F483041

General Info

Members Datasets Scaffolds Average Seq Length
840 692 313 425

Family's Representative Sequence

Representative Sequence 3300003790|Ga0055528_1012778|Ga0055528_10127784
Length 466
Sequence MMTKTAKSGGELPSPMRLNAEGPKVLRAGFIPLVDASVLIAAAEFGFAQKEGLTLDLVKDVSWANVRDRLAFRQFDIAHMLSPMPVASMLGLGSNPSPTITPFSLGRGGNAITLSTRLFDRMRNDAGLPETAGALDNARALAKTLAAMKVRGEPLPTFGVTYPFSSHNYEFRYWLAAGGIDPDKDVKLVVVPPPMTSDALAAGAIDGFCVGAPWNMVASERGVGRIVAAKQDIWPSAPEKVIGMRPDWAETHPETVSRLIVALDAAARWCDQPDNHDALAAALADPRYIAAPVEIIRRVLAGEFSLDAKGNRRIIADYFMFHSGFANYPRPSQALWIYSQMIRWGQAEASLNMARAAASAYRPDLYRTALGDGNAPDDADIRIEGGDEGDRFMDGHVFDPARLPDYVAGFAVKSALPFVTGDEIXSTPACPKRQQGSAPHMASAQKISTTVDSSKNKQTADFEKCK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
39 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
40 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
41 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
42 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
43 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
44 2519899620 Rhizobium sp. Pop5 Isolate Nodule
45 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
48 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
49 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
50 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
51 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
52 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
53 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
54 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
55 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
56 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
57 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
58 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
59 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
60 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
61 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
62 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
63 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
64 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
65 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
66 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
67 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
68 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
69 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
70 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
71 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
72 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
73 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
74 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
75 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
76 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
77 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
78 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
79 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
80 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
81 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
82 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
83 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
84 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
85 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
86 2643221558 Rhizobium sp. Root149 Isolate Unclassified
87 2643221568 Rhizobium sp. Root564 Isolate Unclassified
88 2643221582 Rhizobium sp. Root651 Isolate Unclassified
89 2643221607 Rhizobium sp. Root73 Isolate Unclassified
90 2643221618 Ensifer sp. Root231 Isolate Unclassified
91 2643221626 Ensifer sp. Root31 Isolate Unclassified
92 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
93 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
94 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
95 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
96 2643221655 Ensifer sp. Root1252 Isolate Unclassified
97 2643221659 Ensifer sp. Root127 Isolate Unclassified
98 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
99 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
100 2643221693 Rhizobium sp. Root491 Isolate Unclassified
101 2643221698 Ensifer sp. Root142 Isolate Unclassified
102 2643221712 Ensifer sp. Root258 Isolate Unclassified
103 2643221719 Rhizobium sp. Root274 Isolate Unclassified
104 2643221723 Ensifer sp. Root278 Isolate Unclassified
105 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
106 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
107 2718217882 Rhizobium sp. N741 Isolate Nodule
108 2718217927 Rhizobium sp. N324 Isolate Nodule
109 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
110 2718218009 Rhizobium sp. N561 Isolate Nodule
111 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
112 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
113 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
114 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
115 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
116 2718218363 Rhizobium sp. N113 Isolate Nodule
117 2718218365 Rhizobium sp. N731 Isolate Nodule
118 2718218366 Rhizobium sp. N621 Isolate Nodule
119 2718218423 Rhizobium sp. N941 Isolate Nodule
120 2721755514 Rhizobium sp. N6212 Isolate Nodule
121 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
122 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
123 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
124 2721755809 Rhizobium sp. N541 Isolate Nodule
125 2721755810 Rhizobium sp. N871 Isolate Nodule
126 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
127 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
128 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
129 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
130 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
131 2728369365 Rhizobium sp. N1341 Isolate Nodule
132 2728369397 Rhizobium sp. N1314 Isolate Nodule
133 2738541293 Rhizobium sp. GV031 Isolate Unclassified
134 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
135 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
136 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
137 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
138 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
139 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
140 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
141 2773857925 Microvirga vignae BR3299 Isolate Unclassified
142 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
143 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
144 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
145 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
146 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
147 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
148 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
149 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
150 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
151 2791355256 Rhizobium sp. M10 Isolate Nodule
152 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
153 2791355260 Rhizobium sp. L9 Isolate Nodule
154 2791355261 Rhizobium sp. J15 Isolate Nodule
155 2791355262 Rhizobium sp. M1 Isolate Nodule
156 2791355263 Rhizobium chutanense C5 Isolate Nodule
157 2791355264 Rhizobium sp. S9 Isolate Nodule
158 2791355265 Rhizobium sp. H4 Isolate Nodule
159 2791355266 Rhizobium sp. L43 Isolate Nodule
160 2791355267 Rhizobium sp. L18 Isolate Nodule
161 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
162 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
163 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
164 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
165 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
166 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
167 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
168 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
169 2802429633 Rhizobium anhuiense J3 Isolate Nodule
170 2802429634 Rhizobium anhuiense S10 Isolate Nodule
171 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
172 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
173 2802429637 Rhizobium anhuiense C15 Isolate Nodule
174 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
175 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
176 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
177 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
178 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
179 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
180 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
181 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
182 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
183 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
184 2838048938 Rhizobium pisi 27/80 Isolate Nodule
185 2838061910 Rhizobium phaseoli L15 Isolate Nodule
186 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
187 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
188 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
189 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
190 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
191 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
192 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
193 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
194 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
195 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
196 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
197 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
198 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
199 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
200 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
201 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
202 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
203 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
204 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
205 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
206 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
207 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
208 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
209 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
210 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
211 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
212 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
213 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
214 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
215 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
216 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
217 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
218 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
219 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
220 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
221 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
222 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
223 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
224 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
225 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
226 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
227 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
228 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
229 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
230 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
231 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
232 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
233 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
234 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
235 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
236 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
237 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
238 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
239 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
240 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
241 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
242 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
243 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
244 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
245 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
246 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
247 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
248 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
249 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
250 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
251 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
252 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
253 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
254 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
255 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
256 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
257 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
258 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
259 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
260 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
261 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
262 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
263 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
264 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
265 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
266 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
267 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
268 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
269 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
270 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
271 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
272 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
273 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
274 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
275 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
276 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
277 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
278 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
279 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
280 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
281 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
282 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
283 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
284 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
285 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
286 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
287 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
288 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
289 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
290 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
291 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
292 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
293 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
294 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
295 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
296 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
297 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
298 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
299 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
300 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
301 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
302 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
303 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
304 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
305 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
306 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
307 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
308 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
309 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
310 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
311 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
312 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
313 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
314 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
315 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
316 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
317 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
318 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
319 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
320 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
321 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
322 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
323 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
324 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
325 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
326 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
327 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
328 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
329 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
330 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
331 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
332 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
333 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
334 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
335 2933599457 Rhizobium phaseoli M3 Isolate Nodule
336 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
337 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
338 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
339 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
340 2936381700 Rhizobium chutanense C16 Isolate Unclassified
341 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
342 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
343 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
344 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
345 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
346 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
347 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
348 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
349 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
350 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
351 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
352 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
353 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
354 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
355 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
356 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
357 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
358 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
359 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
360 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
361 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
362 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
363 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
364 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
365 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
366 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
367 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
368 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
369 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
370 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
371 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
372 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
373 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
374 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
375 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
376 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
377 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
378 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
379 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
380 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
381 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
382 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
383 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
384 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
385 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
386 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
387 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
388 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
389 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
390 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
391 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
392 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
393 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
394 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
395 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
396 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
397 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
398 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
399 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
400 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
401 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
402 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
403 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
404 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
405 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
406 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
407 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
408 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
409 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
410 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
411 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
412 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
413 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
414 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
415 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
416 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
417 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
418 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
419 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
420 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
421 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
422 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
423 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
424 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
425 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
426 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
427 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
428 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
429 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
430 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
431 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
432 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
433 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
434 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
435 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
436 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
437 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
438 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
439 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
440 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
441 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
442 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
443 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
444 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
445 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
446 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
447 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
448 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
449 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
450 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
451 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
452 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
453 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
454 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
455 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
456 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
457 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
458 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
459 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
460 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
461 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
462 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
463 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
464 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
465 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
466 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
467 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
468 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
469 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
470 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
471 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
472 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
473 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
474 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
475 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
476 2996893221 Rhizobium sp. R635 Isolate Nodule
477 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
478 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
479 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
480 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
481 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
482 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
483 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
484 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
485 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
486 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
487 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
488 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
489 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
490 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
491 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
492 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
493 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
494 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
495 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
496 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
497 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
498 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
499 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
500 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
501 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
502 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
503 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
504 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
505 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
506 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
507 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
508 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
509 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
510 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
511 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
512 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
513 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
514 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
515 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
516 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
517 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
518 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
519 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
520 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
521 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
522 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
523 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
524 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
525 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
526 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
527 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
528 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
529 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
530 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
531 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
532 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
533 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
534 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
535 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
536 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
537 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
538 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
539 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
540 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
541 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
542 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
543 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
544 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
545 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
546 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
547 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
548 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
550 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
551 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
552 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
553 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
554 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
555 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
556 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
557 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
558 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
559 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
560 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
561 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
562 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
563 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
564 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
565 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
566 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
567 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
568 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
569 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
570 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
571 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
572 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
573 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
574 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
575 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
576 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
577 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
578 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
579 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
580 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
581 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
582 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
583 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
584 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
585 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
586 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
587 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
588 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
589 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
590 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
591 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
592 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
593 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
594 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
595 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
596 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
597 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
598 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
599 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
600 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
601 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
602 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
603 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
604 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
605 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
606 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
607 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
608 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
609 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
610 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
611 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
612 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
613 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
614 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
615 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
616 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
617 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
618 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
619 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
620 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
621 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
622 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
624 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
625 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
626 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
627 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
628 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
629 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
630 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
631 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
632 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
633 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
634 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
635 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
636 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
637 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
638 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
639 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
640 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
641 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
642 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
643 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
644 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
645 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
646 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
647 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
648 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
649 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
650 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
651 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
652 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
653 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
654 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
655 8005275841 Rhizobium sp. N4311 Isolate Nodule
656 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
657 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
658 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
659 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
660 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
661 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
662 8005382845 Rhizobium sp. R634 Isolate Nodule
663 8005395548 Rhizobium sp. R339 Isolate Nodule
664 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
665 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
666 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
667 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
668 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
669 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
670 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
671 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
672 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
673 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
674 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
675 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
676 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
677 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
678 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
679 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
680 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
681 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
682 8018176218 Rhizobium sp. N122 Isolate Nodule
683 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
684 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
685 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
686 8024501048 Rhizobium sp. H4 Isolate Nodule
687 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
688 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
689 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
690 8056382006 Rhizobium croatiense 13T Isolate Nodule
691 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
692 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.26
Metatranscriptomes 0
Isolates 62.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 15.36
Nodule 48.1
Rhizoplane 1.67
Rhizosphere 15.95
Stem 0
Stem Tuber 0
Unclassified 18.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000056 3300002704 Bacteria 73160
2 JGI25156J39149_1000007 3300002705 Bacteria 252108
3 JGI25162J39368_1001472 3300002737 Bacteria 12352
4 JGI25162J39368_1002141 3300002737 Bacteria 8281
5 JGI25154J39366_1000013 3300002738 Bacteria 268260
6 JGI25158J39367_1000108 3300002739 Bacteria 19483
7 JGI25157J39369_1000099 3300002741 Bacteria 73678
8 JGI25159J45721_1000015 3300002987 Bacteria 142431
9 JGI25151J46595_10000007 3300003187 Bacteria 411751
10 JGI25151J46595_10000326 3300003187 Bacteria 51646
11 JGI25151J46595_10002961 3300003187 Bacteria 9701
12 JGI25165J46597_1001164 3300003214 Bacteria 16187
13 JGI25165J46597_1001468 3300003214 Bacteria 12294
14 JGI25153J46596_10000313 3300003215 Bacteria 35777
15 JGI25153J46596_10009273 3300003215 Bacteria 4599
16 JGI25153J46596_10012968 3300003215 Bacteria 3556
17 JGI25153J46596_10013416 3300003215 Bacteria 3460
18 JGI25153J46596_10018971 3300003215 Bacteria 2650
19 rootH2_10040852 3300003320 Bacteria 2414
20 rootL2_10041562 3300003322 Bacteria 13141
21 rootH1_10052729 3300003323 Bacteria 6300
22 rootH1_10056383 3300003323 Bacteria 2055
23 JGI25160J50197_1000003 3300003354 Bacteria 482719
24 JGI25160J50197_1000444 3300003354 Bacteria 25877
25 JGI25160J50197_1007234 3300003354 Bacteria 4365
26 JGI25161J50226_1000093 3300003374 Bacteria 72639
27 JGI25161J50226_1000807 3300003374 Bacteria 11793
28 Ga0055526_1000613 3300003771 Bacteria 27657
29 Ga0055526_1001408 3300003771 Bacteria 17103
30 Ga0055526_1009813 3300003771 Bacteria 4549
31 Ga0055524_1011214 3300003775 Bacteria 3520
32 Ga0055524_1018122 3300003775 Bacteria 2456
33 Ga0055524_1026482 3300003775 Bacteria 1790
34 Ga0055536_1003547 3300003781 Bacteria 8351
35 Ga0055528_1000067 3300003790 Bacteria 83853
36 Ga0055528_1000515 3300003790 Bacteria 30346
37 Ga0055528_1002439 3300003790 Bacteria 9959
38 Ga0055528_1012760 3300003790 Bacteria 3239
39 Ga0055528_1012778 3300003790 Bacteria 3236
40 Ga0055530_10004168 3300003791 Bacteria 7636
41 Ga0055540_1000313 3300003792 Bacteria 42979
42 Ga0058692_1002710 3300003856 Bacteria 5824
43 Ga0055543_1000148 3300004625 Bacteria 58420
44 Ga0055543_1000554 3300004625 Bacteria 20996
45 Ga0055543_1001448 3300004625 Bacteria 9391
46 Ga0065165_1000025 3300005262 Bacteria 246909
47 Ga0065165_1007476 3300005262 Bacteria 5355
48 Ga0065165_1013148 3300005262 Bacteria 3311
49 Ga0068853_100012388 3300005539 Bacteria 6938
50 Ga0068856_100036031 3300005614 Bacteria 4852
51 Ga0075365_10002212 3300006038 Bacteria 9393
52 Ga0075365_10024767 3300006038 Bacteria 3792
53 Ga0075362_10011130 3300006177 Bacteria 3537
54 Ga0075367_10011778 3300006178 Bacteria 4642
55 Ga0075369_10033014 3300006186 Bacteria 2192
56 Ga0079104_1000014 3300006946 Bacteria 337362
57 Ga0099826_10000297 3300006948 Bacteria 22278
58 Ga0099826_10025049 3300006948 Bacteria 4426
59 Ga0105243_10083314 3300009148 Bacteria 2616
60 Ga0105249_10104626 3300009553 Bacteria 2667
61 Ga0123341_1000001 3300009765 Bacteria 314908
62 Ga0123342_1015994 3300009766 Bacteria 6638
63 Ga0105246_10019548 3300011119 Bacteria 4330
64 Ga0157371_10000304 3300013102 Bacteria 64521
65 Ga0157371_10007791 3300013102 Bacteria 8605
66 Ga0157370_10000969 3300013104 Bacteria 36344
67 Ga0157369_10224734 3300013105 Bacteria 1964
68 Ga0171463_1001 3300013249 Bacteria 1406070
69 Ga0157380_10065635 3300014326 Bacteria 2918
70 Ga0182005_1008088 3300015265 Bacteria 3117
71 Ga0183365_10076 3300015684 Bacteria 2320
72 Ga0183363_1108 3300015690 Bacteria 23177
73 Ga0214542_1014663 3300021321 Bacteria 8614
74 Ga0214543_1000025 3300021327 Bacteria 225351
75 Ga0209435_100006 3300025206 Bacteria 542459
76 Ga0209436_100007 3300025208 Bacteria 149841
77 Ga0209436_105224 3300025208 Bacteria 3021
78 Ga0209437_100023 3300025233 Bacteria 614195
79 Ga0209437_100341 3300025233 Bacteria 56114
80 Ga0207425_1000018 3300025245 Bacteria 411841
81 Ga0207425_1007730 3300025245 Bacteria 2809
82 Ga0209646_1000015 3300025246 Bacteria 542459
83 Ga0209026_1000046 3300025250 Bacteria 262031
84 Ga0209759_1000005 3300025256 Bacteria 542459
85 Ga0209129_1000026 3300025258 Bacteria 411839
86 Ga0209129_1001927 3300025258 Bacteria 10886
87 Ga0209129_1005896 3300025258 Bacteria 4155
88 Ga0209233_1000062 3300025261 Bacteria 399685
89 Ga0209233_1000970 3300025261 Bacteria 12354
90 Ga0209673_1000005 3300025273 Bacteria 692788
91 Ga0209673_1000310 3300025273 Bacteria 89821
92 Ga0209673_1000852 3300025273 Bacteria 39696
93 Ga0209673_1000877 3300025273 Bacteria 39066
94 Ga0209673_1002808 3300025273 Bacteria 11264
95 Ga0209673_1007389 3300025273 Bacteria 5080
96 Ga0209130_1000001 3300025284 Bacteria 831557
97 Ga0209130_1000005 3300025284 Bacteria 599620
98 Ga0209676_1002738 3300025292 Bacteria 11815
99 Ga0209676_1003081 3300025292 Bacteria 10741
100 Ga0209025_1000035 3300025294 Bacteria 411841
101 Ga0209025_1000097 3300025294 Bacteria 236632
102 Ga0209025_1000105 3300025294 Bacteria 224157
103 Ga0209025_1002687 3300025294 Bacteria 18144
104 Ga0209025_1007433 3300025294 Bacteria 8170
105 Ga0209025_1015837 3300025294 Bacteria 4505
106 Ga0209564_1000113 3300025295 Bacteria 211564
107 Ga0209564_1000137 3300025295 Bacteria 183874
108 Ga0209564_1000827 3300025295 Bacteria 42062
109 Ga0209564_1002623 3300025295 Bacteria 13744
110 Ga0209564_1010367 3300025295 Bacteria 4300
111 Ga0209758_1000040 3300025297 Bacteria 411841
112 Ga0209758_1000652 3300025297 Bacteria 52407
113 Ga0209758_1000843 3300025297 Bacteria 42750
114 Ga0209758_1001596 3300025297 Bacteria 25926
115 Ga0209758_1012103 3300025297 Bacteria 4879
116 Ga0209758_1014705 3300025297 Bacteria 4134
117 Ga0209050_1000773 3300025298 Bacteria 45942
118 Ga0209050_1001525 3300025298 Bacteria 24412
119 Ga0209050_1004675 3300025298 Bacteria 9099
120 Ga0209256_1000243 3300025299 Bacteria 96714
121 Ga0209256_1002823 3300025299 Bacteria 13268
122 Ga0209256_1003072 3300025299 Bacteria 12269
123 Ga0209256_1003847 3300025299 Bacteria 10034
124 Ga0209256_1006646 3300025299 Bacteria 6030
125 Ga0209256_1011416 3300025299 Bacteria 3555
126 Ga0207426_1000015 3300025302 Bacteria 599316
127 Ga0207426_1000045 3300025302 Bacteria 422847
128 Ga0207426_1000094 3300025302 Bacteria 275293
129 Ga0209051_1000166 3300025303 Bacteria 120265
130 Ga0209051_1003168 3300025303 Bacteria 11023
131 Ga0209257_1003810 3300025304 Bacteria 12399
132 Ga0207639_10005557 3300026041 Bacteria 8524
133 Ga0207702_10025869 3300026078 Bacteria 4872
134 Ga0209281_1000032 3300027111 Bacteria 401727
135 Ga0209281_1000314 3300027111 Bacteria 86424
136 Ga0209281_1000463 3300027111 Bacteria 57136
137 Ga0209371_1000035 3300027312 Bacteria 368979
138 Ga0209371_1000703 3300027312 Bacteria 28337
139 Ga0209282_1000068 3300027666 Bacteria 85817
140 Ga0209282_1018922 3300027666 Bacteria 4369
141 Ga0307515_10000691 3300028794 Bacteria 77788
142 Ga0307515_10088655 3300028794 Bacteria 3907
143 Ga0268256_1000037 3300030500 Bacteria 367024
144 Ga0268256_1004304 3300030500 Bacteria 5951
145 Ga0307513_10009990 3300031456 Bacteria 11972
146 Ga0307405_10191800 3300031731 Bacteria 1477
147 Ga0307406_10021539 3300031901 Bacteria 3813
148 Ga0307412_10003681 3300031911 Bacteria 8515
149 Ga0307412_10068068 3300031911 Bacteria 2420
150 Ga0307416_100354018 3300032002 Bacteria 1487
151 Ga0315913_1002536 3300033430 Bacteria 21509
152 Ga0315915_1000007 3300033464 Bacteria 319225
153 Ga0395905_0017386 3300037471 Bacteria 6828
154 Ga0439436_0040474 3300041404 Bacteria 1336
155 Ga0439465_0011117 3300041413 Bacteria 2825
156 Ga0451833_0078687 3300041491 Bacteria 2483
157 Ga0451847_0635639 3300041503 Bacteria 1681
158 Ga0439449_0051946 3300042007 Bacteria 1516
159 Ga0450920_010243 3300042122 Bacteria 1736
160 Ga0466966_0039862 3300044684 Bacteria 3024
161 Ga0466963_0008496 3300044694 Bacteria 6156
162 Ga0466970_0000129 3300044765 Bacteria 34329
163 Ga0466957_0026361 3300044842 Bacteria 3448
164 Ga0466958_0004823 3300045836 Bacteria 7178
165 Ga0466967_0031937 3300045976 Bacteria 4440
166 Ga0495638_0011576 3300046460 Bacteria 6078
167 Ga0495638_0074122 3300046460 Bacteria 2076
168 Ga0495638_0082242 3300046460 Bacteria 1953
169 Ga0495605_0002741 3300046474 Bacteria 10759
170 Ga0495605_0017316 3300046474 Bacteria 3884
171 Ga0495585_0002821 3300046492 Bacteria 12115
172 Ga0495585_0089613 3300046492 Bacteria 1658
173 Ga0495607_0041404 3300046501 Bacteria 2737
174 Ga0495583_0010915 3300046506 Bacteria 5249
175 Ga0495583_0011370 3300046506 Bacteria 5115
176 Ga0495606_0018665 3300046507 Bacteria 5191
177 Ga0495606_0093696 3300046507 Bacteria 1842
178 Ga0495610_0006528 3300046512 Bacteria 7996
179 Ga0495616_0030010 3300046513 Bacteria 2862
180 Ga0495616_0102870 3300046513 Bacteria 1338
181 Ga0495618_0103750 3300046514 Bacteria 1821
182 Ga0495620_0026199 3300046515 Bacteria 2744
183 Ga0495620_0034226 3300046515 Bacteria 2298
184 Ga0495631_0001667 3300046518 Bacteria 13215
185 Ga0495631_0047053 3300046518 Bacteria 1895
186 Ga0495632_0004656 3300046519 Bacteria 9266
187 Ga0495632_0019294 3300046519 Bacteria 3719
188 Ga0495643_0008402 3300046522 Bacteria 6539
189 Ga0495643_0046898 3300046522 Bacteria 2341
190 Ga0495643_0078187 3300046522 Bacteria 1727
191 Ga0495643_0082196 3300046522 Bacteria 1674
192 Ga0495654_0000063 3300046530 Bacteria 128630
193 Ga0495654_0025530 3300046530 Bacteria 3043
194 Ga0495597_0032515 3300046542 Bacteria 2367
195 Ga0495622_0020076 3300046557 Bacteria 3111
196 Ga0495633_0007159 3300046558 Bacteria 6471
197 Ga0495633_0026464 3300046558 Bacteria 2847
198 Ga0495668_0015549 3300046616 Bacteria 4440
199 Ga0495668_0098438 3300046616 Bacteria 1601
200 Ga0495611_0067088 3300046648 Bacteria 1637
201 Ga0495625_0002084 3300046660 Bacteria 22344
202 Ga0495661_0025399 3300046665 Bacteria 3826
203 Ga0495588_0028969 3300046674 Bacteria 2775
204 Ga0495624_0139096 3300046690 Bacteria 1488
205 Ga0495670_0026642 3300046691 Bacteria 2862
206 Ga0495670_0030487 3300046691 Bacteria 2679
207 Ga0495660_0006931 3300046810 Bacteria 6676
208 Ga0495660_0018178 3300046810 Bacteria 4041
209 Ga0495672_0010381 3300047320 Bacteria 6642
210 Ga0495683_0117102 3300047323 Bacteria 1267
211 Ga0495687_044720 3300047443 Bacteria 1922
212 Ga0495602_0231288 3300048088 Bacteria 1389
213 Ga0496100_0134895 3300048903 Bacteria 1743
214 Ga0496104_0085989 3300048907 Bacteria 3002
215 Ga0496106_0010449 3300048909 Bacteria 6856
216 Ga0496113_0012548 3300048916 Bacteria 5700
217 Ga0496116_0000167 3300048919 Bacteria 132540
218 Ga0496116_0000346 3300048919 Bacteria 73590
219 Ga0496116_0003601 3300048919 Bacteria 15235
220 Ga0496116_0025948 3300048919 Bacteria 4296
221 Ga0496116_0028097 3300048919 Bacteria 4081
222 Ga0496116_0052828 3300048919 Bacteria 2688
223 Ga0496116_0084657 3300048919 Bacteria 1952
224 Ga0496116_0089377 3300048919 Bacteria 1879
225 Ga0496117_0000052 3300048920 Bacteria 280463
226 Ga0496117_0002893 3300048920 Bacteria 20804
227 Ga0496117_0017985 3300048920 Bacteria 5882
228 Ga0496117_0081992 3300048920 Bacteria 2114
229 Ga0496117_0130991 3300048920 Bacteria 1520
230 Ga0496118_0000746 3300048921 Bacteria 52673
231 Ga0496118_0002941 3300048921 Bacteria 22131
232 Ga0496118_0009334 3300048921 Bacteria 9939
233 Ga0496118_0015943 3300048921 Bacteria 6923
234 Ga0496118_0051386 3300048921 Bacteria 3154
235 Ga0496118_0060199 3300048921 Bacteria 2821
236 Ga0496118_0066328 3300048921 Bacteria 2635
237 Ga0496118_0109747 3300048921 Bacteria 1835
238 Ga0496119_0007851 3300048922 Bacteria 9507
239 Ga0496119_0009404 3300048922 Bacteria 8397
240 Ga0496119_0021519 3300048922 Bacteria 4658
241 Ga0496120_0000019 3300048923 Bacteria 260115
242 Ga0496120_0037968 3300048923 Bacteria 2853
243 Ga0496120_0059566 3300048923 Bacteria 2140
244 Ga0496121_0000005 3300048924 Bacteria 1034486
245 Ga0496121_0028896 3300048924 Bacteria 5149
246 Ga0496121_0061857 3300048924 Bacteria 3069
247 Ga0496121_0108313 3300048924 Bacteria 2125
248 Ga0496122_0000053 3300048925 Bacteria 260120
249 Ga0496122_0003439 3300048925 Bacteria 20818
250 Ga0496122_0004410 3300048925 Bacteria 17516
251 Ga0496122_0004580 3300048925 Bacteria 17027
252 Ga0496122_0032871 3300048925 Bacteria 4278
253 Ga0496122_0054803 3300048925 Bacteria 2990
254 Ga0496122_0081260 3300048925 Bacteria 2256
255 Ga0496122_0107248 3300048925 Bacteria 1846
256 Ga0496123_0000038 3300048926 Bacteria 260120
257 Ga0496123_0002783 3300048926 Bacteria 20818
258 Ga0496123_0014707 3300048926 Bacteria 6468
259 Ga0496123_0039294 3300048926 Bacteria 3311
260 Ga0496123_0052719 3300048926 Bacteria 2696
261 Ga0496124_0000111 3300048927 Bacteria 166285
262 Ga0496124_0017334 3300048927 Bacteria 6790
263 Ga0496124_0038683 3300048927 Bacteria 4140
264 Ga0496124_0056959 3300048927 Bacteria 3294
265 Ga0496124_0085463 3300048927 Bacteria 2585
266 Ga0496124_0096601 3300048927 Bacteria 2400
267 Ga0496124_0102302 3300048927 Bacteria 2319
268 Ga0496125_0000159 3300048928 Bacteria 151205
269 Ga0496125_0030426 3300048928 Bacteria 4831
270 Ga0496125_0046707 3300048928 Bacteria 3629
271 Ga0496125_0060563 3300048928 Bacteria 3041
272 Ga0496125_0061727 3300048928 Bacteria 3003
273 Ga0496126_0000768 3300048929 Bacteria 58074
274 Ga0496126_0034992 3300048929 Bacteria 4710
275 Ga0495682_0012302 3300049460 Bacteria 3284
276 Ga0501033_0000556 3300049570 Bacteria 34742
277 Ga0501280_002083 3300049776 Bacteria 3455
278 Ga0501280_004286 3300049776 Bacteria 2107
279 Ga0501035_0008842 3300049822 Bacteria 9373
280 Ga0501044_0135087 3300049823 Bacteria 2458
281 nmdc:mga03683_10856_c1 3300050489 Bacteria 3277
282 nmdc:mga00v17_11_c1 3300050491 Bacteria 135478
283 nmdc:mga0yw44_11438_c2 3300050492 Bacteria 3976
284 nmdc:mga0yw44_14017_c1 3300050492 Bacteria 4241
285 nmdc:mga0yw44_528_c1 3300050492 Bacteria 13715
286 nmdc:mga06z11_16787_c1 3300050494 Bacteria 3307
287 nmdc:mga07m45_15174_c1 3300050496 Bacteria 4113
288 Ga0500555_005877 3300053103 Bacteria 3481
289 Ga0500557_000408 3300053105 Bacteria 5633
290 Ga0500560_000296 3300053107 Bacteria 6320
291 Ga0500560_017815 3300053107 Bacteria 1968
292 Ga0500569_003225 3300053109 Bacteria 3306
293 Ga0500572_004594 3300053111 Bacteria 3131
294 Ga0500593_000025 3300053117 Bacteria 51890
295 Ga0500594_0000244 3300053118 Bacteria 13128
296 Ga0500618_000726 3300053125 Bacteria 18853
297 Ga0500618_009775 3300053125 Bacteria 2605
298 Ga0500618_014746 3300053125 Bacteria 1989
299 Ga0500658_0000846 3300053134 Bacteria 12591
300 Ga0500658_0013140 3300053134 Bacteria 3057
301 Ga0500568_0000005 3300053139 Bacteria 614296
302 Ga0500568_0000617 3300053139 Bacteria 25650
303 Ga0500568_0003912 3300053139 Bacteria 8104
304 Ga0500604_0002542 3300053151 Bacteria 4976
305 Ga0500616_0001339 3300053153 Bacteria 24153
306 Ga0500616_0004193 3300053153 Bacteria 10390
307 Ga0500622_0000134 3300053156 Bacteria 78418
308 Ga0500624_000522 3300053157 Bacteria 11066
309 Ga0500633_0002614 3300053160 Bacteria 3747
310 Ga0500636_0000039 3300053177 Bacteria 69891
311 Ga0500636_0007158 3300053177 Bacteria 6446
312 Ga0500645_012164 3300053730 Bacteria 2788
313 Ga0501082_0160233 3300060353 Bacteria 1955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053117 Ga0500593_000025 Ga0500593_000025_27194_28333 349
2 3300042122 Ga0450920_010243 Ga0450920_010243_353_1477 369
3 3300053139 Ga0500568_0000005 Ga0500568_0000005_451270_452409 374
4 iso_pu_bacteria 2643221698 2644545078 381
5 iso_pu_bacteria 2643221659 2644334729 382
6 3300053103 Ga0500555_005877 Ga0500555_005877_1135_2286 383
7 iso_pu_bacteria 2519899620 2520376255 384
8 3300005539 Ga0068853_100012388 Ga0068853_1000123885 386
9 3300026041 Ga0207639_10005557 Ga0207639_100055577 386
10 3300009148 Ga0105243_10083314 Ga0105243_100833142 390
11 iso_pu_bacteria 2882456835 2882459946 390
12 3300014326 Ga0157380_10065635 Ga0157380_100656352 394
13 iso_pu_bacteria 2894817345 2894820779 394
14 iso_pu_bacteria 2773857925 2774873301 395
15 3300003215 JGI25153J46596_10012968 JGI25153J46596_100129682 398
16 3300003354 JGI25160J50197_1007234 JGI25160J50197_10072342 398
17 3300003771 Ga0055526_1009813 Ga0055526_10098134 398
18 3300025258 Ga0209129_1005896 Ga0209129_10058963 398
19 3300025273 Ga0209673_1002808 Ga0209673_10028081 398
20 3300025295 Ga0209564_1002623 Ga0209564_10026235 398
21 3300025297 Ga0209758_1012103 Ga0209758_10121032 398
22 3300025299 Ga0209256_1011416 Ga0209256_10114163 398
23 3300037471 Ga0395905_0017386 Ga0395905_0017386_3623_4882 398
24 iso_pu_bacteria 2551306086 2551692465 398
25 3300002739 JGI25158J39367_1000108 JGI25158J39367_10001083 400
26 3300003374 JGI25161J50226_1000093 JGI25161J50226_100009311 400
27 3300004625 Ga0055543_1000554 Ga0055543_100055411 400
28 3300005262 Ga0065165_1013148 Ga0065165_10131482 400
29 3300025208 Ga0209436_100007 Ga0209436_10000743 400
30 3300025284 Ga0209130_1000001 Ga0209130_1000001727 400
31 3300025302 Ga0207426_1000045 Ga0207426_1000045336 400
32 3300046514 Ga0495618_0103750 Ga0495618_0103750_501_1706 401
33 3300046557 Ga0495622_0020076 Ga0495622_0020076_916_2121 401
34 3300046690 Ga0495624_0139096 Ga0495624_0139096_81_1286 401
35 3300048088 Ga0495602_0231288 Ga0495602_0231288_95_1300 401
36 3300003775 Ga0055524_1026482 Ga0055524_10264822 403
37 3300048909 Ga0496106_0010449 Ga0496106_0010449_4856_6133 403
38 3300053134 Ga0500658_0013140 Ga0500658_0013140_978_2255 403
39 iso_pu_bacteria 2523231067 2523469966 403
40 iso_pu_bacteria 2738543031 2739350485 403
41 iso_pu_bacteria 2643221618 2644105874 404
42 3300053139 Ga0500568_0003912 Ga0500568_0003912_3495_4772 405
43 3300025294 Ga0209025_1015837 Ga0209025_10158372 406
44 3300003215 JGI25153J46596_10018971 JGI25153J46596_100189712 407
45 3300025292 Ga0209676_1003081 Ga0209676_10030813 407
46 3300025297 Ga0209758_1001596 Ga0209758_10015968 407
47 3300025298 Ga0209050_1001525 Ga0209050_10015258 407
48 3300053153 Ga0500616_0004193 Ga0500616_0004193_5412_6683 407
49 iso_pu_bacteria 2558860983 2561467775 407
50 3300046506 Ga0495583_0011370 Ga0495583_0011370_1145_2416 409
51 iso_pu_bacteria 2894232714 2894236279 409
52 3300028794 Ga0307515_10000691 Ga0307515_100006912 410
53 3300031456 Ga0307513_10009990 Ga0307513_100099908 410
54 iso_pu_bacteria 2511231027 2511391396 410
55 iso_pu_bacteria 2821123053 2821128960 410
56 iso_pu_bacteria 2838736955 2838742275 410
57 iso_pu_bacteria 2841840854 2841846131 410
58 iso_pu_bacteria 2842140634 2842145835 410
59 iso_pu_bacteria 2842871566 2842875665 410
60 iso_pu_bacteria 2857531043 2857536383 410
61 3300009553 Ga0105249_10104626 Ga0105249_101046262 411
62 3300053151 Ga0500604_0002542 Ga0500604_0002542_836_2113 411
63 iso_pu_bacteria 2928521798 2928524939 411
64 iso_pu_bacteria 2954011201 2954011453 411
65 3300006946 Ga0079104_1000014 Ga0079104_100001444 412
66 3300027111 Ga0209281_1000032 Ga0209281_100003246 412
67 3300031731 Ga0307405_10191800 Ga0307405_101918001 412
68 3300032002 Ga0307416_100354018 Ga0307416_1003540182 412
69 3300048924 Ga0496121_0028896 Ga0496121_0028896_755_1999 412
70 iso_pu_bacteria 8055431914 8055432598 412
71 3300047323 Ga0495683_0117102 Ga0495683_0117102_13_1257 413
72 iso_pu_bacteria 2643221558 2643814723 413
73 iso_pu_bacteria 2939669807 2939673113 413
74 3300015265 Ga0182005_1008088 Ga0182005_10080882 414
75 3300046492 Ga0495585_0089613 Ga0495585_0089613_53_1321 414
76 3300046558 Ga0495633_0026464 Ga0495633_0026464_1038_2306 414
77 3300046674 Ga0495588_0028969 Ga0495588_0028969_730_1998 414
78 iso_pu_bacteria 2508501114 2509076607 414
79 iso_pu_bacteria 2775506901 2776260018 414
80 iso_pu_bacteria 2508501050 2508735133 415
81 iso_pu_bacteria 2599185352 2600194946 415
82 iso_pu_bacteria 2643221723 2644671604 415
83 iso_pu_bacteria 2920822456 2920822957 415
84 iso_pu_bacteria 8005658619 8005662740 415
85 3300046513 Ga0495616_0102870 Ga0495616_0102870_16_1284 416
86 iso_pu_bacteria 2643221653 2644297580 416
87 iso_pu_bacteria 2643221719 2644655833 416
88 iso_pu_bacteria 2791355253 2793280966 416
89 3300027111 Ga0209281_1000463 Ga0209281_100046327 417
90 3300048919 Ga0496116_0028097 Ga0496116_0028097_1389_2684 417
91 3300048921 Ga0496118_0109747 Ga0496118_0109747_103_1398 417
92 3300048923 Ga0496120_0037968 Ga0496120_0037968_612_1907 417
93 3300048924 Ga0496121_0000005 Ga0496121_0000005_885505_886800 417
94 3300048928 Ga0496125_0000159 Ga0496125_0000159_9602_10897 417
95 3300049570 Ga0501033_0000556 Ga0501033_0000556_5709_6968 417
96 3300049822 Ga0501035_0008842 Ga0501035_0008842_5597_6856 417
97 iso_pu_bacteria 2510065057 2510307921 417
98 iso_pu_bacteria 2511231052 2511498229 417
99 iso_pu_bacteria 2513237086 2513586875 417
100 iso_pu_bacteria 2513237091 2513619656 417
101 iso_pu_bacteria 2513237140 2513885150 417
102 iso_pu_bacteria 2513237143 2513906261 417
103 iso_pu_bacteria 2516653046 2516896128 417
104 iso_pu_bacteria 2551306084 2551674971 417
105 iso_pu_bacteria 2551306085 2551687287 417
106 iso_pu_bacteria 2599185156 2599332899 417
107 iso_pu_bacteria 2842922631 2842923190 417
108 iso_pu_bacteria 2855825444 2855829047 417
109 iso_pu_bacteria 2855839649 2855844165 417
110 iso_pu_bacteria 2858800743 2858806585 417
111 iso_pu_bacteria 2915986958 2915992213 417
112 iso_pu_bacteria 2915993759 2915999287 417
113 iso_pu_bacteria 2916000859 2916007505 417
114 iso_pu_bacteria 2916007675 2916011616 417
115 iso_pu_bacteria 2916014648 2916018851 417
116 iso_pu_bacteria 2916021584 2916026058 417
117 iso_pu_bacteria 2916028427 2916032115 417
118 iso_pu_bacteria 2916035215 2916039061 417
119 iso_pu_bacteria 2916048683 2916051883 417
120 iso_pu_bacteria 2916055098 2916060872 417
121 iso_pu_bacteria 2916068649 2916071234 417
122 iso_pu_bacteria 2916076590 2916077355 417
123 iso_pu_bacteria 2921201388 2921203592 417
124 iso_pu_bacteria 2921208531 2921209472 417
125 iso_pu_bacteria 2921237296 2921237935 417
126 iso_pu_bacteria 2921244191 2921248285 417
127 iso_pu_bacteria 2921257292 2921260976 417
128 iso_pu_bacteria 2921263974 2921267891 417
129 iso_pu_bacteria 2921282425 2921287063 417
130 iso_pu_bacteria 2921289301 2921295694 417
131 iso_pu_bacteria 2921296804 2921299096 417
132 iso_pu_bacteria 2924144063 2924145708 417
133 iso_pu_bacteria 2924150972 2924155850 417
134 iso_pu_bacteria 2924158325 2924162451 417
135 iso_pu_bacteria 2924165586 2924171316 417
136 iso_pu_bacteria 2924172951 2924178402 417
137 iso_pu_bacteria 2924179722 2924183404 417
138 iso_pu_bacteria 2924186466 2924191997 417
139 iso_pu_bacteria 2924200457 2924204597 417
140 iso_pu_bacteria 2924214083 2924220852 417
141 iso_pu_bacteria 2924228884 2924234608 417
142 iso_pu_bacteria 2929138655 2929142989 417
143 iso_pu_bacteria 2937002841 2937007221 417
144 iso_pu_bacteria 2937009748 2937015197 417
145 iso_pu_bacteria 2937016420 2937020742 417
146 iso_pu_bacteria 2937023124 2937026954 417
147 iso_pu_bacteria 2937042894 2937048066 417
148 iso_pu_bacteria 2937049772 2937054121 417
149 iso_pu_bacteria 2937056579 2937060576 417
150 iso_pu_bacteria 2937063883 2937068010 417
151 iso_pu_bacteria 2937071275 2937076980 417
152 iso_pu_bacteria 2937091812 2937095339 417
153 iso_pu_bacteria 2937098957 2937103604 417
154 iso_pu_bacteria 2937106411 2937110297 417
155 iso_pu_bacteria 2937113482 2937117196 417
156 iso_pu_bacteria 2937119839 2937123583 417
157 iso_pu_bacteria 2937126314 2937130518 417
158 iso_pu_bacteria 2957382221 2957386370 417
159 iso_pu_bacteria 2957388812 2957392791 417
160 iso_pu_bacteria 2957395598 2957401509 417
161 iso_pu_bacteria 2957402308 2957406642 417
162 iso_pu_bacteria 2957408893 2957413643 417
163 iso_pu_bacteria 2957415311 2957420943 417
164 iso_pu_bacteria 2957422303 2957427390 417
165 iso_pu_bacteria 2957443900 2957449175 417
166 iso_pu_bacteria 2957450854 2957456466 417
167 iso_pu_bacteria 2957457609 2957461439 417
168 iso_pu_bacteria 2957464669 2957468577 417
169 iso_pu_bacteria 2957471148 2957476802 417
170 iso_pu_bacteria 2957478035 2957484274 417
171 iso_pu_bacteria 2957484790 2957488641 417
172 iso_pu_bacteria 2957491536 2957497208 417
173 iso_pu_bacteria 2957498199 2957504211 417
174 iso_pu_bacteria 2957505466 2957509656 417
175 iso_pu_bacteria 2960597568 2960601075 417
176 iso_pu_bacteria 2960603979 2960608849 417
177 iso_pu_bacteria 2960610863 2960615814 417
178 iso_pu_bacteria 2960617483 2960622052 417
179 iso_pu_bacteria 2960624210 2960629909 417
180 iso_pu_bacteria 2960637947 2960645265 417
181 iso_pu_bacteria 2960645483 2960649749 417
182 iso_pu_bacteria 2960652885 2960659008 417
183 iso_pu_bacteria 2960660292 2960665645 417
184 iso_pu_bacteria 2960667422 2960671606 417
185 iso_pu_bacteria 2960674078 2960679901 417
186 iso_pu_bacteria 2964607997 2964611931 417
187 iso_pu_bacteria 2964615318 2964619662 417
188 iso_pu_bacteria 2964621998 2964626944 417
189 iso_pu_bacteria 2964628898 2964635026 417
190 iso_pu_bacteria 2964636051 2964640085 417
191 iso_pu_bacteria 2964643177 2964647464 417
192 iso_pu_bacteria 2964649959 2964653781 417
193 iso_pu_bacteria 2964656573 2964662885 417
194 iso_pu_bacteria 2964663802 2964669203 417
195 iso_pu_bacteria 2964670856 2964673648 417
196 iso_pu_bacteria 2964678106 2964682802 417
197 iso_pu_bacteria 2964685014 2964690188 417
198 iso_pu_bacteria 2964691889 2964695617 417
199 iso_pu_bacteria 2964698721 2964703743 417
200 iso_pu_bacteria 2964705432 2964711570 417
201 iso_pu_bacteria 2964712639 2964716247 417
202 iso_pu_bacteria 2964719344 2964724918 417
203 iso_pu_bacteria 2967664464 2967665340 417
204 iso_pu_bacteria 2967671571 2967677200 417
205 iso_pu_bacteria 2967678726 2967683359 417
206 iso_pu_bacteria 2967693043 2967697014 417
207 iso_pu_bacteria 2967699805 2967703962 417
208 iso_pu_bacteria 2967706974 2967711153 417
209 iso_pu_bacteria 2967714385 2967718398 417
210 iso_pu_bacteria 2967721400 2967726987 417
211 iso_pu_bacteria 2967735183 2967738793 417
212 iso_pu_bacteria 2967755722 2967759398 417
213 iso_pu_bacteria 2967762386 2967766257 417
214 iso_pu_bacteria 2967769361 2967773536 417
215 iso_pu_bacteria 2967775926 2967780777 417
216 iso_pu_bacteria 2970019648 2970026611 417
217 iso_pu_bacteria 2970033650 2970040089 417
218 iso_pu_bacteria 2970040964 2970046408 417
219 iso_pu_bacteria 2970047711 2970051652 417
220 iso_pu_bacteria 2970054988 2970059169 417
221 iso_pu_bacteria 2970061556 2970065426 417
222 iso_pu_bacteria 2970068827 2970074109 417
223 iso_pu_bacteria 2970076120 2970080752 417
224 iso_pu_bacteria 2970082768 2970087078 417
225 iso_pu_bacteria 2970088815 2970093158 417
226 iso_pu_bacteria 2970095765 2970099646 417
227 iso_pu_bacteria 2970102677 2970106487 417
228 iso_pu_bacteria 2970109326 2970113718 417
229 iso_pu_bacteria 2970116247 2970120086 417
230 iso_pu_bacteria 2970129317 2970135729 417
231 iso_pu_bacteria 2970136068 2970141898 417
232 iso_pu_bacteria 2970149975 2970154066 417
233 iso_pu_bacteria 2970156795 2970161896 417
234 iso_pu_bacteria 2970164137 2970168081 417
235 iso_pu_bacteria 2970170962 2970176159 417
236 iso_pu_bacteria 2970177841 2970179146 417
237 iso_pu_bacteria 2970184632 2970190212 417
238 iso_pu_bacteria 2970191845 2970195955 417
239 iso_pu_bacteria 2977516862 2977523675 417
240 iso_pu_bacteria 2977523885 2977529766 417
241 iso_pu_bacteria 2977537788 2977541616 417
242 iso_pu_bacteria 2977551784 2977556276 417
243 iso_pu_bacteria 2977558990 2977565062 417
244 iso_pu_bacteria 2977565890 2977570209 417
245 iso_pu_bacteria 2977572785 2977576948 417
246 iso_pu_bacteria 2977579622 2977583449 417
247 iso_pu_bacteria 3003930520 3003933857 417
248 iso_pu_bacteria 648276728 648738333 417
249 iso_pu_bacteria 8003992118 8003996746 417
250 3300002987 JGI25159J45721_1000015 JGI25159J45721_100001519 418
251 3300003187 JGI25151J46595_10002961 JGI25151J46595_100029612 418
252 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003165 418
253 3300003374 JGI25161J50226_1000807 JGI25161J50226_10008075 418
254 3300003781 Ga0055536_1003547 Ga0055536_10035475 418
255 3300003791 Ga0055530_10004168 Ga0055530_100041686 418
256 3300004625 Ga0055543_1001448 Ga0055543_10014483 418
257 3300005262 Ga0065165_1000025 Ga0065165_1000025167 418
258 3300013249 Ga0171463_1001 Ga0171463_10011123 418
259 3300015684 Ga0183365_10076 Ga0183365_100761 418
260 3300015690 Ga0183363_1108 Ga0183363_11087 418
261 3300021321 Ga0214542_1014663 Ga0214542_10146636 418
262 3300021327 Ga0214543_1000025 Ga0214543_1000025123 418
263 3300025208 Ga0209436_105224 Ga0209436_1052242 418
264 3300025284 Ga0209130_1000005 Ga0209130_1000005316 418
265 3300025292 Ga0209676_1002738 Ga0209676_10027386 418
266 3300025294 Ga0209025_1000105 Ga0209025_1000105100 418
267 3300025295 Ga0209564_1000113 Ga0209564_10001135 418
268 3300025298 Ga0209050_1000773 Ga0209050_100077333 418
269 3300025299 Ga0209256_1002823 Ga0209256_10028239 418
270 3300025302 Ga0207426_1000015 Ga0207426_1000015283 418
271 3300025303 Ga0209051_1003168 Ga0209051_10031684 418
272 3300025304 Ga0209257_1003810 Ga0209257_10038105 418
273 3300053111 Ga0500572_004594 Ga0500572_004594_903_2177 418
274 3300053177 Ga0500636_0007158 Ga0500636_0007158_248_1522 418
275 iso_pu_bacteria 2508501122 2509111064 418
276 iso_pu_bacteria 2509276019 2509379394 418
277 iso_pu_bacteria 2558860100 2558861477 418
278 iso_pu_bacteria 2582581299 2585227738 418
279 iso_pu_bacteria 2582581304 2585255592 418
280 iso_pu_bacteria 2585427594 2585847679 418
281 iso_pu_bacteria 2643221626 2644147161 418
282 iso_pu_bacteria 2643221655 2644310486 418
283 iso_pu_bacteria 2643221712 2644612588 418
284 iso_pu_bacteria 2850079185 2850084555 418
285 iso_pu_bacteria 2941499720 2941506469 418
286 3300003323 rootH1_10056383 rootH1_100563832 419
287 3300013102 Ga0157371_10007791 Ga0157371_100077917 419
288 3300013105 Ga0157369_10224734 Ga0157369_102247342 419
289 3300025294 Ga0209025_1002687 Ga0209025_10026875 419
290 3300027111 Ga0209281_1000314 Ga0209281_100031450 419
291 3300027666 Ga0209282_1000068 Ga0209282_100006850 419
292 3300033430 Ga0315913_1002536 Ga0315913_10025362 419
293 3300033464 Ga0315915_1000007 Ga0315915_1000007291 419
294 3300042007 Ga0439449_0051946 Ga0439449_0051946_127_1422 419
295 3300048919 Ga0496116_0000167 Ga0496116_0000167_42610_43881 419
296 3300048929 Ga0496126_0000768 Ga0496126_0000768_14580_15851 419
297 3300049776 Ga0501280_004286 Ga0501280_004286_378_1661 419
298 iso_pu_bacteria 2510065019 2510132669 419
299 iso_pu_bacteria 2510461076 2510894016 419
300 iso_pu_bacteria 2510461076 2510899041 419
301 iso_pu_bacteria 2510917022 2511133402 419
302 iso_pu_bacteria 2512047086 2512528839 419
303 iso_pu_bacteria 2512875026 2512969542 419
304 iso_pu_bacteria 2513237084 2513570183 419
305 iso_pu_bacteria 2513237085 2513575553 419
306 iso_pu_bacteria 2513237089 2513606234 419
307 iso_pu_bacteria 2513237093 2513632865 419
308 iso_pu_bacteria 2513237103 2513710407 419
309 iso_pu_bacteria 2513237156 2513985057 419
310 iso_pu_bacteria 2513237160 2514007949 419
311 iso_pu_bacteria 2513237162 2514019717 419
312 iso_pu_bacteria 2515075009 2515111665 419
313 iso_pu_bacteria 2515154107 2515610802 419
314 iso_pu_bacteria 2515154113 2515634842 419
315 iso_pu_bacteria 2515154114 2515641991 419
316 iso_pu_bacteria 2515154116 2515656062 419
317 iso_pu_bacteria 2515154134 2515739267 419
318 iso_pu_bacteria 2516653077 2517040355 419
319 iso_pu_bacteria 2516653085 2517075847 419
320 iso_pu_bacteria 2517093000 2517094427 419
321 iso_pu_bacteria 2517287029 2517406223 419
322 iso_pu_bacteria 2517487022 2517565580 419
323 iso_pu_bacteria 2524023207 2524449562 419
324 iso_pu_bacteria 2582581307 2585276724 419
325 iso_pu_bacteria 2585427526 2585528900 419
326 iso_pu_bacteria 2585427528 2585540208 419
327 iso_pu_bacteria 2585427531 2585562698 419
328 iso_pu_bacteria 2585427593 2585838406 419
329 iso_pu_bacteria 2585427608 2585899338 419
330 iso_pu_bacteria 2585427609 2585908745 419
331 iso_pu_bacteria 2585427633 2585997434 419
332 iso_pu_bacteria 2585427634 2586002040 419
333 iso_pu_bacteria 2585428125 2587984162 419
334 iso_pu_bacteria 2600254933 2600376365 419
335 iso_pu_bacteria 2615840624 2616292952 419
336 iso_pu_bacteria 2643221568 2643858016 419
337 iso_pu_bacteria 2643221643 2644241018 419
338 iso_pu_bacteria 2718218365 2721158244 419
339 iso_pu_bacteria 2724679232 2725951682 419
340 iso_pu_bacteria 2728369397 2730297876 419
341 iso_pu_bacteria 2738541333 2739037847 419
342 iso_pu_bacteria 2765235942 2766063593 419
343 iso_pu_bacteria 2775507049 2776910524 419
344 iso_pu_bacteria 2791355263 2793342671 419
345 iso_pu_bacteria 2791355264 2793350376 419
346 iso_pu_bacteria 2791355266 2793360532 419
347 iso_pu_bacteria 2802428858 2802715972 419
348 iso_pu_bacteria 2802428859 2802723004 419
349 iso_pu_bacteria 2802428860 2802728863 419
350 iso_pu_bacteria 2802428861 2802735230 419
351 iso_pu_bacteria 2802428862 2802742166 419
352 iso_pu_bacteria 2802428863 2802748613 419
353 iso_pu_bacteria 2802429633 2806048506 419
354 iso_pu_bacteria 2802429634 2806053651 419
355 iso_pu_bacteria 2802429635 2806060851 419
356 iso_pu_bacteria 2802429636 2806067726 419
357 iso_pu_bacteria 2802429637 2806072922 419
358 iso_pu_bacteria 2818991272 2819243342 419
359 iso_pu_bacteria 2838029111 2838030643 419
360 iso_pu_bacteria 2842110456 2842111158 419
361 iso_pu_bacteria 2842475841 2842477076 419
362 iso_pu_bacteria 2842502639 2842503873 419
363 iso_pu_bacteria 2854896431 2854902112 419
364 iso_pu_bacteria 2854916844 2854921312 419
365 iso_pu_bacteria 2915980308 2915983637 419
366 iso_pu_bacteria 2916061851 2916065335 419
367 iso_pu_bacteria 2919166419 2919171020 419
368 iso_pu_bacteria 2919171160 2919173730 419
369 iso_pu_bacteria 2921250672 2921256876 419
370 iso_pu_bacteria 2933586486 2933587183 419
371 iso_pu_bacteria 2936996657 2937002229 419
372 iso_pu_bacteria 2937029754 2937034989 419
373 iso_pu_bacteria 2937036028 2937039220 419
374 iso_pu_bacteria 2937078374 2937084367 419
375 iso_pu_bacteria 2937084907 2937086012 419
376 iso_pu_bacteria 2957375807 2957379096 419
377 iso_pu_bacteria 2957437181 2957442998 419
378 iso_pu_bacteria 2960591022 2960595267 419
379 iso_pu_bacteria 2960631154 2960634356 419
380 iso_pu_bacteria 2960680706 2960683415 419
381 iso_pu_bacteria 2967686174 2967687988 419
382 iso_pu_bacteria 2967728569 2967732668 419
383 iso_pu_bacteria 2970026789 2970028910 419
384 iso_pu_bacteria 2970122695 2970128627 419
385 iso_pu_bacteria 2970143518 2970147832 419
386 iso_pu_bacteria 2977530762 2977533913 419
387 iso_pu_bacteria 2977544691 2977548001 419
388 iso_pu_bacteria 2978969890 2978970451 419
389 iso_pu_bacteria 2984587000 2984587482 419
390 iso_pu_bacteria 2989776772 2989777479 419
391 iso_pu_bacteria 8003999396 8004004057 419
392 iso_pu_bacteria 8018150411 8018151939 419
393 iso_pu_bacteria 8056875544 8056878496 419
394 3300006186 Ga0075369_10033014 Ga0075369_100330142 420
395 3300046460 Ga0495638_0074122 Ga0495638_0074122_593_1870 420
396 3300049776 Ga0501280_002083 Ga0501280_002083_359_1633 420
397 3300049823 Ga0501044_0135087 Ga0501044_0135087_971_2245 420
398 3300053125 Ga0500618_000726 Ga0500618_000726_15333_16601 420
399 iso_pu_bacteria 2509276033 2509442718 420
400 iso_pu_bacteria 2510461069 2510839699 420
401 iso_pu_bacteria 2510917030 2511195642 420
402 iso_pu_bacteria 2617270742 2617384518 420
403 iso_pu_bacteria 2643221634 2644195809 420
404 iso_pu_bacteria 2667528174 2671116742 420
405 iso_pu_bacteria 2718217882 2719180627 420
406 iso_pu_bacteria 2718217927 2719385233 420
407 iso_pu_bacteria 2718218009 2719731376 420
408 iso_pu_bacteria 2718218363 2721146721 420
409 iso_pu_bacteria 2718218366 2721163600 420
410 iso_pu_bacteria 2718218423 2721398952 420
411 iso_pu_bacteria 2721755514 2722839770 420
412 iso_pu_bacteria 2721755809 2724037765 420
413 iso_pu_bacteria 2721755810 2724044132 420
414 iso_pu_bacteria 2721755823 2724109694 420
415 iso_pu_bacteria 2728369365 2730163864 420
416 iso_pu_bacteria 2757320392 2757572098 420
417 iso_pu_bacteria 2765235802 2765468539 420
418 iso_pu_bacteria 2775507266 2778178915 420
419 iso_pu_bacteria 2791355256 2793297006 420
420 iso_pu_bacteria 2791355259 2793315575 420
421 iso_pu_bacteria 2791355261 2793328795 420
422 iso_pu_bacteria 2791355262 2793335201 420
423 iso_pu_bacteria 2791355265 2793352112 420
424 iso_pu_bacteria 2791355267 2793366260 420
425 iso_pu_bacteria 2838035591 2838038989 420
426 iso_pu_bacteria 2838661181 2838664419 420
427 iso_pu_bacteria 2842482326 2842485691 420
428 iso_pu_bacteria 2904578770 2904582408 420
429 iso_pu_bacteria 2919119836 2919123894 420
430 iso_pu_bacteria 2919408235 2919413887 420
431 iso_pu_bacteria 3005409236 3005413522 420
432 iso_pu_bacteria 8005246636 8005250047 420
433 iso_pu_bacteria 8018127388 8018128310 420
434 iso_pu_bacteria 8024479707 8024485557 420
435 3300006038 Ga0075365_10024767 Ga0075365_100247672 421
436 3300011119 Ga0105246_10019548 Ga0105246_100195482 421
437 3300013102 Ga0157371_10000304 Ga0157371_1000030427 421
438 3300013104 Ga0157370_10000969 Ga0157370_100009691 421
439 3300044684 Ga0466966_0039862 Ga0466966_0039862_825_2096 421
440 3300044694 Ga0466963_0008496 Ga0466963_0008496_3688_4959 421
441 3300044765 Ga0466970_0000129 Ga0466970_0000129_20297_21568 421
442 3300044842 Ga0466957_0026361 Ga0466957_0026361_1136_2407 421
443 3300045836 Ga0466958_0004823 Ga0466958_0004823_1074_2345 421
444 3300045976 Ga0466967_0031937 Ga0466967_0031937_1147_2418 421
445 3300046512 Ga0495610_0006528 Ga0495610_0006528_992_2260 421
446 3300046515 Ga0495620_0034226 Ga0495620_0034226_958_2226 421
447 3300046522 Ga0495643_0046898 Ga0495643_0046898_782_2050 421
448 3300046530 Ga0495654_0000063 Ga0495654_0000063_122482_123753 421
449 3300048916 Ga0496113_0012548 Ga0496113_0012548_3243_4520 421
450 3300048919 Ga0496116_0025948 Ga0496116_0025948_2790_4067 421
451 3300048920 Ga0496117_0000052 Ga0496117_0000052_244428_245705 421
452 3300048921 Ga0496118_0002941 Ga0496118_0002941_18439_19716 421
453 3300048923 Ga0496120_0000019 Ga0496120_0000019_224163_225440 421
454 3300048925 Ga0496122_0000053 Ga0496122_0000053_224163_225440 421
455 3300048925 Ga0496122_0003439 Ga0496122_0003439_10260_11531 421
456 3300048926 Ga0496123_0000038 Ga0496123_0000038_224163_225440 421
457 3300048926 Ga0496123_0002783 Ga0496123_0002783_9288_10559 421
458 3300048927 Ga0496124_0017334 Ga0496124_0017334_4676_5953 421
459 3300048927 Ga0496124_0096601 Ga0496124_0096601_678_1946 421
460 3300048927 Ga0496124_0102302 Ga0496124_0102302_459_1730 421
461 3300048928 Ga0496125_0061727 Ga0496125_0061727_620_1897 421
462 3300050491 nmdc:mga00v17_11_c1 nmdc:mga00v17_11_c1_110086_111363 421
463 3300050492 nmdc:mga0yw44_11438_c2 nmdc:mga0yw44_11438_c2_1464_2741 421
464 3300050492 nmdc:mga0yw44_528_c1 nmdc:mga0yw44_528_c1_8992_10269 421
465 3300053125 Ga0500618_014746 Ga0500618_014746_192_1460 421
466 iso_pu_bacteria 2509276021 2509387318 421
467 iso_pu_bacteria 2529292951 2530644968 421
468 iso_pu_bacteria 2554235003 2554245066 421
469 iso_pu_bacteria 2558860242 2559297103 421
470 iso_pu_bacteria 2582581298 2585222423 421
471 iso_pu_bacteria 2582581866 2585398052 421
472 iso_pu_bacteria 2585427529 2585544625 421
473 iso_pu_bacteria 2643221693 2644521346 421
474 iso_pu_bacteria 2718217997 2719665059 421
475 iso_pu_bacteria 2718218199 2720491479 421
476 iso_pu_bacteria 2718218232 2720612773 421
477 iso_pu_bacteria 2718218233 2720619626 421
478 iso_pu_bacteria 2718218235 2720631064 421
479 iso_pu_bacteria 2718218269 2720774702 421
480 iso_pu_bacteria 2721755556 2723026428 421
481 iso_pu_bacteria 2721755684 2723559971 421
482 iso_pu_bacteria 2721755685 2723566590 421
483 iso_pu_bacteria 2721755819 2724089309 421
484 iso_pu_bacteria 2721755822 2724103855 421
485 iso_pu_bacteria 2728369352 2730107364 421
486 iso_pu_bacteria 2738541293 2738799937 421
487 iso_pu_bacteria 2767802442 2770198261 421
488 iso_pu_bacteria 2775506902 2776272836 421
489 iso_pu_bacteria 2775506904 2776283272 421
490 iso_pu_bacteria 2802429605 2805930081 421
491 iso_pu_bacteria 2802429606 2805934975 421
492 iso_pu_bacteria 2808606387 2808988936 421
493 iso_pu_bacteria 2838048938 2838052331 421
494 iso_pu_bacteria 2838061910 2838066529 421
495 iso_pu_bacteria 2838668709 2838669811 421
496 iso_pu_bacteria 2838701080 2838702183 421
497 iso_pu_bacteria 2839993093 2839993694 421
498 iso_pu_bacteria 2840764183 2840765595 421
499 iso_pu_bacteria 2842146304 2842147272 421
500 iso_pu_bacteria 2842192696 2842197201 421
501 iso_pu_bacteria 2842205361 2842206603 421
502 iso_pu_bacteria 2842250916 2842252338 421
503 iso_pu_bacteria 2842317721 2842322849 421
504 iso_pu_bacteria 2842422224 2842425153 421
505 iso_pu_bacteria 2842428310 2842432759 421
506 iso_pu_bacteria 2842434925 2842439064 421
507 iso_pu_bacteria 2842489311 2842494490 421
508 iso_pu_bacteria 2842495871 2842500578 421
509 iso_pu_bacteria 2899845264 2899845295 421
510 iso_pu_bacteria 2919100787 2919103007 421
511 iso_pu_bacteria 2926760298 2926764070 421
512 iso_pu_bacteria 2979089926 2979090832 421
513 iso_pu_bacteria 2979095461 2979096357 421
514 iso_pu_bacteria 2996893221 2996893935 421
515 iso_pu_bacteria 3002141150 3002146242 421
516 iso_pu_bacteria 650716007 650843530 421
517 iso_pu_bacteria 8005301065 8005307208 421
518 iso_pu_bacteria 8005382845 8005384838 421
519 iso_pu_bacteria 8005395548 8005398287 421
520 iso_pu_bacteria 8005497431 8005499723 421
521 iso_pu_bacteria 8005668836 8005671144 421
522 iso_pu_bacteria 8005688590 8005695118 421
523 iso_pu_bacteria 8024501048 8024505036 421
524 iso_pu_bacteria 8056375014 8056379951 421
525 3300003187 JGI25151J46595_10000007 JGI25151J46595_1000000747 422
526 3300003187 JGI25151J46595_10000326 JGI25151J46595_1000032611 422
527 3300003215 JGI25153J46596_10000313 JGI25153J46596_1000031318 422
528 3300003215 JGI25153J46596_10009273 JGI25153J46596_100092732 422
529 3300003215 JGI25153J46596_10013416 JGI25153J46596_100134164 422
530 3300003354 JGI25160J50197_1000444 JGI25160J50197_100044411 422
531 3300003771 Ga0055526_1000613 Ga0055526_100061318 422
532 3300003775 Ga0055524_1011214 Ga0055524_10112144 422
533 3300003790 Ga0055528_1002439 Ga0055528_100243911 422
534 3300003790 Ga0055528_1012778 Ga0055528_10127784 422
535 3300004625 Ga0055543_1000148 Ga0055543_100014833 422
536 3300005262 Ga0065165_1007476 Ga0065165_10074763 422
537 3300006038 Ga0075365_10002212 Ga0075365_100022129 422
538 3300006177 Ga0075362_10011130 Ga0075362_100111303 422
539 3300006178 Ga0075367_10011778 Ga0075367_100117783 422
540 3300025245 Ga0207425_1000018 Ga0207425_1000018283 422
541 3300025245 Ga0207425_1007730 Ga0207425_10077303 422
542 3300025258 Ga0209129_1000026 Ga0209129_100002646 422
543 3300025258 Ga0209129_1001927 Ga0209129_10019271 422
544 3300025273 Ga0209673_1000877 Ga0209673_100087732 422
545 3300025273 Ga0209673_1007389 Ga0209673_10073893 422
546 3300025294 Ga0209025_1000035 Ga0209025_100003546 422
547 3300025294 Ga0209025_1000097 Ga0209025_1000097186 422
548 3300025295 Ga0209564_1000827 Ga0209564_100082734 422
549 3300025295 Ga0209564_1010367 Ga0209564_10103671 422
550 3300025297 Ga0209758_1000040 Ga0209758_100004046 422
551 3300025297 Ga0209758_1000652 Ga0209758_100065224 422
552 3300025297 Ga0209758_1014705 Ga0209758_10147051 422
553 3300025299 Ga0209256_1003847 Ga0209256_100384710 422
554 3300025299 Ga0209256_1006646 Ga0209256_10066463 422
555 3300025302 Ga0207426_1000094 Ga0207426_1000094184 422
556 3300027312 Ga0209371_1000703 Ga0209371_10007035 422
557 3300030500 Ga0268256_1004304 Ga0268256_10043042 422
558 3300031901 Ga0307406_10021539 Ga0307406_100215392 422
559 3300031911 Ga0307412_10003681 Ga0307412_100036816 422
560 3300031911 Ga0307412_10068068 Ga0307412_100680682 422
561 3300041404 Ga0439436_0040474 Ga0439436_0040474_13_1317 422
562 3300041491 Ga0451833_0078687 Ga0451833_0078687_633_1907 422
563 3300041503 Ga0451847_0635639 Ga0451847_0635639_274_1548 422
564 3300046460 Ga0495638_0082242 Ga0495638_0082242_137_1411 422
565 3300046474 Ga0495605_0017316 Ga0495605_0017316_944_2218 422
566 3300046501 Ga0495607_0041404 Ga0495607_0041404_957_2231 422
567 3300046507 Ga0495606_0018665 Ga0495606_0018665_794_2068 422
568 3300046515 Ga0495620_0026199 Ga0495620_0026199_424_1698 422
569 3300046518 Ga0495631_0047053 Ga0495631_0047053_372_1646 422
570 3300046519 Ga0495632_0019294 Ga0495632_0019294_1752_3026 422
571 3300046522 Ga0495643_0008402 Ga0495643_0008402_4839_6113 422
572 3300046530 Ga0495654_0025530 Ga0495654_0025530_1079_2353 422
573 3300046542 Ga0495597_0032515 Ga0495597_0032515_112_1386 422
574 3300046558 Ga0495633_0007159 Ga0495633_0007159_2719_3993 422
575 3300046616 Ga0495668_0098438 Ga0495668_0098438_184_1458 422
576 3300046665 Ga0495661_0025399 Ga0495661_0025399_2132_3406 422
577 3300046691 Ga0495670_0026642 Ga0495670_0026642_362_1636 422
578 3300046810 Ga0495660_0018178 Ga0495660_0018178_184_1458 422
579 3300047443 Ga0495687_044720 Ga0495687_044720_291_1565 422
580 3300048903 Ga0496100_0134895 Ga0496100_0134895_405_1685 422
581 3300048919 Ga0496116_0000346 Ga0496116_0000346_71282_72562 422
582 3300048919 Ga0496116_0003601 Ga0496116_0003601_1608_2891 422
583 3300048920 Ga0496117_0002893 Ga0496117_0002893_18508_19788 422
584 3300048920 Ga0496117_0017985 Ga0496117_0017985_216_1499 422
585 3300048921 Ga0496118_0000746 Ga0496118_0000746_822_2102 422
586 3300048921 Ga0496118_0015943 Ga0496118_0015943_4603_5886 422
587 3300048921 Ga0496118_0060199 Ga0496118_0060199_953_2239 422
588 3300048922 Ga0496119_0021519 Ga0496119_0021519_1113_2396 422
589 3300048924 Ga0496121_0061857 Ga0496121_0061857_1376_2659 422
590 3300048925 Ga0496122_0004410 Ga0496122_0004410_15424_16704 422
591 3300048925 Ga0496122_0004580 Ga0496122_0004580_3723_5009 422
592 3300048925 Ga0496122_0081260 Ga0496122_0081260_89_1372 422
593 3300048926 Ga0496123_0039294 Ga0496123_0039294_900_2180 422
594 3300048927 Ga0496124_0000111 Ga0496124_0000111_2459_3739 422
595 3300048927 Ga0496124_0056959 Ga0496124_0056959_1923_3206 422
596 3300048928 Ga0496125_0046707 Ga0496125_0046707_2130_3413 422
597 3300050489 nmdc:mga03683_10856_c1 nmdc:mga03683_10856_c1_941_2215 422
598 3300050492 nmdc:mga0yw44_14017_c1 nmdc:mga0yw44_14017_c1_1867_3141 422
599 3300050494 nmdc:mga06z11_16787_c1 nmdc:mga06z11_16787_c1_1079_2353 422
600 3300050496 nmdc:mga07m45_15174_c1 nmdc:mga07m45_15174_c1_818_2092 422
601 3300053134 Ga0500658_0000846 Ga0500658_0000846_4963_6237 422
602 3300053177 Ga0500636_0000039 Ga0500636_0000039_56344_57630 422
603 iso_pu_bacteria 2513237159 2514002363 422
604 iso_pu_bacteria 2537561587 2537873086 422
605 iso_pu_bacteria 2582581283 2585167112 422
606 iso_pu_bacteria 2582581306 2585266758 422
607 iso_pu_bacteria 2582581865 2585387799 422
608 iso_pu_bacteria 2599185210 2599604932 422
609 iso_pu_bacteria 2643221582 2643916734 422
610 iso_pu_bacteria 2643221607 2644048167 422
611 iso_pu_bacteria 2643221636 2644201893 422
612 iso_pu_bacteria 2643221686 2644480960 422
613 iso_pu_bacteria 2690316117 2692318392 422
614 iso_pu_bacteria 2751185821 2753462736 422
615 iso_pu_bacteria 2791355091 2792619453 422
616 iso_pu_bacteria 2791355092 2792627225 422
617 iso_pu_bacteria 2791355094 2792641045 422
618 iso_pu_bacteria 2791355260 2793321391 422
619 iso_pu_bacteria 2838016132 2838018557 422
620 iso_pu_bacteria 2838022645 2838022730 422
621 iso_pu_bacteria 2838042994 2838047717 422
622 iso_pu_bacteria 2838680041 2838682799 422
623 iso_pu_bacteria 2838686498 2838693437 422
624 iso_pu_bacteria 2838694306 2838697432 422
625 iso_pu_bacteria 2838707686 2838709390 422
626 iso_pu_bacteria 2838729681 2838735129 422
627 iso_pu_bacteria 2838742623 2838748020 422
628 iso_pu_bacteria 2841851746 2841857587 422
629 iso_pu_bacteria 2841859092 2841861969 422
630 iso_pu_bacteria 2842077413 2842077501 422
631 iso_pu_bacteria 2842118031 2842119990 422
632 iso_pu_bacteria 2842156927 2842162893 422
633 iso_pu_bacteria 2842163707 2842165197 422
634 iso_pu_bacteria 2842180545 2842186577 422
635 iso_pu_bacteria 2842198810 2842201443 422
636 iso_pu_bacteria 2842217011 2842220420 422
637 iso_pu_bacteria 2842229732 2842235781 422
638 iso_pu_bacteria 2842237096 2842238802 422
639 iso_pu_bacteria 2842243621 2842249109 422
640 iso_pu_bacteria 2842257432 2842263064 422
641 iso_pu_bacteria 2842271015 2842277956 422
642 iso_pu_bacteria 2842291075 2842291163 422
643 iso_pu_bacteria 2842304105 2842309940 422
644 iso_pu_bacteria 2842363717 2842366925 422
645 iso_pu_bacteria 2842370503 2842373428 422
646 iso_pu_bacteria 2842377471 2842377559 422
647 iso_pu_bacteria 2842384541 2842386500 422
648 iso_pu_bacteria 2842515876 2842517765 422
649 iso_pu_bacteria 2844454524 2844454668 422
650 iso_pu_bacteria 2847417321 2847423106 422
651 iso_pu_bacteria 2848992105 2848997502 422
652 iso_pu_bacteria 2855872281 2855874091 422
653 iso_pu_bacteria 2857516855 2857523333 422
654 iso_pu_bacteria 2899792073 2899794752 422
655 iso_pu_bacteria 2933011516 2933013394 422
656 iso_pu_bacteria 2933570622 2933576331 422
657 iso_pu_bacteria 2935894831 2935900434 422
658 iso_pu_bacteria 2935901341 2935905142 422
659 iso_pu_bacteria 2936367885 2936373370 422
660 iso_pu_bacteria 2936375103 2936378639 422
661 iso_pu_bacteria 2936381700 2936384730 422
662 iso_pu_bacteria 2960693952 2960695267 422
663 iso_pu_bacteria 639633055 639647876 422
664 iso_pu_bacteria 643692032 643822999 422
665 iso_pu_bacteria 8003570095 8003573205 422
666 iso_pu_bacteria 8005307578 8005314827 422
667 iso_pu_bacteria 8005376324 8005378600 422
668 iso_pu_bacteria 8005460587 8005462316 422
669 iso_pu_bacteria 8005556819 8005558314 422
670 iso_pu_bacteria 8005563573 8005569495 422
671 iso_pu_bacteria 8005570704 8005575233 422
672 iso_pu_bacteria 8005619151 8005620903 422
673 iso_pu_bacteria 8018163183 8018164808 422
674 iso_pu_bacteria 8023680758 8023680777 422
675 iso_pu_bacteria 8054460903 8054463612 422
676 iso_pu_bacteria 8057874678 8057875690 422
677 3300002704 JGI25155J39150_1000056 JGI25155J39150_100005672 423
678 3300002705 JGI25156J39149_1000007 JGI25156J39149_1000007242 423
679 3300002737 JGI25162J39368_1001472 JGI25162J39368_10014722 423
680 3300002737 JGI25162J39368_1002141 JGI25162J39368_10021412 423
681 3300002738 JGI25154J39366_1000013 JGI25154J39366_100001372 423
682 3300002741 JGI25157J39369_1000099 JGI25157J39369_100009972 423
683 3300003214 JGI25165J46597_1001164 JGI25165J46597_100116415 423
684 3300003214 JGI25165J46597_1001468 JGI25165J46597_10014688 423
685 3300003320 rootH2_10040852 rootH2_100408522 423
686 3300003322 rootL2_10041562 rootL2_100415629 423
687 3300003323 rootH1_10052729 rootH1_100527295 423
688 3300003771 Ga0055526_1001408 Ga0055526_10014087 423
689 3300003775 Ga0055524_1018122 Ga0055524_10181223 423
690 3300003790 Ga0055528_1000067 Ga0055528_100006712 423
691 3300003790 Ga0055528_1000515 Ga0055528_100051514 423
692 3300003790 Ga0055528_1012760 Ga0055528_10127603 423
693 3300003792 Ga0055540_1000313 Ga0055540_100031327 423
694 3300003856 Ga0058692_1002710 Ga0058692_10027103 423
695 3300005614 Ga0068856_100036031 Ga0068856_1000360314 423
696 3300006948 Ga0099826_10000297 Ga0099826_100002974 423
697 3300006948 Ga0099826_10025049 Ga0099826_100250493 423
698 3300009765 Ga0123341_1000001 Ga0123341_1000001290 423
699 3300009766 Ga0123342_1015994 Ga0123342_10159943 423
700 3300025206 Ga0209435_100006 Ga0209435_100006284 423
701 3300025233 Ga0209437_100023 Ga0209437_100023379 423
702 3300025233 Ga0209437_100341 Ga0209437_10034148 423
703 3300025246 Ga0209646_1000015 Ga0209646_1000015251 423
704 3300025250 Ga0209026_1000046 Ga0209026_1000046251 423
705 3300025256 Ga0209759_1000005 Ga0209759_1000005284 423
706 3300025261 Ga0209233_1000062 Ga0209233_100006296 423
707 3300025261 Ga0209233_1000970 Ga0209233_10009702 423
708 3300025273 Ga0209673_1000005 Ga0209673_1000005120 423
709 3300025273 Ga0209673_1000310 Ga0209673_100031025 423
710 3300025273 Ga0209673_1000852 Ga0209673_100085224 423
711 3300025294 Ga0209025_1007433 Ga0209025_10074332 423
712 3300025295 Ga0209564_1000137 Ga0209564_100013776 423
713 3300025297 Ga0209758_1000843 Ga0209758_100084332 423
714 3300025298 Ga0209050_1004675 Ga0209050_10046753 423
715 3300025299 Ga0209256_1000243 Ga0209256_1000243153 423
716 3300025299 Ga0209256_1003072 Ga0209256_10030729 423
717 3300025303 Ga0209051_1000166 Ga0209051_100016620 423
718 3300026078 Ga0207702_10025869 Ga0207702_100258694 423
719 3300027312 Ga0209371_1000035 Ga0209371_1000035305 423
720 3300027666 Ga0209282_1018922 Ga0209282_10189223 423
721 3300028794 Ga0307515_10088655 Ga0307515_100886553 423
722 3300030500 Ga0268256_1000037 Ga0268256_1000037304 423
723 3300041413 Ga0439465_0011117 Ga0439465_0011117_1229_2506 423
724 3300046460 Ga0495638_0011576 Ga0495638_0011576_1085_2380 423
725 3300046474 Ga0495605_0002741 Ga0495605_0002741_1459_2757 423
726 3300046492 Ga0495585_0002821 Ga0495585_0002821_6391_7689 423
727 3300046506 Ga0495583_0010915 Ga0495583_0010915_115_1413 423
728 3300046507 Ga0495606_0093696 Ga0495606_0093696_410_1708 423
729 3300046513 Ga0495616_0030010 Ga0495616_0030010_389_1687 423
730 3300046518 Ga0495631_0001667 Ga0495631_0001667_9023_10321 423
731 3300046519 Ga0495632_0004656 Ga0495632_0004656_414_1691 423
732 3300046522 Ga0495643_0078187 Ga0495643_0078187_266_1543 423
733 3300046522 Ga0495643_0082196 Ga0495643_0082196_10_1308 423
734 3300046616 Ga0495668_0015549 Ga0495668_0015549_1975_3273 423
735 3300046648 Ga0495611_0067088 Ga0495611_0067088_110_1408 423
736 3300046660 Ga0495625_0002084 Ga0495625_0002084_10443_11741 423
737 3300046691 Ga0495670_0030487 Ga0495670_0030487_798_2096 423
738 3300046810 Ga0495660_0006931 Ga0495660_0006931_3542_4840 423
739 3300047320 Ga0495672_0010381 Ga0495672_0010381_860_2158 423
740 3300048907 Ga0496104_0085989 Ga0496104_0085989_455_1750 423
741 3300048919 Ga0496116_0052828 Ga0496116_0052828_510_1787 423
742 3300048919 Ga0496116_0084657 Ga0496116_0084657_466_1761 423
743 3300048919 Ga0496116_0089377 Ga0496116_0089377_210_1487 423
744 3300048920 Ga0496117_0081992 Ga0496117_0081992_665_1942 423
745 3300048920 Ga0496117_0130991 Ga0496117_0130991_174_1469 423
746 3300048921 Ga0496118_0009334 Ga0496118_0009334_1039_2316 423
747 3300048921 Ga0496118_0051386 Ga0496118_0051386_120_1415 423
748 3300048921 Ga0496118_0066328 Ga0496118_0066328_785_2062 423
749 3300048922 Ga0496119_0007851 Ga0496119_0007851_8054_9349 423
750 3300048922 Ga0496119_0009404 Ga0496119_0009404_3508_4782 423
751 3300048923 Ga0496120_0059566 Ga0496120_0059566_216_1490 423
752 3300048924 Ga0496121_0108313 Ga0496121_0108313_87_1364 423
753 3300048925 Ga0496122_0032871 Ga0496122_0032871_1887_3161 423
754 3300048925 Ga0496122_0054803 Ga0496122_0054803_691_1968 423
755 3300048925 Ga0496122_0107248 Ga0496122_0107248_249_1532 423
756 3300048926 Ga0496123_0014707 Ga0496123_0014707_2701_3975 423
757 3300048926 Ga0496123_0052719 Ga0496123_0052719_1025_2308 423
758 3300048927 Ga0496124_0038683 Ga0496124_0038683_2548_3825 423
759 3300048927 Ga0496124_0085463 Ga0496124_0085463_207_1481 423
760 3300048928 Ga0496125_0030426 Ga0496125_0030426_1009_2304 423
761 3300048928 Ga0496125_0060563 Ga0496125_0060563_796_2073 423
762 3300048929 Ga0496126_0034992 Ga0496126_0034992_2968_4251 423
763 3300049460 Ga0495682_0012302 Ga0495682_0012302_741_2039 423
764 3300053105 Ga0500557_000408 Ga0500557_000408_4009_5307 423
765 3300053107 Ga0500560_000296 Ga0500560_000296_4320_5615 423
766 3300053107 Ga0500560_017815 Ga0500560_017815_358_1653 423
767 3300053109 Ga0500569_003225 Ga0500569_003225_1638_2936 423
768 3300053118 Ga0500594_0000244 Ga0500594_0000244_4000_5298 423
769 3300053125 Ga0500618_009775 Ga0500618_009775_333_1631 423
770 3300053139 Ga0500568_0000617 Ga0500568_0000617_19967_21265 423
771 3300053153 Ga0500616_0001339 Ga0500616_0001339_4061_5359 423
772 3300053156 Ga0500622_0000134 Ga0500622_0000134_76243_77520 423
773 3300053157 Ga0500624_000522 Ga0500624_000522_813_2108 423
774 3300053160 Ga0500633_0002614 Ga0500633_0002614_532_1809 423
775 3300053730 Ga0500645_012164 Ga0500645_012164_94_1392 423
776 3300060353 Ga0501082_0160233 Ga0501082_0160233_582_1859 423
777 iso_pu_bacteria 2513237144 2513910751 423
778 iso_pu_bacteria 2513237146 2513927273 423
779 iso_pu_bacteria 2582581316 2585332853 423
780 iso_pu_bacteria 2599185170 2599415286 423
781 iso_pu_bacteria 2600255279 2601611056 423
782 iso_pu_bacteria 2600255308 2601747829 423
783 iso_pu_bacteria 2615840698 2616552203 423
784 iso_pu_bacteria 2643221689 2644497445 423
785 iso_pu_bacteria 2818991439 2819561178 423
786 iso_pu_bacteria 2818991448 2819610117 423
787 iso_pu_bacteria 2838068647 2838071191 423
788 iso_pu_bacteria 2838675328 2838678451 423
789 iso_pu_bacteria 2838714209 2838716641 423
790 iso_pu_bacteria 2838719591 2838722747 423
791 iso_pu_bacteria 2838724970 2838727392 423
792 iso_pu_bacteria 2841846520 2841849010 423
793 iso_pu_bacteria 2841864319 2841865099 423
794 iso_pu_bacteria 2842124991 2842128241 423
795 iso_pu_bacteria 2842130223 2842133344 423
796 iso_pu_bacteria 2842152218 2842155337 423
797 iso_pu_bacteria 2842170452 2842173837 423
798 iso_pu_bacteria 2842175837 2842178958 423
799 iso_pu_bacteria 2842187318 2842189749 423
800 iso_pu_bacteria 2842211629 2842214063 423
801 iso_pu_bacteria 2842224351 2842226783 423
802 iso_pu_bacteria 2842264693 2842268626 423
803 iso_pu_bacteria 2842278818 2842280060 423
804 iso_pu_bacteria 2842285085 2842287782 423
805 iso_pu_bacteria 2842311132 2842315159 423
806 iso_pu_bacteria 2842341865 2842347090 423
807 iso_pu_bacteria 2842395702 2842399684 423
808 iso_pu_bacteria 2842402390 2842404689 423
809 iso_pu_bacteria 2842409023 2842411272 423
810 iso_pu_bacteria 2842415677 2842418277 423
811 iso_pu_bacteria 2842441272 2842445693 423
812 iso_pu_bacteria 2842447887 2842451462 423
813 iso_pu_bacteria 2842462802 2842466955 423
814 iso_pu_bacteria 2842469257 2842473678 423
815 iso_pu_bacteria 2842521101 2842524329 423
816 iso_pu_bacteria 2919114240 2919116858 423
817 iso_pu_bacteria 2926754445 2926758371 423
818 iso_pu_bacteria 2933006813 2933009284 423
819 iso_pu_bacteria 2933016740 2933017891 423
820 iso_pu_bacteria 2933594066 2933598269 423
821 iso_pu_bacteria 2933599457 2933601990 423
822 iso_pu_bacteria 2979100975 2979101926 423
823 iso_pu_bacteria 2984509177 2984510136 423
824 iso_pu_bacteria 2984518228 2984519161 423
825 iso_pu_bacteria 2984537506 2984538477 423
826 iso_pu_bacteria 2984601300 2984605199 423
827 iso_pu_bacteria 3005416602 3005417234 423
828 iso_pu_bacteria 8005275841 8005280009 423
829 iso_pu_bacteria 8005282627 8005284106 423
830 iso_pu_bacteria 8005289223 8005294607 423
831 iso_pu_bacteria 8005314921 8005320517 423
832 iso_pu_bacteria 8005430974 8005436287 423
833 iso_pu_bacteria 8005484373 8005487486 423
834 iso_pu_bacteria 8005626139 8005627403 423
835 iso_pu_bacteria 8005645114 8005647890 423
836 iso_pu_bacteria 8005682033 8005684260 423
837 iso_pu_bacteria 8005695170 8005696353 423
838 iso_pu_bacteria 8018176218 8018177795 423
839 iso_pu_bacteria 8024486573 8024486657 423
840 iso_pu_bacteria 8056382006 8056387735 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

19

284

0.97

PF09084

NMT1

NMT1/THI5 like

157

276

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.9123 19 410
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.9032 19 410
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8808 22 370
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8751 22 370
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8651 23 413
ID Description Score Start End Superfamily
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.922 106 227 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8776 19 380 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8555 107 225 3.40.190.10
2regA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8328 23 76 3.40.190.10
3ix1B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8295 22 281 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2N7SGS2-F1-model_v4 deleted 0.9772 19 213
AF-A0A840M481-F1-model_v4 deleted 0.9736 23 406
AF-A0A840R6A8-F1-model_v4 Nitrate/nitrite transport system substrate-binding protein 0.968 23 411 GO:0005886
GO:0012505
AF-A0A528X090-F1-model_v4 ABC transporter substrate-binding protein 0.9674 97 407 GO:0005886
GO:0012505
AF-A0A2N7SGS2-F1-model_v4 deleted 0.9673 19 213

Feature Viewer

pLDDT pTM Quality
91.84 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map