F483073

General Info

Members Datasets Scaffolds Average Seq Length
841 488 1682 194

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1010227|JGI25159J45721_10102272
Length 195
Sequence MNKPSNTSEDILACARTLIASGGYNGFSYADIAQVVSIRKASIHHHFPAKVDLVKALIARYRQDTEAGVAYIEGSAPGALDQLRAYVQYWKTCIGDGSSAFCVCAMLASELPILPHEVALEVRSYFRFLSGWLASLLERGAQQGLIVLGSGDARSEAEAFMATVHGAMLSARAYGDPAVFGVIMDQQLFRLAAKP

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
66 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
82 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
146 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
151 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
265 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
266 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
269 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
276 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
282 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
283 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
284 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
285 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
286 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
287 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
288 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
289 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
290 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
291 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
292 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
293 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
294 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
295 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
296 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
297 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
298 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
299 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
300 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
301 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
302 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
303 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
304 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
305 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
306 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
307 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
308 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
309 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
310 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
311 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
312 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
313 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
314 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
315 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
316 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
317 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
318 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
319 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
320 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
321 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
322 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
323 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
324 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
325 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
326 2643221645 Massilia sp. Root351 Isolate Unclassified
327 2643221664 Massilia sp. Root418 Isolate Unclassified
328 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
329 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
330 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
331 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
332 2738541293 Rhizobium sp. GV031 Isolate Unclassified
333 2738541300 Massilia sp. GV016 Isolate Unclassified
334 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
335 2738543018 Massilia sp. GV045 Isolate Unclassified
336 2738543030 Massilia sp. GV097 Isolate Unclassified
337 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
338 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
339 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
340 2791355263 Rhizobium chutanense C5 Isolate Nodule
341 2791355267 Rhizobium sp. L18 Isolate Nodule
342 2802429633 Rhizobium anhuiense J3 Isolate Nodule
343 2802429634 Rhizobium anhuiense S10 Isolate Nodule
344 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
345 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
346 2802429637 Rhizobium anhuiense C15 Isolate Nodule
347 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
348 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
349 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
350 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
351 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
352 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
353 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
354 2841760612 Bosea sp. Tri-49 Isolate Nodule
355 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
356 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
357 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
358 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
359 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
360 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
361 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
362 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
363 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
364 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
365 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
366 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
367 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
368 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
369 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
370 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
371 2844104063 Bosea sp. Tri-39 Isolate Nodule
372 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
373 2851182111 Bosea sp. Tri-44 Isolate Nodule
374 2851246043 Bosea sp. Tri-54 Isolate Nodule
375 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
376 2854911287 Brucella lupini LUP21 Isolate Unclassified
377 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
378 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
379 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
380 2857564685 Duganella sp. R-74599 Isolate Unclassified
381 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
382 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
383 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
384 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
385 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
386 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
387 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
388 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
389 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
390 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
391 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
392 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
393 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
394 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
395 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
396 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
397 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
398 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
399 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
400 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
401 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
402 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
403 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
404 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
405 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
406 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
407 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
408 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
409 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
410 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
411 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
412 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
413 2909042592 Labrys sp. LIt4 Isolate Nodule
414 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
415 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
416 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
417 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
418 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
419 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
420 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
421 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
422 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
423 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
424 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
425 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
426 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
427 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
428 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
429 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
430 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
431 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
432 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
433 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
434 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
435 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
436 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
437 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
438 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
439 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
440 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
441 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
442 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
443 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
444 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
445 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
446 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
447 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
448 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
449 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
450 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
451 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
452 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
453 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
454 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
455 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
456 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
457 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
458 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
459 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
460 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
461 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
462 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
463 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
464 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
465 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
466 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
467 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
468 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
469 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
470 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
471 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
472 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
473 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
474 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
475 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
476 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
477 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
478 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
479 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
480 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
481 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
482 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
483 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
484 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
485 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
486 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
487 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
488 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.27
Metatranscriptomes 0
Isolates 24.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 25.45
Nodule 17.48
Rhizoplane 2.38
Rhizosphere 36.86
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1010227 3300002987 Bacteria 2409
2 JGI24739J22299_10143181 3300001989 Bacteria 708
3 JGI25156J39149_1007065 3300002705 Bacteria 2998
4 JGI25158J39367_1000147 3300002739 Bacteria 16476
5 JGI25157J39369_1001441 3300002741 Bacteria 8954
6 JGI25152J39213_1000001 3300002773 Bacteria 224104
7 JGI25152J39213_1009455 3300002773 Bacteria 2315
8 JGI25150J39212_1000007 3300002774 Bacteria 253635
9 JGI25159J45721_1000695 3300002987 Bacteria 14706
10 JGI25151J46595_10000013 3300003187 Bacteria 253635
11 JGI25151J46595_10002485 3300003187 Bacteria 11035
12 JGI25151J46595_10004416 3300003187 Bacteria 7446
13 JGI25165J46597_1000079 3300003214 Bacteria 179163
14 JGI25153J46596_10000640 3300003215 Bacteria 21401
15 JGI25153J46596_10005600 3300003215 Bacteria 6563
16 JGI25153J46596_10011017 3300003215 Bacteria 4033
17 JGI25153J46596_10037408 3300003215 Bacteria 1543
18 JGI25153J46596_10039892 3300003215 Bacteria 1462
19 rootH1_10017387 3300003316 Bacteria 40873
20 rootH2_10299493 3300003320 Bacteria 1155
21 rootL2_10107941 3300003322 Bacteria 2748
22 rootH1_10035776 3300003323 Bacteria 1900
23 rootH1_10142015 3300003323 Bacteria 3077
24 rootH1_10217570 3300003323 Bacteria 2319
25 JGI25160J50197_1000022 3300003354 Bacteria 201071
26 JGI25160J50197_1001505 3300003354 Bacteria 11577
27 JGI25160J50197_1007219 3300003354 Bacteria 4373
28 JGI25161J50226_1000024 3300003374 Bacteria 152176
29 JGI25161J50226_1000154 3300003374 Bacteria 47801
30 JGI25161J50226_1003426 3300003374 Bacteria 3628
31 Ga0055539_1003522 3300003752 Bacteria 2179
32 Ga0055535_1007104 3300003761 Bacteria 2177
33 Ga0055542_1001962 3300003762 Bacteria 7992
34 Ga0055529_1004114 3300003763 Bacteria 2257
35 Ga0055526_1002360 3300003771 Bacteria 12814
36 Ga0055526_1009151 3300003771 Bacteria 4813
37 Ga0055526_1018520 3300003771 Bacteria 2594
38 Ga0055537_1000103 3300003773 Bacteria 63399
39 Ga0055524_1001735 3300003775 Bacteria 12094
40 Ga0055524_1006641 3300003775 Bacteria 5002
41 Ga0055524_1018190 3300003775 Bacteria 2448
42 Ga0055536_1005082 3300003781 Bacteria 6530
43 Ga0055534_1000317 3300003784 Bacteria 32025
44 Ga0055528_1000031 3300003790 Bacteria 120960
45 Ga0055528_1006346 3300003790 Bacteria 5373
46 Ga0055528_1007257 3300003790 Bacteria 4920
47 Ga0055528_1013691 3300003790 Bacteria 3056
48 Ga0055528_1016425 3300003790 Bacteria 2618
49 Ga0055540_1010940 3300003792 Bacteria 2976
50 Ga0055540_1028948 3300003792 Bacteria 1303
51 Ga0055540_1034201 3300003792 Bacteria 1146
52 Ga0055543_1000125 3300004625 Bacteria 63343
53 Ga0055543_1000513 3300004625 Bacteria 22087
54 Ga0055543_1001652 3300004625 Bacteria 8502
55 Ga0055543_1004558 3300004625 Bacteria 3740
56 Ga0065165_1000051 3300005262 Bacteria 194844
57 Ga0065165_1000439 3300005262 Bacteria 65347
58 Ga0065165_1005437 3300005262 Bacteria 7160
59 Ga0065165_1081622 3300005262 Bacteria 838
60 Ga0070658_10015348 3300005327 Bacteria 6130
61 Ga0070658_10440893 3300005327 Bacteria 1121
62 Ga0070676_10224910 3300005328 Bacteria 1241
63 Ga0070670_100000133 3300005331 Bacteria 69691
64 Ga0070669_100162007 3300005353 Bacteria 1739
65 Ga0070671_100013556 3300005355 Bacteria 6572
66 Ga0070667_100032879 3300005367 Bacteria 4329
67 Ga0070667_100433010 3300005367 Bacteria 1200
68 Ga0070663_100317289 3300005455 Bacteria 1252
69 Ga0070685_10481149 3300005466 Bacteria 875
70 Ga0068853_100087342 3300005539 Bacteria 2736
71 Ga0068853_100370186 3300005539 Bacteria 1336
72 Ga0070665_100004155 3300005548 Bacteria 15236
73 Ga0068855_100005827 3300005563 Bacteria 15039
74 Ga0068857_101013580 3300005577 Bacteria 799
75 Ga0068852_100295556 3300005616 Bacteria 1566
76 Ga0068859_100498381 3300005617 Bacteria 1313
77 Ga0068863_100013407 3300005841 Bacteria 7903
78 Ga0068860_100244881 3300005843 Bacteria 1744
79 Ga0068862_100188986 3300005844 Bacteria 1852
80 Ga0081540_1045274 3300005983 Bacteria 2237
81 Ga0075365_10015925 3300006038 Bacteria 4559
82 Ga0075365_10034333 3300006038 Bacteria 3275
83 Ga0075365_10036220 3300006038 Bacteria 3196
84 Ga0075365_10523189 3300006038 Bacteria 839
85 Ga0075368_10069582 3300006042 Bacteria 1420
86 Ga0075368_10074203 3300006042 Bacteria 1377
87 Ga0075363_100089068 3300006048 Bacteria 1697
88 Ga0075363_100246756 3300006048 Bacteria 1027
89 Ga0075363_100285269 3300006048 Bacteria 956
90 Ga0075364_10158518 3300006051 Bacteria 1527
91 Ga0075362_10013087 3300006177 Bacteria 3312
92 Ga0075362_10086383 3300006177 Bacteria 1451
93 Ga0075362_10160809 3300006177 Bacteria 1081
94 Ga0075367_10050070 3300006178 Bacteria 2465
95 Ga0075367_10053778 3300006178 Bacteria 2387
96 Ga0075367_10155947 3300006178 Bacteria 1418
97 Ga0075369_10009159 3300006186 Bacteria 3836
98 Ga0075369_10009605 3300006186 Bacteria 3763
99 Ga0075369_10019280 3300006186 Bacteria 2784
100 Ga0075369_10115653 3300006186 Bacteria 1211
101 Ga0075366_10074784 3300006195 Bacteria 2020
102 Ga0075366_10202987 3300006195 Bacteria 1206
103 Ga0075370_10024096 3300006353 Bacteria 3358
104 Ga0075370_10063254 3300006353 Bacteria 2109
105 Ga0075370_10178295 3300006353 Bacteria 1250
106 Ga0075370_10381898 3300006353 Bacteria 844
107 Ga0097620_100498403 3300006931 Bacteria 1313
108 Ga0105244_10004485 3300009036 Bacteria 9590
109 Ga0105240_10031594 3300009093 Bacteria 6863
110 Ga0105240_10118452 3300009093 Bacteria 3191
111 Ga0105240_10131078 3300009093 Bacteria 3007
112 Ga0105240_10527314 3300009093 Bacteria 1310
113 Ga0105241_10545483 3300009174 Bacteria 1040
114 Ga0105242_10591399 3300009176 Bacteria 1070
115 Ga0105242_10688563 3300009176 Bacteria 999
116 Ga0105248_10219814 3300009177 Bacteria 2139
117 Ga0105248_10596640 3300009177 Bacteria 1246
118 Ga0105237_10032528 3300009545 Bacteria 5280
119 Ga0105237_10174637 3300009545 Bacteria 2149
120 Ga0105237_10220033 3300009545 Bacteria 1899
121 Ga0105237_10349530 3300009545 Bacteria 1483
122 Ga0105238_10155985 3300009551 Bacteria 2258
123 Ga0105238_11230290 3300009551 Bacteria 774
124 Ga0123342_1009171 3300009766 Bacteria 11998
125 Ga0105033_102193 3300009986 Bacteria 1618
126 Ga0105239_10128575 3300010375 Bacteria 2816
127 Ga0105239_10214198 3300010375 Bacteria 2159
128 Ga0105239_10291625 3300010375 Bacteria 1837
129 Ga0105239_10317884 3300010375 Bacteria 1755
130 Ga0105239_10395079 3300010375 Bacteria 1564
131 Ga0105239_10476348 3300010375 Bacteria 1418
132 Ga0105239_10581782 3300010375 Bacteria 1276
133 Ga0105239_10857598 3300010375 Bacteria 1042
134 Ga0157373_10072471 3300013100 Bacteria 2431
135 Ga0157371_10024423 3300013102 Bacteria 4413
136 Ga0157369_10307003 3300013105 Bacteria 1650
137 Ga0157378_10415752 3300013297 Bacteria 1328
138 Ga0157378_10707947 3300013297 Bacteria 1027
139 Ga0163162_10630477 3300013306 Bacteria 1197
140 Ga0157372_10316079 3300013307 Bacteria 1818
141 Ga0157372_10481303 3300013307 Bacteria 1447
142 Ga0163163_10087771 3300014325 Bacteria 3121
143 Ga0163163_11040635 3300014325 Bacteria 882
144 Ga0182008_10139732 3300014497 Bacteria 1211
145 Ga0182008_10358043 3300014497 Bacteria 775
146 Ga0157376_10236718 3300014969 Bacteria 1699
147 Ga0157376_10326539 3300014969 Bacteria 1460
148 Ga0182007_10005652 3300015262 Bacteria 5458
149 Ga0182007_10006344 3300015262 Bacteria 5085
150 Ga0182005_1004353 3300015265 Bacteria 4600
151 Ga0182005_1005418 3300015265 Bacteria 3989
152 Ga0163161_10555417 3300017792 Bacteria 942
153 Ga0213872_10060697 3300021361 Bacteria 1710
154 Ga0228711_1004434 3300022739 Bacteria 21595
155 Ga0228710_1004658 3300022740 Bacteria 21595
156 Ga0209436_100021 3300025208 Bacteria 102115
157 Ga0207427_102046 3300025231 Bacteria 6047
158 Ga0209437_100590 3300025233 Bacteria 23064
159 Ga0209258_100341 3300025242 Bacteria 68437
160 Ga0207425_1000032 3300025245 Bacteria 253689
161 Ga0207425_1000699 3300025245 Bacteria 18154
162 Ga0207425_1002075 3300025245 Bacteria 7443
163 Ga0207425_1007448 3300025245 Bacteria 2885
164 Ga0207425_1011452 3300025245 Bacteria 2113
165 Ga0209026_1000118 3300025250 Bacteria 130611
166 Ga0209677_100364 3300025253 Bacteria 27796
167 Ga0209148_1000212 3300025254 Bacteria 101454
168 Ga0209759_1000076 3300025256 Bacteria 175911
169 Ga0209129_1000056 3300025258 Bacteria 253689
170 Ga0209129_1000149 3300025258 Bacteria 114222
171 Ga0209129_1003333 3300025258 Bacteria 7078
172 Ga0209129_1004094 3300025258 Bacteria 5937
173 Ga0209129_1014147 3300025258 Bacteria 1714
174 Ga0209233_1000247 3300025261 Bacteria 87890
175 Ga0209233_1000250 3300025261 Bacteria 85129
176 Ga0209565_1000035 3300025263 Bacteria 298125
177 Ga0209455_1000170 3300025272 Bacteria 110681
178 Ga0209673_1000006 3300025273 Bacteria 650600
179 Ga0209673_1001640 3300025273 Bacteria 19356
180 Ga0209673_1002960 3300025273 Bacteria 10625
181 Ga0209673_1010222 3300025273 Bacteria 3975
182 Ga0209673_1011182 3300025273 Bacteria 3717
183 Ga0209673_1013245 3300025273 Bacteria 3266
184 Ga0209673_1052102 3300025273 Bacteria 1076
185 Ga0209130_1000019 3300025284 Bacteria 381993
186 Ga0209130_1000063 3300025284 Bacteria 198142
187 Ga0209130_1000251 3300025284 Bacteria 67741
188 Ga0209675_1000005 3300025291 Bacteria 849192
189 Ga0209675_1033682 3300025291 Bacteria 1185
190 Ga0209676_1000138 3300025292 Bacteria 178932
191 Ga0209025_1000090 3300025294 Bacteria 253689
192 Ga0209025_1000205 3300025294 Bacteria 141452
193 Ga0209025_1000253 3300025294 Bacteria 125975
194 Ga0209025_1000866 3300025294 Bacteria 47843
195 Ga0209025_1006828 3300025294 Bacteria 8712
196 Ga0209025_1017611 3300025294 Bacteria 4109
197 Ga0209025_1039984 3300025294 Bacteria 2036
198 Ga0209564_1000007 3300025295 Bacteria 1028582
199 Ga0209564_1000083 3300025295 Bacteria 259272
200 Ga0209564_1001757 3300025295 Bacteria 20239
201 Ga0209564_1002391 3300025295 Bacteria 15000
202 Ga0209564_1018387 3300025295 Bacteria 2666
203 Ga0209758_1000084 3300025297 Bacteria 256346
204 Ga0209758_1000296 3300025297 Bacteria 97937
205 Ga0209758_1000567 3300025297 Bacteria 58201
206 Ga0209758_1001105 3300025297 Bacteria 34833
207 Ga0209758_1003899 3300025297 Bacteria 13034
208 Ga0209758_1007385 3300025297 Bacteria 7508
209 Ga0209758_1009542 3300025297 Bacteria 6005
210 Ga0209758_1010105 3300025297 Bacteria 5716
211 Ga0209758_1024193 3300025297 Bacteria 2715
212 Ga0209050_1028567 3300025298 Bacteria 1807
213 Ga0209256_1000141 3300025299 Bacteria 152280
214 Ga0209256_1000200 3300025299 Bacteria 112931
215 Ga0209256_1003442 3300025299 Bacteria 11105
216 Ga0209256_1005526 3300025299 Bacteria 7225
217 Ga0209256_1015501 3300025299 Bacteria 2662
218 Ga0207426_1000005 3300025302 Bacteria 1037188
219 Ga0207426_1000082 3300025302 Bacteria 298939
220 Ga0207426_1000538 3300025302 Bacteria 54233
221 Ga0207426_1020869 3300025302 Bacteria 2271
222 Ga0209051_1017527 3300025303 Bacteria 3197
223 Ga0209051_1050104 3300025303 Bacteria 1401
224 Ga0209257_1074395 3300025304 Bacteria 887
225 Ga0207655_1032856 3300025728 Bacteria 2363
226 Ga0207647_10031287 3300025904 Bacteria 3425
227 Ga0207647_10187446 3300025904 Bacteria 1199
228 Ga0207654_10145889 3300025911 Bacteria 1514
229 Ga0207695_10008916 3300025913 Bacteria 12489
230 Ga0207695_10072374 3300025913 Bacteria 3517
231 Ga0207671_10229575 3300025914 Bacteria 1456
232 Ga0207657_10550164 3300025919 Bacteria 902
233 Ga0207681_10285995 3300025923 Bacteria 1300
234 Ga0207694_10098844 3300025924 Bacteria 2311
235 Ga0207694_10134079 3300025924 Bacteria 1987
236 Ga0207650_10000592 3300025925 Bacteria 29057
237 Ga0207650_10326419 3300025925 Bacteria 1258
238 Ga0207644_10001838 3300025931 Bacteria 13801
239 Ga0207690_10236725 3300025932 Bacteria 1404
240 Ga0207658_10132232 3300025986 Bacteria 2006
241 Ga0207658_10192846 3300025986 Bacteria 1695
242 Ga0207677_11148917 3300026023 Bacteria 709
243 Ga0207639_10148940 3300026041 Bacteria 1958
244 Ga0207678_10456818 3300026067 Bacteria 1111
245 Ga0207702_10719312 3300026078 Bacteria 984
246 Ga0207641_10006236 3300026088 Bacteria 10086
247 Ga0207674_10312323 3300026116 Bacteria 1521
248 Ga0209281_1000194 3300027111 Bacteria 139318
249 Ga0209813_10078746 3300027866 Bacteria 1085
250 Ga0268266_10093857 3300028379 Bacteria 2633
251 Ga0268264_10218603 3300028381 Bacteria 1753
252 Ga0307515_10126031 3300028794 Bacteria 2860
253 Ga0307408_100119605 3300031548 Bacteria 2039
254 Ga0307406_10031266 3300031901 Bacteria 3240
255 Ga0307416_101389291 3300032002 Bacteria 808
256 Ga0307414_10162646 3300032004 Bacteria 1775
257 Ga0307414_10469113 3300032004 Bacteria 1108
258 Ga0373959_0021527 3300034820 Bacteria 1239
259 Ga0395900_0059101 3300037418 Bacteria 3947
260 Ga0395900_0084308 3300037418 Bacteria 3265
261 Ga0395900_0143224 3300037418 Bacteria 2446
262 Ga0395900_0464805 3300037418 Bacteria 1219
263 Ga0395900_0661767 3300037418 Bacteria 980
264 Ga0395898_0024814 3300037466 Bacteria 6044
265 Ga0395898_0239545 3300037466 Bacteria 1730
266 Ga0395905_0000708 3300037471 Bacteria 44246
267 Ga0395905_0120491 3300037471 Bacteria 2466
268 Ga0395905_0133883 3300037471 Bacteria 2331
269 Ga0395901_0066789 3300038443 Bacteria 3745
270 Ga0395901_0411471 3300038443 Bacteria 1388
271 Ga0436361_0218161 3300039447 Bacteria 11074
272 Ga0439438_011759 3300041405 Bacteria 2713
273 Ga0439466_0000152 3300041411 Bacteria 27540
274 Ga0439466_0000502 3300041411 Bacteria 14823
275 Ga0439466_0038688 3300041411 Bacteria 1602
276 Ga0439465_0000115 3300041413 Bacteria 18835
277 Ga0439465_0010116 3300041413 Bacteria 2966
278 Ga0439465_0088021 3300041413 Bacteria 1060
279 Ga0439465_0170467 3300041413 Bacteria 784
280 Ga0451789_0536031 3300041443 Bacteria 1231
281 Ga0451797_1166613 3300041453 Bacteria 1535
282 Ga0451833_0974868 3300041491 Bacteria 1965
283 Ga0451837_0287631 3300041494 Bacteria 1620
284 Ga0451839_0896053 3300041496 Bacteria 1235
285 Ga0451839_0907431 3300041496 Bacteria 2518
286 Ga0451841_0483661 3300041498 Bacteria 3713
287 Ga0451845_0285311 3300041501 Bacteria 1503
288 Ga0451847_0030482 3300041503 Bacteria 1373
289 Ga0451847_0032234 3300041503 Bacteria 1593
290 Ga0451849_1090712 3300041505 Bacteria 1681
291 Ga0451849_1413358 3300041505 Bacteria 1608
292 Ga0451851_0713013 3300041507 Bacteria 1576
293 Ga0451851_0979460 3300041507 Bacteria 1114
294 Ga0451843_0175228 3300041509 Bacteria 816
295 Ga0451843_0179076 3300041509 Bacteria 1262
296 Ga0451843_0637164 3300041509 Bacteria 4098
297 Ga0451843_0781011 3300041509 Bacteria 1257
298 Ga0451853_2319690 3300041512 Bacteria 4648
299 Ga0439431_0003810 3300041997 Bacteria 3333
300 Ga0439431_0010346 3300041997 Bacteria 2117
301 Ga0439442_013133 3300042002 Bacteria 1699
302 Ga0439445_0004610 3300042004 Bacteria 3123
303 Ga0439445_0007696 3300042004 Bacteria 2506
304 Ga0439448_0161039 3300042005 Bacteria 781
305 Ga0439452_010972 3300042010 Bacteria 2617
306 Ga0439456_000415 3300042013 Bacteria 9542
307 Ga0439434_0179732 3300042435 Bacteria 708
308 Ga0466972_0022345 3300044658 Bacteria 3151
309 Ga0466972_0043238 3300044658 Bacteria 2188
310 Ga0466972_0313551 3300044658 Bacteria 733
311 Ga0466965_0046487 3300044683 Bacteria 2149
312 Ga0466965_0091758 3300044683 Bacteria 1546
313 Ga0466966_0016349 3300044684 Bacteria 4904
314 Ga0466966_0051844 3300044684 Bacteria 2607
315 Ga0466961_0058081 3300044693 Bacteria 2462
316 Ga0466971_0061536 3300044719 Bacteria 1698
317 Ga0466970_0191168 3300044765 Bacteria 1137
318 Ga0466957_0097676 3300044842 Bacteria 1847
319 Ga0466959_0030637 3300045049 Bacteria 3983
320 Ga0466959_0042806 3300045049 Bacteria 3340
321 Ga0466958_0334425 3300045836 Bacteria 974
322 Ga0495617_075637 3300046452 Bacteria 1105
323 Ga0495627_013893 3300046453 Bacteria 2825
324 Ga0495590_0011991 3300046457 Bacteria 3227
325 Ga0495590_0046549 3300046457 Bacteria 1513
326 Ga0495590_0199904 3300046457 Bacteria 734
327 Ga0495591_027476 3300046458 Bacteria 1754
328 Ga0495638_0000169 3300046460 Bacteria 101640
329 Ga0495638_0181671 3300046460 Unclassified 1200
330 Ga0495653_0000042 3300046463 Bacteria 117284
331 Ga0495650_0000042 3300046471 Bacteria 357244
332 Ga0495650_0000101 3300046471 Bacteria 212903
333 Ga0495650_0007944 3300046471 Bacteria 6285
334 Ga0495650_0051593 3300046471 Bacteria 1694
335 Ga0495650_0129695 3300046471 Bacteria 921
336 Ga0495584_0005907 3300046491 Bacteria 6450
337 Ga0495584_0020035 3300046491 Bacteria 3397
338 Ga0495596_0000094 3300046500 Bacteria 62938
339 Ga0495607_0004276 3300046501 Bacteria 10564
340 Ga0495607_0018713 3300046501 Bacteria 4407
341 Ga0495607_0019127 3300046501 Bacteria 4355
342 Ga0495607_0050762 3300046501 Bacteria 2413
343 Ga0495607_0053369 3300046501 Bacteria 2336
344 Ga0495607_0072404 3300046501 Unclassified 1918
345 Ga0495607_0080839 3300046501 Bacteria 1786
346 Ga0495583_0018119 3300046506 Bacteria 3716
347 Ga0495583_0025877 3300046506 Bacteria 2922
348 Ga0495583_0026708 3300046506 Bacteria 2857
349 Ga0495583_0046605 3300046506 Bacteria 1998
350 Ga0495583_0222822 3300046506 Bacteria 762
351 Ga0495606_0000039 3300046507 Bacteria 224632
352 Ga0495606_0000087 3300046507 Bacteria 156407
353 Ga0495606_0000576 3300046507 Bacteria 58266
354 Ga0495606_0004066 3300046507 Bacteria 14886
355 Ga0495606_0004183 3300046507 Bacteria 14621
356 Ga0495606_0010822 3300046507 Bacteria 7517
357 Ga0495606_0069006 3300046507 Bacteria 2234
358 Ga0495606_0112336 3300046507 Bacteria 1642
359 Ga0495606_0113385 3300046507 Bacteria 1632
360 Ga0495606_0138844 3300046507 Bacteria 1437
361 Ga0495606_0208584 3300046507 Bacteria 1108
362 Ga0495606_0257742 3300046507 Bacteria 964
363 Ga0495606_0321685 3300046507 Bacteria 831
364 Ga0495610_0002460 3300046512 Bacteria 15569
365 Ga0495610_0004765 3300046512 Bacteria 9895
366 Ga0495610_0018020 3300046512 Bacteria 4003
367 Ga0495610_0062161 3300046512 Bacteria 1772
368 Ga0495610_0082109 3300046512 Bacteria 1478
369 Ga0495610_0090555 3300046512 Bacteria 1387
370 Ga0495610_0107157 3300046512 Bacteria 1243
371 Ga0495616_0038296 3300046513 Bacteria 2462
372 Ga0495616_0092503 3300046513 Bacteria 1430
373 Ga0495620_0010126 3300046515 Bacteria 4984
374 Ga0495620_0054470 3300046515 Bacteria 1689
375 Ga0495620_0060299 3300046515 Bacteria 1582
376 Ga0495620_0125466 3300046515 Bacteria 1010
377 Ga0495631_0012429 3300046518 Bacteria 4157
378 Ga0495632_0214626 3300046519 Bacteria 872
379 Ga0495632_0225862 3300046519 Bacteria 846
380 Ga0495637_0000528 3300046520 Bacteria 27567
381 Ga0495637_0007307 3300046520 Bacteria 5490
382 Ga0495637_0027583 3300046520 Bacteria 2539
383 Ga0495637_0030898 3300046520 Bacteria 2373
384 Ga0495643_0017925 3300046522 Bacteria 4128
385 Ga0495643_0066315 3300046522 Bacteria 1904
386 Ga0495643_0139202 3300046522 Bacteria 1212
387 Ga0495643_0348653 3300046522 Bacteria 663
388 Ga0495648_0002125 3300046524 Bacteria 18671
389 Ga0495648_0002883 3300046524 Bacteria 15481
390 Ga0495663_0090743 3300046525 Bacteria 996
391 Ga0495642_0001000 3300046528 Bacteria 13122
392 Ga0495642_0032721 3300046528 Bacteria 2087
393 Ga0495654_0000038 3300046530 Bacteria 185693
394 Ga0495654_0012778 3300046530 Bacteria 4507
395 Ga0495654_0180559 3300046530 Bacteria 914
396 Ga0495609_0011230 3300046538 Bacteria 4271
397 Ga0495609_0011488 3300046538 Bacteria 4216
398 Ga0495597_0006248 3300046542 Bacteria 6176
399 Ga0495622_0010327 3300046557 Bacteria 4316
400 Ga0495622_0061210 3300046557 Bacteria 1743
401 Ga0495633_0000446 3300046558 Bacteria 42633
402 Ga0495633_0001911 3300046558 Bacteria 15164
403 Ga0495633_0001922 3300046558 Bacteria 15124
404 Ga0495633_0007219 3300046558 Bacteria 6432
405 Ga0495656_0084106 3300046615 Bacteria 1442
406 Ga0495668_0000492 3300046616 Bacteria 49497
407 Ga0495668_0003911 3300046616 Bacteria 10880
408 Ga0495668_0003969 3300046616 Bacteria 10781
409 Ga0495668_0038840 3300046616 Bacteria 2659
410 Ga0495668_0532785 3300046616 Bacteria 648
411 Ga0495625_0004405 3300046660 Bacteria 13347
412 Ga0495625_0025457 3300046660 Bacteria 4489
413 Ga0495625_0041146 3300046660 Bacteria 3365
414 Ga0495625_0130465 3300046660 Bacteria 1703
415 Ga0495625_0188241 3300046660 Bacteria 1369
416 Ga0495625_0217047 3300046660 Bacteria 1255
417 Ga0495625_0223534 3300046660 Bacteria 1232
418 Ga0495661_0033658 3300046665 Bacteria 3231
419 Ga0495661_0128037 3300046665 Bacteria 1394
420 Ga0495588_0014578 3300046674 Bacteria 3763
421 Ga0495669_0032435 3300046684 Bacteria 2296
422 Ga0495670_0022329 3300046691 Bacteria 3124
423 Ga0495671_0082758 3300046692 Bacteria 1573
424 Ga0495649_0011304 3300046694 Bacteria 5241
425 Ga0495649_0045411 3300046694 Bacteria 2395
426 Ga0495649_0061696 3300046694 Bacteria 2016
427 Ga0495649_0095780 3300046694 Bacteria 1580
428 Ga0495589_0005121 3300046794 Bacteria 6936
429 Ga0495589_0024415 3300046794 Bacteria 3072
430 Ga0495660_0011379 3300046810 Bacteria 5166
431 Ga0495660_0015387 3300046810 Bacteria 4420
432 Ga0495660_0044555 3300046810 Bacteria 2440
433 Ga0495660_0116655 3300046810 Bacteria 1356
434 Ga0495660_0207633 3300046810 Bacteria 931
435 Ga0495672_0061166 3300047320 Bacteria 2171
436 Ga0495687_027801 3300047443 Bacteria 2641
437 Ga0495677_0006203 3300047445 Bacteria 4517
438 Ga0495679_116906 3300047446 Bacteria 731
439 Ga0495685_068146 3300047447 Bacteria 1194
440 Ga0495673_0000243 3300047469 Bacteria 77026
441 Ga0495673_0001921 3300047469 Bacteria 15487
442 Ga0495673_0032589 3300047469 Bacteria 2427
443 Ga0495681_0002453 3300047470 Bacteria 13248
444 Ga0495681_0007214 3300047470 Bacteria 7145
445 Ga0495681_0114463 3300047470 Bacteria 1164
446 Ga0495686_0001183 3300047472 Bacteria 30424
447 Ga0495686_0011273 3300047472 Bacteria 6301
448 Ga0495686_0013882 3300047472 Bacteria 5574
449 Ga0495686_0032379 3300047472 Bacteria 3383
450 Ga0495686_0034421 3300047472 Bacteria 3263
451 Ga0495686_0053471 3300047472 Bacteria 2531
452 Ga0495626_0000005 3300048091 Bacteria 337534
453 Ga0495626_0022855 3300048091 Bacteria 3085
454 Ga0495626_0026649 3300048091 Bacteria 2814
455 Ga0495626_0101622 3300048091 Bacteria 1253
456 Ga0496100_0404129 3300048903 Bacteria 1041
457 Ga0496101_0424195 3300048904 Bacteria 1048
458 Ga0496102_0378775 3300048905 Bacteria 1332
459 Ga0496102_1179393 3300048905 Bacteria 685
460 Ga0496103_0054846 3300048906 Bacteria 2471
461 Ga0496106_0000128 3300048909 Bacteria 58226
462 Ga0496108_0267916 3300048911 Bacteria 1487
463 Ga0496110_0091361 3300048913 Bacteria 2723
464 Ga0496111_0058413 3300048914 Bacteria 2793
465 Ga0496111_0237746 3300048914 Bacteria 1353
466 Ga0496112_0120045 3300048915 Bacteria 2599
467 Ga0496112_0316885 3300048915 Bacteria 1504
468 Ga0496113_0103871 3300048916 Bacteria 2204
469 Ga0496114_0218110 3300048917 Bacteria 1674
470 Ga0496116_0003539 3300048919 Bacteria 15371
471 Ga0496116_0012411 3300048919 Bacteria 6963
472 Ga0496116_0013590 3300048919 Bacteria 6549
473 Ga0496116_0037378 3300048919 Bacteria 3386
474 Ga0496116_0256223 3300048919 Bacteria 867
475 Ga0496117_0065358 3300048920 Bacteria 2474
476 Ga0496117_0104860 3300048920 Bacteria 1778
477 Ga0496118_0067336 3300048921 Bacteria 2608
478 Ga0496118_0069457 3300048921 Bacteria 2551
479 Ga0496118_0185131 3300048921 Bacteria 1253
480 Ga0496118_0224259 3300048921 Bacteria 1091
481 Ga0496119_0088072 3300048922 Bacteria 1771
482 Ga0496119_0233240 3300048922 Bacteria 935
483 Ga0496120_0082741 3300048923 Bacteria 1734
484 Ga0496121_0000115 3300048924 Bacteria 178411
485 Ga0496121_0000732 3300048924 Bacteria 60492
486 Ga0496121_0003073 3300048924 Bacteria 24180
487 Ga0496121_0003099 3300048924 Bacteria 24038
488 Ga0496121_0009567 3300048924 Bacteria 11105
489 Ga0496121_0019771 3300048924 Bacteria 6712
490 Ga0496121_0023911 3300048924 Bacteria 5860
491 Ga0496121_0087448 3300048924 Bacteria 2447
492 Ga0496121_0108896 3300048924 Bacteria 2118
493 Ga0496121_0164941 3300048924 Bacteria 1616
494 Ga0496121_0200413 3300048924 Bacteria 1423
495 Ga0496121_0293755 3300048924 Bacteria 1106
496 Ga0496121_0445888 3300048924 Bacteria 835
497 Ga0496122_0002345 3300048925 Bacteria 27302
498 Ga0496122_0003047 3300048925 Bacteria 22665
499 Ga0496122_0004149 3300048925 Bacteria 18287
500 Ga0496122_0006437 3300048925 Bacteria 13481
501 Ga0496122_0022551 3300048925 Bacteria 5590
502 Ga0496122_0024625 3300048925 Bacteria 5261
503 Ga0496122_0033637 3300048925 Bacteria 4212
504 Ga0496122_0056585 3300048925 Bacteria 2922
505 Ga0496122_0106500 3300048925 Bacteria 1856
506 Ga0496123_0001894 3300048926 Bacteria 27302
507 Ga0496123_0002119 3300048926 Bacteria 25445
508 Ga0496123_0002549 3300048926 Bacteria 22213
509 Ga0496123_0004684 3300048926 Bacteria 14173
510 Ga0496123_0017127 3300048926 Bacteria 5847
511 Ga0496123_0023010 3300048926 Bacteria 4784
512 Ga0496123_0155944 3300048926 Unclassified 1224
513 Ga0496123_0191780 3300048926 Bacteria 1056
514 Ga0496123_0285417 3300048926 Bacteria 795
515 Ga0496123_0323993 3300048926 Bacteria 726
516 Ga0496124_0000006 3300048927 Bacteria 904259
517 Ga0496124_0002110 3300048927 Bacteria 26805
518 Ga0496124_0006984 3300048927 Bacteria 12110
519 Ga0496124_0013347 3300048927 Bacteria 8027
520 Ga0496124_0015566 3300048927 Bacteria 7282
521 Ga0496124_0036011 3300048927 Bacteria 4323
522 Ga0496124_0064129 3300048927 Bacteria 3068
523 Ga0496124_0069909 3300048927 Bacteria 2913
524 Ga0496124_0175490 3300048927 Bacteria 1655
525 Ga0496124_0317854 3300048927 Unclassified 1116
526 Ga0496124_0329822 3300048927 Bacteria 1089
527 Ga0496124_0434379 3300048927 Bacteria 900
528 Ga0496124_0451068 3300048927 Bacteria 877
529 Ga0496125_0000989 3300048928 Bacteria 44313
530 Ga0496125_0003290 3300048928 Bacteria 19824
531 Ga0496125_0005889 3300048928 Bacteria 13437
532 Ga0496125_0054813 3300048928 Bacteria 3255
533 Ga0496125_0071584 3300048928 Bacteria 2707
534 Ga0496125_0109079 3300048928 Bacteria 2011
535 Ga0496125_0184735 3300048928 Bacteria 1384
536 Ga0496125_0241744 3300048928 Bacteria 1146
537 Ga0496125_0343223 3300048928 Bacteria 895
538 Ga0496126_0002733 3300048929 Bacteria 23320
539 Ga0496126_0002943 3300048929 Bacteria 22129
540 Ga0496126_0008699 3300048929 Bacteria 10901
541 Ga0496126_0113740 3300048929 Bacteria 2355
542 Ga0496126_0129931 3300048929 Bacteria 2177
543 Ga0496126_0148142 3300048929 Bacteria 2014
544 Ga0496126_0166514 3300048929 Bacteria 1881
545 Ga0496126_0348803 3300048929 Bacteria 1211
546 Ga0496126_0418313 3300048929 Bacteria 1084
547 Ga0495678_085823 3300049459 Bacteria 1120
548 Ga0495678_140902 3300049459 Bacteria 789
549 Ga0495682_0002858 3300049460 Bacteria 7948
550 Ga0495682_0005105 3300049460 Bacteria 5502
551 Ga0495682_0154738 3300049460 Bacteria 817
552 Ga0501034_0072221 3300049571 Bacteria 3459
553 Ga0501034_0117686 3300049571 Bacteria 2645
554 Ga0501034_0342867 3300049571 Bacteria 1424
555 Ga0501036_0106295 3300049572 Bacteria 2374
556 Ga0501036_0179945 3300049572 Bacteria 1780
557 Ga0501037_0086717 3300049573 Bacteria 2266
558 Ga0501039_0225718 3300049575 Bacteria 1472
559 Ga0501040_0888174 3300049576 Bacteria 645
560 Ga0501043_0011739 3300049579 Bacteria 6860
561 Ga0501043_0425390 3300049579 Bacteria 1001
562 Ga0501238_005046 3300049671 Bacteria 1664
563 Ga0501035_0522056 3300049822 Bacteria 975
564 nmdc:mga03683_38234_c1 3300050489 Bacteria 1512
565 nmdc:mga03n38_24298_c1 3300050490 Bacteria 2476
566 nmdc:mga00v17_278059_c1 3300050491 Bacteria 1087
567 nmdc:mga00v17_79470_c1 3300050491 Bacteria 2045
568 nmdc:mga0yw44_232903_c1 3300050492 Bacteria 1223
569 nmdc:mga0yw44_42549_c1 3300050492 Bacteria 2709
570 nmdc:mga0yw44_45675_c1 3300050492 Bacteria 2627
571 nmdc:mga0k408_22463_c1 3300050493 Bacteria 3552
572 nmdc:mga06z11_123663_c1 3300050494 Bacteria 1446
573 nmdc:mga06z11_14867_c1 3300050494 Bacteria 3459
574 nmdc:mga06z11_149601_c1 3300050494 Bacteria 1326
575 nmdc:mga06z11_265596_c1 3300050494 Bacteria 1014
576 nmdc:mga06z11_540624_c1 3300050494 Bacteria 707
577 nmdc:mga04h51_55368_c1 3300050495 Bacteria 1343
578 nmdc:mga04h51_73920_c1 3300050495 Bacteria 1196
579 nmdc:mga07m45_123254_c1 3300050496 Bacteria 1498
580 nmdc:mga07m45_140417_c1 3300050496 Bacteria 1399
581 nmdc:mga07m45_198735_c1 3300050496 Bacteria 1166
582 nmdc:mga07m45_23192_c1 3300050496 Bacteria 3391
583 nmdc:mga07m45_30862_c1 3300050496 Bacteria 2969
584 nmdc:mga07m45_65164_c1 3300050496 Bacteria 2068
585 nmdc:mga0sz30_105200_c1 3300050516 Bacteria 1234
586 nmdc:mga0sz30_109349_c1 3300050516 Bacteria 1211
587 nmdc:mga0sz30_267815_c1 3300050516 Bacteria 761
588 nmdc:mga0sz30_50858_c1 3300050516 Bacteria 1757
589 Ga0500578_0052014 3300053086 Bacteria 2623
590 Ga0500578_0226559 3300053086 Bacteria 1134
591 Ga0500644_0003082 3300053088 Bacteria 4130
592 Ga0500583_0032819 3300053092 Bacteria 2293
593 Ga0500566_0004935 3300053094 Bacteria 7949
594 Ga0500555_023376 3300053103 Bacteria 1773
595 Ga0500562_007425 3300053108 Bacteria 2765
596 Ga0500562_095712 3300053108 Bacteria 807
597 Ga0500594_0011681 3300053118 Bacteria 2053
598 Ga0500595_001365 3300053119 Bacteria 13120
599 Ga0500614_020700 3300053123 Unclassified 1521
600 Ga0500618_000157 3300053125 Bacteria 56116
601 Ga0500618_000364 3300053125 Bacteria 31481
602 Ga0500618_006259 3300053125 Bacteria 3514
603 Ga0500618_009728 3300053125 Bacteria 2613
604 Ga0500642_0067534 3300053130 Bacteria 1620
605 Ga0500655_006895 3300053133 Bacteria 2044
606 Ga0500655_032332 3300053133 Unclassified 1010
607 Ga0500658_0002753 3300053134 Bacteria 6759
608 Ga0500658_0053275 3300053134 Bacteria 1659
609 Ga0500564_059167 3300053138 Bacteria 1741
610 Ga0500564_174455 3300053138 Bacteria 901
611 Ga0500568_0001525 3300053139 Bacteria 14748
612 Ga0500568_0007325 3300053139 Bacteria 5424
613 Ga0500586_000032 3300053145 Bacteria 24537
614 Ga0500586_000214 3300053145 Bacteria 11404
615 Ga0500603_001447 3300053150 Bacteria 5420
616 Ga0500604_0001630 3300053151 Bacteria 6305
617 Ga0500616_0000066 3300053153 Bacteria 237304
618 Ga0500616_0000104 3300053153 Bacteria 159954
619 Ga0500616_0004850 3300053153 Bacteria 9389
620 Ga0500616_0015076 3300053153 Bacteria 4428
621 Ga0500616_0027363 3300053153 Bacteria 3148
622 Ga0500616_0035345 3300053153 Bacteria 2718
623 Ga0500616_0106963 3300053153 Bacteria 1357
624 Ga0500620_075416 3300053155 Bacteria 1164
625 Ga0500622_0001635 3300053156 Bacteria 17534
626 Ga0500622_0001984 3300053156 Bacteria 15344
627 Ga0500622_0026539 3300053156 Bacteria 3056
628 Ga0500627_0001791 3300053158 Bacteria 6107
629 Ga0500627_0131148 3300053158 Bacteria 1132
630 Ga0500627_0138542 3300053158 Bacteria 1099
631 Ga0500627_0245753 3300053158 Bacteria 793
632 Ga0500633_0000139 3300053160 Bacteria 9642
633 Ga0500661_010391 3300055283 Bacteria 1696
634 2503203128 2503198000 Bacteria 6884444
635 2510131908 2510065019 Bacteria 6903379
636 2510840626 2510461069 Bacteria 5505000
637 2510898223 2510461076 Bacteria 8618824
638 2511169774 2510917026 Bacteria 7046020
639 2511195007 2510917030 Bacteria 7460662
640 2512933840 2512875016 Bacteria 6529530
641 2513568725 2513237084 Bacteria 7231967
642 2513580601 2513237085 Bacteria 7695351
643 2513601079 2513237088 Bacteria 6927906
644 2513614464 2513237090 Bacteria 7096802
645 2513634666 2513237093 Bacteria 7545552
646 2513709587 2513237103 Bacteria 7647401
647 2513865999 2513237138 Bacteria 7368160
648 2514022985 2513237162 Bacteria 7468464
649 2515110872 2515075009 Bacteria 7288508
650 2515638605 2515154113 Bacteria 7807172
651 2515645723 2515154114 Bacteria 7848616
652 2515661999 2515154116 Bacteria 7552979
653 2515743186 2515154134 Bacteria 7220242
654 2517039560 2516653077 Bacteria 7555578
655 2517075065 2516653085 Bacteria 7346596
656 2517093698 2517093000 Bacteria 7412387
657 2517405482 2517287029 Bacteria 6905599
658 2524458577 2524023209 Bacteria 6679728
659 2524612861 2524023250 Bacteria 5457705
660 2530644276 2529292951 Bacteria 6916614
661 2535517650 2534681796 Bacteria 7146037
662 2559298582 2558860242 Bacteria 5568029
663 2585221888 2582581298 Bacteria 7315509
664 2585404256 2582581867 Bacteria 7184437
665 2585525227 2585427526 Bacteria 7258840
666 2585540025 2585427528 Bacteria 6842387
667 2585543942 2585427529 Bacteria 7395659
668 2585823188 2585427590 Bacteria 6824633
669 2585838006 2585427593 Bacteria 7141551
670 2585900105 2585427608 Bacteria 6544331
671 2585997597 2585427633 Bacteria 6413184
672 2588519934 2588253730 Bacteria 6881675
673 2599336344 2599185156 Bacteria 5403036
674 2599606289 2599185210 Bacteria 5624189
675 2599722712 2599185236 Bacteria 6875203
676 2644251640 2643221645 Bacteria 7207331
677 2644358181 2643221664 Bacteria 7272945
678 2644500976 2643221689 Bacteria 6042950
679 2694627812 2693429783 Bacteria 7019804
680 2694636062 2693429784 Bacteria 7241525
681 2725951022 2724679232 Bacteria 7646494
682 2738805702 2738541293 Bacteria 7065685
683 2738845434 2738541300 Bacteria 6675882
684 2739034892 2738541333 Bacteria 7106503
685 2739276487 2738543018 Bacteria 6718814
686 2739345531 2738543030 Bacteria 6719714
687 2765468886 2765235802 Bacteria 5618596
688 2766062629 2765235942 Bacteria 7445910
689 2792745510 2791355123 Bacteria 8049106
690 2793344296 2791355263 Bacteria 6872478
691 2793367180 2791355267 Bacteria 7222458
692 2806044179 2802429633 Bacteria 7341974
693 2806052009 2802429634 Bacteria 7083200
694 2806058311 2802429635 Bacteria 7650140
695 2806069215 2802429636 Bacteria 7597525
696 2806074542 2802429637 Bacteria 7067217
697 2819561655 2818991439 Bacteria 6907412
698 2838033561 2838029111 Bacteria 6603031
699 2838043813 2838042994 Bacteria 6046894
700 2838689020 2838686498 Bacteria 7807632
701 2838731315 2838729681 Bacteria 7400765
702 2838743791 2838742623 Bacteria 7396178
703 2839996276 2839993093 Bacteria 5512535
704 2839997321 2839993093 Bacteria 5512535
705 2841766319 2841760612 Bacteria 6454112
706 2841857149 2841851746 Bacteria 7532261
707 2842117163 2842110456 Bacteria 7656360
708 2842159644 2842156927 Bacteria 6894975
709 2842169485 2842163707 Bacteria 6916235
710 2842183740 2842180545 Bacteria 6888678
711 2842220957 2842217011 Bacteria 7497767
712 2842233780 2842229732 Bacteria 7475766
713 2842245255 2842243621 Bacteria 7421798
714 2842260095 2842257432 Bacteria 7401195
715 2842278562 2842271015 Bacteria 7807131
716 2842300162 2842298080 Bacteria 6123127
717 2842307178 2842304105 Bacteria 7023636
718 2842359073 2842357229 Bacteria 6485165
719 2842480167 2842475841 Bacteria 6603183
720 2842508047 2842502639 Bacteria 6604161
721 2842927908 2842922631 Bacteria 5824079
722 2844106085 2844104063 Bacteria 6440972
723 2844455545 2844454524 Bacteria 7952546
724 2851186590 2851182111 Bacteria 6047226
725 2851246441 2851246043 Bacteria 6439203
726 2852391826 2852387548 Bacteria 8025568
727 2854914714 2854911287 Bacteria 5582813
728 2856369799 2856364286 Bacteria 6939991
729 2857353005 2857349434 Bacteria 7926032
730 2857523296 2857516855 Bacteria 7787325
731 2857567125 2857564685 Bacteria 6290584
732 2869290605 2869285874 Bacteria 6901219
733 2871432887 2871429161 Bacteria 6547891
734 2871499805 2871495908 Bacteria 6935695
735 2874130262 2874123672 Bacteria 7238285
736 2874153952 2874146452 Bacteria 7533118
737 2874158639 2874155637 Bacteria 6724144
738 2876363904 2876363079 Bacteria 6544991
739 2876371512 2876369609 Bacteria 6807521
740 2876383268 2876377896 Bacteria 6565995
741 2876396969 2876392853 Bacteria 6660880
742 2876419256 2876413966 Bacteria 6831344
743 2878750501 2878745973 Bacteria 6867388
744 2878763969 2878760144 Bacteria 6823465
745 2878770999 2878767105 Bacteria 6898628
746 2881148273 2881147464 Bacteria 7779814
747 2881165055 2881161766 Bacteria 7127907
748 2885306929 2885305155 Bacteria 7348390
749 2885331688 2885326080 Bacteria 7134805
750 2885335599 2885334103 Bacteria 7216818
751 2888353276 2888350351 Bacteria 7372807
752 2889014993 2889010040 Bacteria 6749192
753 2889019931 2889016732 Bacteria 6700763
754 2899806758 2899803654 Bacteria 5577784
755 2903454015 2903448605 Bacteria 7357801
756 2903499654 2903492973 Bacteria 13473544
757 2903525937 2903521522 Bacteria 6525694
758 2903532517 2903528002 Bacteria 6586099
759 2903544616 2903540706 Bacteria 7062119
760 2904663723 2904659560 Bacteria 6685615
761 2906313426 2906308376 Bacteria 6841989
762 2906326134 2906321335 Bacteria 6579571
763 2906358336 2906354277 Bacteria 6991324
764 2909046047 2909042592 Bacteria 6499737
765 2909400818 2909399089 Bacteria 3922598
766 2919103142 2919100787 Bacteria 7710546
767 2919177422 2919171160 Bacteria 6499771
768 2922133188 2922130491 Bacteria 7173936
769 2922189283 2922185730 Bacteria 7113964
770 2924767051 2924762789 Bacteria 6561353
771 2933572708 2933570622 Bacteria 7023390
772 2933593318 2933586486 Bacteria 7667493
773 2935906712 2935901341 Bacteria 7341747
774 2936368534 2936367885 Bacteria 7324495
775 2936371347 2936367885 Bacteria 7324495
776 2936375451 2936375103 Bacteria 6652732
777 2936376373 2936375103 Bacteria 6652732
778 2937820270 2937813078 Bacteria 7783518
779 2937827625 2937822353 Bacteria 7290551
780 2937850107 2937848649 Bacteria 6983481
781 2937998464 2937994558 Bacteria 7036190
782 2938016834 2938014810 Bacteria 6700592
783 2958055798 2958041894 Bacteria 13082850
784 2958102102 2958100919 Bacteria 6800575
785 2958135006 2958130278 Bacteria 6897202
786 2958168940 2958165035 Bacteria 6906348
787 2958178159 2958172287 Bacteria 6716688
788 2958184035 2958179912 Bacteria 6874908
789 2961082090 2961077736 Bacteria 7079850
790 2961119137 2961114664 Bacteria 6680456
791 2961167402 2961163497 Bacteria 6901077
792 2963645362 2963644680 Bacteria 6530403
793 2965022224 2965018300 Bacteria 6883036
794 2965127179 2965119406 Bacteria 6956431
795 2968089741 2968083720 Bacteria 7351627
796 2968114862 2968110612 Bacteria 6814636
797 2968122586 2968117919 Bacteria 6536078
798 2968175809 2968171901 Bacteria 6894245
799 2970558813 2970554993 Bacteria 6814252
800 2977847037 2977843712 Bacteria 6753583
801 2977943280 2977942078 Bacteria 7570577
802 2977992121 2977986579 Bacteria 6581278
803 2979714688 2979710463 Bacteria 6785254
804 2979748206 2979742915 Bacteria 7301278
805 2984514253 2984509177 Bacteria 5274802
806 2984523284 2984518228 Bacteria 5277463
807 2984542694 2984537506 Bacteria 5277481
808 2987641598 2987636660 Bacteria 8088555
809 2987656308 2987652177 Bacteria 6969023
810 2987663408 2987659509 Bacteria 6966464
811 2987671583 2987666974 Bacteria 6509233
812 2989779518 2989776772 Bacteria 4843317
813 3000136609 3000135777 Bacteria 6891109
814 3004192467 3004188549 Bacteria 6952365
815 3004209591 3004203850 Bacteria 7307914
816 3004216941 3004211236 Bacteria 7417683
817 3004225465 3004218560 Bacteria 7421728
818 3004337227 3004334049 Bacteria 8449246
819 637076951 637000159 Bacteria 7596297
820 639647105 639633055 Bacteria 7751309
821 8001845874 8001845381 Bacteria 5804942
822 8004392895 8004387939 Bacteria 7049250
823 8004643836 8004640170 Bacteria 6723001
824 8004719682 8004714634 Bacteria 6776161
825 8005310932 8005307578 Bacteria 7395396
826 8005377028 8005376324 Bacteria 6590079
827 8005461511 8005460587 Bacteria 7157962
828 8005487657 8005484373 Bacteria 6297373
829 8005549680 8005542996 Bacteria 7077758
830 8005562759 8005556819 Bacteria 6908598
831 8005570032 8005563573 Bacteria 7153261
832 8005577277 8005570704 Bacteria 6957481
833 8018168559 8018163183 Bacteria 7277977
834 8023687391 8023680758 Bacteria 7729763
835 8024480685 8024479707 Bacteria 6954785
836 8046767338 8046767195 Bacteria 7547379
837 8054804163 8054795415 Bacteria 9785225
838 8055914992 8055909800 Bacteria 7278581
839 8056378839 8056375014 Bacteria 7006639
840 8057580112 8057575449 Bacteria 7367519
841 8057881607 8057874678 Bacteria 7494653
842 JGI25159J45721_1010227
843 JGI24739J22299_10143181
844 JGI25156J39149_1007065
845 JGI25158J39367_1000147
846 JGI25157J39369_1001441
847 JGI25152J39213_1000001
848 JGI25152J39213_1009455
849 JGI25150J39212_1000007
850 JGI25159J45721_1000695
851 JGI25151J46595_10000013
852 JGI25151J46595_10002485
853 JGI25151J46595_10004416
854 JGI25165J46597_1000079
855 JGI25153J46596_10000640
856 JGI25153J46596_10005600
857 JGI25153J46596_10011017
858 JGI25153J46596_10037408
859 JGI25153J46596_10039892
860 rootH1_10017387
861 rootH2_10299493
862 rootL2_10107941
863 rootH1_10035776
864 rootH1_10142015
865 rootH1_10217570
866 JGI25160J50197_1000022
867 JGI25160J50197_1001505
868 JGI25160J50197_1007219
869 JGI25161J50226_1000024
870 JGI25161J50226_1000154
871 JGI25161J50226_1003426
872 Ga0055539_1003522
873 Ga0055535_1007104
874 Ga0055542_1001962
875 Ga0055529_1004114
876 Ga0055526_1002360
877 Ga0055526_1009151
878 Ga0055526_1018520
879 Ga0055537_1000103
880 Ga0055524_1001735
881 Ga0055524_1006641
882 Ga0055524_1018190
883 Ga0055536_1005082
884 Ga0055534_1000317
885 Ga0055528_1000031
886 Ga0055528_1006346
887 Ga0055528_1007257
888 Ga0055528_1013691
889 Ga0055528_1016425
890 Ga0055540_1010940
891 Ga0055540_1028948
892 Ga0055540_1034201
893 Ga0055543_1000125
894 Ga0055543_1000513
895 Ga0055543_1001652
896 Ga0055543_1004558
897 Ga0065165_1000051
898 Ga0065165_1000439
899 Ga0065165_1005437
900 Ga0065165_1081622
901 Ga0070658_10015348
902 Ga0070658_10440893
903 Ga0070676_10224910
904 Ga0070670_100000133
905 Ga0070669_100162007
906 Ga0070671_100013556
907 Ga0070667_100032879
908 Ga0070667_100433010
909 Ga0070663_100317289
910 Ga0070685_10481149
911 Ga0068853_100087342
912 Ga0068853_100370186
913 Ga0070665_100004155
914 Ga0068855_100005827
915 Ga0068857_101013580
916 Ga0068852_100295556
917 Ga0068859_100498381
918 Ga0068863_100013407
919 Ga0068860_100244881
920 Ga0068862_100188986
921 Ga0081540_1045274
922 Ga0075365_10015925
923 Ga0075365_10034333
924 Ga0075365_10036220
925 Ga0075365_10523189
926 Ga0075368_10069582
927 Ga0075368_10074203
928 Ga0075363_100089068
929 Ga0075363_100246756
930 Ga0075363_100285269
931 Ga0075364_10158518
932 Ga0075362_10013087
933 Ga0075362_10086383
934 Ga0075362_10160809
935 Ga0075367_10050070
936 Ga0075367_10053778
937 Ga0075367_10155947
938 Ga0075369_10009159
939 Ga0075369_10009605
940 Ga0075369_10019280
941 Ga0075369_10115653
942 Ga0075366_10074784
943 Ga0075366_10202987
944 Ga0075370_10024096
945 Ga0075370_10063254
946 Ga0075370_10178295
947 Ga0075370_10381898
948 Ga0097620_100498403
949 Ga0105244_10004485
950 Ga0105240_10031594
951 Ga0105240_10118452
952 Ga0105240_10131078
953 Ga0105240_10527314
954 Ga0105241_10545483
955 Ga0105242_10591399
956 Ga0105242_10688563
957 Ga0105248_10219814
958 Ga0105248_10596640
959 Ga0105237_10032528
960 Ga0105237_10174637
961 Ga0105237_10220033
962 Ga0105237_10349530
963 Ga0105238_10155985
964 Ga0105238_11230290
965 Ga0123342_1009171
966 Ga0105033_102193
967 Ga0105239_10128575
968 Ga0105239_10214198
969 Ga0105239_10291625
970 Ga0105239_10317884
971 Ga0105239_10395079
972 Ga0105239_10476348
973 Ga0105239_10581782
974 Ga0105239_10857598
975 Ga0157373_10072471
976 Ga0157371_10024423
977 Ga0157369_10307003
978 Ga0157378_10415752
979 Ga0157378_10707947
980 Ga0163162_10630477
981 Ga0157372_10316079
982 Ga0157372_10481303
983 Ga0163163_10087771
984 Ga0163163_11040635
985 Ga0182008_10139732
986 Ga0182008_10358043
987 Ga0157376_10236718
988 Ga0157376_10326539
989 Ga0182007_10005652
990 Ga0182007_10006344
991 Ga0182005_1004353
992 Ga0182005_1005418
993 Ga0163161_10555417
994 Ga0213872_10060697
995 Ga0228711_1004434
996 Ga0228710_1004658
997 Ga0209436_100021
998 Ga0207427_102046
999 Ga0209437_100590
1000 Ga0209258_100341
1001 Ga0207425_1000032
1002 Ga0207425_1000699
1003 Ga0207425_1002075
1004 Ga0207425_1007448
1005 Ga0207425_1011452
1006 Ga0209026_1000118
1007 Ga0209677_100364
1008 Ga0209148_1000212
1009 Ga0209759_1000076
1010 Ga0209129_1000056
1011 Ga0209129_1000149
1012 Ga0209129_1003333
1013 Ga0209129_1004094
1014 Ga0209129_1014147
1015 Ga0209233_1000247
1016 Ga0209233_1000250
1017 Ga0209565_1000035
1018 Ga0209455_1000170
1019 Ga0209673_1000006
1020 Ga0209673_1001640
1021 Ga0209673_1002960
1022 Ga0209673_1010222
1023 Ga0209673_1011182
1024 Ga0209673_1013245
1025 Ga0209673_1052102
1026 Ga0209130_1000019
1027 Ga0209130_1000063
1028 Ga0209130_1000251
1029 Ga0209675_1000005
1030 Ga0209675_1033682
1031 Ga0209676_1000138
1032 Ga0209025_1000090
1033 Ga0209025_1000205
1034 Ga0209025_1000253
1035 Ga0209025_1000866
1036 Ga0209025_1006828
1037 Ga0209025_1017611
1038 Ga0209025_1039984
1039 Ga0209564_1000007
1040 Ga0209564_1000083
1041 Ga0209564_1001757
1042 Ga0209564_1002391
1043 Ga0209564_1018387
1044 Ga0209758_1000084
1045 Ga0209758_1000296
1046 Ga0209758_1000567
1047 Ga0209758_1001105
1048 Ga0209758_1003899
1049 Ga0209758_1007385
1050 Ga0209758_1009542
1051 Ga0209758_1010105
1052 Ga0209758_1024193
1053 Ga0209050_1028567
1054 Ga0209256_1000141
1055 Ga0209256_1000200
1056 Ga0209256_1003442
1057 Ga0209256_1005526
1058 Ga0209256_1015501
1059 Ga0207426_1000005
1060 Ga0207426_1000082
1061 Ga0207426_1000538
1062 Ga0207426_1020869
1063 Ga0209051_1017527
1064 Ga0209051_1050104
1065 Ga0209257_1074395
1066 Ga0207655_1032856
1067 Ga0207647_10031287
1068 Ga0207647_10187446
1069 Ga0207654_10145889
1070 Ga0207695_10008916
1071 Ga0207695_10072374
1072 Ga0207671_10229575
1073 Ga0207657_10550164
1074 Ga0207681_10285995
1075 Ga0207694_10098844
1076 Ga0207694_10134079
1077 Ga0207650_10000592
1078 Ga0207650_10326419
1079 Ga0207644_10001838
1080 Ga0207690_10236725
1081 Ga0207658_10132232
1082 Ga0207658_10192846
1083 Ga0207677_11148917
1084 Ga0207639_10148940
1085 Ga0207678_10456818
1086 Ga0207702_10719312
1087 Ga0207641_10006236
1088 Ga0207674_10312323
1089 Ga0209281_1000194
1090 Ga0209813_10078746
1091 Ga0268266_10093857
1092 Ga0268264_10218603
1093 Ga0307515_10126031
1094 Ga0307408_100119605
1095 Ga0307406_10031266
1096 Ga0307416_101389291
1097 Ga0307414_10162646
1098 Ga0307414_10469113
1099 Ga0373959_0021527
1100 Ga0395900_0059101
1101 Ga0395900_0084308
1102 Ga0395900_0143224
1103 Ga0395900_0464805
1104 Ga0395900_0661767
1105 Ga0395898_0024814
1106 Ga0395898_0239545
1107 Ga0395905_0000708
1108 Ga0395905_0120491
1109 Ga0395905_0133883
1110 Ga0395901_0066789
1111 Ga0395901_0411471
1112 Ga0436361_0218161
1113 Ga0439438_011759
1114 Ga0439466_0000152
1115 Ga0439466_0000502
1116 Ga0439466_0038688
1117 Ga0439465_0000115
1118 Ga0439465_0010116
1119 Ga0439465_0088021
1120 Ga0439465_0170467
1121 Ga0451789_0536031
1122 Ga0451797_1166613
1123 Ga0451833_0974868
1124 Ga0451837_0287631
1125 Ga0451839_0896053
1126 Ga0451839_0907431
1127 Ga0451841_0483661
1128 Ga0451845_0285311
1129 Ga0451847_0030482
1130 Ga0451847_0032234
1131 Ga0451849_1090712
1132 Ga0451849_1413358
1133 Ga0451851_0713013
1134 Ga0451851_0979460
1135 Ga0451843_0175228
1136 Ga0451843_0179076
1137 Ga0451843_0637164
1138 Ga0451843_0781011
1139 Ga0451853_2319690
1140 Ga0439431_0003810
1141 Ga0439431_0010346
1142 Ga0439442_013133
1143 Ga0439445_0004610
1144 Ga0439445_0007696
1145 Ga0439448_0161039
1146 Ga0439452_010972
1147 Ga0439456_000415
1148 Ga0439434_0179732
1149 Ga0466972_0022345
1150 Ga0466972_0043238
1151 Ga0466972_0313551
1152 Ga0466965_0046487
1153 Ga0466965_0091758
1154 Ga0466966_0016349
1155 Ga0466966_0051844
1156 Ga0466961_0058081
1157 Ga0466971_0061536
1158 Ga0466970_0191168
1159 Ga0466957_0097676
1160 Ga0466959_0030637
1161 Ga0466959_0042806
1162 Ga0466958_0334425
1163 Ga0495617_075637
1164 Ga0495627_013893
1165 Ga0495590_0011991
1166 Ga0495590_0046549
1167 Ga0495590_0199904
1168 Ga0495591_027476
1169 Ga0495638_0000169
1170 Ga0495638_0181671
1171 Ga0495653_0000042
1172 Ga0495650_0000042
1173 Ga0495650_0000101
1174 Ga0495650_0007944
1175 Ga0495650_0051593
1176 Ga0495650_0129695
1177 Ga0495584_0005907
1178 Ga0495584_0020035
1179 Ga0495596_0000094
1180 Ga0495607_0004276
1181 Ga0495607_0018713
1182 Ga0495607_0019127
1183 Ga0495607_0050762
1184 Ga0495607_0053369
1185 Ga0495607_0072404
1186 Ga0495607_0080839
1187 Ga0495583_0018119
1188 Ga0495583_0025877
1189 Ga0495583_0026708
1190 Ga0495583_0046605
1191 Ga0495583_0222822
1192 Ga0495606_0000039
1193 Ga0495606_0000087
1194 Ga0495606_0000576
1195 Ga0495606_0004066
1196 Ga0495606_0004183
1197 Ga0495606_0010822
1198 Ga0495606_0069006
1199 Ga0495606_0112336
1200 Ga0495606_0113385
1201 Ga0495606_0138844
1202 Ga0495606_0208584
1203 Ga0495606_0257742
1204 Ga0495606_0321685
1205 Ga0495610_0002460
1206 Ga0495610_0004765
1207 Ga0495610_0018020
1208 Ga0495610_0062161
1209 Ga0495610_0082109
1210 Ga0495610_0090555
1211 Ga0495610_0107157
1212 Ga0495616_0038296
1213 Ga0495616_0092503
1214 Ga0495620_0010126
1215 Ga0495620_0054470
1216 Ga0495620_0060299
1217 Ga0495620_0125466
1218 Ga0495631_0012429
1219 Ga0495632_0214626
1220 Ga0495632_0225862
1221 Ga0495637_0000528
1222 Ga0495637_0007307
1223 Ga0495637_0027583
1224 Ga0495637_0030898
1225 Ga0495643_0017925
1226 Ga0495643_0066315
1227 Ga0495643_0139202
1228 Ga0495643_0348653
1229 Ga0495648_0002125
1230 Ga0495648_0002883
1231 Ga0495663_0090743
1232 Ga0495642_0001000
1233 Ga0495642_0032721
1234 Ga0495654_0000038
1235 Ga0495654_0012778
1236 Ga0495654_0180559
1237 Ga0495609_0011230
1238 Ga0495609_0011488
1239 Ga0495597_0006248
1240 Ga0495622_0010327
1241 Ga0495622_0061210
1242 Ga0495633_0000446
1243 Ga0495633_0001911
1244 Ga0495633_0001922
1245 Ga0495633_0007219
1246 Ga0495656_0084106
1247 Ga0495668_0000492
1248 Ga0495668_0003911
1249 Ga0495668_0003969
1250 Ga0495668_0038840
1251 Ga0495668_0532785
1252 Ga0495625_0004405
1253 Ga0495625_0025457
1254 Ga0495625_0041146
1255 Ga0495625_0130465
1256 Ga0495625_0188241
1257 Ga0495625_0217047
1258 Ga0495625_0223534
1259 Ga0495661_0033658
1260 Ga0495661_0128037
1261 Ga0495588_0014578
1262 Ga0495669_0032435
1263 Ga0495670_0022329
1264 Ga0495671_0082758
1265 Ga0495649_0011304
1266 Ga0495649_0045411
1267 Ga0495649_0061696
1268 Ga0495649_0095780
1269 Ga0495589_0005121
1270 Ga0495589_0024415
1271 Ga0495660_0011379
1272 Ga0495660_0015387
1273 Ga0495660_0044555
1274 Ga0495660_0116655
1275 Ga0495660_0207633
1276 Ga0495672_0061166
1277 Ga0495687_027801
1278 Ga0495677_0006203
1279 Ga0495679_116906
1280 Ga0495685_068146
1281 Ga0495673_0000243
1282 Ga0495673_0001921
1283 Ga0495673_0032589
1284 Ga0495681_0002453
1285 Ga0495681_0007214
1286 Ga0495681_0114463
1287 Ga0495686_0001183
1288 Ga0495686_0011273
1289 Ga0495686_0013882
1290 Ga0495686_0032379
1291 Ga0495686_0034421
1292 Ga0495686_0053471
1293 Ga0495626_0000005
1294 Ga0495626_0022855
1295 Ga0495626_0026649
1296 Ga0495626_0101622
1297 Ga0496100_0404129
1298 Ga0496101_0424195
1299 Ga0496102_0378775
1300 Ga0496102_1179393
1301 Ga0496103_0054846
1302 Ga0496106_0000128
1303 Ga0496108_0267916
1304 Ga0496110_0091361
1305 Ga0496111_0058413
1306 Ga0496111_0237746
1307 Ga0496112_0120045
1308 Ga0496112_0316885
1309 Ga0496113_0103871
1310 Ga0496114_0218110
1311 Ga0496116_0003539
1312 Ga0496116_0012411
1313 Ga0496116_0013590
1314 Ga0496116_0037378
1315 Ga0496116_0256223
1316 Ga0496117_0065358
1317 Ga0496117_0104860
1318 Ga0496118_0067336
1319 Ga0496118_0069457
1320 Ga0496118_0185131
1321 Ga0496118_0224259
1322 Ga0496119_0088072
1323 Ga0496119_0233240
1324 Ga0496120_0082741
1325 Ga0496121_0000115
1326 Ga0496121_0000732
1327 Ga0496121_0003073
1328 Ga0496121_0003099
1329 Ga0496121_0009567
1330 Ga0496121_0019771
1331 Ga0496121_0023911
1332 Ga0496121_0087448
1333 Ga0496121_0108896
1334 Ga0496121_0164941
1335 Ga0496121_0200413
1336 Ga0496121_0293755
1337 Ga0496121_0445888
1338 Ga0496122_0002345
1339 Ga0496122_0003047
1340 Ga0496122_0004149
1341 Ga0496122_0006437
1342 Ga0496122_0022551
1343 Ga0496122_0024625
1344 Ga0496122_0033637
1345 Ga0496122_0056585
1346 Ga0496122_0106500
1347 Ga0496123_0001894
1348 Ga0496123_0002119
1349 Ga0496123_0002549
1350 Ga0496123_0004684
1351 Ga0496123_0017127
1352 Ga0496123_0023010
1353 Ga0496123_0155944
1354 Ga0496123_0191780
1355 Ga0496123_0285417
1356 Ga0496123_0323993
1357 Ga0496124_0000006
1358 Ga0496124_0002110
1359 Ga0496124_0006984
1360 Ga0496124_0013347
1361 Ga0496124_0015566
1362 Ga0496124_0036011
1363 Ga0496124_0064129
1364 Ga0496124_0069909
1365 Ga0496124_0175490
1366 Ga0496124_0317854
1367 Ga0496124_0329822
1368 Ga0496124_0434379
1369 Ga0496124_0451068
1370 Ga0496125_0000989
1371 Ga0496125_0003290
1372 Ga0496125_0005889
1373 Ga0496125_0054813
1374 Ga0496125_0071584
1375 Ga0496125_0109079
1376 Ga0496125_0184735
1377 Ga0496125_0241744
1378 Ga0496125_0343223
1379 Ga0496126_0002733
1380 Ga0496126_0002943
1381 Ga0496126_0008699
1382 Ga0496126_0113740
1383 Ga0496126_0129931
1384 Ga0496126_0148142
1385 Ga0496126_0166514
1386 Ga0496126_0348803
1387 Ga0496126_0418313
1388 Ga0495678_085823
1389 Ga0495678_140902
1390 Ga0495682_0002858
1391 Ga0495682_0005105
1392 Ga0495682_0154738
1393 Ga0501034_0072221
1394 Ga0501034_0117686
1395 Ga0501034_0342867
1396 Ga0501036_0106295
1397 Ga0501036_0179945
1398 Ga0501037_0086717
1399 Ga0501039_0225718
1400 Ga0501040_0888174
1401 Ga0501043_0011739
1402 Ga0501043_0425390
1403 Ga0501238_005046
1404 Ga0501035_0522056
1405 nmdc:mga03683_38234_c1
1406 nmdc:mga03n38_24298_c1
1407 nmdc:mga00v17_278059_c1
1408 nmdc:mga00v17_79470_c1
1409 nmdc:mga0yw44_232903_c1
1410 nmdc:mga0yw44_42549_c1
1411 nmdc:mga0yw44_45675_c1
1412 nmdc:mga0k408_22463_c1
1413 nmdc:mga06z11_123663_c1
1414 nmdc:mga06z11_14867_c1
1415 nmdc:mga06z11_149601_c1
1416 nmdc:mga06z11_265596_c1
1417 nmdc:mga06z11_540624_c1
1418 nmdc:mga04h51_55368_c1
1419 nmdc:mga04h51_73920_c1
1420 nmdc:mga07m45_123254_c1
1421 nmdc:mga07m45_140417_c1
1422 nmdc:mga07m45_198735_c1
1423 nmdc:mga07m45_23192_c1
1424 nmdc:mga07m45_30862_c1
1425 nmdc:mga07m45_65164_c1
1426 nmdc:mga0sz30_105200_c1
1427 nmdc:mga0sz30_109349_c1
1428 nmdc:mga0sz30_267815_c1
1429 nmdc:mga0sz30_50858_c1
1430 Ga0500578_0052014
1431 Ga0500578_0226559
1432 Ga0500644_0003082
1433 Ga0500583_0032819
1434 Ga0500566_0004935
1435 Ga0500555_023376
1436 Ga0500562_007425
1437 Ga0500562_095712
1438 Ga0500594_0011681
1439 Ga0500595_001365
1440 Ga0500614_020700
1441 Ga0500618_000157
1442 Ga0500618_000364
1443 Ga0500618_006259
1444 Ga0500618_009728
1445 Ga0500642_0067534
1446 Ga0500655_006895
1447 Ga0500655_032332
1448 Ga0500658_0002753
1449 Ga0500658_0053275
1450 Ga0500564_059167
1451 Ga0500564_174455
1452 Ga0500568_0001525
1453 Ga0500568_0007325
1454 Ga0500586_000032
1455 Ga0500586_000214
1456 Ga0500603_001447
1457 Ga0500604_0001630
1458 Ga0500616_0000066
1459 Ga0500616_0000104
1460 Ga0500616_0004850
1461 Ga0500616_0015076
1462 Ga0500616_0027363
1463 Ga0500616_0035345
1464 Ga0500616_0106963
1465 Ga0500620_075416
1466 Ga0500622_0001635
1467 Ga0500622_0001984
1468 Ga0500622_0026539
1469 Ga0500627_0001791
1470 Ga0500627_0131148
1471 Ga0500627_0138542
1472 Ga0500627_0245753
1473 Ga0500633_0000139
1474 Ga0500661_010391
1475 2503203128
1476 2510131908
1477 2510840626
1478 2510898223
1479 2511169774
1480 2511195007
1481 2512933840
1482 2513568725
1483 2513580601
1484 2513601079
1485 2513614464
1486 2513634666
1487 2513709587
1488 2513865999
1489 2514022985
1490 2515110872
1491 2515638605
1492 2515645723
1493 2515661999
1494 2515743186
1495 2517039560
1496 2517075065
1497 2517093698
1498 2517405482
1499 2524458577
1500 2524612861
1501 2530644276
1502 2535517650
1503 2559298582
1504 2585221888
1505 2585404256
1506 2585525227
1507 2585540025
1508 2585543942
1509 2585823188
1510 2585838006
1511 2585900105
1512 2585997597
1513 2588519934
1514 2599336344
1515 2599606289
1516 2599722712
1517 2644251640
1518 2644358181
1519 2644500976
1520 2694627812
1521 2694636062
1522 2725951022
1523 2738805702
1524 2738845434
1525 2739034892
1526 2739276487
1527 2739345531
1528 2765468886
1529 2766062629
1530 2792745510
1531 2793344296
1532 2793367180
1533 2806044179
1534 2806052009
1535 2806058311
1536 2806069215
1537 2806074542
1538 2819561655
1539 2838033561
1540 2838043813
1541 2838689020
1542 2838731315
1543 2838743791
1544 2839996276
1545 2839997321
1546 2841766319
1547 2841857149
1548 2842117163
1549 2842159644
1550 2842169485
1551 2842183740
1552 2842220957
1553 2842233780
1554 2842245255
1555 2842260095
1556 2842278562
1557 2842300162
1558 2842307178
1559 2842359073
1560 2842480167
1561 2842508047
1562 2842927908
1563 2844106085
1564 2844455545
1565 2851186590
1566 2851246441
1567 2852391826
1568 2854914714
1569 2856369799
1570 2857353005
1571 2857523296
1572 2857567125
1573 2869290605
1574 2871432887
1575 2871499805
1576 2874130262
1577 2874153952
1578 2874158639
1579 2876363904
1580 2876371512
1581 2876383268
1582 2876396969
1583 2876419256
1584 2878750501
1585 2878763969
1586 2878770999
1587 2881148273
1588 2881165055
1589 2885306929
1590 2885331688
1591 2885335599
1592 2888353276
1593 2889014993
1594 2889019931
1595 2899806758
1596 2903454015
1597 2903499654
1598 2903525937
1599 2903532517
1600 2903544616
1601 2904663723
1602 2906313426
1603 2906326134
1604 2906358336
1605 2909046047
1606 2909400818
1607 2919103142
1608 2919177422
1609 2922133188
1610 2922189283
1611 2924767051
1612 2933572708
1613 2933593318
1614 2935906712
1615 2936368534
1616 2936371347
1617 2936375451
1618 2936376373
1619 2937820270
1620 2937827625
1621 2937850107
1622 2937998464
1623 2938016834
1624 2958055798
1625 2958102102
1626 2958135006
1627 2958168940
1628 2958178159
1629 2958184035
1630 2961082090
1631 2961119137
1632 2961167402
1633 2963645362
1634 2965022224
1635 2965127179
1636 2968089741
1637 2968114862
1638 2968122586
1639 2968175809
1640 2970558813
1641 2977847037
1642 2977943280
1643 2977992121
1644 2979714688
1645 2979748206
1646 2984514253
1647 2984523284
1648 2984542694
1649 2987641598
1650 2987656308
1651 2987663408
1652 2987671583
1653 2989779518
1654 3000136609
1655 3004192467
1656 3004209591
1657 3004216941
1658 3004225465
1659 3004337227
1660 637076951
1661 639647105
1662 8001845874
1663 8004392895
1664 8004643836
1665 8004719682
1666 8005310932
1667 8005377028
1668 8005461511
1669 8005487657
1670 8005549680
1671 8005562759
1672 8005570032
1673 8005577277
1674 8018168559
1675 8023687391
1676 8024480685
1677 8046767338
1678 8054804163
1679 8055914992
1680 8056378839
1681 8057580112
1682 8057881607

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

11

57

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.9761 8 191
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.9409 8 191
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.9123 5 191
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.8991 5 190
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.8937 5 191
ID Description Score Start End Superfamily
2g7sA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9706 8 191 1.10.357.10
2g7sA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9402 8 191 1.10.357.10
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9389 7 53 1.10.10.60
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9375 6 48 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9367 8 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I0XTV5-F1-model_v4 Transcriptional regulator, TetR family 0.9815 5 124 GO:0003677
GO:0006355
AF-A0A5Q0C568-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9741 5 191 GO:0003677
GO:0006355
AF-A0A4S1XGL3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9711 22 191 GO:0003677
GO:0006355
AF-A0A529VXQ4-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9688 1 176 GO:0003677
GO:0006355
AF-A0A1C0SKT1-F1-model_v4 HTH tetR-type domain-containing protein 0.9652 4 193 GO:0003677
GO:0006355

Map