | 3300005344 | Ga0070661_100280495 | Ga0070661_1002804952 | 57 |
| 88 | 3300005344 | Ga0070661_100604439 | Ga0070661_1006044392 | 57 |
| 89 | 3300005344 | Ga0070661_101156747 | Ga0070661_1011567472 | 57 |
| 90 | 3300005345 | Ga0070692_10032892 | Ga0070692_100328924 | 57 |
| 91 | 3300005347 | Ga0070668_100376342 | Ga0070668_1003763423 | 57 |
| 92 | 3300005353 | Ga0070669_100517922 | Ga0070669_1005179222 | 57 |
| 93 | 3300005353 | Ga0070669_101875985 | Ga0070669_1018759852 | 57 |
| 94 | 3300005354 | Ga0070675_100457032 | Ga0070675_1004570322 | 57 |
| 95 | 3300005354 | Ga0070675_100704312 | Ga0070675_1007043122 | 57 |
| 96 | 3300005355 | Ga0070671_100026186 | Ga0070671_1000261862 | 57 |
| 97 | 3300005355 | Ga0070671_100274093 | Ga0070671_1002740932 | 57 |
| 98 | 3300005355 | Ga0070671_100349159 | Ga0070671_1003491592 | 57 |
| 99 | 3300005356 | Ga0070674_100017266 | Ga0070674_1000172665 | 57 |
| 100 | 3300005356 | Ga0070674_100308488 | Ga0070674_1003084882 | 57 |
| 101 | 3300005364 | Ga0070673_100013350 | Ga0070673_1000133504 | 57 |
| 102 | 3300005364 | Ga0070673_100097879 | Ga0070673_1000978792 | 57 |
| 103 | 3300005365 | Ga0070688_100290560 | Ga0070688_1002905602 | 57 |
| 104 | 3300005366 | Ga0070659_100008920 | Ga0070659_1000089207 | 57 |
| 105 | 3300005366 | Ga0070659_100024090 | Ga0070659_1000240903 | 57 |
| 106 | 3300005366 | Ga0070659_100032050 | Ga0070659_1000320502 | 57 |
| 107 | 3300005366 | Ga0070659_100048299 | Ga0070659_1000482994 | 57 |
| 108 | 3300005366 | Ga0070659_100106737 | Ga0070659_1001067374 | 57 |
| 109 | 3300005366 | Ga0070659_100920631 | Ga0070659_1009206312 | 57 |
| 110 | 3300005367 | Ga0070667_100000842 | Ga0070667_1000008424 | 57 |
| 111 | 3300005367 | Ga0070667_100288724 | Ga0070667_1002887242 | 57 |
| 112 | 3300005367 | Ga0070667_100891502 | Ga0070667_1008915022 | 57 |
| 113 | 3300005435 | Ga0070714_100271398 | Ga0070714_1002713983 | 57 |
| 114 | 3300005435 | Ga0070714_101058393 | Ga0070714_1010583932 | 57 |
| 115 | 3300005436 | Ga0070713_100058014 | Ga0070713_1000580145 | 57 |
| 116 | 3300005436 | Ga0070713_100977396 | Ga0070713_1009773961 | 57 |
| 117 | 3300005436 | Ga0070713_101581598 | Ga0070713_1015815982 | 57 |
| 118 | 3300005440 | Ga0070705_100639262 | Ga0070705_1006392621 | 57 |
| 119 | 3300005444 | Ga0070694_100021107 | Ga0070694_1000211074 | 57 |
| 120 | 3300005455 | Ga0070663_100000936 | Ga0070663_1000009363 | 57 |
| 121 | 3300005455 | Ga0070663_100240881 | Ga0070663_1002408813 | 57 |
| 122 | 3300005455 | Ga0070663_100402770 | Ga0070663_1004027702 | 57 |
| 123 | 3300005455 | Ga0070663_100517971 | Ga0070663_1005179712 | 57 |
| 124 | 3300005456 | Ga0070678_100136929 | Ga0070678_1001369293 | 57 |
| 125 | 3300005456 | Ga0070678_100238809 | Ga0070678_1002388092 | 57 |
| 126 | 3300005457 | Ga0070662_100003839 | Ga0070662_10000383910 | 57 |
| 127 | 3300005457 | Ga0070662_100013241 | Ga0070662_1000132414 | 57 |
| 128 | 3300005457 | Ga0070662_100097939 | Ga0070662_1000979393 | 57 |
| 129 | 3300005457 | Ga0070662_100131087 | Ga0070662_1001310873 | 57 |
| 130 | 3300005457 | Ga0070662_100218208 | Ga0070662_1002182083 | 57 |
| 131 | 3300005457 | Ga0070662_100726714 | Ga0070662_1007267142 | 57 |
| 132 | 3300005457 | Ga0070662_101083660 | Ga0070662_1010836601 | 57 |
| 133 | 3300005457 | Ga0070662_101517800 | Ga0070662_1015178002 | 57 |
| 134 | 3300005457 | Ga0070662_101898125 | Ga0070662_1018981251 | 57 |
| 135 | 3300005458 | Ga0070681_10063375 | Ga0070681_100633754 | 57 |
| 136 | 3300005458 | Ga0070681_10391506 | Ga0070681_103915062 | 57 |
| 137 | 3300005459 | Ga0068867_100385815 | Ga0068867_1003858152 | 57 |
| 138 | 3300005459 | Ga0068867_100708830 | Ga0068867_1007088302 | 57 |
| 139 | 3300005466 | Ga0070685_10222170 | Ga0070685_102221703 | 57 |
| 140 | 3300005466 | Ga0070685_10351389 | Ga0070685_103513892 | 57 |
| 141 | 3300005530 | Ga0070679_100001182 | Ga0070679_10000118210 | 57 |
| 142 | 3300005530 | Ga0070679_101480400 | Ga0070679_1014804002 | 57 |
| 143 | 3300005535 | Ga0070684_100215259 | Ga0070684_1002152593 | 57 |
| 144 | 3300005539 | Ga0068853_100010924 | Ga0068853_1000109245 | 57 |
| 145 | 3300005539 | Ga0068853_100042011 | Ga0068853_1000420114 | 57 |
| 146 | 3300005539 | Ga0068853_100509301 | Ga0068853_1005093012 | 57 |
| 147 | 3300005539 | Ga0068853_101264986 | Ga0068853_1012649861 | 57 |
| 148 | 3300005543 | Ga0070672_100001167 | Ga0070672_10000116718 | 57 |
| 149 | 3300005543 | Ga0070672_100446963 | Ga0070672_1004469632 | 57 |
| 150 | 3300005544 | Ga0070686_100580363 | Ga0070686_1005803632 | 57 |
| 151 | 3300005544 | Ga0070686_101445854 | Ga0070686_1014458541 | 57 |
| 152 | 3300005545 | Ga0070695_100123928 | Ga0070695_1001239284 | 57 |
| 153 | 3300005546 | Ga0070696_100022165 | Ga0070696_1000221655 | 57 |
| 154 | 3300005547 | Ga0070693_100310100 | Ga0070693_1003101001 | 57 |
| 155 | 3300005548 | Ga0070665_100423473 | Ga0070665_1004234732 | 57 |
| 156 | 3300005548 | Ga0070665_100778654 | Ga0070665_1007786542 | 57 |
| 157 | 3300005548 | Ga0070665_101507548 | Ga0070665_1015075482 | 57 |
| 158 | 3300005548 | Ga0070665_102533970 | Ga0070665_1025339702 | 57 |
| 159 | 3300005563 | Ga0068855_100014297 | Ga0068855_10001429710 | 57 |
| 160 | 3300005563 | Ga0068855_100482620 | Ga0068855_1004826202 | 57 |
| 161 | 3300005564 | Ga0070664_100007923 | Ga0070664_1000079237 | 57 |
| 162 | 3300005564 | Ga0070664_100012706 | Ga0070664_1000127063 | 57 |
| 163 | 3300005564 | Ga0070664_100045101 | Ga0070664_1000451013 | 57 |
| 164 | 3300005564 | Ga0070664_100056667 | Ga0070664_1000566674 | 57 |
| 165 | 3300005564 | Ga0070664_100644078 | Ga0070664_1006440781 | 57 |
| 166 | 3300005577 | Ga0068857_100065387 | Ga0068857_1000653873 | 57 |
| 167 | 3300005577 | Ga0068857_100150057 | Ga0068857_1001500574 | 57 |
| 168 | 3300005577 | Ga0068857_101065504 | Ga0068857_1010655042 | 57 |
| 169 | 3300005578 | Ga0068854_100089476 | Ga0068854_1000894762 | 57 |
| 170 | 3300005578 | Ga0068854_100504347 | Ga0068854_1005043472 | 57 |
| 171 | 3300005578 | Ga0068854_101087755 | Ga0068854_1010877552 | 57 |
| 172 | 3300005578 | Ga0068854_101145879 | Ga0068854_1011458792 | 57 |
| 173 | 3300005578 | Ga0068854_102191990 | Ga0068854_1021919902 | 57 |
| 174 | 3300005614 | Ga0068856_100321799 | Ga0068856_1003217992 | 57 |
| 175 | 3300005614 | Ga0068856_100965982 | Ga0068856_1009659822 | 57 |
| 176 | 3300005616 | Ga0068852_100141960 | Ga0068852_1001419604 | 57 |
| 177 | 3300005616 | Ga0068852_100142505 | Ga0068852_1001425051 | 57 |
| 178 | 3300005616 | Ga0068852_100208794 | Ga0068852_1002087943 | 57 |
| 179 | 3300005616 | Ga0068852_101834029 | Ga0068852_1018340292 | 57 |
| 180 | 3300005618 | Ga0068864_100014407 | Ga0068864_1000144078 | 57 |
| 181 | 3300005618 | Ga0068864_101113886 | Ga0068864_1011138862 | 57 |
| 182 | 3300005718 | Ga0068866_10013515 | Ga0068866_100135153 | 57 |
| 183 | 3300005718 | Ga0068866_10258846 | Ga0068866_102588462 | 57 |
| 184 | 3300005834 | Ga0068851_10080552 | Ga0068851_100805523 | 57 |
| 185 | 3300005834 | Ga0068851_10185285 | Ga0068851_101852853 | 57 |
| 186 | 3300005840 | Ga0068870_10181017 | Ga0068870_101810172 | 57 |
| 187 | 3300005841 | Ga0068863_100048408 | Ga0068863_1000484082 | 57 |
| 188 | 3300005841 | Ga0068863_100217068 | Ga0068863_1002170683 | 57 |
| 189 | 3300005841 | Ga0068863_100311741 | Ga0068863_1003117412 | 57 |
| 190 | 3300005842 | Ga0068858_100001703 | Ga0068858_1000017035 | 57 |
| 191 | 3300005842 | Ga0068858_100037069 | Ga0068858_1000370695 | 57 |
| 192 | 3300005843 | Ga0068860_100405559 | Ga0068860_1004055592 | 57 |
| 193 | 3300006028 | Ga0070717_10470206 | Ga0070717_104702062 | 57 |
| 194 | 3300006028 | Ga0070717_10888671 | Ga0070717_108886712 | 57 |
| 195 | 3300006237 | Ga0097621_100041877 | Ga0097621_1000418774 | 57 |
| 196 | 3300006237 | Ga0097621_100132776 | Ga0097621_1001327763 | 57 |
| 197 | 3300006358 | Ga0068871_100049909 | Ga0068871_1000499092 | 57 |
| 198 | 3300006358 | Ga0068871_100061563 | Ga0068871_1000615634 | 57 |
| 199 | 3300006358 | Ga0068871_100440671 | Ga0068871_1004406712 | 57 |
| 200 | 3300006844 | Ga0075428_102518008 | Ga0075428_1025180082 | 57 |
| 201 | 3300006881 | Ga0068865_100422592 | Ga0068865_1004225922 | 57 |
| 202 | 3300009094 | Ga0111539_10171535 | Ga0111539_101715353 | 57 |
| 203 | 3300009098 | Ga0105245_10326666 | Ga0105245_103266662 | 57 |
| 204 | 3300009148 | Ga0105243_11060782 | Ga0105243_110607822 | 57 |
| 205 | 3300009148 | Ga0105243_12539711 | Ga0105243_125397112 | 57 |
| 206 | 3300009174 | Ga0105241_11397245 | Ga0105241_113972452 | 57 |
| 207 | 3300009177 | Ga0105248_10000362 | Ga0105248_1000036233 | 57 |
| 208 | 3300009177 | Ga0105248_10015449 | Ga0105248_100154494 | 57 |
| 209 | 3300009177 | Ga0105248_10154280 | Ga0105248_101542804 | 57 |
| 210 | 3300013100 | Ga0157373_10448359 | Ga0157373_104483592 | 57 |
| 211 | 3300013100 | Ga0157373_10505265 | Ga0157373_105052652 | 57 |
| 212 | 3300013100 | Ga0157373_10589686 | Ga0157373_105896862 | 57 |
| 213 | 3300013102 | Ga0157371_11488222 | Ga0157371_114882222 | 57 |
| 214 | 3300013104 | Ga0157370_10009840 | Ga0157370_100098405 | 57 |
| 215 | 3300013105 | Ga0157369_10084502 | Ga0157369_100845024 | 57 |
| 216 | 3300013105 | Ga0157369_10494599 | Ga0157369_104945992 | 57 |
| 217 | 3300013296 | Ga0157374_10181221 | Ga0157374_101812214 | 57 |
| 218 | 3300013296 | Ga0157374_11104556 | Ga0157374_111045562 | 57 |
| 219 | 3300013306 | Ga0163162_10223770 | Ga0163162_102237702 | 57 |
| 220 | 3300013306 | Ga0163162_10572582 | Ga0163162_105725823 | 57 |
| 221 | 3300013306 | Ga0163162_10918524 | Ga0163162_109185242 | 57 |
| 222 | 3300013307 | Ga0157372_12219650 | Ga0157372_122196502 | 57 |
| 223 | 3300013308 | Ga0157375_10013944 | Ga0157375_100139445 | 57 |
| 224 | 3300013308 | Ga0157375_10330959 | Ga0157375_103309592 | 57 |
| 225 | 3300014325 | Ga0163163_10045299 | Ga0163163_100452995 | 57 |
| 226 | 3300014497 | Ga0182008_10255520 | Ga0182008_102555202 | 57 |
| 227 | 3300014497 | Ga0182008_10366285 | Ga0182008_103662852 | 57 |
| 228 | 3300014745 | Ga0157377_10593147 | Ga0157377_105931472 | 57 |
| 229 | 3300014968 | Ga0157379_10823366 | Ga0157379_108233662 | 57 |
| 230 | 3300014968 | Ga0157379_11899559 | Ga0157379_118995592 | 57 |
| 231 | 3300020082 | Ga0206353_11417362 | Ga0206353_114173622 | 57 |
| 232 | 3300025315 | Ga0207697_10165847 | Ga0207697_101658472 | 57 |
| 233 | 3300025321 | Ga0207656_10088593 | Ga0207656_100885933 | 57 |
| 234 | 3300025321 | Ga0207656_10157274 | Ga0207656_101572742 | 57 |
| 235 | 3300025321 | Ga0207656_10220316 | Ga0207656_102203162 | 57 |
| 236 | 3300025899 | Ga0207642_10007456 | Ga0207642_100074563 | 57 |
| 237 | 3300025899 | Ga0207642_10951380 | Ga0207642_109513802 | 57 |
| 238 | 3300025901 | Ga0207688_10060376 | Ga0207688_100603764 | 57 |
| 239 | 3300025901 | Ga0207688_10408952 | Ga0207688_104089522 | 57 |
| 240 | 3300025903 | Ga0207680_10000626 | Ga0207680_100006269 | 57 |
| 241 | 3300025903 | Ga0207680_10228228 | Ga0207680_102282282 | 57 |
| 242 | 3300025904 | Ga0207647_10009933 | Ga0207647_100099336 | 57 |
| 243 | 3300025904 | Ga0207647_10047161 | Ga0207647_100471613 | 57 |
| 244 | 3300025904 | Ga0207647_10215638 | Ga0207647_102156382 | 57 |
| 245 | 3300025907 | Ga0207645_10423616 | Ga0207645_104236162 | 57 |
| 246 | 3300025908 | Ga0207643_10395860 | Ga0207643_103958602 | 57 |
| 247 | 3300025909 | Ga0207705_10000205 | Ga0207705_1000020544 | 57 |
| 248 | 3300025909 | Ga0207705_10029143 | Ga0207705_100291434 | 57 |
| 249 | 3300025909 | Ga0207705_10626484 | Ga0207705_106264842 | 57 |
| 250 | 3300025909 | Ga0207705_10922477 | Ga0207705_109224772 | 57 |
| 251 | 3300025912 | Ga0207707_10069959 | Ga0207707_100699594 | 57 |
| 252 | 3300025912 | Ga0207707_10357671 | Ga0207707_103576712 | 57 |
| 253 | 3300025915 | Ga0207693_10920348 | Ga0207693_109203481 | 57 |
| 254 | 3300025917 | Ga0207660_10001386 | Ga0207660_100013869 | 57 |
| 255 | 3300025918 | Ga0207662_10085881 | Ga0207662_100858814 | 57 |
| 256 | 3300025919 | Ga0207657_10003566 | Ga0207657_1000356616 | 57 |
| 257 | 3300025919 | Ga0207657_10007910 | Ga0207657_100079109 | 57 |
| 258 | 3300025919 | Ga0207657_10011594 | Ga0207657_100115945 | 57 |
| 259 | 3300025919 | Ga0207657_10041186 | Ga0207657_100411866 | 57 |
| 260 | 3300025919 | Ga0207657_10142321 | Ga0207657_101423213 | 57 |
| 261 | 3300025919 | Ga0207657_10673461 | Ga0207657_106734612 | 57 |
| 262 | 3300025919 | Ga0207657_11464349 | Ga0207657_114643492 | 57 |
| 263 | 3300025920 | Ga0207649_10019857 | Ga0207649_100198575 | 57 |
| 264 | 3300025920 | Ga0207649_10077821 | Ga0207649_100778212 | 57 |
| 265 | 3300025920 | Ga0207649_10124012 | Ga0207649_101240124 | 57 |
| 266 | 3300025920 | Ga0207649_10192535 | Ga0207649_101925354 | 57 |
| 267 | 3300025920 | Ga0207649_10333002 | Ga0207649_103330022 | 57 |
| 268 | 3300025920 | Ga0207649_10689902 | Ga0207649_106899022 | 57 |
| 269 | 3300025921 | Ga0207652_10000270 | Ga0207652_1000027011 | 57 |
| 270 | 3300025921 | Ga0207652_11123503 | Ga0207652_111235032 | 57 |
| 271 | 3300025924 | Ga0207694_11505638 | Ga0207694_115056382 | 57 |
| 272 | 3300025925 | Ga0207650_10028035 | Ga0207650_100280353 | 57 |
| 273 | 3300025925 | Ga0207650_10038230 | Ga0207650_100382303 | 57 |
| 274 | 3300025925 | Ga0207650_10197418 | Ga0207650_101974182 | 57 |
| 275 | 3300025925 | Ga0207650_10644129 | Ga0207650_106441292 | 57 |
| 276 | 3300025925 | Ga0207650_10897746 | Ga0207650_108977462 | 57 |
| 277 | 3300025925 | Ga0207650_11038171 | Ga0207650_110381712 | 57 |
| 278 | 3300025925 | Ga0207650_11474793 | Ga0207650_114747932 | 57 |
| 279 | 3300025925 | Ga0207650_11679380 | Ga0207650_116793802 | 57 |
| 280 | 3300025926 | Ga0207659_10014421 | Ga0207659_100144212 | 57 |
| 281 | 3300025926 | Ga0207659_10560970 | Ga0207659_105609702 | 57 |
| 282 | 3300025927 | Ga0207687_11376811 | Ga0207687_113768112 | 57 |
| 283 | 3300025928 | Ga0207700_10755064 | Ga0207700_107550642 | 57 |
| 284 | 3300025929 | Ga0207664_11392867 | Ga0207664_113928672 | 57 |
| 285 | 3300025931 | Ga0207644_10120776 | Ga0207644_101207762 | 57 |
| 286 | 3300025931 | Ga0207644_10274315 | Ga0207644_102743152 | 57 |
| 287 | 3300025931 | Ga0207644_11175350 | Ga0207644_111753502 | 57 |
| 288 | 3300025932 | Ga0207690_10009242 | Ga0207690_100092423 | 57 |
| 289 | 3300025932 | Ga0207690_10241226 | Ga0207690_102412262 | 57 |
| 290 | 3300025932 | Ga0207690_10916474 | Ga0207690_109164742 | 57 |
| 291 | 3300025933 | Ga0207706_10006135 | Ga0207706_100061355 | 57 |
| 292 | 3300025933 | Ga0207706_10088152 | Ga0207706_100881523 | 57 |
| 293 | 3300025933 | Ga0207706_10157347 | Ga0207706_101573472 | 57 |
| 294 | 3300025933 | Ga0207706_10188380 | Ga0207706_101883802 | 57 |
| 295 | 3300025933 | Ga0207706_10237420 | Ga0207706_102374202 | 57 |
| 296 | 3300025933 | Ga0207706_11512504 | Ga0207706_115125042 | 57 |
| 297 | 3300025935 | Ga0207709_10710384 | Ga0207709_107103842 | 57 |
| 298 | 3300025936 | Ga0207670_10036600 | Ga0207670_100366003 | 57 |
| 299 | 3300025937 | Ga0207669_10002475 | Ga0207669_100024759 | 57 |
| 300 | 3300025937 | Ga0207669_10409457 | Ga0207669_104094572 | 57 |
| 301 | 3300025938 | Ga0207704_11842489 | Ga0207704_118424892 | 57 |
| 302 | 3300025940 | Ga0207691_10004833 | Ga0207691_100048336 | 57 |
| 303 | 3300025940 | Ga0207691_10155884 | Ga0207691_101558843 | 57 |
| 304 | 3300025941 | Ga0207711_10000610 | Ga0207711_1000061033 | 57 |
| 305 | 3300025941 | Ga0207711_10029458 | Ga0207711_100294584 | 57 |
| 306 | 3300025941 | Ga0207711_10108999 | Ga0207711_101089992 | 57 |
| 307 | 3300025944 | Ga0207661_10035672 | Ga0207661_100356724 | 57 |
| 308 | 3300025944 | Ga0207661_10281857 | Ga0207661_102818572 | 57 |
| 309 | 3300025944 | Ga0207661_11866792 | Ga0207661_118667922 | 57 |
| 310 | 3300025945 | Ga0207679_10092671 | Ga0207679_100926712 | 57 |
| 311 | 3300025945 | Ga0207679_10237494 | Ga0207679_102374943 | 57 |
| 312 | 3300025945 | Ga0207679_10273154 | Ga0207679_102731542 | 57 |
| 313 | 3300025945 | Ga0207679_10336713 | Ga0207679_103367133 | 57 |
| 314 | 3300025949 | Ga0207667_10092876 | Ga0207667_100928764 | 57 |
| 315 | 3300025949 | Ga0207667_10459662 | Ga0207667_104596623 | 57 |
| 316 | 3300025949 | Ga0207667_10965854 | Ga0207667_109658541 | 57 |
| 317 | 3300025960 | Ga0207651_10027626 | Ga0207651_100276265 | 57 |
| 318 | 3300025960 | Ga0207651_10036114 | Ga0207651_100361142 | 57 |
| 319 | 3300025960 | Ga0207651_11023616 | Ga0207651_110236162 | 57 |
| 320 | 3300025972 | Ga0207668_10427699 | Ga0207668_104276993 | 57 |
| 321 | 3300025981 | Ga0207640_10274531 | Ga0207640_102745312 | 57 |
| 322 | 3300025981 | Ga0207640_10648041 | Ga0207640_106480412 | 57 |
| 323 | 3300025981 | Ga0207640_10719177 | Ga0207640_107191772 | 57 |
| 324 | 3300025981 | Ga0207640_11927692 | Ga0207640_119276921 | 57 |
| 325 | 3300025981 | Ga0207640_12128530 | Ga0207640_121285302 | 57 |
| 326 | 3300025986 | Ga0207658_10005525 | Ga0207658_100055255 | 57 |
| 327 | 3300025986 | Ga0207658_10274113 | Ga0207658_102741133 | 57 |
| 328 | 3300025986 | Ga0207658_10967702 | Ga0207658_109677022 | 57 |
| 329 | 3300026023 | Ga0207677_10003982 | Ga0207677_100039826 | 57 |
| 330 | 3300026023 | Ga0207677_10075441 | Ga0207677_100754414 | 57 |
| 331 | 3300026035 | Ga0207703_10006106 | Ga0207703_100061064 | 57 |
| 332 | 3300026035 | Ga0207703_10197852 | Ga0207703_101978522 | 57 |
| 333 | 3300026035 | Ga0207703_12376262 | Ga0207703_123762622 | 57 |
| 334 | 3300026041 | Ga0207639_10036236 | Ga0207639_100362363 | 57 |
| 335 | 3300026041 | Ga0207639_10207711 | Ga0207639_102077112 | 57 |
| 336 | 3300026041 | Ga0207639_10411625 | Ga0207639_104116252 | 57 |
| 337 | 3300026041 | Ga0207639_10927817 | Ga0207639_109278172 | 57 |
| 338 | 3300026041 | Ga0207639_11826009 | Ga0207639_118260092 | 57 |
| 339 | 3300026067 | Ga0207678_10000766 | Ga0207678_1000076611 | 57 |
| 340 | 3300026067 | Ga0207678_10105549 | Ga0207678_101055493 | 57 |
| 341 | 3300026067 | Ga0207678_10210123 | Ga0207678_102101232 | 57 |
| 342 | 3300026067 | Ga0207678_10347446 | Ga0207678_103474461 | 57 |
| 343 | 3300026067 | Ga0207678_10564039 | Ga0207678_105640392 | 57 |
| 344 | 3300026078 | Ga0207702_10307882 | Ga0207702_103078823 | 57 |
| 345 | 3300026078 | Ga0207702_10334089 | Ga0207702_103340892 | 57 |
| 346 | 3300026078 | Ga0207702_10545875 | Ga0207702_105458752 | 57 |
| 347 | 3300026088 | Ga0207641_10043334 | Ga0207641_100433342 | 57 |
| 348 | 3300026088 | Ga0207641_10117465 | Ga0207641_101174654 | 57 |
| 349 | 3300026089 | Ga0207648_10464460 | Ga0207648_104644602 | 57 |
| 350 | 3300026095 | Ga0207676_10005201 | Ga0207676_100052012 | 57 |
| 351 | 3300026095 | Ga0207676_10098779 | Ga0207676_100987792 | 57 |
| 352 | 3300026116 | Ga0207674_10037696 | Ga0207674_100376964 | 57 |
| 353 | 3300026116 | Ga0207674_10113335 | Ga0207674_101133353 | 57 |
| 354 | 3300026121 | Ga0207683_10009640 | Ga0207683_100096408 | 57 |
| 355 | 3300026121 | Ga0207683_10161003 | Ga0207683_101610032 | 57 |
| 356 | 3300026142 | Ga0207698_10036882 | Ga0207698_100368823 | 57 |
| 357 | 3300026142 | Ga0207698_10923718 | Ga0207698_109237182 | 57 |
| 358 | 3300026142 | Ga0207698_11164902 | Ga0207698_111649022 | 57 |
| 359 | 3300026142 | Ga0207698_12120547 | Ga0207698_121205472 | 57 |
| 360 | 3300028379 | Ga0268266_10108623 | Ga0268266_101086234 | 57 |
| 361 | 3300028379 | Ga0268266_12185213 | Ga0268266_121852132 | 57 |
| 362 | 3300028381 | Ga0268264_10293205 | Ga0268264_102932053 | 57 |
| 363 | 3300028381 | Ga0268264_10541117 | Ga0268264_105411173 | 57 |
| 364 | 3300030745 | Ga0316182_1086040 | Ga0316182_10860402 | 57 |
| 365 | 3300031548 | Ga0307408_100161243 | Ga0307408_1001612433 | 57 |
| 366 | 3300031548 | Ga0307408_100320899 | Ga0307408_1003208992 | 57 |
| 367 | 3300031548 | Ga0307408_101890301 | Ga0307408_1018903012 | 57 |
| 368 | 3300031731 | Ga0307405_10027152 | Ga0307405_100271523 | 57 |
| 369 | 3300031731 | Ga0307405_10038617 | Ga0307405_100386174 | 57 |
| 370 | 3300031731 | Ga0307405_10433949 | Ga0307405_104339493 | 57 |
| 371 | 3300031731 | Ga0307405_11379822 | Ga0307405_113798222 | 57 |
| 372 | 3300031731 | Ga0307405_11987780 | Ga0307405_119877802 | 57 |
| 373 | 3300031824 | Ga0307413_10304826 | Ga0307413_103048261 | 57 |
| 374 | 3300031824 | Ga0307413_11048306 | Ga0307413_110483062 | 57 |
| 375 | 3300031852 | Ga0307410_10016738 | Ga0307410_100167383 | 57 |
| 376 | 3300031852 | Ga0307410_10021687 | Ga0307410_100216873 | 57 |
| 377 | 3300031852 | Ga0307410_10111275 | Ga0307410_101112752 | 57 |
| 378 | 3300031852 | Ga0307410_10127807 | Ga0307410_101278072 | 57 |
| 379 | 3300031852 | Ga0307410_10193983 | Ga0307410_101939833 | 57 |
| 380 | 3300031901 | Ga0307406_10031393 | Ga0307406_100313933 | 57 |
| 381 | 3300031901 | Ga0307406_11304834 | Ga0307406_113048342 | 57 |
| 382 | 3300031901 | Ga0307406_12057372 | Ga0307406_120573722 | 57 |
| 383 | 3300031903 | Ga0307407_10105864 | Ga0307407_101058642 | 57 |
| 384 | 3300031903 | Ga0307407_10254180 | Ga0307407_102541802 | 57 |
| 385 | 3300031903 | Ga0307407_10330289 | Ga0307407_103302892 | 57 |
| 386 | 3300031911 | Ga0307412_10022002 | Ga0307412_100220023 | 57 |
| 387 | 3300031911 | Ga0307412_10041018 | Ga0307412_100410184 | 57 |
| 388 | 3300031911 | Ga0307412_10169511 | Ga0307412_101695113 | 57 |
| 389 | 3300031911 | Ga0307412_10974681 | Ga0307412_109746812 | 57 |
| 390 | 3300031995 | Ga0307409_100047085 | Ga0307409_1000470852 | 57 |
| 391 | 3300031995 | Ga0307409_100055516 | Ga0307409_1000555161 | 57 |
| 392 | 3300031995 | Ga0307409_100273382 | Ga0307409_1002733823 | 57 |
| 393 | 3300031995 | Ga0307409_101517804 | Ga0307409_1015178042 | 57 |
| 394 | 3300031995 | Ga0307409_101531280 | Ga0307409_1015312802 | 57 |
| 395 | 3300032002 | Ga0307416_100014810 | Ga0307416_1000148107 | 57 |
| 396 | 3300032002 | Ga0307416_100060676 | Ga0307416_1000606763 | 57 |
| 397 | 3300032002 | Ga0307416_100205117 | Ga0307416_1002051172 | 57 |
| 398 | 3300032002 | Ga0307416_100670824 | Ga0307416_1006708243 | 57 |
| 399 | 3300032002 | Ga0307416_100707317 | Ga0307416_1007073171 | 57 |
| 400 | 3300032004 | Ga0307414_10033242 | Ga0307414_100332422 | 57 |
| 401 | 3300032004 | Ga0307414_11300883 | Ga0307414_113008831 | 57 |
| 402 | 3300032004 | Ga0307414_11467893 | Ga0307414_114678932 | 57 |
| 403 | 3300032005 | Ga0307411_10001101 | Ga0307411_100011019 | 57 |
| 404 | 3300032005 | Ga0307411_10017670 | Ga0307411_100176703 | 57 |
| 405 | 3300032005 | Ga0307411_10466265 | Ga0307411_104662652 | 57 |
| 406 | 3300032005 | Ga0307411_10642535 | Ga0307411_106425352 | 57 |
| 407 | 3300032126 | Ga0307415_100036128 | Ga0307415_1000361282 | 57 |
| 408 | 3300032126 | Ga0307415_100077367 | Ga0307415_1000773672 | 57 |
| 409 | 3300032126 | Ga0307415_100355808 | Ga0307415_1003558082 | 57 |
| 410 | 3300032126 | Ga0307415_100496136 | Ga0307415_1004961362 | 57 |
| 411 | 3300035089 | Ga0373944_0422555 | Ga0373944_0422555_175_348 | 57 |
| 412 | 3300035115 | Ga0373941_0208531 | Ga0373941_0208531_563_736 | 57 |
| 413 | 3300035115 | Ga0373941_0291262 | Ga0373941_0291262_68_241 | 57 |
| 414 | 3300035170 | Ga0373943_0002387 | Ga0373943_0002387_3634_3807 | 57 |
| 415 | 3300035171 | Ga0373946_0004744 | Ga0373946_0004744_4107_4280 | 57 |
| 416 | 3300035692 | Ga0373935_0042878 | Ga0373935_0042878_389_562 | 57 |
| 417 | 3300035695 | Ga0373927_0052303 | Ga0373927_0052303_2215_2388 | 57 |
| 418 | 3300036401 | Ga0373937_0236204 | Ga0373937_0236204_742_915 | 57 |
| 419 | 3300037068 | Ga0373925_0061658 | Ga0373925_0061658_1955_2128 | 57 |
| 420 | 3300037312 | Ga0395899_0000387 | Ga0395899_0000387_36869_37042 | 57 |
| 421 | 3300037312 | Ga0395899_0001750 | Ga0395899_0001750_3290_3463 | 57 |
| 422 | 3300037312 | Ga0395899_0004293 | Ga0395899_0004293_8991_9164 | 57 |
| 423 | 3300037312 | Ga0395899_0024278 | Ga0395899_0024278_2471_2644 | 57 |
| 424 | 3300037312 | Ga0395899_0047348 | Ga0395899_0047348_2777_2950 | 57 |
| 425 | 3300037312 | Ga0395899_0048289 | Ga0395899_0048289_2009_2182 | 57 |
| 426 | 3300037312 | Ga0395899_0050207 | Ga0395899_0050207_578_751 | 57 |
| 427 | 3300037312 | Ga0395899_0981287 | Ga0395899_0981287_323_496 | 57 |
| 428 | 3300037418 | Ga0395900_0000130 | Ga0395900_0000130_90341_90514 | 57 |
| 429 | 3300037418 | Ga0395900_0006337 | Ga0395900_0006337_8306_8479 | 57 |
| 430 | 3300037418 | Ga0395900_0050595 | Ga0395900_0050595_3640_3813 | 57 |
| 431 | 3300037418 | Ga0395900_0060173 | Ga0395900_0060173_1308_1481 | 57 |
| 432 | 3300037418 | Ga0395900_0070709 | Ga0395900_0070709_155_328 | 57 |
| 433 | 3300037418 | Ga0395900_0111023 | Ga0395900_0111023_20_193 | 57 |
| 434 | 3300037418 | Ga0395900_0161969 | Ga0395900_0161969_1853_2026 | 57 |
| 435 | 3300037418 | Ga0395900_0915297 | Ga0395900_0915297_142_315 | 57 |
| 436 | 3300037418 | Ga0395900_1280988 | Ga0395900_1280988_463_636 | 57 |
| 437 | 3300037466 | Ga0395898_0000274 | Ga0395898_0000274_68545_68718 | 57 |
| 438 | 3300037466 | Ga0395898_0001594 | Ga0395898_0001594_7546_7719 | 57 |
| 439 | 3300037466 | Ga0395898_0004865 | Ga0395898_0004865_1112_1285 | 57 |
| 440 | 3300037466 | Ga0395898_0029190 | Ga0395898_0029190_2334_2507 | 57 |
| 441 | 3300037466 | Ga0395898_0108818 | Ga0395898_0108818_152_325 | 57 |
| 442 | 3300037471 | Ga0395905_0000287 | Ga0395905_0000287_58200_58373 | 57 |
| 443 | 3300037471 | Ga0395905_0001408 | Ga0395905_0001408_3633_3806 | 57 |
| 444 | 3300037471 | Ga0395905_0008347 | Ga0395905_0008347_24_197 | 57 |
| 445 | 3300037471 | Ga0395905_0009393 | Ga0395905_0009393_2437_2610 | 57 |
| 446 | 3300037471 | Ga0395905_0010680 | Ga0395905_0010680_5738_5911 | 57 |
| 447 | 3300037471 | Ga0395905_0019454 | Ga0395905_0019454_5597_5770 | 57 |
| 448 | 3300037471 | Ga0395905_0019534 | Ga0395905_0019534_3980_4153 | 57 |
| 449 | 3300037471 | Ga0395905_0022556 | Ga0395905_0022556_1261_1434 | 57 |
| 450 | 3300037471 | Ga0395905_0041942 | Ga0395905_0041942_3726_3899 | 57 |
| 451 | 3300037471 | Ga0395905_0043388 | Ga0395905_0043388_3506_3679 | 57 |
| 452 | 3300037471 | Ga0395905_0076037 | Ga0395905_0076037_350_523 | 57 |
| 453 | 3300037471 | Ga0395905_0122356 | Ga0395905_0122356_2161_2334 | 57 |
| 454 | 3300037471 | Ga0395905_0140054 | Ga0395905_0140054_2022_2195 | 57 |
| 455 | 3300037471 | Ga0395905_0146626 | Ga0395905_0146626_1363_1536 | 57 |
| 456 | 3300037471 | Ga0395905_0235254 | Ga0395905_0235254_878_1051 | 57 |
| 457 | 3300037471 | Ga0395905_0306403 | Ga0395905_0306403_1236_1409 | 57 |
| 458 | 3300037471 | Ga0395905_0338299 | Ga0395905_0338299_756_929 | 57 |
| 459 | 3300037471 | Ga0395905_0384558 | Ga0395905_0384558_962_1135 | 57 |
| 460 | 3300037471 | Ga0395905_0583012 | Ga0395905_0583012_40_213 | 57 |
| 461 | 3300037471 | Ga0395905_0648975 | Ga0395905_0648975_185_358 | 57 |
| 462 | 3300037471 | Ga0395905_1634907 | Ga0395905_1634907_230_403 | 57 |
| 463 | 3300038443 | Ga0395901_0018835 | Ga0395901_0018835_6729_6902 | 57 |
| 464 | 3300038443 | Ga0395901_0028662 | Ga0395901_0028662_3786_3959 | 57 |
| 465 | 3300038443 | Ga0395901_0059419 | Ga0395901_0059419_3780_3953 | 57 |
| 466 | 3300038443 | Ga0395901_0110482 | Ga0395901_0110482_32_205 | 57 |
| 467 | 3300038443 | Ga0395901_0120095 | Ga0395901_0120095_1189_1362 | 57 |
| 468 | 3300038443 | Ga0395901_0130566 | Ga0395901_0130566_160_333 | 57 |
| 469 | 3300038443 | Ga0395901_0150193 | Ga0395901_0150193_303_476 | 57 |
| 470 | 3300038443 | Ga0395901_0156682 | Ga0395901_0156682_613_786 | 57 |
| 471 | 3300038443 | Ga0395901_0512005 | Ga0395901_0512005_985_1158 | 57 |
| 472 | 3300038443 | Ga0395901_0686819 | Ga0395901_0686819_351_524 | 57 |
| 473 | 3300038443 | Ga0395901_0729428 | Ga0395901_0729428_467_640 | 57 |
| 474 | 3300038443 | Ga0395901_0751606 | Ga0395901_0751606_643_816 | 57 |
| 475 | 3300041413 | Ga0439465_0058319 | Ga0439465_0058319_587_760 | 57 |
| 476 | 3300042005 | Ga0439448_0004596 | Ga0439448_0004596_3028_3201 | 57 |
| 477 | 3300042006 | Ga0439432_222939 | Ga0439432_222939_250_423 | 57 |
| 478 | 3300042007 | Ga0439449_0235685 | Ga0439449_0235685_17_190 | 57 |
| 479 | 3300042012 | Ga0439455_0120683 | Ga0439455_0120683_231_404 | 57 |
| 480 | 3300042118 | Ga0450914_000440 | Ga0450914_000440_111_284 | 57 |
| 481 | 3300042127 | Ga0450890_005968 | Ga0450890_005968_504_677 | 57 |
| 482 | 3300042142 | Ga0450905_001095 | Ga0450905_001095_2367_2540 | 57 |
| 483 | 3300042144 | Ga0450889_000275 | Ga0450889_000275_2298_2471 | 57 |
| 484 | 3300042157 | Ga0439458_0000405 | Ga0439458_0000405_4615_4788 | 57 |
| 485 | 3300042157 | Ga0439458_0054816 | Ga0439458_0054816_382_555 | 57 |
| 486 | 3300042157 | Ga0439458_0071267 | Ga0439458_0071267_44_217 | 57 |
| 487 | 3300042438 | Ga0439459_0130688 | Ga0439459_0130688_382_555 | 57 |
| 488 | 3300044684 | Ga0466966_0841087 | Ga0466966_0841087_341_514 | 57 |
| 489 | 3300044706 | Ga0466964_0602646 | Ga0466964_0602646_408_581 | 57 |
| 490 | 3300044765 | Ga0466970_0765966 | Ga0466970_0765966_283_456 | 57 |
| 491 | 3300046459 | Ga0495629_0710345 | Ga0495629_0710345_383_556 | 57 |
| 492 | 3300046681 | Ga0495647_0044685 | Ga0495647_0044685_1088_1261 | 57 |
| 493 | 3300048903 | Ga0496100_0056386 | Ga0496100_0056386_464_637 | 57 |
| 494 | 3300048904 | Ga0496101_0018340 | Ga0496101_0018340_3604_3777 | 57 |
| 495 | 3300048904 | Ga0496101_0842522 | Ga0496101_0842522_298_471 | 57 |
| 496 | 3300048905 | Ga0496102_0671464 | Ga0496102_0671464_553_726 | 57 |
| 497 | 3300048906 | Ga0496103_0152161 | Ga0496103_0152161_274_447 | 57 |
| 498 | 3300048909 | Ga0496106_0292314 | Ga0496106_0292314_550_723 | 57 |
| 499 | 3300048909 | Ga0496106_0427041 | Ga0496106_0427041_558_731 | 57 |
| 500 | 3300048910 | Ga0496107_0124754 | Ga0496107_0124754_1262_1435 | 57 |
| 501 | 3300048910 | Ga0496107_0875417 | Ga0496107_0875417_246_419 | 57 |
| 502 | 3300048911 | Ga0496108_0114552 | Ga0496108_0114552_1687_1860 | 57 |
| 503 | 3300048912 | Ga0496109_0010711 | Ga0496109_0010711_6436_6609 | 57 |
| 504 | 3300048913 | Ga0496110_0033088 | Ga0496110_0033088_3225_3398 | 57 |
| 505 | 3300048915 | Ga0496112_0021480 | Ga0496112_0021480_1881_2054 | 57 |
| 506 | 3300048915 | Ga0496112_0072589 | Ga0496112_0072589_1659_1832 | 57 |
| 507 | 3300048916 | Ga0496113_0159089 | Ga0496113_0159089_1164_1337 | 57 |
| 508 | 3300048916 | Ga0496113_0207635 | Ga0496113_0207635_1342_1515 | 57 |
| 509 | 3300048917 | Ga0496114_0063559 | Ga0496114_0063559_1190_1363 | 57 |
| 510 | 3300048918 | Ga0496115_0058860 | Ga0496115_0058860_2622_2795 | 57 |
| 511 | 3300049652 | Ga0501202_038346 | Ga0501202_038346_145_318 | 57 |
| 512 | 3300049659 | Ga0501214_020059 | Ga0501214_020059_649_822 | 57 |
| 513 | 3300049664 | Ga0501224_014860 | Ga0501224_014860_932_1105 | 57 |
| 514 | 3300049667 | Ga0501230_079417 | Ga0501230_079417_36_209 | 57 |
| 515 | 3300049679 | Ga0501249_077708 | Ga0501249_077708_565_738 | 57 |
| 516 | 3300049682 | Ga0501252_033881 | Ga0501252_033881_281_454 | 57 |
| 517 | 3300049704 | Ga0501221_025277 | Ga0501221_025277_687_860 | 57 |
| 518 | 3300049705 | Ga0501225_0159470 | Ga0501225_0159470_125_298 | 57 |
| 519 | 3300049706 | Ga0501229_022774 | Ga0501229_022774_509_682 | 57 |
| 520 | 3300049759 | Ga0501262_011795 | Ga0501262_011795_704_877 | 57 |
| 521 | 3300049765 | Ga0501268_004007 | Ga0501268_004007_1776_1949 | 57 |
| 522 | 3300049767 | Ga0501270_044554 | Ga0501270_044554_139_312 | 57 |
| 523 | 3300049769 | Ga0501272_018225 | Ga0501272_018225_180_353 | 57 |
| 524 | 3300049770 | Ga0501273_042440 | Ga0501273_042440_327_500 | 57 |
| 525 | 3300050507 | nmdc:mga05p37_1150221_c1 | nmdc:mga05p37_1150221_c1_39_212 | 57 |
| 526 | 3300050511 | nmdc:mga08y16_224427_c1 | nmdc:mga08y16_224427_c1_1192_1365 | 57 |
| 527 | 3300001915 | JGI24741J21665_1035010 | JGI24741J21665_10350102 | 58 |
| 528 | 3300001979 | JGI24740J21852_10084697 | JGI24740J21852_100846972 | 58 |
| 529 | 3300001990 | JGI24737J22298_10036820 | JGI24737J22298_100368202 | 58 |
| 530 | 3300005327 | Ga0070658_10269566 | Ga0070658_102695662 | 58 |
| 531 | 3300005329 | Ga0070683_100101421 | Ga0070683_1001014212 | 58 |
| 532 | 3300005336 | Ga0070680_100452584 | Ga0070680_1004525842 | 58 |
| 533 | 3300005337 | Ga0070682_100346490 | Ga0070682_1003464902 | 58 |
| 534 | 3300005338 | Ga0068868_100294037 | Ga0068868_1002940372 | 58 |
| 535 | 3300005339 | Ga0070660_101069563 | Ga0070660_1010695632 | 58 |
| 536 | 3300005355 | Ga0070671_100767129 | Ga0070671_1007671291 | 58 |
| 537 | 3300005366 | Ga0070659_100187115 | Ga0070659_1001871154 | 58 |
| 538 | 3300005366 | Ga0070659_100304191 | Ga0070659_1003041912 | 58 |
| 539 | 3300005435 | Ga0070714_100447321 | Ga0070714_1004473212 | 58 |
| 540 | 3300005455 | Ga0070663_100525254 | Ga0070663_1005252542 | 58 |
| 541 | 3300005457 | Ga0070662_100359167 | Ga0070662_1003591671 | 58 |
| 542 | 3300005530 | Ga0070679_100241495 | Ga0070679_1002414953 | 58 |
| 543 | 3300005535 | Ga0070684_100074316 | Ga0070684_1000743164 | 58 |
| 544 | 3300005539 | Ga0068853_100177096 | Ga0068853_1001770963 | 58 |
| 545 | 3300005563 | Ga0068855_100469504 | Ga0068855_1004695042 | 58 |
| 546 | 3300005563 | Ga0068855_100653960 | Ga0068855_1006539602 | 58 |
| 547 | 3300005564 | Ga0070664_100202083 | Ga0070664_1002020832 | 58 |
| 548 | 3300005564 | Ga0070664_101818241 | Ga0070664_1018182412 | 58 |
| 549 | 3300005577 | Ga0068857_100139426 | Ga0068857_1001394264 | 58 |
| 550 | 3300005578 | Ga0068854_100039387 | Ga0068854_1000393873 | 58 |
| 551 | 3300005614 | Ga0068856_100373702 | Ga0068856_1003737022 | 58 |
| 552 | 3300005616 | Ga0068852_100300469 | Ga0068852_1003004691 | 58 |
| 553 | 3300005618 | Ga0068864_100006944 | Ga0068864_1000069445 | 58 |
| 554 | 3300009093 | Ga0105240_11103936 | Ga0105240_111039362 | 58 |
| 555 | 3300009174 | Ga0105241_12261586 | Ga0105241_122615861 | 58 |
| 556 | 3300009177 | Ga0105248_10084821 | Ga0105248_100848212 | 58 |
| 557 | 3300009551 | Ga0105238_10329376 | Ga0105238_103293763 | 58 |
| 558 | 3300013100 | Ga0157373_10055148 | Ga0157373_100551482 | 58 |
| 559 | 3300013102 | Ga0157371_11061688 | Ga0157371_110616882 | 58 |
| 560 | 3300013102 | Ga0157371_11140433 | Ga0157371_111404331 | 58 |
| 561 | 3300013104 | Ga0157370_10182775 | Ga0157370_101827752 | 58 |
| 562 | 3300013105 | Ga0157369_11517645 | Ga0157369_115176452 | 58 |
| 563 | 3300020070 | Ga0206356_10946257 | Ga0206356_109462572 | 58 |
| 564 | 3300025904 | Ga0207647_10048856 | Ga0207647_100488564 | 58 |
| 565 | 3300025911 | Ga0207654_11165591 | Ga0207654_111655912 | 58 |
| 566 | 3300025917 | Ga0207660_10516928 | Ga0207660_105169282 | 58 |
| 567 | 3300025919 | Ga0207657_10023947 | Ga0207657_100239472 | 58 |
| 568 | 3300025920 | Ga0207649_10165897 | Ga0207649_101658972 | 58 |
| 569 | 3300025921 | Ga0207652_10324428 | Ga0207652_103244283 | 58 |
| 570 | 3300025929 | Ga0207664_10868960 | Ga0207664_108689602 | 58 |
| 571 | 3300025932 | Ga0207690_10068654 | Ga0207690_100686542 | 58 |
| 572 | 3300025933 | Ga0207706_10042422 | Ga0207706_100424224 | 58 |
| 573 | 3300025941 | Ga0207711_10047172 | Ga0207711_100471722 | 58 |
| 574 | 3300025944 | Ga0207661_10092895 | Ga0207661_100928952 | 58 |
| 575 | 3300025945 | Ga0207679_10521531 | Ga0207679_105215312 | 58 |
| 576 | 3300025949 | Ga0207667_10486653 | Ga0207667_104866531 | 58 |
| 577 | 3300025949 | Ga0207667_10592858 | Ga0207667_105928582 | 58 |
| 578 | 3300025981 | Ga0207640_10057088 | Ga0207640_100570884 | 58 |
| 579 | 3300026041 | Ga0207639_10084907 | Ga0207639_100849071 | 58 |
| 580 | 3300026067 | Ga0207678_10325503 | Ga0207678_103255032 | 58 |
| 581 | 3300026078 | Ga0207702_10061009 | Ga0207702_100610094 | 58 |
| 582 | 3300026088 | Ga0207641_10111213 | Ga0207641_101112134 | 58 |
| 583 | 3300026095 | Ga0207676_10019201 | Ga0207676_100192013 | 58 |
| 584 | 3300026116 | Ga0207674_10005522 | Ga0207674_1000552216 | 58 |
| 585 | 3300026142 | Ga0207698_10010929 | Ga0207698_100109294 | 58 |
| 586 | 3300037471 | Ga0395905_0883429 | Ga0395905_0883429_451_627 | 58 |
| 587 | 3300047445 | Ga0495677_0073261 | Ga0495677_0073261_387_563 | 58 |
| 588 | 3300047447 | Ga0495685_258333 | Ga0495685_258333_213_389 | 58 |
| 589 | 3300048907 | Ga0496104_0344529 | Ga0496104_0344529_42_218 | 58 |
| 590 | 3300048909 | Ga0496106_0683911 | Ga0496106_0683911_269_445 | 58 |
| 591 | 3300048910 | Ga0496107_0098795 | Ga0496107_0098795_300_476 | 58 |
| 592 | 3300048911 | Ga0496108_0043524 | Ga0496108_0043524_2416_2592 | 58 |
| 593 | 3300048912 | Ga0496109_0026042 | Ga0496109_0026042_1862_2038 | 58 |
| 594 | 3300048913 | Ga0496110_1857347 | Ga0496110_1857347_251_427 | 58 |
| 595 | 3300048914 | Ga0496111_0121862 | Ga0496111_0121862_1152_1328 | 58 |
| 596 | 3300048915 | Ga0496112_0064275 | Ga0496112_0064275_1575_1751 | 58 |
| 597 | 3300048916 | Ga0496113_0113283 | Ga0496113_0113283_1495_1671 | 58 |
| 598 | 3300001904 | JGI24736J21556_1031894 | JGI24736J21556_10318942 | 59 |
| 599 | 3300001915 | JGI24741J21665_1067737 | JGI24741J21665_10677371 | 59 |
| 600 | 3300001979 | JGI24740J21852_10011555 | JGI24740J21852_100115555 | 59 |
| 601 | 3300001979 | JGI24740J21852_10074816 | JGI24740J21852_100748162 | 59 |
| 602 | 3300001989 | JGI24739J22299_10007851 | JGI24739J22299_100078513 | 59 |
| 603 | 3300001990 | JGI24737J22298_10000832 | JGI24737J22298_100008328 | 59 |
| 604 | 3300002067 | JGI24735J21928_10004365 | JGI24735J21928_100043656 | 59 |
| 605 | 3300002075 | JGI24738J21930_10001094 | JGI24738J21930_100010942 | 59 |
| 606 | 3300002239 | JGI24034J26672_10083741 | JGI24034J26672_100837411 | 59 |
| 607 | 3300005327 | Ga0070658_10000453 | Ga0070658_1000045316 | 59 |
| 608 | 3300005327 | Ga0070658_10021750 | Ga0070658_100217505 | 59 |
| 609 | 3300005327 | Ga0070658_10279940 | Ga0070658_102799403 | 59 |
| 610 | 3300005327 | Ga0070658_10316630 | Ga0070658_103166302 | 59 |
| 611 | 3300005327 | Ga0070658_10325594 | Ga0070658_103255941 | 59 |
| 612 | 3300005329 | Ga0070683_100019423 | Ga0070683_1000194236 | 59 |
| 613 | 3300005329 | Ga0070683_100895421 | Ga0070683_1008954212 | 59 |
| 614 | 3300005329 | Ga0070683_100931072 | Ga0070683_1009310722 | 59 |
| 615 | 3300005330 | Ga0070690_100486886 | Ga0070690_1004868862 | 59 |
| 616 | 3300005331 | Ga0070670_101668958 | Ga0070670_1016689582 | 59 |
| 617 | 3300005335 | Ga0070666_10001156 | Ga0070666_1000115612 | 59 |
| 618 | 3300005336 | Ga0070680_100126344 | Ga0070680_1001263443 | 59 |
| 619 | 3300005336 | Ga0070680_100551589 | Ga0070680_1005515892 | 59 |
| 620 | 3300005336 | Ga0070680_100660329 | Ga0070680_1006603291 | 59 |
| 621 | 3300005336 | Ga0070680_100941569 | Ga0070680_1009415692 | 59 |
| 622 | 3300005336 | Ga0070680_101389410 | Ga0070680_1013894102 | 59 |
| 623 | 3300005337 | Ga0070682_100036603 | Ga0070682_1000366033 | 59 |
| 624 | 3300005339 | Ga0070660_100000488 | Ga0070660_10000048821 | 59 |
| 625 | 3300005339 | Ga0070660_100072300 | Ga0070660_1000723002 | 59 |
| 626 | 3300005339 | Ga0070660_100164935 | Ga0070660_1001649352 | 59 |
| 627 | 3300005339 | Ga0070660_100232619 | Ga0070660_1002326193 | 59 |
| 628 | 3300005341 | Ga0070691_11072063 | Ga0070691_110720631 | 59 |
| 629 | 3300005344 | Ga0070661_100000311 | Ga0070661_10000031121 | 59 |
| 630 | 3300005344 | Ga0070661_100009119 | Ga0070661_1000091194 | 59 |
| 631 | 3300005344 | Ga0070661_100386994 | Ga0070661_1003869942 | 59 |
| 632 | 3300005344 | Ga0070661_101213872 | Ga0070661_1012138722 | 59 |
| 633 | 3300005345 | Ga0070692_10141619 | Ga0070692_101416193 | 59 |
| 634 | 3300005345 | Ga0070692_11139777 | Ga0070692_111397771 | 59 |
| 635 | 3300005355 | Ga0070671_100013021 | Ga0070671_1000130214 | 59 |
| 636 | 3300005364 | Ga0070673_102233371 | Ga0070673_1022333712 | 59 |
| 637 | 3300005366 | Ga0070659_100000594 | Ga0070659_10000059410 | 59 |
| 638 | 3300005366 | Ga0070659_100021739 | Ga0070659_1000217392 | 59 |
| 639 | 3300005366 | Ga0070659_100059160 | Ga0070659_1000591604 | 59 |
| 640 | 3300005366 | Ga0070659_100369752 | Ga0070659_1003697522 | 59 |
| 641 | 3300005367 | Ga0070667_100006873 | Ga0070667_1000068731 | 59 |
| 642 | 3300005435 | Ga0070714_100383278 | Ga0070714_1003832782 | 59 |
| 643 | 3300005455 | Ga0070663_100003876 | Ga0070663_1000038762 | 59 |
| 644 | 3300005455 | Ga0070663_100759149 | Ga0070663_1007591492 | 59 |
| 645 | 3300005457 | Ga0070662_100000198 | Ga0070662_10000019821 | 59 |
| 646 | 3300005457 | Ga0070662_100611683 | Ga0070662_1006116831 | 59 |
| 647 | 3300005458 | Ga0070681_10308950 | Ga0070681_103089503 | 59 |
| 648 | 3300005458 | Ga0070681_10689912 | Ga0070681_106899122 | 59 |
| 649 | 3300005530 | Ga0070679_101153839 | Ga0070679_1011538392 | 59 |
| 650 | 3300005530 | Ga0070679_101458392 | Ga0070679_1014583922 | 59 |
| 651 | 3300005535 | Ga0070684_100519069 | Ga0070684_1005190692 | 59 |
| 652 | 3300005539 | Ga0068853_100000154 | Ga0068853_1000001542 | 59 |
| 653 | 3300005539 | Ga0068853_100000655 | Ga0068853_1000006557 | 59 |
| 654 | 3300005539 | Ga0068853_100078309 | Ga0068853_1000783093 | 59 |
| 655 | 3300005544 | Ga0070686_100296780 | Ga0070686_1002967802 | 59 |
| 656 | 3300005547 | Ga0070693_100000578 | Ga0070693_10000057814 | 59 |
| 657 | 3300005548 | Ga0070665_100147557 | Ga0070665_1001475572 | 59 |
| 658 | 3300005563 | Ga0068855_100003204 | Ga0068855_10000320410 | 59 |
| 659 | 3300005563 | Ga0068855_100040366 | Ga0068855_1000403664 | 59 |
| 660 | 3300005563 | Ga0068855_100079821 | Ga0068855_1000798215 | 59 |
| 661 | 3300005563 | Ga0068855_100284249 | Ga0068855_1002842492 | 59 |
| 662 | 3300005563 | Ga0068855_101321209 | Ga0068855_1013212092 | 59 |
| 663 | 3300005564 | Ga0070664_100000259 | Ga0070664_10000025922 | 59 |
| 664 | 3300005564 | Ga0070664_100675247 | Ga0070664_1006752472 | 59 |
| 665 | 3300005564 | Ga0070664_102043169 | Ga0070664_1020431692 | 59 |
| 666 | 3300005577 | Ga0068857_100031303 | Ga0068857_1000313035 | 59 |
| 667 | 3300005577 | Ga0068857_101976446 | Ga0068857_1019764462 | 59 |
| 668 | 3300005578 | Ga0068854_100008271 | Ga0068854_1000082718 | 59 |
| 669 | 3300005578 | Ga0068854_100169923 | Ga0068854_1001699232 | 59 |
| 670 | 3300005578 | Ga0068854_100272825 | Ga0068854_1002728252 | 59 |
| 671 | 3300005614 | Ga0068856_100000315 | Ga0068856_10000031517 | 59 |
| 672 | 3300005614 | Ga0068856_100513395 | Ga0068856_1005133952 | 59 |
| 673 | 3300005614 | Ga0068856_100548682 | Ga0068856_1005486822 | 59 |
| 674 | 3300005614 | Ga0068856_101983622 | Ga0068856_1019836222 | 59 |
| 675 | 3300005616 | Ga0068852_100000548 | Ga0068852_1000005488 | 59 |
| 676 | 3300005616 | Ga0068852_100003431 | Ga0068852_1000034316 | 59 |
| 677 | 3300005616 | Ga0068852_100005054 | Ga0068852_1000050546 | 59 |
| 678 | 3300005616 | Ga0068852_100021395 | Ga0068852_1000213953 | 59 |
| 679 | 3300005616 | Ga0068852_102630340 | Ga0068852_1026303402 | 59 |
| 680 | 3300005617 | Ga0068859_100554978 | Ga0068859_1005549782 | 59 |
| 681 | 3300005618 | Ga0068864_100372834 | Ga0068864_1003728343 | 59 |
| 682 | 3300005834 | Ga0068851_10043922 | Ga0068851_100439223 | 59 |
| 683 | 3300005834 | Ga0068851_10375388 | Ga0068851_103753881 | 59 |
| 684 | 3300005842 | Ga0068858_100145934 | Ga0068858_1001459343 | 59 |
| 685 | 3300006237 | Ga0097621_100160527 | Ga0097621_1001605273 | 59 |
| 686 | 3300006931 | Ga0097620_100554989 | Ga0097620_1005549892 | 59 |
| 687 | 3300009093 | Ga0105240_10045821 | Ga0105240_100458214 | 59 |
| 688 | 3300009101 | Ga0105247_10637957 | Ga0105247_106379572 | 59 |
| 689 | 3300009174 | Ga0105241_10115466 | Ga0105241_101154664 | 59 |
| 690 | 3300009174 | Ga0105241_10486671 | Ga0105241_104866712 | 59 |
| 691 | 3300009177 | Ga0105248_10000395 | Ga0105248_1000039516 | 59 |
| 692 | 3300009545 | Ga0105237_11218392 | Ga0105237_112183922 | 59 |
| 693 | 3300009551 | Ga0105238_10025019 | Ga0105238_100250193 | 59 |
| 694 | 3300013100 | Ga0157373_10019290 | Ga0157373_100192906 | 59 |
| 695 | 3300013100 | Ga0157373_10205018 | Ga0157373_102050182 | 59 |
| 696 | 3300013100 | Ga0157373_10242214 | Ga0157373_102422142 | 59 |
| 697 | 3300013100 | Ga0157373_10993881 | Ga0157373_109938811 | 59 |
| 698 | 3300013102 | Ga0157371_10179963 | Ga0157371_101799634 | 59 |
| 699 | 3300013102 | Ga0157371_10195429 | Ga0157371_101954292 | 59 |
| 700 | 3300013102 | Ga0157371_10317038 | Ga0157371_103170383 | 59 |
| 701 | 3300013102 | Ga0157371_10878755 | Ga0157371_108787552 | 59 |
| 702 | 3300013102 | Ga0157371_11108085 | Ga0157371_111080852 | 59 |
| 703 | 3300013104 | Ga0157370_10036438 | Ga0157370_100364384 | 59 |
| 704 | 3300013104 | Ga0157370_10292334 | Ga0157370_102923342 | 59 |
| 705 | 3300013104 | Ga0157370_10476072 | Ga0157370_104760721 | 59 |
| 706 | 3300013104 | Ga0157370_10629320 | Ga0157370_106293202 | 59 |
| 707 | 3300013104 | Ga0157370_10770082 | Ga0157370_107700822 | 59 |
| 708 | 3300013105 | Ga0157369_10005829 | Ga0157369_100058293 | 59 |
| 709 | 3300013105 | Ga0157369_10050842 | Ga0157369_100508423 | 59 |
| 710 | 3300013105 | Ga0157369_10268072 | Ga0157369_102680722 | 59 |
| 711 | 3300013105 | Ga0157369_10405068 | Ga0157369_104050683 | 59 |
| 712 | 3300013105 | Ga0157369_12481169 | Ga0157369_124811692 | 59 |
| 713 | 3300013296 | Ga0157374_10077668 | Ga0157374_100776684 | 59 |
| 714 | 3300013307 | Ga0157372_10011276 | Ga0157372_100112769 | 59 |
| 715 | 3300013307 | Ga0157372_10663215 | Ga0157372_106632153 | 59 |
| 716 | 3300013307 | Ga0157372_10865199 | Ga0157372_108651992 | 59 |
| 717 | 3300013307 | Ga0157372_12539293 | Ga0157372_125392932 | 59 |
| 718 | 3300014325 | Ga0163163_10001203 | Ga0163163_100012035 | 59 |
| 719 | 3300014968 | Ga0157379_10208696 | Ga0157379_102086962 | 59 |
| 720 | 3300014969 | Ga0157376_11302703 | Ga0157376_113027032 | 59 |
| 721 | 3300020081 | Ga0206354_10972652 | Ga0206354_109726522 | 59 |
| 722 | 3300020082 | Ga0206353_10319710 | Ga0206353_103197102 | 59 |
| 723 | 3300020082 | Ga0206353_11687510 | Ga0206353_116875102 | 59 |
| 724 | 3300025321 | Ga0207656_10532257 | Ga0207656_105322571 | 59 |
| 725 | 3300025321 | Ga0207656_10668172 | Ga0207656_106681722 | 59 |
| 726 | 3300025903 | Ga0207680_10000267 | Ga0207680_1000026711 | 59 |
| 727 | 3300025904 | Ga0207647_10006403 | Ga0207647_100064039 | 59 |
| 728 | 3300025904 | Ga0207647_10045794 | Ga0207647_100457943 | 59 |
| 729 | 3300025904 | Ga0207647_10381492 | Ga0207647_103814921 | 59 |
| 730 | 3300025909 | Ga0207705_10000449 | Ga0207705_1000044922 | 59 |
| 731 | 3300025909 | Ga0207705_10033148 | Ga0207705_100331486 | 59 |
| 732 | 3300025909 | Ga0207705_10117988 | Ga0207705_101179881 | 59 |
| 733 | 3300025909 | Ga0207705_11017606 | Ga0207705_110176062 | 59 |
| 734 | 3300025909 | Ga0207705_11224692 | Ga0207705_112246922 | 59 |
| 735 | 3300025911 | Ga0207654_10065206 | Ga0207654_100652062 | 59 |
| 736 | 3300025912 | Ga0207707_10949402 | Ga0207707_109494022 | 59 |
| 737 | 3300025913 | Ga0207695_10078613 | Ga0207695_100786133 | 59 |
| 738 | 3300025914 | Ga0207671_10103235 | Ga0207671_101032353 | 59 |
| 739 | 3300025917 | Ga0207660_11224645 | Ga0207660_112246452 | 59 |
| 740 | 3300025919 | Ga0207657_10001304 | Ga0207657_1000130410 | 59 |
| 741 | 3300025919 | Ga0207657_10039954 | Ga0207657_100399543 | 59 |
| 742 | 3300025919 | Ga0207657_10162031 | Ga0207657_101620315 | 59 |
| 743 | 3300025919 | Ga0207657_10185328 | Ga0207657_101853283 | 59 |
| 744 | 3300025919 | Ga0207657_10300715 | Ga0207657_103007152 | 59 |
| 745 | 3300025919 | Ga0207657_10852948 | Ga0207657_108529482 | 59 |
| 746 | 3300025920 | Ga0207649_10000942 | Ga0207649_1000094211 | 59 |
| 747 | 3300025920 | Ga0207649_10047985 | Ga0207649_100479854 | 59 |
| 748 | 3300025920 | Ga0207649_10390110 | Ga0207649_103901102 | 59 |
| 749 | 3300025920 | Ga0207649_10581622 | Ga0207649_105816221 | 59 |
| 750 | 3300025920 | Ga0207649_11412181 | Ga0207649_114121812 | 59 |
| 751 | 3300025924 | Ga0207694_10002320 | Ga0207694_100023202 | 59 |
| 752 | 3300025924 | Ga0207694_10089196 | Ga0207694_100891963 | 59 |
| 753 | 3300025925 | Ga0207650_11328403 | Ga0207650_113284032 | 59 |
| 754 | 3300025931 | Ga0207644_10005695 | Ga0207644_100056955 | 59 |
| 755 | 3300025932 | Ga0207690_10000257 | Ga0207690_1000025731 | 59 |
| 756 | 3300025932 | Ga0207690_10013935 | Ga0207690_100139353 | 59 |
| 757 | 3300025932 | Ga0207690_10269552 | Ga0207690_102695522 | 59 |
| 758 | 3300025932 | Ga0207690_10545639 | Ga0207690_105456392 | 59 |
| 759 | 3300025933 | Ga0207706_10001176 | Ga0207706_1000117621 | 59 |
| 760 | 3300025933 | Ga0207706_11140165 | Ga0207706_111401652 | 59 |
| 761 | 3300025941 | Ga0207711_10000427 | Ga0207711_1000042717 | 59 |
| 762 | 3300025944 | Ga0207661_10000918 | Ga0207661_1000091812 | 59 |
| 763 | 3300025944 | Ga0207661_10174405 | Ga0207661_101744052 | 59 |
| 764 | 3300025944 | Ga0207661_11115504 | Ga0207661_111155041 | 59 |
| 765 | 3300025945 | Ga0207679_10000463 | Ga0207679_100004634 | 59 |
| 766 | 3300025945 | Ga0207679_10933021 | Ga0207679_109330212 | 59 |
| 767 | 3300025945 | Ga0207679_11128305 | Ga0207679_111283052 | 59 |
| 768 | 3300025949 | Ga0207667_10005298 | Ga0207667_100052988 | 59 |
| 769 | 3300025949 | Ga0207667_10031169 | Ga0207667_100311697 | 59 |
| 770 | 3300025949 | Ga0207667_10117241 | Ga0207667_101172412 | 59 |
| 771 | 3300025949 | Ga0207667_11053064 | Ga0207667_110530642 | 59 |
| 772 | 3300025949 | Ga0207667_11446050 | Ga0207667_114460502 | 59 |
| 773 | 3300025981 | Ga0207640_10109823 | Ga0207640_101098232 | 59 |
| 774 | 3300025981 | Ga0207640_10175751 | Ga0207640_101757512 | 59 |
| 775 | 3300025981 | Ga0207640_12180355 | Ga0207640_121803551 | 59 |
| 776 | 3300025986 | Ga0207658_10142548 | Ga0207658_101425481 | 59 |
| 777 | 3300026035 | Ga0207703_10056018 | Ga0207703_100560182 | 59 |
| 778 | 3300026041 | Ga0207639_10000899 | Ga0207639_100008998 | 59 |
| 779 | 3300026041 | Ga0207639_10304903 | Ga0207639_103049031 | 59 |
| 780 | 3300026041 | Ga0207639_10401038 | Ga0207639_104010382 | 59 |
| 781 | 3300026067 | Ga0207678_10009100 | Ga0207678_1000910010 | 59 |
| 782 | 3300026067 | Ga0207678_10073610 | Ga0207678_100736103 | 59 |
| 783 | 3300026078 | Ga0207702_10002140 | Ga0207702_100021405 | 59 |
| 784 | 3300026078 | Ga0207702_10348925 | Ga0207702_103489252 | 59 |
| 785 | 3300026078 | Ga0207702_10520496 | Ga0207702_105204962 | 59 |
| 786 | 3300026095 | Ga0207676_10012479 | Ga0207676_100124797 | 59 |
| 787 | 3300026116 | Ga0207674_10296822 | Ga0207674_102968224 | 59 |
| 788 | 3300026116 | Ga0207674_11201913 | Ga0207674_112019132 | 59 |
| 789 | 3300026116 | Ga0207674_11375886 | Ga0207674_113758861 | 59 |
| 790 | 3300026142 | Ga0207698_10000435 | Ga0207698_1000043518 | 59 |
| 791 | 3300026142 | Ga0207698_10000560 | Ga0207698_1000056017 | 59 |
| 792 | 3300026142 | Ga0207698_10004591 | Ga0207698_100045918 | 59 |
| 793 | 3300026142 | Ga0207698_10004812 | Ga0207698_100048125 | 59 |
| 794 | 3300028379 | Ga0268266_10083621 | Ga0268266_100836213 | 59 |
| 795 | 3300034816 | Ga0373930_0163397 | Ga0373930_0163397_358_537 | 59 |
| 796 | 3300034818 | Ga0373950_0032043 | Ga0373950_0032043_577_756 | 59 |
| 797 | 3300035114 | Ga0373939_0086535 | Ga0373939_0086535_624_803 | 59 |
| 798 | 3300035115 | Ga0373941_0015662 | Ga0373941_0015662_66_245 | 59 |
| 799 | 3300035241 | Ga0373961_0008248 | Ga0373961_0008248_1989_2168 | 59 |
| 800 | 3300035242 | Ga0373962_0289297 | Ga0373962_0289297_241_420 | 59 |
| 801 | 3300035691 | Ga0373931_0116666 | Ga0373931_0116666_463_642 | 59 |
| 802 | 3300037312 | Ga0395899_0011077 | Ga0395899_0011077_1775_1954 | 59 |
| 803 | 3300037312 | Ga0395899_0098320 | Ga0395899_0098320_1219_1398 | 59 |
| 804 | 3300037312 | Ga0395899_0165787 | Ga0395899_0165787_229_408 | 59 |
| 805 | 3300037312 | Ga0395899_0593732 | Ga0395899_0593732_225_404 | 59 |
| 806 | 3300037418 | Ga0395900_0019755 | Ga0395900_0019755_1943_2122 | 59 |
| 807 | 3300037418 | Ga0395900_0064510 | Ga0395900_0064510_1691_1870 | 59 |
| 808 | 3300037418 | Ga0395900_0182805 | Ga0395900_0182805_1388_1567 | 59 |
| 809 | 3300037418 | Ga0395900_0314084 | Ga0395900_0314084_472_651 | 59 |
| 810 | 3300037418 | Ga0395900_1112744 | Ga0395900_1112744_267_446 | 59 |
| 811 | 3300037466 | Ga0395898_0042473 | Ga0395898_0042473_2153_2332 | 59 |
| 812 | 3300037466 | Ga0395898_0053112 | Ga0395898_0053112_3343_3522 | 59 |
| 813 | 3300037466 | Ga0395898_0270220 | Ga0395898_0270220_798_977 | 59 |
| 814 | 3300037471 | Ga0395905_0051282 | Ga0395905_0051282_3423_3602 | 59 |
| 815 | 3300037471 | Ga0395905_0324861 | Ga0395905_0324861_770_949 | 59 |
| 816 | 3300037471 | Ga0395905_0412885 | Ga0395905_0412885_218_397 | 59 |
| 817 | 3300037471 | Ga0395905_0646301 | Ga0395905_0646301_302_481 | 59 |
| 818 | 3300037471 | Ga0395905_0995427 | Ga0395905_0995427_262_441 | 59 |
| 819 | 3300038443 | Ga0395901_0014759 | Ga0395901_0014759_2332_2511 | 59 |
| 820 | 3300038443 | Ga0395901_0142529 | Ga0395901_0142529_575_754 | 59 |
| 821 | 3300038443 | Ga0395901_0442414 | Ga0395901_0442414_136_315 | 59 |
| 822 | 3300038443 | Ga0395901_1577988 | Ga0395901_1577988_193_372 | 59 |
| 823 | 3300044694 | Ga0466963_0011272 | Ga0466963_0011272_4840_5019 | 59 |
| 824 | 3300044694 | Ga0466963_0603338 | Ga0466963_0603338_538_717 | 59 |
| 825 | 3300044706 | Ga0466964_0061663 | Ga0466964_0061663_39_218 | 59 |
| 826 | 3300044842 | Ga0466957_0003051 | Ga0466957_0003051_682_861 | 59 |
| 827 | 3300045976 | Ga0466967_0000053 | Ga0466967_0000053_32358_32537 | 59 |
| 828 | 3300045976 | Ga0466967_0117666 | Ga0466967_0117666_1007_1186 | 59 |
| 829 | 3300045976 | Ga0466967_0152078 | Ga0466967_0152078_359_538 | 59 |
| 830 | 3300045976 | Ga0466967_0283260 | Ga0466967_0283260_1374_1553 | 59 |
| 831 | 3300045976 | Ga0466967_0592188 | Ga0466967_0592188_429_608 | 59 |
| 832 | 3300048906 | Ga0496103_0309545 | Ga0496103_0309545_372_551 | 59 |
| 833 | 3300048908 | Ga0496105_1287102 | Ga0496105_1287102_327_506 | 59 |
| 834 | 3300048909 | Ga0496106_0200985 | Ga0496106_0200985_763_942 | 59 |
| 835 | 3300048910 | Ga0496107_0148922 | Ga0496107_0148922_1273_1452 | 59 |
| 836 | 3300048911 | Ga0496108_1084218 | Ga0496108_1084218_278_457 | 59 |
| 837 | 3300048914 | Ga0496111_0057303 | Ga0496111_0057303_830_1009 | 59 |
| 838 | 3300049571 | Ga0501034_0526388 | Ga0501034_0526388_357_536 | 59 |
| 839 | 3300049580 | Ga0501046_0766886 | Ga0501046_0766886_400_579 | 59 |
| 840 | 3300049584 | Ga0501068_0184571 | Ga0501068_0184571_745_924 | 59 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fay-assembly1.cif.gz_A | y208f mutant of choline tma-lyase | 1 | 5 | 40 |
| 5fau-assembly2.cif.gz_D | wild-type choline tma lyase in complex with choline | 0.9996 | 5 | 40 |
| 5fav-assembly1.cif.gz_B | e491q mutant of choline tma-lyase | 0.998 | 5 | 40 |
| 5faw-assembly1.cif.gz_B | t502a mutant of choline tma-lyase | 0.9975 | 5 | 40 |
| 5kdp-assembly1.cif.gz_A | e491a mutant of choline tma-lyase | 0.9957 | 5 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D9PTP5_274_476_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 1.006 | 4 | 43 | 1.20.1270.60 |
| af_Q9FFY4_132_273_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 1.006 | 3 | 43 | 1.20.1070.10 |
| af_I1K9S1_1_128_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 1.005 | 3 | 43 | 1.25.40.10 |
| af_Q9URX8_818_968_1.25.40.450 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Nucleoporin, helical domain, N-terminal subdomain | 1 | 9 | 43 | 1.25.40.450 |
| af_Q54CX7_116_196_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.9958 | 6 | 43 | 1.20.58.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2E7K4-F1-model_v4 | Uncharacterized protein | 1.017 | 6 | 43 |
|
| AF-A0A7Y4H666-F1-model_v4 | Uncharacterized protein | 1.015 | 5 | 43 |
|
| AF-A0A1Q7BPX4-F1-model_v4 | HTH tetR-type domain-containing protein | 1.014 | 6 | 43 |
|
| AF-A0A1A8XS35-F1-model_v4 | Phasin domain-containing protein | 1.014 | 3 | 43 |
|
| AF-A0A017HJJ8-F1-model_v4 | Uncharacterized protein | 1.013 | 4 | 43 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar