F483073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 841 | 488 | 1682 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300002987|JGI25159J45721_1010227|JGI25159J45721_10102272 |
| Length | 195 |
| Sequence | MNKPSNTSEDILACARTLIASGGYNGFSYADIAQVVSIRKASIHHHFPAKVDLVKALIARYRQDTEAGVAYIEGSAPGALDQLRAYVQYWKTCIGDGSSAFCVCAMLASELPILPHEVALEVRSYFRFLSGWLASLLERGAQQGLIVLGSGDARSEAEAFMATVHGAMLSARAYGDPAVFGVIMDQQLFRLAAKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 66 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 81 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 82 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 83 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 141 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 142 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 143 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 144 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 147 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 148 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 149 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 150 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 151 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 152 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 153 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 154 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 155 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 156 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 157 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 158 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 159 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 160 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 161 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 162 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 163 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 164 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 165 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 166 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 167 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 168 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 172 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 231 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 232 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 233 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 234 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 237 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 252 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 256 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 257 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 258 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 259 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 261 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 263 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 265 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 266 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 268 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 269 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 271 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 272 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 276 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 279 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 280 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 281 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 283 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 284 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 285 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 286 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 287 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 288 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 289 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 290 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 291 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 292 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 293 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 294 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 295 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 296 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 297 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 298 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 299 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 300 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 301 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 302 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 303 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 304 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 305 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 306 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 307 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 308 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 309 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 310 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 311 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 312 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 313 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 314 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 315 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 316 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 317 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 318 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 319 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 320 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 321 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 322 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 323 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 324 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 325 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 326 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 327 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 328 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 329 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 330 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 331 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 332 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 333 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 334 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 335 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 336 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 337 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 338 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 339 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 340 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 341 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 342 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 343 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 344 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 345 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 346 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 347 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 348 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 349 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 350 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 351 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 352 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 353 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 354 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 355 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 356 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 357 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 358 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 359 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 360 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 361 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 362 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 363 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 364 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 365 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 366 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 367 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 368 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 369 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 370 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 371 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 372 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 373 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 374 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 375 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 376 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 377 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 378 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 379 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 380 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 381 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 382 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 383 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 384 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 385 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 386 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 387 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 388 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 389 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 390 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 391 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 392 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 393 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 394 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 395 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 396 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 397 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 398 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 399 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 400 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 401 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 402 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 403 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 404 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 405 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 406 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 407 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 408 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 409 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 410 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 411 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 412 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 413 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 414 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 415 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 416 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 417 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 418 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 419 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 420 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 421 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 422 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 423 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 424 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 425 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 426 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 427 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 428 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 429 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 430 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 431 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 432 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 433 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 434 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 435 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 436 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 437 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 438 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 439 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 440 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 441 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 442 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 443 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 444 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 445 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 446 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 447 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 448 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 449 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 450 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 451 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 452 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 453 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 454 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 455 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 456 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 457 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 458 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 459 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 460 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 461 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 462 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 463 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 464 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 465 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 466 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 467 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 468 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 469 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 470 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 471 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 472 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 473 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 474 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 475 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 476 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 477 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 478 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 479 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 480 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 481 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 482 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 483 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 484 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 485 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 486 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 487 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 488 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.27 |
| Metatranscriptomes | 0 |
| Isolates | 24.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 25.45 |
| Nodule | 17.48 |
| Rhizoplane | 2.38 |
| Rhizosphere | 36.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1010227 | 3300002987 | Bacteria | 2409 |
| 2 | JGI24739J22299_10143181 | 3300001989 | Bacteria | 708 |
| 3 | JGI25156J39149_1007065 | 3300002705 | Bacteria | 2998 |
| 4 | JGI25158J39367_1000147 | 3300002739 | Bacteria | 16476 |
| 5 | JGI25157J39369_1001441 | 3300002741 | Bacteria | 8954 |
| 6 | JGI25152J39213_1000001 | 3300002773 | Bacteria | 224104 |
| 7 | JGI25152J39213_1009455 | 3300002773 | Bacteria | 2315 |
| 8 | JGI25150J39212_1000007 | 3300002774 | Bacteria | 253635 |
| 9 | JGI25159J45721_1000695 | 3300002987 | Bacteria | 14706 |
| 10 | JGI25151J46595_10000013 | 3300003187 | Bacteria | 253635 |
| 11 | JGI25151J46595_10002485 | 3300003187 | Bacteria | 11035 |
| 12 | JGI25151J46595_10004416 | 3300003187 | Bacteria | 7446 |
| 13 | JGI25165J46597_1000079 | 3300003214 | Bacteria | 179163 |
| 14 | JGI25153J46596_10000640 | 3300003215 | Bacteria | 21401 |
| 15 | JGI25153J46596_10005600 | 3300003215 | Bacteria | 6563 |
| 16 | JGI25153J46596_10011017 | 3300003215 | Bacteria | 4033 |
| 17 | JGI25153J46596_10037408 | 3300003215 | Bacteria | 1543 |
| 18 | JGI25153J46596_10039892 | 3300003215 | Bacteria | 1462 |
| 19 | rootH1_10017387 | 3300003316 | Bacteria | 40873 |
| 20 | rootH2_10299493 | 3300003320 | Bacteria | 1155 |
| 21 | rootL2_10107941 | 3300003322 | Bacteria | 2748 |
| 22 | rootH1_10035776 | 3300003323 | Bacteria | 1900 |
| 23 | rootH1_10142015 | 3300003323 | Bacteria | 3077 |
| 24 | rootH1_10217570 | 3300003323 | Bacteria | 2319 |
| 25 | JGI25160J50197_1000022 | 3300003354 | Bacteria | 201071 |
| 26 | JGI25160J50197_1001505 | 3300003354 | Bacteria | 11577 |
| 27 | JGI25160J50197_1007219 | 3300003354 | Bacteria | 4373 |
| 28 | JGI25161J50226_1000024 | 3300003374 | Bacteria | 152176 |
| 29 | JGI25161J50226_1000154 | 3300003374 | Bacteria | 47801 |
| 30 | JGI25161J50226_1003426 | 3300003374 | Bacteria | 3628 |
| 31 | Ga0055539_1003522 | 3300003752 | Bacteria | 2179 |
| 32 | Ga0055535_1007104 | 3300003761 | Bacteria | 2177 |
| 33 | Ga0055542_1001962 | 3300003762 | Bacteria | 7992 |
| 34 | Ga0055529_1004114 | 3300003763 | Bacteria | 2257 |
| 35 | Ga0055526_1002360 | 3300003771 | Bacteria | 12814 |
| 36 | Ga0055526_1009151 | 3300003771 | Bacteria | 4813 |
| 37 | Ga0055526_1018520 | 3300003771 | Bacteria | 2594 |
| 38 | Ga0055537_1000103 | 3300003773 | Bacteria | 63399 |
| 39 | Ga0055524_1001735 | 3300003775 | Bacteria | 12094 |
| 40 | Ga0055524_1006641 | 3300003775 | Bacteria | 5002 |
| 41 | Ga0055524_1018190 | 3300003775 | Bacteria | 2448 |
| 42 | Ga0055536_1005082 | 3300003781 | Bacteria | 6530 |
| 43 | Ga0055534_1000317 | 3300003784 | Bacteria | 32025 |
| 44 | Ga0055528_1000031 | 3300003790 | Bacteria | 120960 |
| 45 | Ga0055528_1006346 | 3300003790 | Bacteria | 5373 |
| 46 | Ga0055528_1007257 | 3300003790 | Bacteria | 4920 |
| 47 | Ga0055528_1013691 | 3300003790 | Bacteria | 3056 |
| 48 | Ga0055528_1016425 | 3300003790 | Bacteria | 2618 |
| 49 | Ga0055540_1010940 | 3300003792 | Bacteria | 2976 |
| 50 | Ga0055540_1028948 | 3300003792 | Bacteria | 1303 |
| 51 | Ga0055540_1034201 | 3300003792 | Bacteria | 1146 |
| 52 | Ga0055543_1000125 | 3300004625 | Bacteria | 63343 |
| 53 | Ga0055543_1000513 | 3300004625 | Bacteria | 22087 |
| 54 | Ga0055543_1001652 | 3300004625 | Bacteria | 8502 |
| 55 | Ga0055543_1004558 | 3300004625 | Bacteria | 3740 |
| 56 | Ga0065165_1000051 | 3300005262 | Bacteria | 194844 |
| 57 | Ga0065165_1000439 | 3300005262 | Bacteria | 65347 |
| 58 | Ga0065165_1005437 | 3300005262 | Bacteria | 7160 |
| 59 | Ga0065165_1081622 | 3300005262 | Bacteria | 838 |
| 60 | Ga0070658_10015348 | 3300005327 | Bacteria | 6130 |
| 61 | Ga0070658_10440893 | 3300005327 | Bacteria | 1121 |
| 62 | Ga0070676_10224910 | 3300005328 | Bacteria | 1241 |
| 63 | Ga0070670_100000133 | 3300005331 | Bacteria | 69691 |
| 64 | Ga0070669_100162007 | 3300005353 | Bacteria | 1739 |
| 65 | Ga0070671_100013556 | 3300005355 | Bacteria | 6572 |
| 66 | Ga0070667_100032879 | 3300005367 | Bacteria | 4329 |
| 67 | Ga0070667_100433010 | 3300005367 | Bacteria | 1200 |
| 68 | Ga0070663_100317289 | 3300005455 | Bacteria | 1252 |
| 69 | Ga0070685_10481149 | 3300005466 | Bacteria | 875 |
| 70 | Ga0068853_100087342 | 3300005539 | Bacteria | 2736 |
| 71 | Ga0068853_100370186 | 3300005539 | Bacteria | 1336 |
| 72 | Ga0070665_100004155 | 3300005548 | Bacteria | 15236 |
| 73 | Ga0068855_100005827 | 3300005563 | Bacteria | 15039 |
| 74 | Ga0068857_101013580 | 3300005577 | Bacteria | 799 |
| 75 | Ga0068852_100295556 | 3300005616 | Bacteria | 1566 |
| 76 | Ga0068859_100498381 | 3300005617 | Bacteria | 1313 |
| 77 | Ga0068863_100013407 | 3300005841 | Bacteria | 7903 |
| 78 | Ga0068860_100244881 | 3300005843 | Bacteria | 1744 |
| 79 | Ga0068862_100188986 | 3300005844 | Bacteria | 1852 |
| 80 | Ga0081540_1045274 | 3300005983 | Bacteria | 2237 |
| 81 | Ga0075365_10015925 | 3300006038 | Bacteria | 4559 |
| 82 | Ga0075365_10034333 | 3300006038 | Bacteria | 3275 |
| 83 | Ga0075365_10036220 | 3300006038 | Bacteria | 3196 |
| 84 | Ga0075365_10523189 | 3300006038 | Bacteria | 839 |
| 85 | Ga0075368_10069582 | 3300006042 | Bacteria | 1420 |
| 86 | Ga0075368_10074203 | 3300006042 | Bacteria | 1377 |
| 87 | Ga0075363_100089068 | 3300006048 | Bacteria | 1697 |
| 88 | Ga0075363_100246756 | 3300006048 | Bacteria | 1027 |
| 89 | Ga0075363_100285269 | 3300006048 | Bacteria | 956 |
| 90 | Ga0075364_10158518 | 3300006051 | Bacteria | 1527 |
| 91 | Ga0075362_10013087 | 3300006177 | Bacteria | 3312 |
| 92 | Ga0075362_10086383 | 3300006177 | Bacteria | 1451 |
| 93 | Ga0075362_10160809 | 3300006177 | Bacteria | 1081 |
| 94 | Ga0075367_10050070 | 3300006178 | Bacteria | 2465 |
| 95 | Ga0075367_10053778 | 3300006178 | Bacteria | 2387 |
| 96 | Ga0075367_10155947 | 3300006178 | Bacteria | 1418 |
| 97 | Ga0075369_10009159 | 3300006186 | Bacteria | 3836 |
| 98 | Ga0075369_10009605 | 3300006186 | Bacteria | 3763 |
| 99 | Ga0075369_10019280 | 3300006186 | Bacteria | 2784 |
| 100 | Ga0075369_10115653 | 3300006186 | Bacteria | 1211 |
| 101 | Ga0075366_10074784 | 3300006195 | Bacteria | 2020 |
| 102 | Ga0075366_10202987 | 3300006195 | Bacteria | 1206 |
| 103 | Ga0075370_10024096 | 3300006353 | Bacteria | 3358 |
| 104 | Ga0075370_10063254 | 3300006353 | Bacteria | 2109 |
| 105 | Ga0075370_10178295 | 3300006353 | Bacteria | 1250 |
| 106 | Ga0075370_10381898 | 3300006353 | Bacteria | 844 |
| 107 | Ga0097620_100498403 | 3300006931 | Bacteria | 1313 |
| 108 | Ga0105244_10004485 | 3300009036 | Bacteria | 9590 |
| 109 | Ga0105240_10031594 | 3300009093 | Bacteria | 6863 |
| 110 | Ga0105240_10118452 | 3300009093 | Bacteria | 3191 |
| 111 | Ga0105240_10131078 | 3300009093 | Bacteria | 3007 |
| 112 | Ga0105240_10527314 | 3300009093 | Bacteria | 1310 |
| 113 | Ga0105241_10545483 | 3300009174 | Bacteria | 1040 |
| 114 | Ga0105242_10591399 | 3300009176 | Bacteria | 1070 |
| 115 | Ga0105242_10688563 | 3300009176 | Bacteria | 999 |
| 116 | Ga0105248_10219814 | 3300009177 | Bacteria | 2139 |
| 117 | Ga0105248_10596640 | 3300009177 | Bacteria | 1246 |
| 118 | Ga0105237_10032528 | 3300009545 | Bacteria | 5280 |
| 119 | Ga0105237_10174637 | 3300009545 | Bacteria | 2149 |
| 120 | Ga0105237_10220033 | 3300009545 | Bacteria | 1899 |
| 121 | Ga0105237_10349530 | 3300009545 | Bacteria | 1483 |
| 122 | Ga0105238_10155985 | 3300009551 | Bacteria | 2258 |
| 123 | Ga0105238_11230290 | 3300009551 | Bacteria | 774 |
| 124 | Ga0123342_1009171 | 3300009766 | Bacteria | 11998 |
| 125 | Ga0105033_102193 | 3300009986 | Bacteria | 1618 |
| 126 | Ga0105239_10128575 | 3300010375 | Bacteria | 2816 |
| 127 | Ga0105239_10214198 | 3300010375 | Bacteria | 2159 |
| 128 | Ga0105239_10291625 | 3300010375 | Bacteria | 1837 |
| 129 | Ga0105239_10317884 | 3300010375 | Bacteria | 1755 |
| 130 | Ga0105239_10395079 | 3300010375 | Bacteria | 1564 |
| 131 | Ga0105239_10476348 | 3300010375 | Bacteria | 1418 |
| 132 | Ga0105239_10581782 | 3300010375 | Bacteria | 1276 |
| 133 | Ga0105239_10857598 | 3300010375 | Bacteria | 1042 |
| 134 | Ga0157373_10072471 | 3300013100 | Bacteria | 2431 |
| 135 | Ga0157371_10024423 | 3300013102 | Bacteria | 4413 |
| 136 | Ga0157369_10307003 | 3300013105 | Bacteria | 1650 |
| 137 | Ga0157378_10415752 | 3300013297 | Bacteria | 1328 |
| 138 | Ga0157378_10707947 | 3300013297 | Bacteria | 1027 |
| 139 | Ga0163162_10630477 | 3300013306 | Bacteria | 1197 |
| 140 | Ga0157372_10316079 | 3300013307 | Bacteria | 1818 |
| 141 | Ga0157372_10481303 | 3300013307 | Bacteria | 1447 |
| 142 | Ga0163163_10087771 | 3300014325 | Bacteria | 3121 |
| 143 | Ga0163163_11040635 | 3300014325 | Bacteria | 882 |
| 144 | Ga0182008_10139732 | 3300014497 | Bacteria | 1211 |
| 145 | Ga0182008_10358043 | 3300014497 | Bacteria | 775 |
| 146 | Ga0157376_10236718 | 3300014969 | Bacteria | 1699 |
| 147 | Ga0157376_10326539 | 3300014969 | Bacteria | 1460 |
| 148 | Ga0182007_10005652 | 3300015262 | Bacteria | 5458 |
| 149 | Ga0182007_10006344 | 3300015262 | Bacteria | 5085 |
| 150 | Ga0182005_1004353 | 3300015265 | Bacteria | 4600 |
| 151 | Ga0182005_1005418 | 3300015265 | Bacteria | 3989 |
| 152 | Ga0163161_10555417 | 3300017792 | Bacteria | 942 |
| 153 | Ga0213872_10060697 | 3300021361 | Bacteria | 1710 |
| 154 | Ga0228711_1004434 | 3300022739 | Bacteria | 21595 |
| 155 | Ga0228710_1004658 | 3300022740 | Bacteria | 21595 |
| 156 | Ga0209436_100021 | 3300025208 | Bacteria | 102115 |
| 157 | Ga0207427_102046 | 3300025231 | Bacteria | 6047 |
| 158 | Ga0209437_100590 | 3300025233 | Bacteria | 23064 |
| 159 | Ga0209258_100341 | 3300025242 | Bacteria | 68437 |
| 160 | Ga0207425_1000032 | 3300025245 | Bacteria | 253689 |
| 161 | Ga0207425_1000699 | 3300025245 | Bacteria | 18154 |
| 162 | Ga0207425_1002075 | 3300025245 | Bacteria | 7443 |
| 163 | Ga0207425_1007448 | 3300025245 | Bacteria | 2885 |
| 164 | Ga0207425_1011452 | 3300025245 | Bacteria | 2113 |
| 165 | Ga0209026_1000118 | 3300025250 | Bacteria | 130611 |
| 166 | Ga0209677_100364 | 3300025253 | Bacteria | 27796 |
| 167 | Ga0209148_1000212 | 3300025254 | Bacteria | 101454 |
| 168 | Ga0209759_1000076 | 3300025256 | Bacteria | 175911 |
| 169 | Ga0209129_1000056 | 3300025258 | Bacteria | 253689 |
| 170 | Ga0209129_1000149 | 3300025258 | Bacteria | 114222 |
| 171 | Ga0209129_1003333 | 3300025258 | Bacteria | 7078 |
| 172 | Ga0209129_1004094 | 3300025258 | Bacteria | 5937 |
| 173 | Ga0209129_1014147 | 3300025258 | Bacteria | 1714 |
| 174 | Ga0209233_1000247 | 3300025261 | Bacteria | 87890 |
| 175 | Ga0209233_1000250 | 3300025261 | Bacteria | 85129 |
| 176 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 177 | Ga0209455_1000170 | 3300025272 | Bacteria | 110681 |
| 178 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 179 | Ga0209673_1001640 | 3300025273 | Bacteria | 19356 |
| 180 | Ga0209673_1002960 | 3300025273 | Bacteria | 10625 |
| 181 | Ga0209673_1010222 | 3300025273 | Bacteria | 3975 |
| 182 | Ga0209673_1011182 | 3300025273 | Bacteria | 3717 |
| 183 | Ga0209673_1013245 | 3300025273 | Bacteria | 3266 |
| 184 | Ga0209673_1052102 | 3300025273 | Bacteria | 1076 |
| 185 | Ga0209130_1000019 | 3300025284 | Bacteria | 381993 |
| 186 | Ga0209130_1000063 | 3300025284 | Bacteria | 198142 |
| 187 | Ga0209130_1000251 | 3300025284 | Bacteria | 67741 |
| 188 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 189 | Ga0209675_1033682 | 3300025291 | Bacteria | 1185 |
| 190 | Ga0209676_1000138 | 3300025292 | Bacteria | 178932 |
| 191 | Ga0209025_1000090 | 3300025294 | Bacteria | 253689 |
| 192 | Ga0209025_1000205 | 3300025294 | Bacteria | 141452 |
| 193 | Ga0209025_1000253 | 3300025294 | Bacteria | 125975 |
| 194 | Ga0209025_1000866 | 3300025294 | Bacteria | 47843 |
| 195 | Ga0209025_1006828 | 3300025294 | Bacteria | 8712 |
| 196 | Ga0209025_1017611 | 3300025294 | Bacteria | 4109 |
| 197 | Ga0209025_1039984 | 3300025294 | Bacteria | 2036 |
| 198 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 199 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 200 | Ga0209564_1001757 | 3300025295 | Bacteria | 20239 |
| 201 | Ga0209564_1002391 | 3300025295 | Bacteria | 15000 |
| 202 | Ga0209564_1018387 | 3300025295 | Bacteria | 2666 |
| 203 | Ga0209758_1000084 | 3300025297 | Bacteria | 256346 |
| 204 | Ga0209758_1000296 | 3300025297 | Bacteria | 97937 |
| 205 | Ga0209758_1000567 | 3300025297 | Bacteria | 58201 |
| 206 | Ga0209758_1001105 | 3300025297 | Bacteria | 34833 |
| 207 | Ga0209758_1003899 | 3300025297 | Bacteria | 13034 |
| 208 | Ga0209758_1007385 | 3300025297 | Bacteria | 7508 |
| 209 | Ga0209758_1009542 | 3300025297 | Bacteria | 6005 |
| 210 | Ga0209758_1010105 | 3300025297 | Bacteria | 5716 |
| 211 | Ga0209758_1024193 | 3300025297 | Bacteria | 2715 |
| 212 | Ga0209050_1028567 | 3300025298 | Bacteria | 1807 |
| 213 | Ga0209256_1000141 | 3300025299 | Bacteria | 152280 |
| 214 | Ga0209256_1000200 | 3300025299 | Bacteria | 112931 |
| 215 | Ga0209256_1003442 | 3300025299 | Bacteria | 11105 |
| 216 | Ga0209256_1005526 | 3300025299 | Bacteria | 7225 |
| 217 | Ga0209256_1015501 | 3300025299 | Bacteria | 2662 |
| 218 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 219 | Ga0207426_1000082 | 3300025302 | Bacteria | 298939 |
| 220 | Ga0207426_1000538 | 3300025302 | Bacteria | 54233 |
| 221 | Ga0207426_1020869 | 3300025302 | Bacteria | 2271 |
| 222 | Ga0209051_1017527 | 3300025303 | Bacteria | 3197 |
| 223 | Ga0209051_1050104 | 3300025303 | Bacteria | 1401 |
| 224 | Ga0209257_1074395 | 3300025304 | Bacteria | 887 |
| 225 | Ga0207655_1032856 | 3300025728 | Bacteria | 2363 |
| 226 | Ga0207647_10031287 | 3300025904 | Bacteria | 3425 |
| 227 | Ga0207647_10187446 | 3300025904 | Bacteria | 1199 |
| 228 | Ga0207654_10145889 | 3300025911 | Bacteria | 1514 |
| 229 | Ga0207695_10008916 | 3300025913 | Bacteria | 12489 |
| 230 | Ga0207695_10072374 | 3300025913 | Bacteria | 3517 |
| 231 | Ga0207671_10229575 | 3300025914 | Bacteria | 1456 |
| 232 | Ga0207657_10550164 | 3300025919 | Bacteria | 902 |
| 233 | Ga0207681_10285995 | 3300025923 | Bacteria | 1300 |
| 234 | Ga0207694_10098844 | 3300025924 | Bacteria | 2311 |
| 235 | Ga0207694_10134079 | 3300025924 | Bacteria | 1987 |
| 236 | Ga0207650_10000592 | 3300025925 | Bacteria | 29057 |
| 237 | Ga0207650_10326419 | 3300025925 | Bacteria | 1258 |
| 238 | Ga0207644_10001838 | 3300025931 | Bacteria | 13801 |
| 239 | Ga0207690_10236725 | 3300025932 | Bacteria | 1404 |
| 240 | Ga0207658_10132232 | 3300025986 | Bacteria | 2006 |
| 241 | Ga0207658_10192846 | 3300025986 | Bacteria | 1695 |
| 242 | Ga0207677_11148917 | 3300026023 | Bacteria | 709 |
| 243 | Ga0207639_10148940 | 3300026041 | Bacteria | 1958 |
| 244 | Ga0207678_10456818 | 3300026067 | Bacteria | 1111 |
| 245 | Ga0207702_10719312 | 3300026078 | Bacteria | 984 |
| 246 | Ga0207641_10006236 | 3300026088 | Bacteria | 10086 |
| 247 | Ga0207674_10312323 | 3300026116 | Bacteria | 1521 |
| 248 | Ga0209281_1000194 | 3300027111 | Bacteria | 139318 |
| 249 | Ga0209813_10078746 | 3300027866 | Bacteria | 1085 |
| 250 | Ga0268266_10093857 | 3300028379 | Bacteria | 2633 |
| 251 | Ga0268264_10218603 | 3300028381 | Bacteria | 1753 |
| 252 | Ga0307515_10126031 | 3300028794 | Bacteria | 2860 |
| 253 | Ga0307408_100119605 | 3300031548 | Bacteria | 2039 |
| 254 | Ga0307406_10031266 | 3300031901 | Bacteria | 3240 |
| 255 | Ga0307416_101389291 | 3300032002 | Bacteria | 808 |
| 256 | Ga0307414_10162646 | 3300032004 | Bacteria | 1775 |
| 257 | Ga0307414_10469113 | 3300032004 | Bacteria | 1108 |
| 258 | Ga0373959_0021527 | 3300034820 | Bacteria | 1239 |
| 259 | Ga0395900_0059101 | 3300037418 | Bacteria | 3947 |
| 260 | Ga0395900_0084308 | 3300037418 | Bacteria | 3265 |
| 261 | Ga0395900_0143224 | 3300037418 | Bacteria | 2446 |
| 262 | Ga0395900_0464805 | 3300037418 | Bacteria | 1219 |
| 263 | Ga0395900_0661767 | 3300037418 | Bacteria | 980 |
| 264 | Ga0395898_0024814 | 3300037466 | Bacteria | 6044 |
| 265 | Ga0395898_0239545 | 3300037466 | Bacteria | 1730 |
| 266 | Ga0395905_0000708 | 3300037471 | Bacteria | 44246 |
| 267 | Ga0395905_0120491 | 3300037471 | Bacteria | 2466 |
| 268 | Ga0395905_0133883 | 3300037471 | Bacteria | 2331 |
| 269 | Ga0395901_0066789 | 3300038443 | Bacteria | 3745 |
| 270 | Ga0395901_0411471 | 3300038443 | Bacteria | 1388 |
| 271 | Ga0436361_0218161 | 3300039447 | Bacteria | 11074 |
| 272 | Ga0439438_011759 | 3300041405 | Bacteria | 2713 |
| 273 | Ga0439466_0000152 | 3300041411 | Bacteria | 27540 |
| 274 | Ga0439466_0000502 | 3300041411 | Bacteria | 14823 |
| 275 | Ga0439466_0038688 | 3300041411 | Bacteria | 1602 |
| 276 | Ga0439465_0000115 | 3300041413 | Bacteria | 18835 |
| 277 | Ga0439465_0010116 | 3300041413 | Bacteria | 2966 |
| 278 | Ga0439465_0088021 | 3300041413 | Bacteria | 1060 |
| 279 | Ga0439465_0170467 | 3300041413 | Bacteria | 784 |
| 280 | Ga0451789_0536031 | 3300041443 | Bacteria | 1231 |
| 281 | Ga0451797_1166613 | 3300041453 | Bacteria | 1535 |
| 282 | Ga0451833_0974868 | 3300041491 | Bacteria | 1965 |
| 283 | Ga0451837_0287631 | 3300041494 | Bacteria | 1620 |
| 284 | Ga0451839_0896053 | 3300041496 | Bacteria | 1235 |
| 285 | Ga0451839_0907431 | 3300041496 | Bacteria | 2518 |
| 286 | Ga0451841_0483661 | 3300041498 | Bacteria | 3713 |
| 287 | Ga0451845_0285311 | 3300041501 | Bacteria | 1503 |
| 288 | Ga0451847_0030482 | 3300041503 | Bacteria | 1373 |
| 289 | Ga0451847_0032234 | 3300041503 | Bacteria | 1593 |
| 290 | Ga0451849_1090712 | 3300041505 | Bacteria | 1681 |
| 291 | Ga0451849_1413358 | 3300041505 | Bacteria | 1608 |
| 292 | Ga0451851_0713013 | 3300041507 | Bacteria | 1576 |
| 293 | Ga0451851_0979460 | 3300041507 | Bacteria | 1114 |
| 294 | Ga0451843_0175228 | 3300041509 | Bacteria | 816 |
| 295 | Ga0451843_0179076 | 3300041509 | Bacteria | 1262 |
| 296 | Ga0451843_0637164 | 3300041509 | Bacteria | 4098 |
| 297 | Ga0451843_0781011 | 3300041509 | Bacteria | 1257 |
| 298 | Ga0451853_2319690 | 3300041512 | Bacteria | 4648 |
| 299 | Ga0439431_0003810 | 3300041997 | Bacteria | 3333 |
| 300 | Ga0439431_0010346 | 3300041997 | Bacteria | 2117 |
| 301 | Ga0439442_013133 | 3300042002 | Bacteria | 1699 |
| 302 | Ga0439445_0004610 | 3300042004 | Bacteria | 3123 |
| 303 | Ga0439445_0007696 | 3300042004 | Bacteria | 2506 |
| 304 | Ga0439448_0161039 | 3300042005 | Bacteria | 781 |
| 305 | Ga0439452_010972 | 3300042010 | Bacteria | 2617 |
| 306 | Ga0439456_000415 | 3300042013 | Bacteria | 9542 |
| 307 | Ga0439434_0179732 | 3300042435 | Bacteria | 708 |
| 308 | Ga0466972_0022345 | 3300044658 | Bacteria | 3151 |
| 309 | Ga0466972_0043238 | 3300044658 | Bacteria | 2188 |
| 310 | Ga0466972_0313551 | 3300044658 | Bacteria | 733 |
| 311 | Ga0466965_0046487 | 3300044683 | Bacteria | 2149 |
| 312 | Ga0466965_0091758 | 3300044683 | Bacteria | 1546 |
| 313 | Ga0466966_0016349 | 3300044684 | Bacteria | 4904 |
| 314 | Ga0466966_0051844 | 3300044684 | Bacteria | 2607 |
| 315 | Ga0466961_0058081 | 3300044693 | Bacteria | 2462 |
| 316 | Ga0466971_0061536 | 3300044719 | Bacteria | 1698 |
| 317 | Ga0466970_0191168 | 3300044765 | Bacteria | 1137 |
| 318 | Ga0466957_0097676 | 3300044842 | Bacteria | 1847 |
| 319 | Ga0466959_0030637 | 3300045049 | Bacteria | 3983 |
| 320 | Ga0466959_0042806 | 3300045049 | Bacteria | 3340 |
| 321 | Ga0466958_0334425 | 3300045836 | Bacteria | 974 |
| 322 | Ga0495617_075637 | 3300046452 | Bacteria | 1105 |
| 323 | Ga0495627_013893 | 3300046453 | Bacteria | 2825 |
| 324 | Ga0495590_0011991 | 3300046457 | Bacteria | 3227 |
| 325 | Ga0495590_0046549 | 3300046457 | Bacteria | 1513 |
| 326 | Ga0495590_0199904 | 3300046457 | Bacteria | 734 |
| 327 | Ga0495591_027476 | 3300046458 | Bacteria | 1754 |
| 328 | Ga0495638_0000169 | 3300046460 | Bacteria | 101640 |
| 329 | Ga0495638_0181671 | 3300046460 | Unclassified | 1200 |
| 330 | Ga0495653_0000042 | 3300046463 | Bacteria | 117284 |
| 331 | Ga0495650_0000042 | 3300046471 | Bacteria | 357244 |
| 332 | Ga0495650_0000101 | 3300046471 | Bacteria | 212903 |
| 333 | Ga0495650_0007944 | 3300046471 | Bacteria | 6285 |
| 334 | Ga0495650_0051593 | 3300046471 | Bacteria | 1694 |
| 335 | Ga0495650_0129695 | 3300046471 | Bacteria | 921 |
| 336 | Ga0495584_0005907 | 3300046491 | Bacteria | 6450 |
| 337 | Ga0495584_0020035 | 3300046491 | Bacteria | 3397 |
| 338 | Ga0495596_0000094 | 3300046500 | Bacteria | 62938 |
| 339 | Ga0495607_0004276 | 3300046501 | Bacteria | 10564 |
| 340 | Ga0495607_0018713 | 3300046501 | Bacteria | 4407 |
| 341 | Ga0495607_0019127 | 3300046501 | Bacteria | 4355 |
| 342 | Ga0495607_0050762 | 3300046501 | Bacteria | 2413 |
| 343 | Ga0495607_0053369 | 3300046501 | Bacteria | 2336 |
| 344 | Ga0495607_0072404 | 3300046501 | Unclassified | 1918 |
| 345 | Ga0495607_0080839 | 3300046501 | Bacteria | 1786 |
| 346 | Ga0495583_0018119 | 3300046506 | Bacteria | 3716 |
| 347 | Ga0495583_0025877 | 3300046506 | Bacteria | 2922 |
| 348 | Ga0495583_0026708 | 3300046506 | Bacteria | 2857 |
| 349 | Ga0495583_0046605 | 3300046506 | Bacteria | 1998 |
| 350 | Ga0495583_0222822 | 3300046506 | Bacteria | 762 |
| 351 | Ga0495606_0000039 | 3300046507 | Bacteria | 224632 |
| 352 | Ga0495606_0000087 | 3300046507 | Bacteria | 156407 |
| 353 | Ga0495606_0000576 | 3300046507 | Bacteria | 58266 |
| 354 | Ga0495606_0004066 | 3300046507 | Bacteria | 14886 |
| 355 | Ga0495606_0004183 | 3300046507 | Bacteria | 14621 |
| 356 | Ga0495606_0010822 | 3300046507 | Bacteria | 7517 |
| 357 | Ga0495606_0069006 | 3300046507 | Bacteria | 2234 |
| 358 | Ga0495606_0112336 | 3300046507 | Bacteria | 1642 |
| 359 | Ga0495606_0113385 | 3300046507 | Bacteria | 1632 |
| 360 | Ga0495606_0138844 | 3300046507 | Bacteria | 1437 |
| 361 | Ga0495606_0208584 | 3300046507 | Bacteria | 1108 |
| 362 | Ga0495606_0257742 | 3300046507 | Bacteria | 964 |
| 363 | Ga0495606_0321685 | 3300046507 | Bacteria | 831 |
| 364 | Ga0495610_0002460 | 3300046512 | Bacteria | 15569 |
| 365 | Ga0495610_0004765 | 3300046512 | Bacteria | 9895 |
| 366 | Ga0495610_0018020 | 3300046512 | Bacteria | 4003 |
| 367 | Ga0495610_0062161 | 3300046512 | Bacteria | 1772 |
| 368 | Ga0495610_0082109 | 3300046512 | Bacteria | 1478 |
| 369 | Ga0495610_0090555 | 3300046512 | Bacteria | 1387 |
| 370 | Ga0495610_0107157 | 3300046512 | Bacteria | 1243 |
| 371 | Ga0495616_0038296 | 3300046513 | Bacteria | 2462 |
| 372 | Ga0495616_0092503 | 3300046513 | Bacteria | 1430 |
| 373 | Ga0495620_0010126 | 3300046515 | Bacteria | 4984 |
| 374 | Ga0495620_0054470 | 3300046515 | Bacteria | 1689 |
| 375 | Ga0495620_0060299 | 3300046515 | Bacteria | 1582 |
| 376 | Ga0495620_0125466 | 3300046515 | Bacteria | 1010 |
| 377 | Ga0495631_0012429 | 3300046518 | Bacteria | 4157 |
| 378 | Ga0495632_0214626 | 3300046519 | Bacteria | 872 |
| 379 | Ga0495632_0225862 | 3300046519 | Bacteria | 846 |
| 380 | Ga0495637_0000528 | 3300046520 | Bacteria | 27567 |
| 381 | Ga0495637_0007307 | 3300046520 | Bacteria | 5490 |
| 382 | Ga0495637_0027583 | 3300046520 | Bacteria | 2539 |
| 383 | Ga0495637_0030898 | 3300046520 | Bacteria | 2373 |
| 384 | Ga0495643_0017925 | 3300046522 | Bacteria | 4128 |
| 385 | Ga0495643_0066315 | 3300046522 | Bacteria | 1904 |
| 386 | Ga0495643_0139202 | 3300046522 | Bacteria | 1212 |
| 387 | Ga0495643_0348653 | 3300046522 | Bacteria | 663 |
| 388 | Ga0495648_0002125 | 3300046524 | Bacteria | 18671 |
| 389 | Ga0495648_0002883 | 3300046524 | Bacteria | 15481 |
| 390 | Ga0495663_0090743 | 3300046525 | Bacteria | 996 |
| 391 | Ga0495642_0001000 | 3300046528 | Bacteria | 13122 |
| 392 | Ga0495642_0032721 | 3300046528 | Bacteria | 2087 |
| 393 | Ga0495654_0000038 | 3300046530 | Bacteria | 185693 |
| 394 | Ga0495654_0012778 | 3300046530 | Bacteria | 4507 |
| 395 | Ga0495654_0180559 | 3300046530 | Bacteria | 914 |
| 396 | Ga0495609_0011230 | 3300046538 | Bacteria | 4271 |
| 397 | Ga0495609_0011488 | 3300046538 | Bacteria | 4216 |
| 398 | Ga0495597_0006248 | 3300046542 | Bacteria | 6176 |
| 399 | Ga0495622_0010327 | 3300046557 | Bacteria | 4316 |
| 400 | Ga0495622_0061210 | 3300046557 | Bacteria | 1743 |
| 401 | Ga0495633_0000446 | 3300046558 | Bacteria | 42633 |
| 402 | Ga0495633_0001911 | 3300046558 | Bacteria | 15164 |
| 403 | Ga0495633_0001922 | 3300046558 | Bacteria | 15124 |
| 404 | Ga0495633_0007219 | 3300046558 | Bacteria | 6432 |
| 405 | Ga0495656_0084106 | 3300046615 | Bacteria | 1442 |
| 406 | Ga0495668_0000492 | 3300046616 | Bacteria | 49497 |
| 407 | Ga0495668_0003911 | 3300046616 | Bacteria | 10880 |
| 408 | Ga0495668_0003969 | 3300046616 | Bacteria | 10781 |
| 409 | Ga0495668_0038840 | 3300046616 | Bacteria | 2659 |
| 410 | Ga0495668_0532785 | 3300046616 | Bacteria | 648 |
| 411 | Ga0495625_0004405 | 3300046660 | Bacteria | 13347 |
| 412 | Ga0495625_0025457 | 3300046660 | Bacteria | 4489 |
| 413 | Ga0495625_0041146 | 3300046660 | Bacteria | 3365 |
| 414 | Ga0495625_0130465 | 3300046660 | Bacteria | 1703 |
| 415 | Ga0495625_0188241 | 3300046660 | Bacteria | 1369 |
| 416 | Ga0495625_0217047 | 3300046660 | Bacteria | 1255 |
| 417 | Ga0495625_0223534 | 3300046660 | Bacteria | 1232 |
| 418 | Ga0495661_0033658 | 3300046665 | Bacteria | 3231 |
| 419 | Ga0495661_0128037 | 3300046665 | Bacteria | 1394 |
| 420 | Ga0495588_0014578 | 3300046674 | Bacteria | 3763 |
| 421 | Ga0495669_0032435 | 3300046684 | Bacteria | 2296 |
| 422 | Ga0495670_0022329 | 3300046691 | Bacteria | 3124 |
| 423 | Ga0495671_0082758 | 3300046692 | Bacteria | 1573 |
| 424 | Ga0495649_0011304 | 3300046694 | Bacteria | 5241 |
| 425 | Ga0495649_0045411 | 3300046694 | Bacteria | 2395 |
| 426 | Ga0495649_0061696 | 3300046694 | Bacteria | 2016 |
| 427 | Ga0495649_0095780 | 3300046694 | Bacteria | 1580 |
| 428 | Ga0495589_0005121 | 3300046794 | Bacteria | 6936 |
| 429 | Ga0495589_0024415 | 3300046794 | Bacteria | 3072 |
| 430 | Ga0495660_0011379 | 3300046810 | Bacteria | 5166 |
| 431 | Ga0495660_0015387 | 3300046810 | Bacteria | 4420 |
| 432 | Ga0495660_0044555 | 3300046810 | Bacteria | 2440 |
| 433 | Ga0495660_0116655 | 3300046810 | Bacteria | 1356 |
| 434 | Ga0495660_0207633 | 3300046810 | Bacteria | 931 |
| 435 | Ga0495672_0061166 | 3300047320 | Bacteria | 2171 |
| 436 | Ga0495687_027801 | 3300047443 | Bacteria | 2641 |
| 437 | Ga0495677_0006203 | 3300047445 | Bacteria | 4517 |
| 438 | Ga0495679_116906 | 3300047446 | Bacteria | 731 |
| 439 | Ga0495685_068146 | 3300047447 | Bacteria | 1194 |
| 440 | Ga0495673_0000243 | 3300047469 | Bacteria | 77026 |
| 441 | Ga0495673_0001921 | 3300047469 | Bacteria | 15487 |
| 442 | Ga0495673_0032589 | 3300047469 | Bacteria | 2427 |
| 443 | Ga0495681_0002453 | 3300047470 | Bacteria | 13248 |
| 444 | Ga0495681_0007214 | 3300047470 | Bacteria | 7145 |
| 445 | Ga0495681_0114463 | 3300047470 | Bacteria | 1164 |
| 446 | Ga0495686_0001183 | 3300047472 | Bacteria | 30424 |
| 447 | Ga0495686_0011273 | 3300047472 | Bacteria | 6301 |
| 448 | Ga0495686_0013882 | 3300047472 | Bacteria | 5574 |
| 449 | Ga0495686_0032379 | 3300047472 | Bacteria | 3383 |
| 450 | Ga0495686_0034421 | 3300047472 | Bacteria | 3263 |
| 451 | Ga0495686_0053471 | 3300047472 | Bacteria | 2531 |
| 452 | Ga0495626_0000005 | 3300048091 | Bacteria | 337534 |
| 453 | Ga0495626_0022855 | 3300048091 | Bacteria | 3085 |
| 454 | Ga0495626_0026649 | 3300048091 | Bacteria | 2814 |
| 455 | Ga0495626_0101622 | 3300048091 | Bacteria | 1253 |
| 456 | Ga0496100_0404129 | 3300048903 | Bacteria | 1041 |
| 457 | Ga0496101_0424195 | 3300048904 | Bacteria | 1048 |
| 458 | Ga0496102_0378775 | 3300048905 | Bacteria | 1332 |
| 459 | Ga0496102_1179393 | 3300048905 | Bacteria | 685 |
| 460 | Ga0496103_0054846 | 3300048906 | Bacteria | 2471 |
| 461 | Ga0496106_0000128 | 3300048909 | Bacteria | 58226 |
| 462 | Ga0496108_0267916 | 3300048911 | Bacteria | 1487 |
| 463 | Ga0496110_0091361 | 3300048913 | Bacteria | 2723 |
| 464 | Ga0496111_0058413 | 3300048914 | Bacteria | 2793 |
| 465 | Ga0496111_0237746 | 3300048914 | Bacteria | 1353 |
| 466 | Ga0496112_0120045 | 3300048915 | Bacteria | 2599 |
| 467 | Ga0496112_0316885 | 3300048915 | Bacteria | 1504 |
| 468 | Ga0496113_0103871 | 3300048916 | Bacteria | 2204 |
| 469 | Ga0496114_0218110 | 3300048917 | Bacteria | 1674 |
| 470 | Ga0496116_0003539 | 3300048919 | Bacteria | 15371 |
| 471 | Ga0496116_0012411 | 3300048919 | Bacteria | 6963 |
| 472 | Ga0496116_0013590 | 3300048919 | Bacteria | 6549 |
| 473 | Ga0496116_0037378 | 3300048919 | Bacteria | 3386 |
| 474 | Ga0496116_0256223 | 3300048919 | Bacteria | 867 |
| 475 | Ga0496117_0065358 | 3300048920 | Bacteria | 2474 |
| 476 | Ga0496117_0104860 | 3300048920 | Bacteria | 1778 |
| 477 | Ga0496118_0067336 | 3300048921 | Bacteria | 2608 |
| 478 | Ga0496118_0069457 | 3300048921 | Bacteria | 2551 |
| 479 | Ga0496118_0185131 | 3300048921 | Bacteria | 1253 |
| 480 | Ga0496118_0224259 | 3300048921 | Bacteria | 1091 |
| 481 | Ga0496119_0088072 | 3300048922 | Bacteria | 1771 |
| 482 | Ga0496119_0233240 | 3300048922 | Bacteria | 935 |
| 483 | Ga0496120_0082741 | 3300048923 | Bacteria | 1734 |
| 484 | Ga0496121_0000115 | 3300048924 | Bacteria | 178411 |
| 485 | Ga0496121_0000732 | 3300048924 | Bacteria | 60492 |
| 486 | Ga0496121_0003073 | 3300048924 | Bacteria | 24180 |
| 487 | Ga0496121_0003099 | 3300048924 | Bacteria | 24038 |
| 488 | Ga0496121_0009567 | 3300048924 | Bacteria | 11105 |
| 489 | Ga0496121_0019771 | 3300048924 | Bacteria | 6712 |
| 490 | Ga0496121_0023911 | 3300048924 | Bacteria | 5860 |
| 491 | Ga0496121_0087448 | 3300048924 | Bacteria | 2447 |
| 492 | Ga0496121_0108896 | 3300048924 | Bacteria | 2118 |
| 493 | Ga0496121_0164941 | 3300048924 | Bacteria | 1616 |
| 494 | Ga0496121_0200413 | 3300048924 | Bacteria | 1423 |
| 495 | Ga0496121_0293755 | 3300048924 | Bacteria | 1106 |
| 496 | Ga0496121_0445888 | 3300048924 | Bacteria | 835 |
| 497 | Ga0496122_0002345 | 3300048925 | Bacteria | 27302 |
| 498 | Ga0496122_0003047 | 3300048925 | Bacteria | 22665 |
| 499 | Ga0496122_0004149 | 3300048925 | Bacteria | 18287 |
| 500 | Ga0496122_0006437 | 3300048925 | Bacteria | 13481 |
| 501 | Ga0496122_0022551 | 3300048925 | Bacteria | 5590 |
| 502 | Ga0496122_0024625 | 3300048925 | Bacteria | 5261 |
| 503 | Ga0496122_0033637 | 3300048925 | Bacteria | 4212 |
| 504 | Ga0496122_0056585 | 3300048925 | Bacteria | 2922 |
| 505 | Ga0496122_0106500 | 3300048925 | Bacteria | 1856 |
| 506 | Ga0496123_0001894 | 3300048926 | Bacteria | 27302 |
| 507 | Ga0496123_0002119 | 3300048926 | Bacteria | 25445 |
| 508 | Ga0496123_0002549 | 3300048926 | Bacteria | 22213 |
| 509 | Ga0496123_0004684 | 3300048926 | Bacteria | 14173 |
| 510 | Ga0496123_0017127 | 3300048926 | Bacteria | 5847 |
| 511 | Ga0496123_0023010 | 3300048926 | Bacteria | 4784 |
| 512 | Ga0496123_0155944 | 3300048926 | Unclassified | 1224 |
| 513 | Ga0496123_0191780 | 3300048926 | Bacteria | 1056 |
| 514 | Ga0496123_0285417 | 3300048926 | Bacteria | 795 |
| 515 | Ga0496123_0323993 | 3300048926 | Bacteria | 726 |
| 516 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 517 | Ga0496124_0002110 | 3300048927 | Bacteria | 26805 |
| 518 | Ga0496124_0006984 | 3300048927 | Bacteria | 12110 |
| 519 | Ga0496124_0013347 | 3300048927 | Bacteria | 8027 |
| 520 | Ga0496124_0015566 | 3300048927 | Bacteria | 7282 |
| 521 | Ga0496124_0036011 | 3300048927 | Bacteria | 4323 |
| 522 | Ga0496124_0064129 | 3300048927 | Bacteria | 3068 |
| 523 | Ga0496124_0069909 | 3300048927 | Bacteria | 2913 |
| 524 | Ga0496124_0175490 | 3300048927 | Bacteria | 1655 |
| 525 | Ga0496124_0317854 | 3300048927 | Unclassified | 1116 |
| 526 | Ga0496124_0329822 | 3300048927 | Bacteria | 1089 |
| 527 | Ga0496124_0434379 | 3300048927 | Bacteria | 900 |
| 528 | Ga0496124_0451068 | 3300048927 | Bacteria | 877 |
| 529 | Ga0496125_0000989 | 3300048928 | Bacteria | 44313 |
| 530 | Ga0496125_0003290 | 3300048928 | Bacteria | 19824 |
| 531 | Ga0496125_0005889 | 3300048928 | Bacteria | 13437 |
| 532 | Ga0496125_0054813 | 3300048928 | Bacteria | 3255 |
| 533 | Ga0496125_0071584 | 3300048928 | Bacteria | 2707 |
| 534 | Ga0496125_0109079 | 3300048928 | Bacteria | 2011 |
| 535 | Ga0496125_0184735 | 3300048928 | Bacteria | 1384 |
| 536 | Ga0496125_0241744 | 3300048928 | Bacteria | 1146 |
| 537 | Ga0496125_0343223 | 3300048928 | Bacteria | 895 |
| 538 | Ga0496126_0002733 | 3300048929 | Bacteria | 23320 |
| 539 | Ga0496126_0002943 | 3300048929 | Bacteria | 22129 |
| 540 | Ga0496126_0008699 | 3300048929 | Bacteria | 10901 |
| 541 | Ga0496126_0113740 | 3300048929 | Bacteria | 2355 |
| 542 | Ga0496126_0129931 | 3300048929 | Bacteria | 2177 |
| 543 | Ga0496126_0148142 | 3300048929 | Bacteria | 2014 |
| 544 | Ga0496126_0166514 | 3300048929 | Bacteria | 1881 |
| 545 | Ga0496126_0348803 | 3300048929 | Bacteria | 1211 |
| 546 | Ga0496126_0418313 | 3300048929 | Bacteria | 1084 |
| 547 | Ga0495678_085823 | 3300049459 | Bacteria | 1120 |
| 548 | Ga0495678_140902 | 3300049459 | Bacteria | 789 |
| 549 | Ga0495682_0002858 | 3300049460 | Bacteria | 7948 |
| 550 | Ga0495682_0005105 | 3300049460 | Bacteria | 5502 |
| 551 | Ga0495682_0154738 | 3300049460 | Bacteria | 817 |
| 552 | Ga0501034_0072221 | 3300049571 | Bacteria | 3459 |
| 553 | Ga0501034_0117686 | 3300049571 | Bacteria | 2645 |
| 554 | Ga0501034_0342867 | 3300049571 | Bacteria | 1424 |
| 555 | Ga0501036_0106295 | 3300049572 | Bacteria | 2374 |
| 556 | Ga0501036_0179945 | 3300049572 | Bacteria | 1780 |
| 557 | Ga0501037_0086717 | 3300049573 | Bacteria | 2266 |
| 558 | Ga0501039_0225718 | 3300049575 | Bacteria | 1472 |
| 559 | Ga0501040_0888174 | 3300049576 | Bacteria | 645 |
| 560 | Ga0501043_0011739 | 3300049579 | Bacteria | 6860 |
| 561 | Ga0501043_0425390 | 3300049579 | Bacteria | 1001 |
| 562 | Ga0501238_005046 | 3300049671 | Bacteria | 1664 |
| 563 | Ga0501035_0522056 | 3300049822 | Bacteria | 975 |
| 564 | nmdc:mga03683_38234_c1 | 3300050489 | Bacteria | 1512 |
| 565 | nmdc:mga03n38_24298_c1 | 3300050490 | Bacteria | 2476 |
| 566 | nmdc:mga00v17_278059_c1 | 3300050491 | Bacteria | 1087 |
| 567 | nmdc:mga00v17_79470_c1 | 3300050491 | Bacteria | 2045 |
| 568 | nmdc:mga0yw44_232903_c1 | 3300050492 | Bacteria | 1223 |
| 569 | nmdc:mga0yw44_42549_c1 | 3300050492 | Bacteria | 2709 |
| 570 | nmdc:mga0yw44_45675_c1 | 3300050492 | Bacteria | 2627 |
| 571 | nmdc:mga0k408_22463_c1 | 3300050493 | Bacteria | 3552 |
| 572 | nmdc:mga06z11_123663_c1 | 3300050494 | Bacteria | 1446 |
| 573 | nmdc:mga06z11_14867_c1 | 3300050494 | Bacteria | 3459 |
| 574 | nmdc:mga06z11_149601_c1 | 3300050494 | Bacteria | 1326 |
| 575 | nmdc:mga06z11_265596_c1 | 3300050494 | Bacteria | 1014 |
| 576 | nmdc:mga06z11_540624_c1 | 3300050494 | Bacteria | 707 |
| 577 | nmdc:mga04h51_55368_c1 | 3300050495 | Bacteria | 1343 |
| 578 | nmdc:mga04h51_73920_c1 | 3300050495 | Bacteria | 1196 |
| 579 | nmdc:mga07m45_123254_c1 | 3300050496 | Bacteria | 1498 |
| 580 | nmdc:mga07m45_140417_c1 | 3300050496 | Bacteria | 1399 |
| 581 | nmdc:mga07m45_198735_c1 | 3300050496 | Bacteria | 1166 |
| 582 | nmdc:mga07m45_23192_c1 | 3300050496 | Bacteria | 3391 |
| 583 | nmdc:mga07m45_30862_c1 | 3300050496 | Bacteria | 2969 |
| 584 | nmdc:mga07m45_65164_c1 | 3300050496 | Bacteria | 2068 |
| 585 | nmdc:mga0sz30_105200_c1 | 3300050516 | Bacteria | 1234 |
| 586 | nmdc:mga0sz30_109349_c1 | 3300050516 | Bacteria | 1211 |
| 587 | nmdc:mga0sz30_267815_c1 | 3300050516 | Bacteria | 761 |
| 588 | nmdc:mga0sz30_50858_c1 | 3300050516 | Bacteria | 1757 |
| 589 | Ga0500578_0052014 | 3300053086 | Bacteria | 2623 |
| 590 | Ga0500578_0226559 | 3300053086 | Bacteria | 1134 |
| 591 | Ga0500644_0003082 | 3300053088 | Bacteria | 4130 |
| 592 | Ga0500583_0032819 | 3300053092 | Bacteria | 2293 |
| 593 | Ga0500566_0004935 | 3300053094 | Bacteria | 7949 |
| 594 | Ga0500555_023376 | 3300053103 | Bacteria | 1773 |
| 595 | Ga0500562_007425 | 3300053108 | Bacteria | 2765 |
| 596 | Ga0500562_095712 | 3300053108 | Bacteria | 807 |
| 597 | Ga0500594_0011681 | 3300053118 | Bacteria | 2053 |
| 598 | Ga0500595_001365 | 3300053119 | Bacteria | 13120 |
| 599 | Ga0500614_020700 | 3300053123 | Unclassified | 1521 |
| 600 | Ga0500618_000157 | 3300053125 | Bacteria | 56116 |
| 601 | Ga0500618_000364 | 3300053125 | Bacteria | 31481 |
| 602 | Ga0500618_006259 | 3300053125 | Bacteria | 3514 |
| 603 | Ga0500618_009728 | 3300053125 | Bacteria | 2613 |
| 604 | Ga0500642_0067534 | 3300053130 | Bacteria | 1620 |
| 605 | Ga0500655_006895 | 3300053133 | Bacteria | 2044 |
| 606 | Ga0500655_032332 | 3300053133 | Unclassified | 1010 |
| 607 | Ga0500658_0002753 | 3300053134 | Bacteria | 6759 |
| 608 | Ga0500658_0053275 | 3300053134 | Bacteria | 1659 |
| 609 | Ga0500564_059167 | 3300053138 | Bacteria | 1741 |
| 610 | Ga0500564_174455 | 3300053138 | Bacteria | 901 |
| 611 | Ga0500568_0001525 | 3300053139 | Bacteria | 14748 |
| 612 | Ga0500568_0007325 | 3300053139 | Bacteria | 5424 |
| 613 | Ga0500586_000032 | 3300053145 | Bacteria | 24537 |
| 614 | Ga0500586_000214 | 3300053145 | Bacteria | 11404 |
| 615 | Ga0500603_001447 | 3300053150 | Bacteria | 5420 |
| 616 | Ga0500604_0001630 | 3300053151 | Bacteria | 6305 |
| 617 | Ga0500616_0000066 | 3300053153 | Bacteria | 237304 |
| 618 | Ga0500616_0000104 | 3300053153 | Bacteria | 159954 |
| 619 | Ga0500616_0004850 | 3300053153 | Bacteria | 9389 |
| 620 | Ga0500616_0015076 | 3300053153 | Bacteria | 4428 |
| 621 | Ga0500616_0027363 | 3300053153 | Bacteria | 3148 |
| 622 | Ga0500616_0035345 | 3300053153 | Bacteria | 2718 |
| 623 | Ga0500616_0106963 | 3300053153 | Bacteria | 1357 |
| 624 | Ga0500620_075416 | 3300053155 | Bacteria | 1164 |
| 625 | Ga0500622_0001635 | 3300053156 | Bacteria | 17534 |
| 626 | Ga0500622_0001984 | 3300053156 | Bacteria | 15344 |
| 627 | Ga0500622_0026539 | 3300053156 | Bacteria | 3056 |
| 628 | Ga0500627_0001791 | 3300053158 | Bacteria | 6107 |
| 629 | Ga0500627_0131148 | 3300053158 | Bacteria | 1132 |
| 630 | Ga0500627_0138542 | 3300053158 | Bacteria | 1099 |
| 631 | Ga0500627_0245753 | 3300053158 | Bacteria | 793 |
| 632 | Ga0500633_0000139 | 3300053160 | Bacteria | 9642 |
| 633 | Ga0500661_010391 | 3300055283 | Bacteria | 1696 |
| 634 | 2503203128 | 2503198000 | Bacteria | 6884444 |
| 635 | 2510131908 | 2510065019 | Bacteria | 6903379 |
| 636 | 2510840626 | 2510461069 | Bacteria | 5505000 |
| 637 | 2510898223 | 2510461076 | Bacteria | 8618824 |
| 638 | 2511169774 | 2510917026 | Bacteria | 7046020 |
| 639 | 2511195007 | 2510917030 | Bacteria | 7460662 |
| 640 | 2512933840 | 2512875016 | Bacteria | 6529530 |
| 641 | 2513568725 | 2513237084 | Bacteria | 7231967 |
| 642 | 2513580601 | 2513237085 | Bacteria | 7695351 |
| 643 | 2513601079 | 2513237088 | Bacteria | 6927906 |
| 644 | 2513614464 | 2513237090 | Bacteria | 7096802 |
| 645 | 2513634666 | 2513237093 | Bacteria | 7545552 |
| 646 | 2513709587 | 2513237103 | Bacteria | 7647401 |
| 647 | 2513865999 | 2513237138 | Bacteria | 7368160 |
| 648 | 2514022985 | 2513237162 | Bacteria | 7468464 |
| 649 | 2515110872 | 2515075009 | Bacteria | 7288508 |
| 650 | 2515638605 | 2515154113 | Bacteria | 7807172 |
| 651 | 2515645723 | 2515154114 | Bacteria | 7848616 |
| 652 | 2515661999 | 2515154116 | Bacteria | 7552979 |
| 653 | 2515743186 | 2515154134 | Bacteria | 7220242 |
| 654 | 2517039560 | 2516653077 | Bacteria | 7555578 |
| 655 | 2517075065 | 2516653085 | Bacteria | 7346596 |
| 656 | 2517093698 | 2517093000 | Bacteria | 7412387 |
| 657 | 2517405482 | 2517287029 | Bacteria | 6905599 |
| 658 | 2524458577 | 2524023209 | Bacteria | 6679728 |
| 659 | 2524612861 | 2524023250 | Bacteria | 5457705 |
| 660 | 2530644276 | 2529292951 | Bacteria | 6916614 |
| 661 | 2535517650 | 2534681796 | Bacteria | 7146037 |
| 662 | 2559298582 | 2558860242 | Bacteria | 5568029 |
| 663 | 2585221888 | 2582581298 | Bacteria | 7315509 |
| 664 | 2585404256 | 2582581867 | Bacteria | 7184437 |
| 665 | 2585525227 | 2585427526 | Bacteria | 7258840 |
| 666 | 2585540025 | 2585427528 | Bacteria | 6842387 |
| 667 | 2585543942 | 2585427529 | Bacteria | 7395659 |
| 668 | 2585823188 | 2585427590 | Bacteria | 6824633 |
| 669 | 2585838006 | 2585427593 | Bacteria | 7141551 |
| 670 | 2585900105 | 2585427608 | Bacteria | 6544331 |
| 671 | 2585997597 | 2585427633 | Bacteria | 6413184 |
| 672 | 2588519934 | 2588253730 | Bacteria | 6881675 |
| 673 | 2599336344 | 2599185156 | Bacteria | 5403036 |
| 674 | 2599606289 | 2599185210 | Bacteria | 5624189 |
| 675 | 2599722712 | 2599185236 | Bacteria | 6875203 |
| 676 | 2644251640 | 2643221645 | Bacteria | 7207331 |
| 677 | 2644358181 | 2643221664 | Bacteria | 7272945 |
| 678 | 2644500976 | 2643221689 | Bacteria | 6042950 |
| 679 | 2694627812 | 2693429783 | Bacteria | 7019804 |
| 680 | 2694636062 | 2693429784 | Bacteria | 7241525 |
| 681 | 2725951022 | 2724679232 | Bacteria | 7646494 |
| 682 | 2738805702 | 2738541293 | Bacteria | 7065685 |
| 683 | 2738845434 | 2738541300 | Bacteria | 6675882 |
| 684 | 2739034892 | 2738541333 | Bacteria | 7106503 |
| 685 | 2739276487 | 2738543018 | Bacteria | 6718814 |
| 686 | 2739345531 | 2738543030 | Bacteria | 6719714 |
| 687 | 2765468886 | 2765235802 | Bacteria | 5618596 |
| 688 | 2766062629 | 2765235942 | Bacteria | 7445910 |
| 689 | 2792745510 | 2791355123 | Bacteria | 8049106 |
| 690 | 2793344296 | 2791355263 | Bacteria | 6872478 |
| 691 | 2793367180 | 2791355267 | Bacteria | 7222458 |
| 692 | 2806044179 | 2802429633 | Bacteria | 7341974 |
| 693 | 2806052009 | 2802429634 | Bacteria | 7083200 |
| 694 | 2806058311 | 2802429635 | Bacteria | 7650140 |
| 695 | 2806069215 | 2802429636 | Bacteria | 7597525 |
| 696 | 2806074542 | 2802429637 | Bacteria | 7067217 |
| 697 | 2819561655 | 2818991439 | Bacteria | 6907412 |
| 698 | 2838033561 | 2838029111 | Bacteria | 6603031 |
| 699 | 2838043813 | 2838042994 | Bacteria | 6046894 |
| 700 | 2838689020 | 2838686498 | Bacteria | 7807632 |
| 701 | 2838731315 | 2838729681 | Bacteria | 7400765 |
| 702 | 2838743791 | 2838742623 | Bacteria | 7396178 |
| 703 | 2839996276 | 2839993093 | Bacteria | 5512535 |
| 704 | 2839997321 | 2839993093 | Bacteria | 5512535 |
| 705 | 2841766319 | 2841760612 | Bacteria | 6454112 |
| 706 | 2841857149 | 2841851746 | Bacteria | 7532261 |
| 707 | 2842117163 | 2842110456 | Bacteria | 7656360 |
| 708 | 2842159644 | 2842156927 | Bacteria | 6894975 |
| 709 | 2842169485 | 2842163707 | Bacteria | 6916235 |
| 710 | 2842183740 | 2842180545 | Bacteria | 6888678 |
| 711 | 2842220957 | 2842217011 | Bacteria | 7497767 |
| 712 | 2842233780 | 2842229732 | Bacteria | 7475766 |
| 713 | 2842245255 | 2842243621 | Bacteria | 7421798 |
| 714 | 2842260095 | 2842257432 | Bacteria | 7401195 |
| 715 | 2842278562 | 2842271015 | Bacteria | 7807131 |
| 716 | 2842300162 | 2842298080 | Bacteria | 6123127 |
| 717 | 2842307178 | 2842304105 | Bacteria | 7023636 |
| 718 | 2842359073 | 2842357229 | Bacteria | 6485165 |
| 719 | 2842480167 | 2842475841 | Bacteria | 6603183 |
| 720 | 2842508047 | 2842502639 | Bacteria | 6604161 |
| 721 | 2842927908 | 2842922631 | Bacteria | 5824079 |
| 722 | 2844106085 | 2844104063 | Bacteria | 6440972 |
| 723 | 2844455545 | 2844454524 | Bacteria | 7952546 |
| 724 | 2851186590 | 2851182111 | Bacteria | 6047226 |
| 725 | 2851246441 | 2851246043 | Bacteria | 6439203 |
| 726 | 2852391826 | 2852387548 | Bacteria | 8025568 |
| 727 | 2854914714 | 2854911287 | Bacteria | 5582813 |
| 728 | 2856369799 | 2856364286 | Bacteria | 6939991 |
| 729 | 2857353005 | 2857349434 | Bacteria | 7926032 |
| 730 | 2857523296 | 2857516855 | Bacteria | 7787325 |
| 731 | 2857567125 | 2857564685 | Bacteria | 6290584 |
| 732 | 2869290605 | 2869285874 | Bacteria | 6901219 |
| 733 | 2871432887 | 2871429161 | Bacteria | 6547891 |
| 734 | 2871499805 | 2871495908 | Bacteria | 6935695 |
| 735 | 2874130262 | 2874123672 | Bacteria | 7238285 |
| 736 | 2874153952 | 2874146452 | Bacteria | 7533118 |
| 737 | 2874158639 | 2874155637 | Bacteria | 6724144 |
| 738 | 2876363904 | 2876363079 | Bacteria | 6544991 |
| 739 | 2876371512 | 2876369609 | Bacteria | 6807521 |
| 740 | 2876383268 | 2876377896 | Bacteria | 6565995 |
| 741 | 2876396969 | 2876392853 | Bacteria | 6660880 |
| 742 | 2876419256 | 2876413966 | Bacteria | 6831344 |
| 743 | 2878750501 | 2878745973 | Bacteria | 6867388 |
| 744 | 2878763969 | 2878760144 | Bacteria | 6823465 |
| 745 | 2878770999 | 2878767105 | Bacteria | 6898628 |
| 746 | 2881148273 | 2881147464 | Bacteria | 7779814 |
| 747 | 2881165055 | 2881161766 | Bacteria | 7127907 |
| 748 | 2885306929 | 2885305155 | Bacteria | 7348390 |
| 749 | 2885331688 | 2885326080 | Bacteria | 7134805 |
| 750 | 2885335599 | 2885334103 | Bacteria | 7216818 |
| 751 | 2888353276 | 2888350351 | Bacteria | 7372807 |
| 752 | 2889014993 | 2889010040 | Bacteria | 6749192 |
| 753 | 2889019931 | 2889016732 | Bacteria | 6700763 |
| 754 | 2899806758 | 2899803654 | Bacteria | 5577784 |
| 755 | 2903454015 | 2903448605 | Bacteria | 7357801 |
| 756 | 2903499654 | 2903492973 | Bacteria | 13473544 |
| 757 | 2903525937 | 2903521522 | Bacteria | 6525694 |
| 758 | 2903532517 | 2903528002 | Bacteria | 6586099 |
| 759 | 2903544616 | 2903540706 | Bacteria | 7062119 |
| 760 | 2904663723 | 2904659560 | Bacteria | 6685615 |
| 761 | 2906313426 | 2906308376 | Bacteria | 6841989 |
| 762 | 2906326134 | 2906321335 | Bacteria | 6579571 |
| 763 | 2906358336 | 2906354277 | Bacteria | 6991324 |
| 764 | 2909046047 | 2909042592 | Bacteria | 6499737 |
| 765 | 2909400818 | 2909399089 | Bacteria | 3922598 |
| 766 | 2919103142 | 2919100787 | Bacteria | 7710546 |
| 767 | 2919177422 | 2919171160 | Bacteria | 6499771 |
| 768 | 2922133188 | 2922130491 | Bacteria | 7173936 |
| 769 | 2922189283 | 2922185730 | Bacteria | 7113964 |
| 770 | 2924767051 | 2924762789 | Bacteria | 6561353 |
| 771 | 2933572708 | 2933570622 | Bacteria | 7023390 |
| 772 | 2933593318 | 2933586486 | Bacteria | 7667493 |
| 773 | 2935906712 | 2935901341 | Bacteria | 7341747 |
| 774 | 2936368534 | 2936367885 | Bacteria | 7324495 |
| 775 | 2936371347 | 2936367885 | Bacteria | 7324495 |
| 776 | 2936375451 | 2936375103 | Bacteria | 6652732 |
| 777 | 2936376373 | 2936375103 | Bacteria | 6652732 |
| 778 | 2937820270 | 2937813078 | Bacteria | 7783518 |
| 779 | 2937827625 | 2937822353 | Bacteria | 7290551 |
| 780 | 2937850107 | 2937848649 | Bacteria | 6983481 |
| 781 | 2937998464 | 2937994558 | Bacteria | 7036190 |
| 782 | 2938016834 | 2938014810 | Bacteria | 6700592 |
| 783 | 2958055798 | 2958041894 | Bacteria | 13082850 |
| 784 | 2958102102 | 2958100919 | Bacteria | 6800575 |
| 785 | 2958135006 | 2958130278 | Bacteria | 6897202 |
| 786 | 2958168940 | 2958165035 | Bacteria | 6906348 |
| 787 | 2958178159 | 2958172287 | Bacteria | 6716688 |
| 788 | 2958184035 | 2958179912 | Bacteria | 6874908 |
| 789 | 2961082090 | 2961077736 | Bacteria | 7079850 |
| 790 | 2961119137 | 2961114664 | Bacteria | 6680456 |
| 791 | 2961167402 | 2961163497 | Bacteria | 6901077 |
| 792 | 2963645362 | 2963644680 | Bacteria | 6530403 |
| 793 | 2965022224 | 2965018300 | Bacteria | 6883036 |
| 794 | 2965127179 | 2965119406 | Bacteria | 6956431 |
| 795 | 2968089741 | 2968083720 | Bacteria | 7351627 |
| 796 | 2968114862 | 2968110612 | Bacteria | 6814636 |
| 797 | 2968122586 | 2968117919 | Bacteria | 6536078 |
| 798 | 2968175809 | 2968171901 | Bacteria | 6894245 |
| 799 | 2970558813 | 2970554993 | Bacteria | 6814252 |
| 800 | 2977847037 | 2977843712 | Bacteria | 6753583 |
| 801 | 2977943280 | 2977942078 | Bacteria | 7570577 |
| 802 | 2977992121 | 2977986579 | Bacteria | 6581278 |
| 803 | 2979714688 | 2979710463 | Bacteria | 6785254 |
| 804 | 2979748206 | 2979742915 | Bacteria | 7301278 |
| 805 | 2984514253 | 2984509177 | Bacteria | 5274802 |
| 806 | 2984523284 | 2984518228 | Bacteria | 5277463 |
| 807 | 2984542694 | 2984537506 | Bacteria | 5277481 |
| 808 | 2987641598 | 2987636660 | Bacteria | 8088555 |
| 809 | 2987656308 | 2987652177 | Bacteria | 6969023 |
| 810 | 2987663408 | 2987659509 | Bacteria | 6966464 |
| 811 | 2987671583 | 2987666974 | Bacteria | 6509233 |
| 812 | 2989779518 | 2989776772 | Bacteria | 4843317 |
| 813 | 3000136609 | 3000135777 | Bacteria | 6891109 |
| 814 | 3004192467 | 3004188549 | Bacteria | 6952365 |
| 815 | 3004209591 | 3004203850 | Bacteria | 7307914 |
| 816 | 3004216941 | 3004211236 | Bacteria | 7417683 |
| 817 | 3004225465 | 3004218560 | Bacteria | 7421728 |
| 818 | 3004337227 | 3004334049 | Bacteria | 8449246 |
| 819 | 637076951 | 637000159 | Bacteria | 7596297 |
| 820 | 639647105 | 639633055 | Bacteria | 7751309 |
| 821 | 8001845874 | 8001845381 | Bacteria | 5804942 |
| 822 | 8004392895 | 8004387939 | Bacteria | 7049250 |
| 823 | 8004643836 | 8004640170 | Bacteria | 6723001 |
| 824 | 8004719682 | 8004714634 | Bacteria | 6776161 |
| 825 | 8005310932 | 8005307578 | Bacteria | 7395396 |
| 826 | 8005377028 | 8005376324 | Bacteria | 6590079 |
| 827 | 8005461511 | 8005460587 | Bacteria | 7157962 |
| 828 | 8005487657 | 8005484373 | Bacteria | 6297373 |
| 829 | 8005549680 | 8005542996 | Bacteria | 7077758 |
| 830 | 8005562759 | 8005556819 | Bacteria | 6908598 |
| 831 | 8005570032 | 8005563573 | Bacteria | 7153261 |
| 832 | 8005577277 | 8005570704 | Bacteria | 6957481 |
| 833 | 8018168559 | 8018163183 | Bacteria | 7277977 |
| 834 | 8023687391 | 8023680758 | Bacteria | 7729763 |
| 835 | 8024480685 | 8024479707 | Bacteria | 6954785 |
| 836 | 8046767338 | 8046767195 | Bacteria | 7547379 |
| 837 | 8054804163 | 8054795415 | Bacteria | 9785225 |
| 838 | 8055914992 | 8055909800 | Bacteria | 7278581 |
| 839 | 8056378839 | 8056375014 | Bacteria | 7006639 |
| 840 | 8057580112 | 8057575449 | Bacteria | 7367519 |
| 841 | 8057881607 | 8057874678 | Bacteria | 7494653 |
| 842 | JGI25159J45721_1010227 | |||
| 843 | JGI24739J22299_10143181 | |||
| 844 | JGI25156J39149_1007065 | |||
| 845 | JGI25158J39367_1000147 | |||
| 846 | JGI25157J39369_1001441 | |||
| 847 | JGI25152J39213_1000001 | |||
| 848 | JGI25152J39213_1009455 | |||
| 849 | JGI25150J39212_1000007 | |||
| 850 | JGI25159J45721_1000695 | |||
| 851 | JGI25151J46595_10000013 | |||
| 852 | JGI25151J46595_10002485 | |||
| 853 | JGI25151J46595_10004416 | |||
| 854 | JGI25165J46597_1000079 | |||
| 855 | JGI25153J46596_10000640 | |||
| 856 | JGI25153J46596_10005600 | |||
| 857 | JGI25153J46596_10011017 | |||
| 858 | JGI25153J46596_10037408 | |||
| 859 | JGI25153J46596_10039892 | |||
| 860 | rootH1_10017387 | |||
| 861 | rootH2_10299493 | |||
| 862 | rootL2_10107941 | |||
| 863 | rootH1_10035776 | |||
| 864 | rootH1_10142015 | |||
| 865 | rootH1_10217570 | |||
| 866 | JGI25160J50197_1000022 | |||
| 867 | JGI25160J50197_1001505 | |||
| 868 | JGI25160J50197_1007219 | |||
| 869 | JGI25161J50226_1000024 | |||
| 870 | JGI25161J50226_1000154 | |||
| 871 | JGI25161J50226_1003426 | |||
| 872 | Ga0055539_1003522 | |||
| 873 | Ga0055535_1007104 | |||
| 874 | Ga0055542_1001962 | |||
| 875 | Ga0055529_1004114 | |||
| 876 | Ga0055526_1002360 | |||
| 877 | Ga0055526_1009151 | |||
| 878 | Ga0055526_1018520 | |||
| 879 | Ga0055537_1000103 | |||
| 880 | Ga0055524_1001735 | |||
| 881 | Ga0055524_1006641 | |||
| 882 | Ga0055524_1018190 | |||
| 883 | Ga0055536_1005082 | |||
| 884 | Ga0055534_1000317 | |||
| 885 | Ga0055528_1000031 | |||
| 886 | Ga0055528_1006346 | |||
| 887 | Ga0055528_1007257 | |||
| 888 | Ga0055528_1013691 | |||
| 889 | Ga0055528_1016425 | |||
| 890 | Ga0055540_1010940 | |||
| 891 | Ga0055540_1028948 | |||
| 892 | Ga0055540_1034201 | |||
| 893 | Ga0055543_1000125 | |||
| 894 | Ga0055543_1000513 | |||
| 895 | Ga0055543_1001652 | |||
| 896 | Ga0055543_1004558 | |||
| 897 | Ga0065165_1000051 | |||
| 898 | Ga0065165_1000439 | |||
| 899 | Ga0065165_1005437 | |||
| 900 | Ga0065165_1081622 | |||
| 901 | Ga0070658_10015348 | |||
| 902 | Ga0070658_10440893 | |||
| 903 | Ga0070676_10224910 | |||
| 904 | Ga0070670_100000133 | |||
| 905 | Ga0070669_100162007 | |||
| 906 | Ga0070671_100013556 | |||
| 907 | Ga0070667_100032879 | |||
| 908 | Ga0070667_100433010 | |||
| 909 | Ga0070663_100317289 | |||
| 910 | Ga0070685_10481149 | |||
| 911 | Ga0068853_100087342 | |||
| 912 | Ga0068853_100370186 | |||
| 913 | Ga0070665_100004155 | |||
| 914 | Ga0068855_100005827 | |||
| 915 | Ga0068857_101013580 | |||
| 916 | Ga0068852_100295556 | |||
| 917 | Ga0068859_100498381 | |||
| 918 | Ga0068863_100013407 | |||
| 919 | Ga0068860_100244881 | |||
| 920 | Ga0068862_100188986 | |||
| 921 | Ga0081540_1045274 | |||
| 922 | Ga0075365_10015925 | |||
| 923 | Ga0075365_10034333 | |||
| 924 | Ga0075365_10036220 | |||
| 925 | Ga0075365_10523189 | |||
| 926 | Ga0075368_10069582 | |||
| 927 | Ga0075368_10074203 | |||
| 928 | Ga0075363_100089068 | |||
| 929 | Ga0075363_100246756 | |||
| 930 | Ga0075363_100285269 | |||
| 931 | Ga0075364_10158518 | |||
| 932 | Ga0075362_10013087 | |||
| 933 | Ga0075362_10086383 | |||
| 934 | Ga0075362_10160809 | |||
| 935 | Ga0075367_10050070 | |||
| 936 | Ga0075367_10053778 | |||
| 937 | Ga0075367_10155947 | |||
| 938 | Ga0075369_10009159 | |||
| 939 | Ga0075369_10009605 | |||
| 940 | Ga0075369_10019280 | |||
| 941 | Ga0075369_10115653 | |||
| 942 | Ga0075366_10074784 | |||
| 943 | Ga0075366_10202987 | |||
| 944 | Ga0075370_10024096 | |||
| 945 | Ga0075370_10063254 | |||
| 946 | Ga0075370_10178295 | |||
| 947 | Ga0075370_10381898 | |||
| 948 | Ga0097620_100498403 | |||
| 949 | Ga0105244_10004485 | |||
| 950 | Ga0105240_10031594 | |||
| 951 | Ga0105240_10118452 | |||
| 952 | Ga0105240_10131078 | |||
| 953 | Ga0105240_10527314 | |||
| 954 | Ga0105241_10545483 | |||
| 955 | Ga0105242_10591399 | |||
| 956 | Ga0105242_10688563 | |||
| 957 | Ga0105248_10219814 | |||
| 958 | Ga0105248_10596640 | |||
| 959 | Ga0105237_10032528 | |||
| 960 | Ga0105237_10174637 | |||
| 961 | Ga0105237_10220033 | |||
| 962 | Ga0105237_10349530 | |||
| 963 | Ga0105238_10155985 | |||
| 964 | Ga0105238_11230290 | |||
| 965 | Ga0123342_1009171 | |||
| 966 | Ga0105033_102193 | |||
| 967 | Ga0105239_10128575 | |||
| 968 | Ga0105239_10214198 | |||
| 969 | Ga0105239_10291625 | |||
| 970 | Ga0105239_10317884 | |||
| 971 | Ga0105239_10395079 | |||
| 972 | Ga0105239_10476348 | |||
| 973 | Ga0105239_10581782 | |||
| 974 | Ga0105239_10857598 | |||
| 975 | Ga0157373_10072471 | |||
| 976 | Ga0157371_10024423 | |||
| 977 | Ga0157369_10307003 | |||
| 978 | Ga0157378_10415752 | |||
| 979 | Ga0157378_10707947 | |||
| 980 | Ga0163162_10630477 | |||
| 981 | Ga0157372_10316079 | |||
| 982 | Ga0157372_10481303 | |||
| 983 | Ga0163163_10087771 | |||
| 984 | Ga0163163_11040635 | |||
| 985 | Ga0182008_10139732 | |||
| 986 | Ga0182008_10358043 | |||
| 987 | Ga0157376_10236718 | |||
| 988 | Ga0157376_10326539 | |||
| 989 | Ga0182007_10005652 | |||
| 990 | Ga0182007_10006344 | |||
| 991 | Ga0182005_1004353 | |||
| 992 | Ga0182005_1005418 | |||
| 993 | Ga0163161_10555417 | |||
| 994 | Ga0213872_10060697 | |||
| 995 | Ga0228711_1004434 | |||
| 996 | Ga0228710_1004658 | |||
| 997 | Ga0209436_100021 | |||
| 998 | Ga0207427_102046 | |||
| 999 | Ga0209437_100590 | |||
| 1000 | Ga0209258_100341 | |||
| 1001 | Ga0207425_1000032 | |||
| 1002 | Ga0207425_1000699 | |||
| 1003 | Ga0207425_1002075 | |||
| 1004 | Ga0207425_1007448 | |||
| 1005 | Ga0207425_1011452 | |||
| 1006 | Ga0209026_1000118 | |||
| 1007 | Ga0209677_100364 | |||
| 1008 | Ga0209148_1000212 | |||
| 1009 | Ga0209759_1000076 | |||
| 1010 | Ga0209129_1000056 | |||
| 1011 | Ga0209129_1000149 | |||
| 1012 | Ga0209129_1003333 | |||
| 1013 | Ga0209129_1004094 | |||
| 1014 | Ga0209129_1014147 | |||
| 1015 | Ga0209233_1000247 | |||
| 1016 | Ga0209233_1000250 | |||
| 1017 | Ga0209565_1000035 | |||
| 1018 | Ga0209455_1000170 | |||
| 1019 | Ga0209673_1000006 | |||
| 1020 | Ga0209673_1001640 | |||
| 1021 | Ga0209673_1002960 | |||
| 1022 | Ga0209673_1010222 | |||
| 1023 | Ga0209673_1011182 | |||
| 1024 | Ga0209673_1013245 | |||
| 1025 | Ga0209673_1052102 | |||
| 1026 | Ga0209130_1000019 | |||
| 1027 | Ga0209130_1000063 | |||
| 1028 | Ga0209130_1000251 | |||
| 1029 | Ga0209675_1000005 | |||
| 1030 | Ga0209675_1033682 | |||
| 1031 | Ga0209676_1000138 | |||
| 1032 | Ga0209025_1000090 | |||
| 1033 | Ga0209025_1000205 | |||
| 1034 | Ga0209025_1000253 | |||
| 1035 | Ga0209025_1000866 | |||
| 1036 | Ga0209025_1006828 | |||
| 1037 | Ga0209025_1017611 | |||
| 1038 | Ga0209025_1039984 | |||
| 1039 | Ga0209564_1000007 | |||
| 1040 | Ga0209564_1000083 | |||
| 1041 | Ga0209564_1001757 | |||
| 1042 | Ga0209564_1002391 | |||
| 1043 | Ga0209564_1018387 | |||
| 1044 | Ga0209758_1000084 | |||
| 1045 | Ga0209758_1000296 | |||
| 1046 | Ga0209758_1000567 | |||
| 1047 | Ga0209758_1001105 | |||
| 1048 | Ga0209758_1003899 | |||
| 1049 | Ga0209758_1007385 | |||
| 1050 | Ga0209758_1009542 | |||
| 1051 | Ga0209758_1010105 | |||
| 1052 | Ga0209758_1024193 | |||
| 1053 | Ga0209050_1028567 | |||
| 1054 | Ga0209256_1000141 | |||
| 1055 | Ga0209256_1000200 | |||
| 1056 | Ga0209256_1003442 | |||
| 1057 | Ga0209256_1005526 | |||
| 1058 | Ga0209256_1015501 | |||
| 1059 | Ga0207426_1000005 | |||
| 1060 | Ga0207426_1000082 | |||
| 1061 | Ga0207426_1000538 | |||
| 1062 | Ga0207426_1020869 | |||
| 1063 | Ga0209051_1017527 | |||
| 1064 | Ga0209051_1050104 | |||
| 1065 | Ga0209257_1074395 | |||
| 1066 | Ga0207655_1032856 | |||
| 1067 | Ga0207647_10031287 | |||
| 1068 | Ga0207647_10187446 | |||
| 1069 | Ga0207654_10145889 | |||
| 1070 | Ga0207695_10008916 | |||
| 1071 | Ga0207695_10072374 | |||
| 1072 | Ga0207671_10229575 | |||
| 1073 | Ga0207657_10550164 | |||
| 1074 | Ga0207681_10285995 | |||
| 1075 | Ga0207694_10098844 | |||
| 1076 | Ga0207694_10134079 | |||
| 1077 | Ga0207650_10000592 | |||
| 1078 | Ga0207650_10326419 | |||
| 1079 | Ga0207644_10001838 | |||
| 1080 | Ga0207690_10236725 | |||
| 1081 | Ga0207658_10132232 | |||
| 1082 | Ga0207658_10192846 | |||
| 1083 | Ga0207677_11148917 | |||
| 1084 | Ga0207639_10148940 | |||
| 1085 | Ga0207678_10456818 | |||
| 1086 | Ga0207702_10719312 | |||
| 1087 | Ga0207641_10006236 | |||
| 1088 | Ga0207674_10312323 | |||
| 1089 | Ga0209281_1000194 | |||
| 1090 | Ga0209813_10078746 | |||
| 1091 | Ga0268266_10093857 | |||
| 1092 | Ga0268264_10218603 | |||
| 1093 | Ga0307515_10126031 | |||
| 1094 | Ga0307408_100119605 | |||
| 1095 | Ga0307406_10031266 | |||
| 1096 | Ga0307416_101389291 | |||
| 1097 | Ga0307414_10162646 | |||
| 1098 | Ga0307414_10469113 | |||
| 1099 | Ga0373959_0021527 | |||
| 1100 | Ga0395900_0059101 | |||
| 1101 | Ga0395900_0084308 | |||
| 1102 | Ga0395900_0143224 | |||
| 1103 | Ga0395900_0464805 | |||
| 1104 | Ga0395900_0661767 | |||
| 1105 | Ga0395898_0024814 | |||
| 1106 | Ga0395898_0239545 | |||
| 1107 | Ga0395905_0000708 | |||
| 1108 | Ga0395905_0120491 | |||
| 1109 | Ga0395905_0133883 | |||
| 1110 | Ga0395901_0066789 | |||
| 1111 | Ga0395901_0411471 | |||
| 1112 | Ga0436361_0218161 | |||
| 1113 | Ga0439438_011759 | |||
| 1114 | Ga0439466_0000152 | |||
| 1115 | Ga0439466_0000502 | |||
| 1116 | Ga0439466_0038688 | |||
| 1117 | Ga0439465_0000115 | |||
| 1118 | Ga0439465_0010116 | |||
| 1119 | Ga0439465_0088021 | |||
| 1120 | Ga0439465_0170467 | |||
| 1121 | Ga0451789_0536031 | |||
| 1122 | Ga0451797_1166613 | |||
| 1123 | Ga0451833_0974868 | |||
| 1124 | Ga0451837_0287631 | |||
| 1125 | Ga0451839_0896053 | |||
| 1126 | Ga0451839_0907431 | |||
| 1127 | Ga0451841_0483661 | |||
| 1128 | Ga0451845_0285311 | |||
| 1129 | Ga0451847_0030482 | |||
| 1130 | Ga0451847_0032234 | |||
| 1131 | Ga0451849_1090712 | |||
| 1132 | Ga0451849_1413358 | |||
| 1133 | Ga0451851_0713013 | |||
| 1134 | Ga0451851_0979460 | |||
| 1135 | Ga0451843_0175228 | |||
| 1136 | Ga0451843_0179076 | |||
| 1137 | Ga0451843_0637164 | |||
| 1138 | Ga0451843_0781011 | |||
| 1139 | Ga0451853_2319690 | |||
| 1140 | Ga0439431_0003810 | |||
| 1141 | Ga0439431_0010346 | |||
| 1142 | Ga0439442_013133 | |||
| 1143 | Ga0439445_0004610 | |||
| 1144 | Ga0439445_0007696 | |||
| 1145 | Ga0439448_0161039 | |||
| 1146 | Ga0439452_010972 | |||
| 1147 | Ga0439456_000415 | |||
| 1148 | Ga0439434_0179732 | |||
| 1149 | Ga0466972_0022345 | |||
| 1150 | Ga0466972_0043238 | |||
| 1151 | Ga0466972_0313551 | |||
| 1152 | Ga0466965_0046487 | |||
| 1153 | Ga0466965_0091758 | |||
| 1154 | Ga0466966_0016349 | |||
| 1155 | Ga0466966_0051844 | |||
| 1156 | Ga0466961_0058081 | |||
| 1157 | Ga0466971_0061536 | |||
| 1158 | Ga0466970_0191168 | |||
| 1159 | Ga0466957_0097676 | |||
| 1160 | Ga0466959_0030637 | |||
| 1161 | Ga0466959_0042806 | |||
| 1162 | Ga0466958_0334425 | |||
| 1163 | Ga0495617_075637 | |||
| 1164 | Ga0495627_013893 | |||
| 1165 | Ga0495590_0011991 | |||
| 1166 | Ga0495590_0046549 | |||
| 1167 | Ga0495590_0199904 | |||
| 1168 | Ga0495591_027476 | |||
| 1169 | Ga0495638_0000169 | |||
| 1170 | Ga0495638_0181671 | |||
| 1171 | Ga0495653_0000042 | |||
| 1172 | Ga0495650_0000042 | |||
| 1173 | Ga0495650_0000101 | |||
| 1174 | Ga0495650_0007944 | |||
| 1175 | Ga0495650_0051593 | |||
| 1176 | Ga0495650_0129695 | |||
| 1177 | Ga0495584_0005907 | |||
| 1178 | Ga0495584_0020035 | |||
| 1179 | Ga0495596_0000094 | |||
| 1180 | Ga0495607_0004276 | |||
| 1181 | Ga0495607_0018713 | |||
| 1182 | Ga0495607_0019127 | |||
| 1183 | Ga0495607_0050762 | |||
| 1184 | Ga0495607_0053369 | |||
| 1185 | Ga0495607_0072404 | |||
| 1186 | Ga0495607_0080839 | |||
| 1187 | Ga0495583_0018119 | |||
| 1188 | Ga0495583_0025877 | |||
| 1189 | Ga0495583_0026708 | |||
| 1190 | Ga0495583_0046605 | |||
| 1191 | Ga0495583_0222822 | |||
| 1192 | Ga0495606_0000039 | |||
| 1193 | Ga0495606_0000087 | |||
| 1194 | Ga0495606_0000576 | |||
| 1195 | Ga0495606_0004066 | |||
| 1196 | Ga0495606_0004183 | |||
| 1197 | Ga0495606_0010822 | |||
| 1198 | Ga0495606_0069006 | |||
| 1199 | Ga0495606_0112336 | |||
| 1200 | Ga0495606_0113385 | |||
| 1201 | Ga0495606_0138844 | |||
| 1202 | Ga0495606_0208584 | |||
| 1203 | Ga0495606_0257742 | |||
| 1204 | Ga0495606_0321685 | |||
| 1205 | Ga0495610_0002460 | |||
| 1206 | Ga0495610_0004765 | |||
| 1207 | Ga0495610_0018020 | |||
| 1208 | Ga0495610_0062161 | |||
| 1209 | Ga0495610_0082109 | |||
| 1210 | Ga0495610_0090555 | |||
| 1211 | Ga0495610_0107157 | |||
| 1212 | Ga0495616_0038296 | |||
| 1213 | Ga0495616_0092503 | |||
| 1214 | Ga0495620_0010126 | |||
| 1215 | Ga0495620_0054470 | |||
| 1216 | Ga0495620_0060299 | |||
| 1217 | Ga0495620_0125466 | |||
| 1218 | Ga0495631_0012429 | |||
| 1219 | Ga0495632_0214626 | |||
| 1220 | Ga0495632_0225862 | |||
| 1221 | Ga0495637_0000528 | |||
| 1222 | Ga0495637_0007307 | |||
| 1223 | Ga0495637_0027583 | |||
| 1224 | Ga0495637_0030898 | |||
| 1225 | Ga0495643_0017925 | |||
| 1226 | Ga0495643_0066315 | |||
| 1227 | Ga0495643_0139202 | |||
| 1228 | Ga0495643_0348653 | |||
| 1229 | Ga0495648_0002125 | |||
| 1230 | Ga0495648_0002883 | |||
| 1231 | Ga0495663_0090743 | |||
| 1232 | Ga0495642_0001000 | |||
| 1233 | Ga0495642_0032721 | |||
| 1234 | Ga0495654_0000038 | |||
| 1235 | Ga0495654_0012778 | |||
| 1236 | Ga0495654_0180559 | |||
| 1237 | Ga0495609_0011230 | |||
| 1238 | Ga0495609_0011488 | |||
| 1239 | Ga0495597_0006248 | |||
| 1240 | Ga0495622_0010327 | |||
| 1241 | Ga0495622_0061210 | |||
| 1242 | Ga0495633_0000446 | |||
| 1243 | Ga0495633_0001911 | |||
| 1244 | Ga0495633_0001922 | |||
| 1245 | Ga0495633_0007219 | |||
| 1246 | Ga0495656_0084106 | |||
| 1247 | Ga0495668_0000492 | |||
| 1248 | Ga0495668_0003911 | |||
| 1249 | Ga0495668_0003969 | |||
| 1250 | Ga0495668_0038840 | |||
| 1251 | Ga0495668_0532785 | |||
| 1252 | Ga0495625_0004405 | |||
| 1253 | Ga0495625_0025457 | |||
| 1254 | Ga0495625_0041146 | |||
| 1255 | Ga0495625_0130465 | |||
| 1256 | Ga0495625_0188241 | |||
| 1257 | Ga0495625_0217047 | |||
| 1258 | Ga0495625_0223534 | |||
| 1259 | Ga0495661_0033658 | |||
| 1260 | Ga0495661_0128037 | |||
| 1261 | Ga0495588_0014578 | |||
| 1262 | Ga0495669_0032435 | |||
| 1263 | Ga0495670_0022329 | |||
| 1264 | Ga0495671_0082758 | |||
| 1265 | Ga0495649_0011304 | |||
| 1266 | Ga0495649_0045411 | |||
| 1267 | Ga0495649_0061696 | |||
| 1268 | Ga0495649_0095780 | |||
| 1269 | Ga0495589_0005121 | |||
| 1270 | Ga0495589_0024415 | |||
| 1271 | Ga0495660_0011379 | |||
| 1272 | Ga0495660_0015387 | |||
| 1273 | Ga0495660_0044555 | |||
| 1274 | Ga0495660_0116655 | |||
| 1275 | Ga0495660_0207633 | |||
| 1276 | Ga0495672_0061166 | |||
| 1277 | Ga0495687_027801 | |||
| 1278 | Ga0495677_0006203 | |||
| 1279 | Ga0495679_116906 | |||
| 1280 | Ga0495685_068146 | |||
| 1281 | Ga0495673_0000243 | |||
| 1282 | Ga0495673_0001921 | |||
| 1283 | Ga0495673_0032589 | |||
| 1284 | Ga0495681_0002453 | |||
| 1285 | Ga0495681_0007214 | |||
| 1286 | Ga0495681_0114463 | |||
| 1287 | Ga0495686_0001183 | |||
| 1288 | Ga0495686_0011273 | |||
| 1289 | Ga0495686_0013882 | |||
| 1290 | Ga0495686_0032379 | |||
| 1291 | Ga0495686_0034421 | |||
| 1292 | Ga0495686_0053471 | |||
| 1293 | Ga0495626_0000005 | |||
| 1294 | Ga0495626_0022855 | |||
| 1295 | Ga0495626_0026649 | |||
| 1296 | Ga0495626_0101622 | |||
| 1297 | Ga0496100_0404129 | |||
| 1298 | Ga0496101_0424195 | |||
| 1299 | Ga0496102_0378775 | |||
| 1300 | Ga0496102_1179393 | |||
| 1301 | Ga0496103_0054846 | |||
| 1302 | Ga0496106_0000128 | |||
| 1303 | Ga0496108_0267916 | |||
| 1304 | Ga0496110_0091361 | |||
| 1305 | Ga0496111_0058413 | |||
| 1306 | Ga0496111_0237746 | |||
| 1307 | Ga0496112_0120045 | |||
| 1308 | Ga0496112_0316885 | |||
| 1309 | Ga0496113_0103871 | |||
| 1310 | Ga0496114_0218110 | |||
| 1311 | Ga0496116_0003539 | |||
| 1312 | Ga0496116_0012411 | |||
| 1313 | Ga0496116_0013590 | |||
| 1314 | Ga0496116_0037378 | |||
| 1315 | Ga0496116_0256223 | |||
| 1316 | Ga0496117_0065358 | |||
| 1317 | Ga0496117_0104860 | |||
| 1318 | Ga0496118_0067336 | |||
| 1319 | Ga0496118_0069457 | |||
| 1320 | Ga0496118_0185131 | |||
| 1321 | Ga0496118_0224259 | |||
| 1322 | Ga0496119_0088072 | |||
| 1323 | Ga0496119_0233240 | |||
| 1324 | Ga0496120_0082741 | |||
| 1325 | Ga0496121_0000115 | |||
| 1326 | Ga0496121_0000732 | |||
| 1327 | Ga0496121_0003073 | |||
| 1328 | Ga0496121_0003099 | |||
| 1329 | Ga0496121_0009567 | |||
| 1330 | Ga0496121_0019771 | |||
| 1331 | Ga0496121_0023911 | |||
| 1332 | Ga0496121_0087448 | |||
| 1333 | Ga0496121_0108896 | |||
| 1334 | Ga0496121_0164941 | |||
| 1335 | Ga0496121_0200413 | |||
| 1336 | Ga0496121_0293755 | |||
| 1337 | Ga0496121_0445888 | |||
| 1338 | Ga0496122_0002345 | |||
| 1339 | Ga0496122_0003047 | |||
| 1340 | Ga0496122_0004149 | |||
| 1341 | Ga0496122_0006437 | |||
| 1342 | Ga0496122_0022551 | |||
| 1343 | Ga0496122_0024625 | |||
| 1344 | Ga0496122_0033637 | |||
| 1345 | Ga0496122_0056585 | |||
| 1346 | Ga0496122_0106500 | |||
| 1347 | Ga0496123_0001894 | |||
| 1348 | Ga0496123_0002119 | |||
| 1349 | Ga0496123_0002549 | |||
| 1350 | Ga0496123_0004684 | |||
| 1351 | Ga0496123_0017127 | |||
| 1352 | Ga0496123_0023010 | |||
| 1353 | Ga0496123_0155944 | |||
| 1354 | Ga0496123_0191780 | |||
| 1355 | Ga0496123_0285417 | |||
| 1356 | Ga0496123_0323993 | |||
| 1357 | Ga0496124_0000006 | |||
| 1358 | Ga0496124_0002110 | |||
| 1359 | Ga0496124_0006984 | |||
| 1360 | Ga0496124_0013347 | |||
| 1361 | Ga0496124_0015566 | |||
| 1362 | Ga0496124_0036011 | |||
| 1363 | Ga0496124_0064129 | |||
| 1364 | Ga0496124_0069909 | |||
| 1365 | Ga0496124_0175490 | |||
| 1366 | Ga0496124_0317854 | |||
| 1367 | Ga0496124_0329822 | |||
| 1368 | Ga0496124_0434379 | |||
| 1369 | Ga0496124_0451068 | |||
| 1370 | Ga0496125_0000989 | |||
| 1371 | Ga0496125_0003290 | |||
| 1372 | Ga0496125_0005889 | |||
| 1373 | Ga0496125_0054813 | |||
| 1374 | Ga0496125_0071584 | |||
| 1375 | Ga0496125_0109079 | |||
| 1376 | Ga0496125_0184735 | |||
| 1377 | Ga0496125_0241744 | |||
| 1378 | Ga0496125_0343223 | |||
| 1379 | Ga0496126_0002733 | |||
| 1380 | Ga0496126_0002943 | |||
| 1381 | Ga0496126_0008699 | |||
| 1382 | Ga0496126_0113740 | |||
| 1383 | Ga0496126_0129931 | |||
| 1384 | Ga0496126_0148142 | |||
| 1385 | Ga0496126_0166514 | |||
| 1386 | Ga0496126_0348803 | |||
| 1387 | Ga0496126_0418313 | |||
| 1388 | Ga0495678_085823 | |||
| 1389 | Ga0495678_140902 | |||
| 1390 | Ga0495682_0002858 | |||
| 1391 | Ga0495682_0005105 | |||
| 1392 | Ga0495682_0154738 | |||
| 1393 | Ga0501034_0072221 | |||
| 1394 | Ga0501034_0117686 | |||
| 1395 | Ga0501034_0342867 | |||
| 1396 | Ga0501036_0106295 | |||
| 1397 | Ga0501036_0179945 | |||
| 1398 | Ga0501037_0086717 | |||
| 1399 | Ga0501039_0225718 | |||
| 1400 | Ga0501040_0888174 | |||
| 1401 | Ga0501043_0011739 | |||
| 1402 | Ga0501043_0425390 | |||
| 1403 | Ga0501238_005046 | |||
| 1404 | Ga0501035_0522056 | |||
| 1405 | nmdc:mga03683_38234_c1 | |||
| 1406 | nmdc:mga03n38_24298_c1 | |||
| 1407 | nmdc:mga00v17_278059_c1 | |||
| 1408 | nmdc:mga00v17_79470_c1 | |||
| 1409 | nmdc:mga0yw44_232903_c1 | |||
| 1410 | nmdc:mga0yw44_42549_c1 | |||
| 1411 | nmdc:mga0yw44_45675_c1 | |||
| 1412 | nmdc:mga0k408_22463_c1 | |||
| 1413 | nmdc:mga06z11_123663_c1 | |||
| 1414 | nmdc:mga06z11_14867_c1 | |||
| 1415 | nmdc:mga06z11_149601_c1 | |||
| 1416 | nmdc:mga06z11_265596_c1 | |||
| 1417 | nmdc:mga06z11_540624_c1 | |||
| 1418 | nmdc:mga04h51_55368_c1 | |||
| 1419 | nmdc:mga04h51_73920_c1 | |||
| 1420 | nmdc:mga07m45_123254_c1 | |||
| 1421 | nmdc:mga07m45_140417_c1 | |||
| 1422 | nmdc:mga07m45_198735_c1 | |||
| 1423 | nmdc:mga07m45_23192_c1 | |||
| 1424 | nmdc:mga07m45_30862_c1 | |||
| 1425 | nmdc:mga07m45_65164_c1 | |||
| 1426 | nmdc:mga0sz30_105200_c1 | |||
| 1427 | nmdc:mga0sz30_109349_c1 | |||
| 1428 | nmdc:mga0sz30_267815_c1 | |||
| 1429 | nmdc:mga0sz30_50858_c1 | |||
| 1430 | Ga0500578_0052014 | |||
| 1431 | Ga0500578_0226559 | |||
| 1432 | Ga0500644_0003082 | |||
| 1433 | Ga0500583_0032819 | |||
| 1434 | Ga0500566_0004935 | |||
| 1435 | Ga0500555_023376 | |||
| 1436 | Ga0500562_007425 | |||
| 1437 | Ga0500562_095712 | |||
| 1438 | Ga0500594_0011681 | |||
| 1439 | Ga0500595_001365 | |||
| 1440 | Ga0500614_020700 | |||
| 1441 | Ga0500618_000157 | |||
| 1442 | Ga0500618_000364 | |||
| 1443 | Ga0500618_006259 | |||
| 1444 | Ga0500618_009728 | |||
| 1445 | Ga0500642_0067534 | |||
| 1446 | Ga0500655_006895 | |||
| 1447 | Ga0500655_032332 | |||
| 1448 | Ga0500658_0002753 | |||
| 1449 | Ga0500658_0053275 | |||
| 1450 | Ga0500564_059167 | |||
| 1451 | Ga0500564_174455 | |||
| 1452 | Ga0500568_0001525 | |||
| 1453 | Ga0500568_0007325 | |||
| 1454 | Ga0500586_000032 | |||
| 1455 | Ga0500586_000214 | |||
| 1456 | Ga0500603_001447 | |||
| 1457 | Ga0500604_0001630 | |||
| 1458 | Ga0500616_0000066 | |||
| 1459 | Ga0500616_0000104 | |||
| 1460 | Ga0500616_0004850 | |||
| 1461 | Ga0500616_0015076 | |||
| 1462 | Ga0500616_0027363 | |||
| 1463 | Ga0500616_0035345 | |||
| 1464 | Ga0500616_0106963 | |||
| 1465 | Ga0500620_075416 | |||
| 1466 | Ga0500622_0001635 | |||
| 1467 | Ga0500622_0001984 | |||
| 1468 | Ga0500622_0026539 | |||
| 1469 | Ga0500627_0001791 | |||
| 1470 | Ga0500627_0131148 | |||
| 1471 | Ga0500627_0138542 | |||
| 1472 | Ga0500627_0245753 | |||
| 1473 | Ga0500633_0000139 | |||
| 1474 | Ga0500661_010391 | |||
| 1475 | 2503203128 | |||
| 1476 | 2510131908 | |||
| 1477 | 2510840626 | |||
| 1478 | 2510898223 | |||
| 1479 | 2511169774 | |||
| 1480 | 2511195007 | |||
| 1481 | 2512933840 | |||
| 1482 | 2513568725 | |||
| 1483 | 2513580601 | |||
| 1484 | 2513601079 | |||
| 1485 | 2513614464 | |||
| 1486 | 2513634666 | |||
| 1487 | 2513709587 | |||
| 1488 | 2513865999 | |||
| 1489 | 2514022985 | |||
| 1490 | 2515110872 | |||
| 1491 | 2515638605 | |||
| 1492 | 2515645723 | |||
| 1493 | 2515661999 | |||
| 1494 | 2515743186 | |||
| 1495 | 2517039560 | |||
| 1496 | 2517075065 | |||
| 1497 | 2517093698 | |||
| 1498 | 2517405482 | |||
| 1499 | 2524458577 | |||
| 1500 | 2524612861 | |||
| 1501 | 2530644276 | |||
| 1502 | 2535517650 | |||
| 1503 | 2559298582 | |||
| 1504 | 2585221888 | |||
| 1505 | 2585404256 | |||
| 1506 | 2585525227 | |||
| 1507 | 2585540025 | |||
| 1508 | 2585543942 | |||
| 1509 | 2585823188 | |||
| 1510 | 2585838006 | |||
| 1511 | 2585900105 | |||
| 1512 | 2585997597 | |||
| 1513 | 2588519934 | |||
| 1514 | 2599336344 | |||
| 1515 | 2599606289 | |||
| 1516 | 2599722712 | |||
| 1517 | 2644251640 | |||
| 1518 | 2644358181 | |||
| 1519 | 2644500976 | |||
| 1520 | 2694627812 | |||
| 1521 | 2694636062 | |||
| 1522 | 2725951022 | |||
| 1523 | 2738805702 | |||
| 1524 | 2738845434 | |||
| 1525 | 2739034892 | |||
| 1526 | 2739276487 | |||
| 1527 | 2739345531 | |||
| 1528 | 2765468886 | |||
| 1529 | 2766062629 | |||
| 1530 | 2792745510 | |||
| 1531 | 2793344296 | |||
| 1532 | 2793367180 | |||
| 1533 | 2806044179 | |||
| 1534 | 2806052009 | |||
| 1535 | 2806058311 | |||
| 1536 | 2806069215 | |||
| 1537 | 2806074542 | |||
| 1538 | 2819561655 | |||
| 1539 | 2838033561 | |||
| 1540 | 2838043813 | |||
| 1541 | 2838689020 | |||
| 1542 | 2838731315 | |||
| 1543 | 2838743791 | |||
| 1544 | 2839996276 | |||
| 1545 | 2839997321 | |||
| 1546 | 2841766319 | |||
| 1547 | 2841857149 | |||
| 1548 | 2842117163 | |||
| 1549 | 2842159644 | |||
| 1550 | 2842169485 | |||
| 1551 | 2842183740 | |||
| 1552 | 2842220957 | |||
| 1553 | 2842233780 | |||
| 1554 | 2842245255 | |||
| 1555 | 2842260095 | |||
| 1556 | 2842278562 | |||
| 1557 | 2842300162 | |||
| 1558 | 2842307178 | |||
| 1559 | 2842359073 | |||
| 1560 | 2842480167 | |||
| 1561 | 2842508047 | |||
| 1562 | 2842927908 | |||
| 1563 | 2844106085 | |||
| 1564 | 2844455545 | |||
| 1565 | 2851186590 | |||
| 1566 | 2851246441 | |||
| 1567 | 2852391826 | |||
| 1568 | 2854914714 | |||
| 1569 | 2856369799 | |||
| 1570 | 2857353005 | |||
| 1571 | 2857523296 | |||
| 1572 | 2857567125 | |||
| 1573 | 2869290605 | |||
| 1574 | 2871432887 | |||
| 1575 | 2871499805 | |||
| 1576 | 2874130262 | |||
| 1577 | 2874153952 | |||
| 1578 | 2874158639 | |||
| 1579 | 2876363904 | |||
| 1580 | 2876371512 | |||
| 1581 | 2876383268 | |||
| 1582 | 2876396969 | |||
| 1583 | 2876419256 | |||
| 1584 | 2878750501 | |||
| 1585 | 2878763969 | |||
| 1586 | 2878770999 | |||
| 1587 | 2881148273 | |||
| 1588 | 2881165055 | |||
| 1589 | 2885306929 | |||
| 1590 | 2885331688 | |||
| 1591 | 2885335599 | |||
| 1592 | 2888353276 | |||
| 1593 | 2889014993 | |||
| 1594 | 2889019931 | |||
| 1595 | 2899806758 | |||
| 1596 | 2903454015 | |||
| 1597 | 2903499654 | |||
| 1598 | 2903525937 | |||
| 1599 | 2903532517 | |||
| 1600 | 2903544616 | |||
| 1601 | 2904663723 | |||
| 1602 | 2906313426 | |||
| 1603 | 2906326134 | |||
| 1604 | 2906358336 | |||
| 1605 | 2909046047 | |||
| 1606 | 2909400818 | |||
| 1607 | 2919103142 | |||
| 1608 | 2919177422 | |||
| 1609 | 2922133188 | |||
| 1610 | 2922189283 | |||
| 1611 | 2924767051 | |||
| 1612 | 2933572708 | |||
| 1613 | 2933593318 | |||
| 1614 | 2935906712 | |||
| 1615 | 2936368534 | |||
| 1616 | 2936371347 | |||
| 1617 | 2936375451 | |||
| 1618 | 2936376373 | |||
| 1619 | 2937820270 | |||
| 1620 | 2937827625 | |||
| 1621 | 2937850107 | |||
| 1622 | 2937998464 | |||
| 1623 | 2938016834 | |||
| 1624 | 2958055798 | |||
| 1625 | 2958102102 | |||
| 1626 | 2958135006 | |||
| 1627 | 2958168940 | |||
| 1628 | 2958178159 | |||
| 1629 | 2958184035 | |||
| 1630 | 2961082090 | |||
| 1631 | 2961119137 | |||
| 1632 | 2961167402 | |||
| 1633 | 2963645362 | |||
| 1634 | 2965022224 | |||
| 1635 | 2965127179 | |||
| 1636 | 2968089741 | |||
| 1637 | 2968114862 | |||
| 1638 | 2968122586 | |||
| 1639 | 2968175809 | |||
| 1640 | 2970558813 | |||
| 1641 | 2977847037 | |||
| 1642 | 2977943280 | |||
| 1643 | 2977992121 | |||
| 1644 | 2979714688 | |||
| 1645 | 2979748206 | |||
| 1646 | 2984514253 | |||
| 1647 | 2984523284 | |||
| 1648 | 2984542694 | |||
| 1649 | 2987641598 | |||
| 1650 | 2987656308 | |||
| 1651 | 2987663408 | |||
| 1652 | 2987671583 | |||
| 1653 | 2989779518 | |||
| 1654 | 3000136609 | |||
| 1655 | 3004192467 | |||
| 1656 | 3004209591 | |||
| 1657 | 3004216941 | |||
| 1658 | 3004225465 | |||
| 1659 | 3004337227 | |||
| 1660 | 637076951 | |||
| 1661 | 639647105 | |||
| 1662 | 8001845874 | |||
| 1663 | 8004392895 | |||
| 1664 | 8004643836 | |||
| 1665 | 8004719682 | |||
| 1666 | 8005310932 | |||
| 1667 | 8005377028 | |||
| 1668 | 8005461511 | |||
| 1669 | 8005487657 | |||
| 1670 | 8005549680 | |||
| 1671 | 8005562759 | |||
| 1672 | 8005570032 | |||
| 1673 | 8005577277 | |||
| 1674 | 8018168559 | |||
| 1675 | 8023687391 | |||
| 1676 | 8024480685 | |||
| 1677 | 8046767338 | |||
| 1678 | 8054804163 | |||
| 1679 | 8055914992 | |||
| 1680 | 8056378839 | |||
| 1681 | 8057580112 | |||
| 1682 | 8057881607 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g7s-assembly1.cif.gz_A-2 | the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens | 0.9761 | 8 | 191 |
| 2g7s-assembly1.cif.gz_A-2 | the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens | 0.9409 | 8 | 191 |
| 3on4-assembly4.cif.gz_F | crystal structure of tetr transcriptional regulator from legionella pneumophila | 0.9123 | 5 | 191 |
| 3bru-assembly1.cif.gz_B | crystal structure of regulatory protein tetr from rhodobacter sphaeroides | 0.8991 | 5 | 190 |
| 3on4-assembly4.cif.gz_F | crystal structure of tetr transcriptional regulator from legionella pneumophila | 0.8937 | 5 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g7sA00 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.9706 | 8 | 191 | 1.10.357.10 |
| 2g7sA00 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.9402 | 8 | 191 | 1.10.357.10 |
| 2eh3A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9389 | 7 | 53 | 1.10.10.60 |
| 2of7A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9375 | 6 | 48 | 1.10.10.60 |
| 1jt6E01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9367 | 8 | 53 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I0XTV5-F1-model_v4 | Transcriptional regulator, TetR family | 0.9815 | 5 | 124 |
GO:0003677
GO:0006355 |
| AF-A0A5Q0C568-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9741 | 5 | 191 |
GO:0003677
GO:0006355 |
| AF-A0A4S1XGL3-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9711 | 22 | 191 |
GO:0003677
GO:0006355 |
| AF-A0A529VXQ4-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9688 | 1 | 176 |
GO:0003677
GO:0006355 |
| AF-A0A1C0SKT1-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9652 | 4 | 193 |
GO:0003677
GO:0006355 |