F483091

General Info

Members Datasets Scaffolds Average Seq Length
841 417 1682 293

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10126540|Ga0207661_101265402
Length 344
Sequence VAGTGWPRTLMPDRADRKATGARAGQGSSKSGGKTTAKAPKKMPNETGRPPDAAASSNGARLTVLKTYKLFIGGAFPRSESGRSYPARTPDGDLLANAARASRKDVRDAVKAARGAFGRWSGATAYNRGQVLYRVAEMLEGRAGQFAAEVAAAEGAAPRAAQEQVAAAIDRWVWYAGWTDKVAQVTGGANPVAGPFVNFSVPEPAGVAALIAPPQSSLLGLVSVLAPVIATGNTAVVVASPDRPLPAITLAEVLATSDVPGGVVNLLTGYVAELAPVLAGHMDVDAIDVSGADPEMAAELERLAAGNLKRVLRAVPGEDWSAAPGTRRLTAFLETKTFWHPAGI

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
208 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
209 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
210 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
211 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
212 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
298 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
349 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
350 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
359 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
360 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
361 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
362 2643221647 Streptomyces sp. Root369 Isolate Unclassified
363 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
364 2643221711 Terrabacter sp. Root85 Isolate Unclassified
365 2643221714 Streptomyces sp. Root264 Isolate Unclassified
366 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
367 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
368 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
369 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
370 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
371 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
372 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
373 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
374 2808606448 Streptomyces sp. 193411 Isolate Unclassified
375 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
376 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
377 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
378 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
379 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
380 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
381 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
382 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
383 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
384 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
385 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
386 2867428634 Streptomyces sp. RP5T Isolate Unclassified
387 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
388 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
389 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
390 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
391 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
392 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
393 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
394 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
395 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
396 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
397 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
398 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
399 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
400 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
401 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
402 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
403 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
404 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
405 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
406 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
407 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
408 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
409 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
410 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
411 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
412 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
413 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
414 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
415 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
416 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
417 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.91
Metatranscriptomes 0.95
Isolates 7.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0.24
Rhizoplane 10.82
Rhizosphere 79.07
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10126540 3300025944 Bacteria 2183
2 LJQas_1008776 3300000549 Bacteria 1225
3 rootL2_10065946 3300003322 Bacteria 5700
4 rootL2_10216345 3300003322 Bacteria 1479
5 rootH1_10000873 3300003323 Bacteria 3387
6 JGI25160J50197_1005091 3300003354 Bacteria 5537
7 JGI25160J50197_1018265 3300003354 Bacteria 2191
8 Ga0006562J51391_1130078 3300003578 Bacteria 1800
9 Ga0006562J51391_1130079 3300003578 Bacteria 1743
10 Ga0070658_10001223 3300005327 Bacteria 22027
11 Ga0070658_10004318 3300005327 Bacteria 11612
12 Ga0070658_10006650 3300005327 Bacteria 9367
13 Ga0070658_10033497 3300005327 Bacteria 4134
14 Ga0070683_100023938 3300005329 Bacteria 5466
15 Ga0070683_100090637 3300005329 Bacteria 2871
16 Ga0070683_100159764 3300005329 Bacteria 2138
17 Ga0070683_100200548 3300005329 Bacteria 1895
18 Ga0070690_100052304 3300005330 Bacteria 2610
19 Ga0068869_100020772 3300005334 Bacteria 4508
20 Ga0070680_100000001 3300005336 Bacteria 276263
21 Ga0070680_100060843 3300005336 Bacteria 3090
22 Ga0070680_100281138 3300005336 Bacteria 1410
23 Ga0070680_100376407 3300005336 Bacteria 1209
24 Ga0070682_100058084 3300005337 Bacteria 2439
25 Ga0070682_100128678 3300005337 Bacteria 1711
26 Ga0070682_100210140 3300005337 Bacteria 1378
27 Ga0070682_100287621 3300005337 Bacteria 1201
28 Ga0070660_100089079 3300005339 Bacteria 2431
29 Ga0070689_100004630 3300005340 Bacteria 9314
30 Ga0070691_10021982 3300005341 Bacteria 2956
31 Ga0070687_100001722 3300005343 Bacteria 7865
32 Ga0070687_100013788 3300005343 Bacteria 3613
33 Ga0070687_100093103 3300005343 Bacteria 1671
34 Ga0070661_100030319 3300005344 Bacteria 3906
35 Ga0070692_10030527 3300005345 Bacteria 2695
36 Ga0070692_10070095 3300005345 Bacteria 1866
37 Ga0070675_100018710 3300005354 Bacteria 5514
38 Ga0070671_100113031 3300005355 Bacteria 2281
39 Ga0070674_100005758 3300005356 Bacteria 7190
40 Ga0070688_100006693 3300005365 Bacteria 6177
41 Ga0070659_100007264 3300005366 Bacteria 8042
42 Ga0070659_100135111 3300005366 Bacteria 2005
43 Ga0070659_100356790 3300005366 Bacteria 1228
44 Ga0070703_10000129 3300005406 Bacteria 39084
45 Ga0070709_10028642 3300005434 Bacteria 3324
46 Ga0070709_10045059 3300005434 Bacteria 2735
47 Ga0070714_100000013 3300005435 Bacteria 211756
48 Ga0070714_100002811 3300005435 Bacteria 12847
49 Ga0070714_100023225 3300005435 Bacteria 5091
50 Ga0070714_100352332 3300005435 Bacteria 1383
51 Ga0070713_100037570 3300005436 Bacteria 3916
52 Ga0070701_10007733 3300005438 Bacteria 4611
53 Ga0070705_100006178 3300005440 Bacteria 5865
54 Ga0070705_100016636 3300005440 Bacteria 3824
55 Ga0070705_100031130 3300005440 Bacteria 2952
56 Ga0070705_100079581 3300005440 Bacteria 2008
57 Ga0070700_100006665 3300005441 Bacteria 6186
58 Ga0070694_100005027 3300005444 Bacteria 7980
59 Ga0070694_100234954 3300005444 Bacteria 1381
60 Ga0070708_100001218 3300005445 Bacteria 19787
61 Ga0070708_100002638 3300005445 Bacteria 13882
62 Ga0070708_100225561 3300005445 Bacteria 1758
63 Ga0070663_100262994 3300005455 Bacteria 1369
64 Ga0070663_100353253 3300005455 Bacteria 1191
65 Ga0070663_100391867 3300005455 Bacteria 1133
66 Ga0070678_100183300 3300005456 Bacteria 1716
67 Ga0070662_100020576 3300005457 Bacteria 4496
68 Ga0070662_100251836 3300005457 Bacteria 1420
69 Ga0070681_10137053 3300005458 Bacteria 2378
70 Ga0070681_10246028 3300005458 Bacteria 1701
71 Ga0068867_100286959 3300005459 Bacteria 1351
72 Ga0070685_10077897 3300005466 Bacteria 1980
73 Ga0070685_10101147 3300005466 Bacteria 1761
74 Ga0070706_100000807 3300005467 Bacteria 34728
75 Ga0070706_100010398 3300005467 Bacteria 8642
76 Ga0070706_100191776 3300005467 Bacteria 1909
77 Ga0070707_100006986 3300005468 Bacteria 10466
78 Ga0070707_100010232 3300005468 Bacteria 8736
79 Ga0070707_100015743 3300005468 Bacteria 7099
80 Ga0070707_100017966 3300005468 Bacteria 6651
81 Ga0070707_100090372 3300005468 Bacteria 2964
82 Ga0070707_100107716 3300005468 Bacteria 2704
83 Ga0070707_100153627 3300005468 Bacteria 2241
84 Ga0070707_100174077 3300005468 Bacteria 2097
85 Ga0070707_100250296 3300005468 Bacteria 1724
86 Ga0070698_100025796 3300005471 Bacteria 6125
87 Ga0070698_100057224 3300005471 Bacteria 3946
88 Ga0070698_100057863 3300005471 Bacteria 3921
89 Ga0070698_100072108 3300005471 Bacteria 3462
90 Ga0070699_100003016 3300005518 Bacteria 14946
91 Ga0070699_100027295 3300005518 Bacteria 4926
92 Ga0070699_100441878 3300005518 Bacteria 1179
93 Ga0070679_100238425 3300005530 Bacteria 1777
94 Ga0070679_100257349 3300005530 Bacteria 1701
95 Ga0070679_100481758 3300005530 Bacteria 1185
96 Ga0070684_100022730 3300005535 Bacteria 5234
97 Ga0070684_100330671 3300005535 Bacteria 1400
98 Ga0070697_100007052 3300005536 Bacteria 8734
99 Ga0070697_100053440 3300005536 Bacteria 3283
100 Ga0070697_100100386 3300005536 Bacteria 2404
101 Ga0070686_100104438 3300005544 Bacteria 1919
102 Ga0070686_100163433 3300005544 Bacteria 1569
103 Ga0070686_100379371 3300005544 Bacteria 1070
104 Ga0070695_100037348 3300005545 Bacteria 3060
105 Ga0070695_100255936 3300005545 Bacteria 1276
106 Ga0070696_100016636 3300005546 Bacteria 4958
107 Ga0070696_100032706 3300005546 Bacteria 3569
108 Ga0070696_100054813 3300005546 Bacteria 2779
109 Ga0070696_100073792 3300005546 Bacteria 2405
110 Ga0070696_100085168 3300005546 Bacteria 2243
111 Ga0070696_100139093 3300005546 Bacteria 1773
112 Ga0070696_100169816 3300005546 Bacteria 1612
113 Ga0070665_100093907 3300005548 Bacteria 3005
114 Ga0070704_100008091 3300005549 Bacteria 6282
115 Ga0070704_100021796 3300005549 Bacteria 4159
116 Ga0070704_100040313 3300005549 Bacteria 3214
117 Ga0068855_100011359 3300005563 Bacteria 10751
118 Ga0070664_100175336 3300005564 Bacteria 1903
119 Ga0068857_100222744 3300005577 Bacteria 1723
120 Ga0068856_100165771 3300005614 Bacteria 2220
121 Ga0068856_100172273 3300005614 Bacteria 2176
122 Ga0068856_100416995 3300005614 Bacteria 1362
123 Ga0070702_100015401 3300005615 Bacteria 3904
124 Ga0068864_100041198 3300005618 Bacteria 3950
125 Ga0068864_100077863 3300005618 Bacteria 2901
126 Ga0068864_100080226 3300005618 Bacteria 2858
127 Ga0068864_100089740 3300005618 Bacteria 2708
128 Ga0068864_100180467 3300005618 Bacteria 1930
129 Ga0068866_10026048 3300005718 Bacteria 2756
130 Ga0068866_10172172 3300005718 Bacteria 1272
131 Ga0068861_100206869 3300005719 Bacteria 1651
132 Ga0068863_100000632 3300005841 Bacteria 35693
133 Ga0068863_100019372 3300005841 Bacteria 6508
134 Ga0068863_100324563 3300005841 Bacteria 1496
135 Ga0068858_100045979 3300005842 Bacteria 4047
136 Ga0068860_100162043 3300005843 Bacteria 2157
137 Ga0068862_100527254 3300005844 Bacteria 1125
138 Ga0081455_10000683 3300005937 Bacteria 44068
139 Ga0081455_10001095 3300005937 Bacteria 33996
140 Ga0081455_10082451 3300005937 Bacteria 2630
141 Ga0081539_10020888 3300005985 Bacteria 4399
142 Ga0081539_10040803 3300005985 Bacteria 2721
143 Ga0075365_10011126 3300006038 Bacteria 5279
144 Ga0075365_10051612 3300006038 Bacteria 2717
145 Ga0075368_10000633 3300006042 Bacteria 10650
146 Ga0075368_10043329 3300006042 Bacteria 1773
147 Ga0075363_100001382 3300006048 Bacteria 9146
148 Ga0075364_10035588 3300006051 Bacteria 3218
149 Ga0075364_10048981 3300006051 Bacteria 2754
150 Ga0070716_100036774 3300006173 Bacteria 2701
151 Ga0070712_100176077 3300006175 Bacteria 1663
152 Ga0075362_10116532 3300006177 Bacteria 1261
153 Ga0075367_10000576 3300006178 Bacteria 14012
154 Ga0075367_10033026 3300006178 Bacteria 2980
155 Ga0075367_10053490 3300006178 Bacteria 2392
156 Ga0075370_10001568 3300006353 Bacteria 10043
157 Ga0075370_10012320 3300006353 Bacteria 4515
158 Ga0075370_10130274 3300006353 Bacteria 1467
159 Ga0075428_100000323 3300006844 Bacteria 47418
160 Ga0075428_100008365 3300006844 Bacteria 11472
161 Ga0075428_100038044 3300006844 Bacteria 5295
162 Ga0075428_100371321 3300006844 Bacteria 1534
163 Ga0075430_100001867 3300006846 Bacteria 17230
164 Ga0075430_100090486 3300006846 Bacteria 2560
165 Ga0075431_100012098 3300006847 Bacteria 8707
166 Ga0075431_100105822 3300006847 Bacteria 2903
167 Ga0075431_100152366 3300006847 Bacteria 2380
168 Ga0075433_10046905 3300006852 Bacteria 3758
169 Ga0075433_10078018 3300006852 Bacteria 2918
170 Ga0075433_10161594 3300006852 Bacteria 1994
171 Ga0075434_100337403 3300006871 Bacteria 1528
172 Ga0075434_100408005 3300006871 Bacteria 1380
173 Ga0075429_100000390 3300006880 Bacteria 32202
174 Ga0075429_100032720 3300006880 Bacteria 4519
175 Ga0075435_100072506 3300007076 Bacteria 2813
176 Ga0105240_10090564 3300009093 Bacteria 3738
177 Ga0105240_10525030 3300009093 Bacteria 1313
178 Ga0111539_10037320 3300009094 Bacteria 5868
179 Ga0111539_10692531 3300009094 Bacteria 1186
180 Ga0105245_10020726 3300009098 Bacteria 5763
181 Ga0105245_10163833 3300009098 Bacteria 2112
182 Ga0105247_10020007 3300009101 Bacteria 4023
183 Ga0105247_10459479 3300009101 Bacteria 919
184 Ga0114129_10000680 3300009147 Bacteria 42864
185 Ga0114129_10122194 3300009147 Bacteria 3583
186 Ga0114129_10542573 3300009147 Bacteria 1513
187 Ga0105243_10020293 3300009148 Bacteria 5039
188 Ga0105243_10028126 3300009148 Bacteria 4313
189 Ga0105242_10025657 3300009176 Bacteria 4666
190 Ga0105242_10035063 3300009176 Bacteria 4024
191 Ga0105248_10598231 3300009177 Bacteria 1244
192 Ga0105237_10244969 3300009545 Bacteria 1794
193 Ga0105238_10136744 3300009551 Bacteria 2428
194 Ga0105249_10015393 3300009553 Bacteria 6769
195 Ga0105249_10542888 3300009553 Bacteria 1212
196 Ga0105239_10015560 3300010375 Bacteria 8425
197 Ga0105239_10099219 3300010375 Bacteria 3219
198 Ga0105239_10135604 3300010375 Bacteria 2740
199 Ga0105246_10011160 3300011119 Bacteria 5569
200 Ga0157369_10044896 3300013105 Bacteria 4808
201 Ga0157378_10002433 3300013297 Bacteria 16558
202 Ga0157378_10015654 3300013297 Bacteria 6643
203 Ga0157378_10073764 3300013297 Bacteria 3069
204 Ga0157378_10250606 3300013297 Bacteria 1695
205 Ga0163162_10018280 3300013306 Bacteria 6866
206 Ga0157372_10876626 3300013307 Bacteria 1042
207 Ga0157375_10026881 3300013308 Bacteria 5371
208 Ga0157375_10157963 3300013308 Bacteria 2408
209 Ga0163163_10024613 3300014325 Bacteria 5731
210 Ga0163163_10052447 3300014325 Bacteria 4023
211 Ga0163163_10151532 3300014325 Bacteria 2362
212 Ga0163163_10305206 3300014325 Bacteria 1644
213 Ga0157380_10012180 3300014326 Bacteria 6230
214 Ga0182008_10001225 3300014497 Bacteria 17696
215 Ga0157377_10166068 3300014745 Bacteria 1376
216 Ga0157379_10095834 3300014968 Bacteria 2663
217 Ga0157379_10193178 3300014968 Bacteria 1840
218 Ga0157379_10286796 3300014968 Bacteria 1499
219 Ga0157379_10369962 3300014968 Bacteria 1314
220 Ga0157376_10222505 3300014969 Bacteria 1749
221 Ga0182007_10000750 3300015262 Bacteria 18258
222 Ga0206353_10341901 3300020082 Bacteria 1212
223 Ga0206353_10728699 3300020082 Bacteria 1522
224 Ga0206353_11878516 3300020082 Bacteria 3370
225 Ga0224712_10001707 3300022467 Bacteria 5208
226 Ga0224572_1007699 3300024225 Bacteria 1979
227 Ga0224572_1033250 3300024225 Bacteria 981
228 Ga0207426_1004416 3300025302 Bacteria 6876
229 Ga0207426_1014300 3300025302 Bacteria 2909
230 Ga0207653_10000241 3300025885 Bacteria 36454
231 Ga0207692_10036265 3300025898 Bacteria 2403
232 Ga0207642_10146028 3300025899 Bacteria 1253
233 Ga0207699_10023834 3300025906 Bacteria 3337
234 Ga0207643_10007289 3300025908 Bacteria 5935
235 Ga0207705_10016639 3300025909 Bacteria 5267
236 Ga0207705_10055520 3300025909 Bacteria 2856
237 Ga0207684_10000862 3300025910 Bacteria 34728
238 Ga0207684_10002316 3300025910 Bacteria 19331
239 Ga0207684_10003968 3300025910 Bacteria 14168
240 Ga0207684_10015993 3300025910 Bacteria 6444
241 Ga0207684_10151894 3300025910 Bacteria 1992
242 Ga0207707_10124549 3300025912 Bacteria 2254
243 Ga0207695_10050262 3300025913 Bacteria 4387
244 Ga0207693_10161543 3300025915 Bacteria 1763
245 Ga0207660_10000001 3300025917 Bacteria 1034169
246 Ga0207662_10000425 3300025918 Bacteria 18634
247 Ga0207657_10075540 3300025919 Bacteria 2843
248 Ga0207652_10096303 3300025921 Bacteria 2607
249 Ga0207652_10188662 3300025921 Bacteria 1854
250 Ga0207652_10242033 3300025921 Bacteria 1626
251 Ga0207646_10000033 3300025922 Bacteria 213090
252 Ga0207646_10002777 3300025922 Bacteria 20446
253 Ga0207646_10004969 3300025922 Bacteria 14205
254 Ga0207646_10016710 3300025922 Bacteria 6884
255 Ga0207646_10029948 3300025922 Bacteria 4941
256 Ga0207646_10051384 3300025922 Bacteria 3689
257 Ga0207646_10073152 3300025922 Bacteria 3062
258 Ga0207646_10112623 3300025922 Bacteria 2442
259 Ga0207646_10112983 3300025922 Bacteria 2438
260 Ga0207694_10259117 3300025924 Bacteria 1424
261 Ga0207659_10037424 3300025926 Bacteria 3369
262 Ga0207687_10046798 3300025927 Bacteria 2996
263 Ga0207687_10448903 3300025927 Bacteria 1069
264 Ga0207687_10480014 3300025927 Bacteria 1035
265 Ga0207700_10021038 3300025928 Bacteria 4447
266 Ga0207700_10336715 3300025928 Bacteria 1311
267 Ga0207664_10000001 3300025929 Bacteria 724213
268 Ga0207664_10001979 3300025929 Bacteria 13484
269 Ga0207664_10024558 3300025929 Bacteria 4530
270 Ga0207664_10027923 3300025929 Bacteria 4284
271 Ga0207664_10066230 3300025929 Bacteria 2895
272 Ga0207664_10070066 3300025929 Bacteria 2821
273 Ga0207690_10173995 3300025932 Bacteria 1615
274 Ga0207706_10118468 3300025933 Bacteria 2328
275 Ga0207706_10188970 3300025933 Bacteria 1808
276 Ga0207706_10372747 3300025933 Bacteria 1239
277 Ga0207709_10021724 3300025935 Bacteria 3634
278 Ga0207711_10013333 3300025941 Bacteria 6827
279 Ga0207711_10457107 3300025941 Bacteria 1189
280 Ga0207689_10031711 3300025942 Bacteria 4397
281 Ga0207689_10113354 3300025942 Bacteria 2229
282 Ga0207661_10012386 3300025944 Bacteria 6195
283 Ga0207661_10148368 3300025944 Bacteria 2025
284 Ga0207661_10175061 3300025944 Bacteria 1870
285 Ga0207661_10373229 3300025944 Bacteria 1290
286 Ga0207661_10676644 3300025944 Bacteria 949
287 Ga0207679_10078673 3300025945 Bacteria 2512
288 Ga0207679_10246389 3300025945 Bacteria 1517
289 Ga0207679_10305687 3300025945 Bacteria 1372
290 Ga0207667_10025976 3300025949 Bacteria 6405
291 Ga0207667_10335396 3300025949 Bacteria 1544
292 Ga0207712_10026410 3300025961 Bacteria 3869
293 Ga0207712_10114434 3300025961 Bacteria 2029
294 Ga0207677_10024329 3300026023 Bacteria 3760
295 Ga0207703_10170845 3300026035 Bacteria 1912
296 Ga0207678_10018654 3300026067 Bacteria 6090
297 Ga0207678_10027932 3300026067 Bacteria 4926
298 Ga0207678_10237546 3300026067 Bacteria 1561
299 Ga0207708_10001184 3300026075 Bacteria 19642
300 Ga0207702_10267808 3300026078 Bacteria 1611
301 Ga0207702_10297492 3300026078 Bacteria 1531
302 Ga0207702_10361451 3300026078 Bacteria 1391
303 Ga0207641_10038082 3300026088 Bacteria 4019
304 Ga0207641_10122480 3300026088 Bacteria 2323
305 Ga0207648_10002936 3300026089 Bacteria 18044
306 Ga0207648_10080631 3300026089 Bacteria 2839
307 Ga0207648_10310667 3300026089 Bacteria 1415
308 Ga0207676_10084492 3300026095 Bacteria 2588
309 Ga0207676_10133200 3300026095 Bacteria 2116
310 Ga0207676_10152388 3300026095 Bacteria 1993
311 Ga0207674_10013399 3300026116 Bacteria 9101
312 Ga0207674_10042954 3300026116 Bacteria 4664
313 Ga0207674_10045818 3300026116 Bacteria 4495
314 Ga0207674_10064149 3300026116 Bacteria 3706
315 Ga0207675_100108728 3300026118 Bacteria 2615
316 Ga0207683_10062250 3300026121 Bacteria 3286
317 Ga0207683_10390442 3300026121 Bacteria 1280
318 Ga0207698_10060308 3300026142 Bacteria 2950
319 Ga0209371_1015601 3300027312 Bacteria 2034
320 Ga0209974_10001189 3300027876 Bacteria 9301
321 Ga0207428_10010598 3300027907 Bacteria 8226
322 Ga0268266_10018552 3300028379 Bacteria 5930
323 Ga0268266_10067027 3300028379 Bacteria 3106
324 Ga0268266_10196398 3300028379 Bacteria 1845
325 Ga0268264_10144041 3300028381 Bacteria 2128
326 Ga0265326_10001207 3300028558 Bacteria 9253
327 Ga0265334_10000742 3300028573 Bacteria 16338
328 Ga0265318_10015205 3300028577 Bacteria 3208
329 Ga0265323_10003324 3300028653 Bacteria 7137
330 Ga0265322_10003953 3300028654 Bacteria 4441
331 Ga0265336_10001768 3300028666 Bacteria 9450
332 Ga0307517_10010838 3300028786 Bacteria 12707
333 Ga0307515_10141865 3300028794 Bacteria 2571
334 Ga0265338_10000288 3300028800 Bacteria 90670
335 Ga0265338_10001573 3300028800 Bacteria 36794
336 Ga0265338_10005567 3300028800 Bacteria 16386
337 Ga0265338_10093316 3300028800 Bacteria 2480
338 Ga0265338_10358295 3300028800 Bacteria 1047
339 Ga0265324_10002842 3300029957 Bacteria 8531
340 Ga0265760_10013690 3300031090 Bacteria 2322
341 Ga0265332_10001336 3300031238 Bacteria 13970
342 Ga0265320_10010891 3300031240 Bacteria 5383
343 Ga0265320_10018211 3300031240 Bacteria 3874
344 Ga0265325_10029814 3300031241 Bacteria 2929
345 Ga0265325_10100348 3300031241 Bacteria 1418
346 Ga0265340_10061154 3300031247 Bacteria 1802
347 Ga0265331_10086387 3300031250 Bacteria 1453
348 Ga0307513_10030783 3300031456 Bacteria 6091
349 Ga0307513_10136979 3300031456 Bacteria 2382
350 Ga0265313_10013884 3300031595 Bacteria 4798
351 Ga0265313_10022785 3300031595 Bacteria 3389
352 Ga0307508_10005648 3300031616 Bacteria 11855
353 Ga0307508_10080284 3300031616 Bacteria 2844
354 Ga0307508_10268091 3300031616 Bacteria 1301
355 Ga0307514_10021933 3300031649 Bacteria 5198
356 Ga0307514_10057870 3300031649 Bacteria 2968
357 Ga0307514_10092657 3300031649 Bacteria 2197
358 Ga0265314_10010683 3300031711 Bacteria 7640
359 Ga0265314_10014312 3300031711 Bacteria 6358
360 Ga0265342_10022487 3300031712 Bacteria 4007
361 Ga0265342_10092069 3300031712 Bacteria 1737
362 Ga0307516_10045157 3300031730 Bacteria 4353
363 Ga0307405_10060158 3300031731 Bacteria 2396
364 Ga0307405_10309595 3300031731 Bacteria 1202
365 Ga0307413_10093453 3300031824 Bacteria 1966
366 Ga0307518_10155664 3300031838 Bacteria 1576
367 Ga0307410_10014555 3300031852 Bacteria 4634
368 Ga0307406_10022300 3300031901 Bacteria 3755
369 Ga0307406_10146626 3300031901 Bacteria 1678
370 Ga0307407_10351320 3300031903 Bacteria 1044
371 Ga0307412_10036178 3300031911 Bacteria 3160
372 Ga0307412_10333803 3300031911 Bacteria 1211
373 Ga0307409_100129519 3300031995 Bacteria 2153
374 Ga0307409_100204443 3300031995 Bacteria 1770
375 Ga0307409_100494175 3300031995 Bacteria 1190
376 Ga0307416_100015846 3300032002 Bacteria 5220
377 Ga0307416_100055822 3300032002 Bacteria 3183
378 Ga0307416_100109395 3300032002 Bacteria 2431
379 Ga0307411_10127386 3300032005 Bacteria 1854
380 Ga0307415_100000215 3300032126 Bacteria 25330
381 Ga0307415_100040887 3300032126 Bacteria 3075
382 Ga0307415_100076655 3300032126 Bacteria 2371
383 Ga0307415_100097348 3300032126 Bacteria 2147
384 Ga0307415_100174319 3300032126 Bacteria 1680
385 Ga0307507_10000004 3300033179 Bacteria 289641
386 Ga0307507_10168127 3300033179 Bacteria 1601
387 Ga0307510_10036759 3300033180 Bacteria 5448
388 Ga0373957_0016606 3300035120 Bacteria 2551
389 Ga0373955_0068113 3300035172 Bacteria 1983
390 Ga0373947_0188032 3300035725 Bacteria 1347
391 Ga0373937_0282052 3300036401 Bacteria 1569
392 Ga0373925_0000157 3300037068 Bacteria 72993
393 Ga0373925_0001598 3300037068 Bacteria 19142
394 Ga0373925_0052056 3300037068 Bacteria 3058
395 Ga0395899_0022634 3300037312 Bacteria 4761
396 Ga0395898_0001784 3300037466 Bacteria 27962
397 Ga0395898_0024405 3300037466 Bacteria 6098
398 Ga0395898_0030181 3300037466 Bacteria 5426
399 Ga0395898_0039715 3300037466 Bacteria 4656
400 Ga0395898_0048999 3300037466 Bacteria 4141
401 Ga0395898_0053373 3300037466 Bacteria 3948
402 Ga0395898_0139922 3300037466 Bacteria 2317
403 Ga0395898_0601044 3300037466 Bacteria 1043
404 Ga0395905_0344416 3300037471 Bacteria 1382
405 Ga0395901_0022869 3300038443 Bacteria 6409
406 Ga0395901_0025426 3300038443 Bacteria 6077
407 Ga0395901_0036323 3300038443 Bacteria 5092
408 Ga0395901_0082296 3300038443 Bacteria 3363
409 Ga0395901_0360776 3300038443 Bacteria 1498
410 Ga0451797_0688976 3300041453 Bacteria 1354
411 Ga0451807_1563351 3300041486 Bacteria 1008
412 Ga0451853_0579279 3300041512 Bacteria 2127
413 Ga0451853_4019717 3300041512 Bacteria 1708
414 Ga0439441_003378 3300042001 Bacteria 2350
415 Ga0439448_0001907 3300042005 Bacteria 5551
416 Ga0439449_0023072 3300042007 Bacteria 2329
417 Ga0439449_0035985 3300042007 Bacteria 1841
418 Ga0439450_030404 3300042008 Bacteria 1212
419 Ga0439457_000565 3300042014 Bacteria 10815
420 Ga0450894_000053 3300042131 Bacteria 17593
421 Ga0450896_008117 3300042133 Bacteria 1453
422 Ga0450899_001403 3300042135 Bacteria 2692
423 Ga0450903_000489 3300042138 Bacteria 8298
424 Ga0450906_001299 3300042145 Bacteria 5483
425 Ga0450907_002007 3300042146 Bacteria 4075
426 Ga0439446_0015826 3300042156 Bacteria 2096
427 Ga0439435_0034646 3300042436 Bacteria 1389
428 Ga0466969_0021066 3300044656 Bacteria 3372
429 Ga0466972_0031810 3300044658 Bacteria 2593
430 Ga0466965_0008209 3300044683 Bacteria 4823
431 Ga0466965_0024809 3300044683 Bacteria 2901
432 Ga0466966_0012046 3300044684 Bacteria 5731
433 Ga0466966_0072900 3300044684 Bacteria 2149
434 Ga0466961_0003374 3300044693 Bacteria 9971
435 Ga0466961_0016795 3300044693 Bacteria 4705
436 Ga0466961_0021305 3300044693 Bacteria 4172
437 Ga0466961_0080966 3300044693 Bacteria 2055
438 Ga0466963_0005036 3300044694 Bacteria 7719
439 Ga0466963_0009925 3300044694 Bacteria 5750
440 Ga0466963_0019787 3300044694 Bacteria 4228
441 Ga0466963_0201406 3300044694 Bacteria 1392
442 Ga0466964_0006222 3300044706 Bacteria 4449
443 Ga0466971_0000404 3300044719 Bacteria 16780
444 Ga0466971_0004275 3300044719 Bacteria 6158
445 Ga0466971_0031388 3300044719 Bacteria 2379
446 Ga0466971_0031391 3300044719 Bacteria 2379
447 Ga0466971_0218846 3300044719 Bacteria 902
448 Ga0466968_0011702 3300044735 Bacteria 3423
449 Ga0466970_0012682 3300044765 Bacteria 4311
450 Ga0466957_0022441 3300044842 Bacteria 3724
451 Ga0466957_0033822 3300044842 Bacteria 3067
452 Ga0466957_0053642 3300044842 Bacteria 2458
453 Ga0466957_0055087 3300044842 Bacteria 2429
454 Ga0466957_0120811 3300044842 Bacteria 1670
455 Ga0466960_0007211 3300044901 Bacteria 4501
456 Ga0466960_0035797 3300044901 Bacteria 2322
457 Ga0466959_0036600 3300045049 Bacteria 3626
458 Ga0466959_0037801 3300045049 Bacteria 3567
459 Ga0466959_0121221 3300045049 Bacteria 1859
460 Ga0466959_0147111 3300045049 Bacteria 1662
461 Ga0466959_0281960 3300045049 Bacteria 1140
462 Ga0451576_0309046 3300045051 Bacteria 1654
463 Ga0466958_0007605 3300045836 Bacteria 5968
464 Ga0466958_0042249 3300045836 Bacteria 2745
465 Ga0466958_0067078 3300045836 Bacteria 2191
466 Ga0466958_0071063 3300045836 Bacteria 2131
467 Ga0466967_0046897 3300045976 Bacteria 3765
468 Ga0466967_0075941 3300045976 Bacteria 3021
469 Ga0466967_0208609 3300045976 Bacteria 1852
470 Ga0466967_0286573 3300045976 Bacteria 1581
471 Ga0466967_0401117 3300045976 Bacteria 1334
472 Ga0495603_0005814 3300046455 Bacteria 7378
473 Ga0495603_0008145 3300046455 Bacteria 6333
474 Ga0495590_0106535 3300046457 Bacteria 998
475 Ga0495641_0080810 3300046461 Bacteria 1456
476 Ga0495580_0101618 3300046472 Bacteria 1999
477 Ga0495605_0026071 3300046474 Bacteria 3040
478 Ga0495594_0011850 3300046499 Bacteria 4536
479 Ga0495594_0042463 3300046499 Bacteria 2490
480 Ga0495594_0078419 3300046499 Bacteria 1843
481 Ga0495583_0031093 3300046506 Bacteria 2592
482 Ga0495606_0018653 3300046507 Bacteria 5193
483 Ga0495608_0066915 3300046511 Bacteria 2351
484 Ga0495610_0016941 3300046512 Bacteria 4173
485 Ga0495610_0146392 3300046512 Bacteria 1012
486 Ga0495616_0023993 3300046513 Bacteria 3276
487 Ga0495618_0009955 3300046514 Bacteria 5750
488 Ga0495618_0057465 3300046514 Bacteria 2463
489 Ga0495620_0014341 3300046515 Bacteria 4030
490 Ga0495620_0059562 3300046515 Bacteria 1595
491 Ga0495628_0016920 3300046516 Bacteria 6077
492 Ga0495628_0057356 3300046516 Bacteria 3063
493 Ga0495628_0130257 3300046516 Bacteria 1924
494 Ga0495637_0033553 3300046520 Bacteria 2253
495 Ga0495643_0079397 3300046522 Bacteria 1710
496 Ga0495648_0033636 3300046524 Bacteria 3345
497 Ga0495652_0034046 3300046529 Bacteria 4442
498 Ga0495652_0233631 3300046529 Bacteria 1373
499 Ga0495654_0018579 3300046530 Bacteria 3641
500 Ga0495640_0015572 3300046533 Bacteria 5718
501 Ga0495640_0033441 3300046533 Bacteria 3651
502 Ga0495645_0197569 3300046543 Bacteria 1366
503 Ga0495633_0014210 3300046558 Bacteria 4170
504 Ga0495667_0128572 3300046559 Bacteria 1634
505 Ga0495667_0128884 3300046559 Bacteria 1632
506 Ga0495656_0181864 3300046615 Bacteria 1034
507 Ga0495634_0063649 3300046642 Bacteria 2447
508 Ga0495634_0072265 3300046642 Bacteria 2269
509 Ga0495625_0048468 3300046660 Bacteria 3058
510 Ga0495635_0003194 3300046663 Bacteria 11297
511 Ga0495661_0050122 3300046665 Bacteria 2529
512 Ga0495657_0032151 3300046675 Bacteria 3664
513 Ga0495657_0082740 3300046675 Bacteria 2073
514 Ga0495623_0137890 3300046679 Bacteria 1454
515 Ga0495658_0099713 3300046683 Bacteria 1732
516 Ga0495613_0022324 3300046689 Bacteria 4716
517 Ga0495649_0003017 3300046694 Bacteria 11552
518 Ga0495649_0177194 3300046694 Bacteria 1113
519 Ga0495589_0021998 3300046794 Bacteria 3257
520 Ga0495600_0043084 3300046809 Bacteria 2942
521 Ga0495600_0110571 3300046809 Bacteria 1789
522 Ga0495660_0077902 3300046810 Bacteria 1743
523 Ga0495660_0123269 3300046810 Bacteria 1308
524 Ga0495581_0056352 3300047315 Bacteria 2268
525 Ga0495581_0122532 3300047315 Bacteria 1513
526 Ga0495604_0044817 3300047317 Bacteria 3453
527 Ga0495636_0021952 3300047318 Bacteria 2579
528 Ga0495636_0034409 3300047318 Bacteria 2085
529 Ga0495636_0047369 3300047318 Bacteria 1795
530 Ga0495674_0062035 3300047319 Bacteria 3256
531 Ga0495674_0196585 3300047319 Bacteria 1675
532 Ga0495676_0021113 3300047321 Bacteria 5698
533 Ga0495676_0028112 3300047321 Bacteria 4810
534 Ga0495680_0004298 3300047322 Bacteria 13666
535 Ga0495687_006388 3300047443 Bacteria 7236
536 Ga0495687_031996 3300047443 Bacteria 2407
537 Ga0495687_042063 3300047443 Bacteria 1999
538 Ga0495675_0000649 3300047444 Bacteria 22067
539 Ga0495675_0250439 3300047444 Bacteria 1064
540 Ga0495685_005860 3300047447 Bacteria 4013
541 Ga0495685_017836 3300047447 Bacteria 2432
542 Ga0495686_0140821 3300047472 Bacteria 1423
543 Ga0495614_0084056 3300048089 Bacteria 1380
544 Ga0495626_0014010 3300048091 Bacteria 4149
545 Ga0496100_0033536 3300048903 Bacteria 3213
546 Ga0496100_0223944 3300048903 Bacteria 1381
547 Ga0496100_0277176 3300048903 Bacteria 1249
548 Ga0496100_0369584 3300048903 Bacteria 1087
549 Ga0496101_0147921 3300048904 Bacteria 1795
550 Ga0496101_0150798 3300048904 Bacteria 1778
551 Ga0496101_0295023 3300048904 Bacteria 1269
552 Ga0496101_0463067 3300048904 Bacteria 1000
553 Ga0496102_0032556 3300048905 Bacteria 4683
554 Ga0496102_0044963 3300048905 Bacteria 4007
555 Ga0496102_0078824 3300048905 Bacteria 3033
556 Ga0496102_0249098 3300048905 Bacteria 1675
557 Ga0496102_0581166 3300048905 Bacteria 1043
558 Ga0496103_0013549 3300048906 Bacteria 4835
559 Ga0496103_0014670 3300048906 Bacteria 4656
560 Ga0496104_0007088 3300048907 Bacteria 9886
561 Ga0496104_0019956 3300048907 Bacteria 6137
562 Ga0496104_0030064 3300048907 Bacteria 5045
563 Ga0496104_0043700 3300048907 Bacteria 4208
564 Ga0496104_0052870 3300048907 Bacteria 3836
565 Ga0496104_0158497 3300048907 Bacteria 2172
566 Ga0496104_0164946 3300048907 Bacteria 2124
567 Ga0496104_0171236 3300048907 Bacteria 2082
568 Ga0496104_0184555 3300048907 Bacteria 1997
569 Ga0496104_0427273 3300048907 Bacteria 1237
570 Ga0496105_0014328 3300048908 Bacteria 6310
571 Ga0496105_0034236 3300048908 Bacteria 4177
572 Ga0496105_0198669 3300048908 Bacteria 1637
573 Ga0496105_0214917 3300048908 Bacteria 1566
574 Ga0496105_0409080 3300048908 Bacteria 1076
575 Ga0496106_0028616 3300048909 Bacteria 4151
576 Ga0496106_0071074 3300048909 Bacteria 2659
577 Ga0496106_0083855 3300048909 Bacteria 2451
578 Ga0496106_0196409 3300048909 Bacteria 1605
579 Ga0496106_0244803 3300048909 Bacteria 1433
580 Ga0496107_0007139 3300048910 Bacteria 7697
581 Ga0496108_0055779 3300048911 Bacteria 3318
582 Ga0496108_0060876 3300048911 Bacteria 3176
583 Ga0496108_0113253 3300048911 Bacteria 2321
584 Ga0496108_0113419 3300048911 Bacteria 2320
585 Ga0496108_0114649 3300048911 Bacteria 2307
586 Ga0496108_0140069 3300048911 Bacteria 2084
587 Ga0496108_0163447 3300048911 Bacteria 1925
588 Ga0496108_0348926 3300048911 Bacteria 1291
589 Ga0496109_0058834 3300048912 Bacteria 3511
590 Ga0496109_0065255 3300048912 Bacteria 3333
591 Ga0496109_0079220 3300048912 Bacteria 3026
592 Ga0496109_0103582 3300048912 Bacteria 2641
593 Ga0496109_0119076 3300048912 Bacteria 2458
594 Ga0496109_0134886 3300048912 Bacteria 2306
595 Ga0496109_0160686 3300048912 Bacteria 2105
596 Ga0496109_0308344 3300048912 Bacteria 1493
597 Ga0496110_0018589 3300048913 Bacteria 5830
598 Ga0496110_0049279 3300048913 Bacteria 3694
599 Ga0496110_0070997 3300048913 Bacteria 3086
600 Ga0496110_0179932 3300048913 Bacteria 1920
601 Ga0496110_0323475 3300048913 Bacteria 1405
602 Ga0496111_0014234 3300048914 Bacteria 5429
603 Ga0496111_0020997 3300048914 Bacteria 4553
604 Ga0496111_0051617 3300048914 Bacteria 2968
605 Ga0496111_0118034 3300048914 Bacteria 1958
606 Ga0496111_0141060 3300048914 Bacteria 1785
607 Ga0496111_0221657 3300048914 Bacteria 1405
608 Ga0496111_0225113 3300048914 Bacteria 1393
609 Ga0496112_0000075 3300048915 Bacteria 65390
610 Ga0496112_0008373 3300048915 Bacteria 9262
611 Ga0496112_0033410 3300048915 Bacteria 5001
612 Ga0496112_0058218 3300048915 Bacteria 3805
613 Ga0496112_0075037 3300048915 Bacteria 3344
614 Ga0496112_0078179 3300048915 Bacteria 3272
615 Ga0496112_0120163 3300048915 Bacteria 2597
616 Ga0496112_0168549 3300048915 Bacteria 2155
617 Ga0496112_0587560 3300048915 Bacteria 1046
618 Ga0496113_0024570 3300048916 Bacteria 4284
619 Ga0496113_0038151 3300048916 Bacteria 3531
620 Ga0496113_0045280 3300048916 Bacteria 3262
621 Ga0496113_0062406 3300048916 Bacteria 2814
622 Ga0496113_0081864 3300048916 Bacteria 2475
623 Ga0496113_0119621 3300048916 Bacteria 2058
624 Ga0496113_0163996 3300048916 Bacteria 1758
625 Ga0496113_0196748 3300048916 Bacteria 1601
626 Ga0496114_0004631 3300048917 Bacteria 10687
627 Ga0496114_0014886 3300048917 Bacteria 6251
628 Ga0496114_0051019 3300048917 Bacteria 3444
629 Ga0496114_0079316 3300048917 Bacteria 2771
630 Ga0496114_0457063 3300048917 Bacteria 1130
631 Ga0496114_0581407 3300048917 Bacteria 988
632 Ga0496115_0099377 3300048918 Bacteria 2384
633 Ga0496115_0215575 3300048918 Bacteria 1585
634 Ga0496126_0006685 3300048929 Bacteria 12814
635 Ga0496126_0015703 3300048929 Bacteria 7609
636 Ga0496126_0058059 3300048929 Bacteria 3489
637 Ga0495682_0021937 3300049460 Bacteria 2391
638 Ga0501318_004964 3300049534 Bacteria 1300
639 Ga0501031_0041859 3300049568 Bacteria 2991
640 Ga0501031_0062020 3300049568 Bacteria 2436
641 Ga0501033_0001291 3300049570 Bacteria 22291
642 Ga0501033_0002560 3300049570 Bacteria 15356
643 Ga0501033_0039647 3300049570 Bacteria 3518
644 Ga0501033_0056386 3300049570 Bacteria 2904
645 Ga0501033_0194542 3300049570 Bacteria 1450
646 Ga0501033_0227249 3300049570 Bacteria 1327
647 Ga0501034_0553819 3300049571 Bacteria 1059
648 Ga0501036_0087436 3300049572 Bacteria 2634
649 Ga0501036_0091666 3300049572 Bacteria 2567
650 Ga0501036_0141514 3300049572 Bacteria 2030
651 Ga0501037_0005388 3300049573 Bacteria 9313
652 Ga0501037_0083006 3300049573 Bacteria 2321
653 Ga0501038_0003048 3300049574 Bacteria 15622
654 Ga0501038_0003106 3300049574 Bacteria 15492
655 Ga0501038_0004443 3300049574 Bacteria 13032
656 Ga0501038_0083857 3300049574 Bacteria 2682
657 Ga0501038_0127586 3300049574 Bacteria 2092
658 Ga0501038_0289838 3300049574 Bacteria 1287
659 Ga0501039_0093355 3300049575 Bacteria 2345
660 Ga0501039_0149340 3300049575 Bacteria 1836
661 Ga0501040_0141230 3300049576 Bacteria 1697
662 Ga0501040_0299451 3300049576 Bacteria 1150
663 Ga0501041_0250978 3300049577 Bacteria 1112
664 Ga0501042_0096538 3300049578 Bacteria 2123
665 Ga0501042_0138828 3300049578 Bacteria 1752
666 Ga0501042_0155814 3300049578 Bacteria 1648
667 Ga0501043_0007412 3300049579 Bacteria 8705
668 Ga0501043_0199711 3300049579 Bacteria 1552
669 Ga0501046_0014709 3300049580 Bacteria 6589
670 Ga0501046_0034395 3300049580 Bacteria 4090
671 Ga0501046_0121103 3300049580 Bacteria 1990
672 Ga0501047_0000005 3300049581 Bacteria 456524
673 Ga0501047_0003094 3300049581 Bacteria 15789
674 Ga0501047_0030085 3300049581 Bacteria 5235
675 Ga0501047_0083382 3300049581 Bacteria 3072
676 Ga0501047_0094101 3300049581 Bacteria 2875
677 Ga0501047_0111239 3300049581 Bacteria 2622
678 Ga0501047_0127199 3300049581 Bacteria 2428
679 Ga0501047_0140621 3300049581 Bacteria 2292
680 Ga0501047_0229804 3300049581 Bacteria 1709
681 Ga0501048_0007309 3300049582 Bacteria 8372
682 Ga0501067_0004493 3300049583 Bacteria 7694
683 Ga0501067_0026010 3300049583 Bacteria 3243
684 Ga0501068_0037962 3300049584 Bacteria 2884
685 Ga0501068_0073469 3300049584 Bacteria 2089
686 Ga0501068_0077790 3300049584 Bacteria 2032
687 Ga0501068_0085592 3300049584 Bacteria 1940
688 Ga0501068_0180787 3300049584 Bacteria 1333
689 Ga0501069_0023163 3300049585 Bacteria 3384
690 Ga0501069_0244199 3300049585 Bacteria 1047
691 Ga0501070_0391881 3300049586 Bacteria 1124
692 Ga0501072_0027141 3300049588 Bacteria 4468
693 Ga0501073_0027215 3300049589 Bacteria 4092
694 Ga0501074_0002170 3300049590 Bacteria 13599
695 Ga0501074_0055498 3300049590 Bacteria 2855
696 Ga0501074_0126830 3300049590 Bacteria 1826
697 Ga0501075_0018269 3300049591 Bacteria 5073
698 Ga0501075_0201415 3300049591 Bacteria 1518
699 Ga0501075_0205479 3300049591 Bacteria 1502
700 Ga0501076_0075425 3300049592 Bacteria 2703
701 Ga0501076_0164426 3300049592 Bacteria 1809
702 Ga0501076_0214071 3300049592 Bacteria 1575
703 Ga0501076_0285630 3300049592 Bacteria 1352
704 Ga0501076_0358835 3300049592 Bacteria 1197
705 Ga0501077_0046472 3300049593 Bacteria 2758
706 Ga0501077_0051486 3300049593 Bacteria 2617
707 Ga0501077_0079184 3300049593 Bacteria 2082
708 Ga0501079_0076032 3300049741 Bacteria 2597
709 Ga0501079_0363860 3300049741 Bacteria 1134
710 Ga0501080_0350105 3300049742 Bacteria 1334
711 Ga0501081_0180463 3300049743 Bacteria 1527
712 Ga0501083_0116602 3300049744 Bacteria 1753
713 Ga0501035_0004383 3300049822 Bacteria 13400
714 Ga0501035_0032380 3300049822 Bacteria 4756
715 Ga0501035_0054230 3300049822 Bacteria 3583
716 Ga0501044_0004786 3300049823 Bacteria 15144
717 Ga0501044_0070542 3300049823 Bacteria 3554
718 Ga0501044_0077035 3300049823 Bacteria 3382
719 Ga0501044_0107851 3300049823 Bacteria 2795
720 Ga0501044_0113200 3300049823 Bacteria 2720
721 Ga0501044_0228505 3300049823 Bacteria 1809
722 Ga0501044_0532473 3300049823 Bacteria 1073
723 Ga0501045_0049156 3300049824 Bacteria 3075
724 Ga0501045_0115914 3300049824 Bacteria 1987
725 Ga0501045_0247273 3300049824 Bacteria 1328
726 nmdc:mga03683_92328_c1 3300050489 Bacteria 1321
727 nmdc:mga00v17_4189_c1 3300050491 Bacteria 7482
728 nmdc:mga0yw44_231461_c1 3300050492 Bacteria 1227
729 nmdc:mga0yw44_262860_c1 3300050492 Bacteria 1150
730 nmdc:mga06z11_52138_c1 3300050494 Bacteria 2098
731 nmdc:mga06z11_560_c1 3300050494 Bacteria 13606
732 nmdc:mga06z11_86771_c1 3300050494 Bacteria 1691
733 nmdc:mga07m45_112576_c1 3300050496 Bacteria 1568
734 nmdc:mga07m45_2260_c1 3300050496 Bacteria 8998
735 nmdc:mga05p37_12604_c1 3300050507 Bacteria 10096
736 nmdc:mga05p37_600_c1 3300050507 Bacteria 39739
737 nmdc:mga09592_1919_c1 3300050508 Bacteria 16710
738 nmdc:mga09592_46336_c1 3300050508 Bacteria 3663
739 nmdc:mga0qj67_16412_c1 3300050509 Bacteria 5616
740 nmdc:mga06r32_288_c1 3300050510 Bacteria 41844
741 nmdc:mga06r32_449213_c1 3300050510 Bacteria 1269
742 nmdc:mga06r32_4639_c1 3300050510 Bacteria 12328
743 nmdc:mga08y16_19267_c1 3300050511 Bacteria 7190
744 nmdc:mga08y16_347340_c1 3300050511 Bacteria 1524
745 nmdc:mga0n895_231105_c1 3300050512 Bacteria 1877
746 nmdc:mga0n895_332272_c1 3300050512 Bacteria 1540
747 nmdc:mga0rr50_76862_c1 3300050513 Bacteria 2564
748 nmdc:mga0a205_189986_c1 3300050515 Bacteria 1946
749 nmdc:mga0a205_27527_c1 3300050515 Bacteria 5428
750 nmdc:mga0a205_32809_c1 3300050515 Bacteria 4978
751 nmdc:mga0a205_44881_c1 3300050515 Bacteria 4262
752 Ga0495601_0007889 3300053077 Bacteria 6270
753 Ga0495601_0026064 3300053077 Bacteria 3607
754 Ga0495612_0000297 3300053078 Bacteria 20179
755 Ga0495612_0030672 3300053078 Unclassified 2166
756 Ga0500610_0091615 3300053079 Bacteria 1579
757 Ga0495595_0028906 3300053084 Bacteria 2477
758 Ga0495619_0019837 3300053085 Bacteria 4278
759 Ga0495619_0053330 3300053085 Bacteria 2675
760 Ga0500644_0000495 3300053088 Bacteria 17150
761 Ga0500644_0027398 3300053088 Bacteria 1773
762 Ga0500583_0114065 3300053092 Bacteria 1333
763 Ga0500600_0154629 3300053149 Bacteria 1136
764 Ga0501084_0052232 3300054114 Bacteria 3420
765 Ga0501084_0092070 3300054114 Bacteria 2546
766 Ga0501084_0196410 3300054114 Bacteria 1702
767 Ga0501084_0217760 3300054114 Bacteria 1611
768 Ga0590071_005637 3300059421 Bacteria 3007
769 Ga0590075_005423 3300059424 Bacteria 3012
770 Ga0590077_009602 3300059426 Bacteria 1987
771 Ga0501082_0197932 3300060353 Bacteria 1748
772 Ga0501082_0297742 3300060353 Bacteria 1405
773 Ga0501082_0553342 3300060353 Bacteria 1006
774 Ga0466962_0001014 3300061719 Bacteria 12829
775 Ga0466962_0011061 3300061719 Bacteria 4345
776 Ga0466962_0018185 3300061719 Bacteria 3381
777 Ga0466962_0202434 3300061719 Bacteria 970
778 Ga0530510_0007663 3300061734 Bacteria 7519
779 Ga0530510_0120311 3300061734 Bacteria 1927
780 Ga0530510_0169388 3300061734 Bacteria 1617
781 Ga0530510_0219173 3300061734 Bacteria 1414
782 2547411876 2547132111 Bacteria 8013147
783 2554256594 2554235005 Bacteria 6457341
784 2585306110 2582581313 Bacteria 10042643
785 2616696500 2616644814 Bacteria 11555299
786 2644261327 2643221647 Bacteria 10741251
787 2644439572 2643221678 Bacteria 9540101
788 2644611235 2643221711 Bacteria 4865335
789 2644633080 2643221714 Bacteria 9015452
790 2676492279 2675903060 Bacteria 10051191
791 2768643712 2767802112 Bacteria 6465194
792 2785341641 2784746763 Bacteria 9783172
793 2785371036 2784746768 Bacteria 10036182
794 2786672234 2786546132 Bacteria 10419719
795 2804845248 2802429296 Bacteria 7227771
796 2808843582 2808606359 Bacteria 9866990
797 2808913143 2808606375 Bacteria 9466072
798 2809233635 2808606448 Bacteria 8656184
799 2812375650 2811994882 Bacteria 4688362
800 2812479205 2811994917 Bacteria 7761064
801 2819424517 2818991318 Bacteria 5266538
802 2819668089 2818991458 Bacteria 4794049
803 2819691958 2818991462 Bacteria 4320267
804 2819729701 2818991469 Bacteria 4644110
805 2862287248 2862281513 Bacteria 9621493
806 2862294763 2862290372 Bacteria 7471434
807 2862390844 2862382967 Bacteria 10317375
808 2862710434 2862705112 Bacteria 6563286
809 2863411325 2863404153 Bacteria 9672205
810 2867435113 2867428634 Bacteria 9590268
811 2868092750 2868088558 Bacteria 7609351
812 2877679543 2877676314 Bacteria 9512378
813 2918506027 2918501144 Bacteria 8668083
814 2919470454 2919468124 Bacteria 9133025
815 2946048363 2946045630 Bacteria 8527308
816 2946077314 2946072368 Bacteria 8999607
817 2954384442 2954380949 Bacteria 10050426
818 2954678510 2954673503 Bacteria 9685905
819 2954685645 2954682443 Bacteria 9862841
820 2954695304 2954691527 Bacteria 10720516
821 2954710495 2954701450 Bacteria 10834262
822 2954714741 2954711539 Bacteria 10867210
823 2954724686 2954721474 Bacteria 10456478
824 2954737131 2954731030 Bacteria 10243860
825 2954743610 2954740390 Bacteria 10229294
826 2954755984 2954749733 Bacteria 10366972
827 2954762562 2954759201 Bacteria 9358192
828 2990044988 2990044586 Bacteria 6603797
829 2997600569 2997600082 Bacteria 9896405
830 3006324143 3006321560 Bacteria 8247479
831 3006499038 3006493962 Bacteria 8825450
832 8001782414 8001781756 Bacteria 9586736
833 8008491413 8008485437 Bacteria 7198341
834 8008566793 8008558824 Bacteria 10610750
835 8023625622 8023623736 Bacteria 8593882
836 8025415464 8025413630 Bacteria 7014048
837 8025530743 8025524527 Bacteria 7197316
838 8025532418 8025530807 Bacteria 8495698
839 8033691186 8033684223 Bacteria 6906479
840 8048406907 8048406513 Bacteria 8936924
841 8056670523 8056667051 Bacteria 6953971
842 Ga0207661_10126540
843 LJQas_1008776
844 rootL2_10065946
845 rootL2_10216345
846 rootH1_10000873
847 JGI25160J50197_1005091
848 JGI25160J50197_1018265
849 Ga0006562J51391_1130078
850 Ga0006562J51391_1130079
851 Ga0070658_10001223
852 Ga0070658_10004318
853 Ga0070658_10006650
854 Ga0070658_10033497
855 Ga0070683_100023938
856 Ga0070683_100090637
857 Ga0070683_100159764
858 Ga0070683_100200548
859 Ga0070690_100052304
860 Ga0068869_100020772
861 Ga0070680_100000001
862 Ga0070680_100060843
863 Ga0070680_100281138
864 Ga0070680_100376407
865 Ga0070682_100058084
866 Ga0070682_100128678
867 Ga0070682_100210140
868 Ga0070682_100287621
869 Ga0070660_100089079
870 Ga0070689_100004630
871 Ga0070691_10021982
872 Ga0070687_100001722
873 Ga0070687_100013788
874 Ga0070687_100093103
875 Ga0070661_100030319
876 Ga0070692_10030527
877 Ga0070692_10070095
878 Ga0070675_100018710
879 Ga0070671_100113031
880 Ga0070674_100005758
881 Ga0070688_100006693
882 Ga0070659_100007264
883 Ga0070659_100135111
884 Ga0070659_100356790
885 Ga0070703_10000129
886 Ga0070709_10028642
887 Ga0070709_10045059
888 Ga0070714_100000013
889 Ga0070714_100002811
890 Ga0070714_100023225
891 Ga0070714_100352332
892 Ga0070713_100037570
893 Ga0070701_10007733
894 Ga0070705_100006178
895 Ga0070705_100016636
896 Ga0070705_100031130
897 Ga0070705_100079581
898 Ga0070700_100006665
899 Ga0070694_100005027
900 Ga0070694_100234954
901 Ga0070708_100001218
902 Ga0070708_100002638
903 Ga0070708_100225561
904 Ga0070663_100262994
905 Ga0070663_100353253
906 Ga0070663_100391867
907 Ga0070678_100183300
908 Ga0070662_100020576
909 Ga0070662_100251836
910 Ga0070681_10137053
911 Ga0070681_10246028
912 Ga0068867_100286959
913 Ga0070685_10077897
914 Ga0070685_10101147
915 Ga0070706_100000807
916 Ga0070706_100010398
917 Ga0070706_100191776
918 Ga0070707_100006986
919 Ga0070707_100010232
920 Ga0070707_100015743
921 Ga0070707_100017966
922 Ga0070707_100090372
923 Ga0070707_100107716
924 Ga0070707_100153627
925 Ga0070707_100174077
926 Ga0070707_100250296
927 Ga0070698_100025796
928 Ga0070698_100057224
929 Ga0070698_100057863
930 Ga0070698_100072108
931 Ga0070699_100003016
932 Ga0070699_100027295
933 Ga0070699_100441878
934 Ga0070679_100238425
935 Ga0070679_100257349
936 Ga0070679_100481758
937 Ga0070684_100022730
938 Ga0070684_100330671
939 Ga0070697_100007052
940 Ga0070697_100053440
941 Ga0070697_100100386
942 Ga0070686_100104438
943 Ga0070686_100163433
944 Ga0070686_100379371
945 Ga0070695_100037348
946 Ga0070695_100255936
947 Ga0070696_100016636
948 Ga0070696_100032706
949 Ga0070696_100054813
950 Ga0070696_100073792
951 Ga0070696_100085168
952 Ga0070696_100139093
953 Ga0070696_100169816
954 Ga0070665_100093907
955 Ga0070704_100008091
956 Ga0070704_100021796
957 Ga0070704_100040313
958 Ga0068855_100011359
959 Ga0070664_100175336
960 Ga0068857_100222744
961 Ga0068856_100165771
962 Ga0068856_100172273
963 Ga0068856_100416995
964 Ga0070702_100015401
965 Ga0068864_100041198
966 Ga0068864_100077863
967 Ga0068864_100080226
968 Ga0068864_100089740
969 Ga0068864_100180467
970 Ga0068866_10026048
971 Ga0068866_10172172
972 Ga0068861_100206869
973 Ga0068863_100000632
974 Ga0068863_100019372
975 Ga0068863_100324563
976 Ga0068858_100045979
977 Ga0068860_100162043
978 Ga0068862_100527254
979 Ga0081455_10000683
980 Ga0081455_10001095
981 Ga0081455_10082451
982 Ga0081539_10020888
983 Ga0081539_10040803
984 Ga0075365_10011126
985 Ga0075365_10051612
986 Ga0075368_10000633
987 Ga0075368_10043329
988 Ga0075363_100001382
989 Ga0075364_10035588
990 Ga0075364_10048981
991 Ga0070716_100036774
992 Ga0070712_100176077
993 Ga0075362_10116532
994 Ga0075367_10000576
995 Ga0075367_10033026
996 Ga0075367_10053490
997 Ga0075370_10001568
998 Ga0075370_10012320
999 Ga0075370_10130274
1000 Ga0075428_100000323
1001 Ga0075428_100008365
1002 Ga0075428_100038044
1003 Ga0075428_100371321
1004 Ga0075430_100001867
1005 Ga0075430_100090486
1006 Ga0075431_100012098
1007 Ga0075431_100105822
1008 Ga0075431_100152366
1009 Ga0075433_10046905
1010 Ga0075433_10078018
1011 Ga0075433_10161594
1012 Ga0075434_100337403
1013 Ga0075434_100408005
1014 Ga0075429_100000390
1015 Ga0075429_100032720
1016 Ga0075435_100072506
1017 Ga0105240_10090564
1018 Ga0105240_10525030
1019 Ga0111539_10037320
1020 Ga0111539_10692531
1021 Ga0105245_10020726
1022 Ga0105245_10163833
1023 Ga0105247_10020007
1024 Ga0105247_10459479
1025 Ga0114129_10000680
1026 Ga0114129_10122194
1027 Ga0114129_10542573
1028 Ga0105243_10020293
1029 Ga0105243_10028126
1030 Ga0105242_10025657
1031 Ga0105242_10035063
1032 Ga0105248_10598231
1033 Ga0105237_10244969
1034 Ga0105238_10136744
1035 Ga0105249_10015393
1036 Ga0105249_10542888
1037 Ga0105239_10015560
1038 Ga0105239_10099219
1039 Ga0105239_10135604
1040 Ga0105246_10011160
1041 Ga0157369_10044896
1042 Ga0157378_10002433
1043 Ga0157378_10015654
1044 Ga0157378_10073764
1045 Ga0157378_10250606
1046 Ga0163162_10018280
1047 Ga0157372_10876626
1048 Ga0157375_10026881
1049 Ga0157375_10157963
1050 Ga0163163_10024613
1051 Ga0163163_10052447
1052 Ga0163163_10151532
1053 Ga0163163_10305206
1054 Ga0157380_10012180
1055 Ga0182008_10001225
1056 Ga0157377_10166068
1057 Ga0157379_10095834
1058 Ga0157379_10193178
1059 Ga0157379_10286796
1060 Ga0157379_10369962
1061 Ga0157376_10222505
1062 Ga0182007_10000750
1063 Ga0206353_10341901
1064 Ga0206353_10728699
1065 Ga0206353_11878516
1066 Ga0224712_10001707
1067 Ga0224572_1007699
1068 Ga0224572_1033250
1069 Ga0207426_1004416
1070 Ga0207426_1014300
1071 Ga0207653_10000241
1072 Ga0207692_10036265
1073 Ga0207642_10146028
1074 Ga0207699_10023834
1075 Ga0207643_10007289
1076 Ga0207705_10016639
1077 Ga0207705_10055520
1078 Ga0207684_10000862
1079 Ga0207684_10002316
1080 Ga0207684_10003968
1081 Ga0207684_10015993
1082 Ga0207684_10151894
1083 Ga0207707_10124549
1084 Ga0207695_10050262
1085 Ga0207693_10161543
1086 Ga0207660_10000001
1087 Ga0207662_10000425
1088 Ga0207657_10075540
1089 Ga0207652_10096303
1090 Ga0207652_10188662
1091 Ga0207652_10242033
1092 Ga0207646_10000033
1093 Ga0207646_10002777
1094 Ga0207646_10004969
1095 Ga0207646_10016710
1096 Ga0207646_10029948
1097 Ga0207646_10051384
1098 Ga0207646_10073152
1099 Ga0207646_10112623
1100 Ga0207646_10112983
1101 Ga0207694_10259117
1102 Ga0207659_10037424
1103 Ga0207687_10046798
1104 Ga0207687_10448903
1105 Ga0207687_10480014
1106 Ga0207700_10021038
1107 Ga0207700_10336715
1108 Ga0207664_10000001
1109 Ga0207664_10001979
1110 Ga0207664_10024558
1111 Ga0207664_10027923
1112 Ga0207664_10066230
1113 Ga0207664_10070066
1114 Ga0207690_10173995
1115 Ga0207706_10118468
1116 Ga0207706_10188970
1117 Ga0207706_10372747
1118 Ga0207709_10021724
1119 Ga0207711_10013333
1120 Ga0207711_10457107
1121 Ga0207689_10031711
1122 Ga0207689_10113354
1123 Ga0207661_10012386
1124 Ga0207661_10148368
1125 Ga0207661_10175061
1126 Ga0207661_10373229
1127 Ga0207661_10676644
1128 Ga0207679_10078673
1129 Ga0207679_10246389
1130 Ga0207679_10305687
1131 Ga0207667_10025976
1132 Ga0207667_10335396
1133 Ga0207712_10026410
1134 Ga0207712_10114434
1135 Ga0207677_10024329
1136 Ga0207703_10170845
1137 Ga0207678_10018654
1138 Ga0207678_10027932
1139 Ga0207678_10237546
1140 Ga0207708_10001184
1141 Ga0207702_10267808
1142 Ga0207702_10297492
1143 Ga0207702_10361451
1144 Ga0207641_10038082
1145 Ga0207641_10122480
1146 Ga0207648_10002936
1147 Ga0207648_10080631
1148 Ga0207648_10310667
1149 Ga0207676_10084492
1150 Ga0207676_10133200
1151 Ga0207676_10152388
1152 Ga0207674_10013399
1153 Ga0207674_10042954
1154 Ga0207674_10045818
1155 Ga0207674_10064149
1156 Ga0207675_100108728
1157 Ga0207683_10062250
1158 Ga0207683_10390442
1159 Ga0207698_10060308
1160 Ga0209371_1015601
1161 Ga0209974_10001189
1162 Ga0207428_10010598
1163 Ga0268266_10018552
1164 Ga0268266_10067027
1165 Ga0268266_10196398
1166 Ga0268264_10144041
1167 Ga0265326_10001207
1168 Ga0265334_10000742
1169 Ga0265318_10015205
1170 Ga0265323_10003324
1171 Ga0265322_10003953
1172 Ga0265336_10001768
1173 Ga0307517_10010838
1174 Ga0307515_10141865
1175 Ga0265338_10000288
1176 Ga0265338_10001573
1177 Ga0265338_10005567
1178 Ga0265338_10093316
1179 Ga0265338_10358295
1180 Ga0265324_10002842
1181 Ga0265760_10013690
1182 Ga0265332_10001336
1183 Ga0265320_10010891
1184 Ga0265320_10018211
1185 Ga0265325_10029814
1186 Ga0265325_10100348
1187 Ga0265340_10061154
1188 Ga0265331_10086387
1189 Ga0307513_10030783
1190 Ga0307513_10136979
1191 Ga0265313_10013884
1192 Ga0265313_10022785
1193 Ga0307508_10005648
1194 Ga0307508_10080284
1195 Ga0307508_10268091
1196 Ga0307514_10021933
1197 Ga0307514_10057870
1198 Ga0307514_10092657
1199 Ga0265314_10010683
1200 Ga0265314_10014312
1201 Ga0265342_10022487
1202 Ga0265342_10092069
1203 Ga0307516_10045157
1204 Ga0307405_10060158
1205 Ga0307405_10309595
1206 Ga0307413_10093453
1207 Ga0307518_10155664
1208 Ga0307410_10014555
1209 Ga0307406_10022300
1210 Ga0307406_10146626
1211 Ga0307407_10351320
1212 Ga0307412_10036178
1213 Ga0307412_10333803
1214 Ga0307409_100129519
1215 Ga0307409_100204443
1216 Ga0307409_100494175
1217 Ga0307416_100015846
1218 Ga0307416_100055822
1219 Ga0307416_100109395
1220 Ga0307411_10127386
1221 Ga0307415_100000215
1222 Ga0307415_100040887
1223 Ga0307415_100076655
1224 Ga0307415_100097348
1225 Ga0307415_100174319
1226 Ga0307507_10000004
1227 Ga0307507_10168127
1228 Ga0307510_10036759
1229 Ga0373957_0016606
1230 Ga0373955_0068113
1231 Ga0373947_0188032
1232 Ga0373937_0282052
1233 Ga0373925_0000157
1234 Ga0373925_0001598
1235 Ga0373925_0052056
1236 Ga0395899_0022634
1237 Ga0395898_0001784
1238 Ga0395898_0024405
1239 Ga0395898_0030181
1240 Ga0395898_0039715
1241 Ga0395898_0048999
1242 Ga0395898_0053373
1243 Ga0395898_0139922
1244 Ga0395898_0601044
1245 Ga0395905_0344416
1246 Ga0395901_0022869
1247 Ga0395901_0025426
1248 Ga0395901_0036323
1249 Ga0395901_0082296
1250 Ga0395901_0360776
1251 Ga0451797_0688976
1252 Ga0451807_1563351
1253 Ga0451853_0579279
1254 Ga0451853_4019717
1255 Ga0439441_003378
1256 Ga0439448_0001907
1257 Ga0439449_0023072
1258 Ga0439449_0035985
1259 Ga0439450_030404
1260 Ga0439457_000565
1261 Ga0450894_000053
1262 Ga0450896_008117
1263 Ga0450899_001403
1264 Ga0450903_000489
1265 Ga0450906_001299
1266 Ga0450907_002007
1267 Ga0439446_0015826
1268 Ga0439435_0034646
1269 Ga0466969_0021066
1270 Ga0466972_0031810
1271 Ga0466965_0008209
1272 Ga0466965_0024809
1273 Ga0466966_0012046
1274 Ga0466966_0072900
1275 Ga0466961_0003374
1276 Ga0466961_0016795
1277 Ga0466961_0021305
1278 Ga0466961_0080966
1279 Ga0466963_0005036
1280 Ga0466963_0009925
1281 Ga0466963_0019787
1282 Ga0466963_0201406
1283 Ga0466964_0006222
1284 Ga0466971_0000404
1285 Ga0466971_0004275
1286 Ga0466971_0031388
1287 Ga0466971_0031391
1288 Ga0466971_0218846
1289 Ga0466968_0011702
1290 Ga0466970_0012682
1291 Ga0466957_0022441
1292 Ga0466957_0033822
1293 Ga0466957_0053642
1294 Ga0466957_0055087
1295 Ga0466957_0120811
1296 Ga0466960_0007211
1297 Ga0466960_0035797
1298 Ga0466959_0036600
1299 Ga0466959_0037801
1300 Ga0466959_0121221
1301 Ga0466959_0147111
1302 Ga0466959_0281960
1303 Ga0451576_0309046
1304 Ga0466958_0007605
1305 Ga0466958_0042249
1306 Ga0466958_0067078
1307 Ga0466958_0071063
1308 Ga0466967_0046897
1309 Ga0466967_0075941
1310 Ga0466967_0208609
1311 Ga0466967_0286573
1312 Ga0466967_0401117
1313 Ga0495603_0005814
1314 Ga0495603_0008145
1315 Ga0495590_0106535
1316 Ga0495641_0080810
1317 Ga0495580_0101618
1318 Ga0495605_0026071
1319 Ga0495594_0011850
1320 Ga0495594_0042463
1321 Ga0495594_0078419
1322 Ga0495583_0031093
1323 Ga0495606_0018653
1324 Ga0495608_0066915
1325 Ga0495610_0016941
1326 Ga0495610_0146392
1327 Ga0495616_0023993
1328 Ga0495618_0009955
1329 Ga0495618_0057465
1330 Ga0495620_0014341
1331 Ga0495620_0059562
1332 Ga0495628_0016920
1333 Ga0495628_0057356
1334 Ga0495628_0130257
1335 Ga0495637_0033553
1336 Ga0495643_0079397
1337 Ga0495648_0033636
1338 Ga0495652_0034046
1339 Ga0495652_0233631
1340 Ga0495654_0018579
1341 Ga0495640_0015572
1342 Ga0495640_0033441
1343 Ga0495645_0197569
1344 Ga0495633_0014210
1345 Ga0495667_0128572
1346 Ga0495667_0128884
1347 Ga0495656_0181864
1348 Ga0495634_0063649
1349 Ga0495634_0072265
1350 Ga0495625_0048468
1351 Ga0495635_0003194
1352 Ga0495661_0050122
1353 Ga0495657_0032151
1354 Ga0495657_0082740
1355 Ga0495623_0137890
1356 Ga0495658_0099713
1357 Ga0495613_0022324
1358 Ga0495649_0003017
1359 Ga0495649_0177194
1360 Ga0495589_0021998
1361 Ga0495600_0043084
1362 Ga0495600_0110571
1363 Ga0495660_0077902
1364 Ga0495660_0123269
1365 Ga0495581_0056352
1366 Ga0495581_0122532
1367 Ga0495604_0044817
1368 Ga0495636_0021952
1369 Ga0495636_0034409
1370 Ga0495636_0047369
1371 Ga0495674_0062035
1372 Ga0495674_0196585
1373 Ga0495676_0021113
1374 Ga0495676_0028112
1375 Ga0495680_0004298
1376 Ga0495687_006388
1377 Ga0495687_031996
1378 Ga0495687_042063
1379 Ga0495675_0000649
1380 Ga0495675_0250439
1381 Ga0495685_005860
1382 Ga0495685_017836
1383 Ga0495686_0140821
1384 Ga0495614_0084056
1385 Ga0495626_0014010
1386 Ga0496100_0033536
1387 Ga0496100_0223944
1388 Ga0496100_0277176
1389 Ga0496100_0369584
1390 Ga0496101_0147921
1391 Ga0496101_0150798
1392 Ga0496101_0295023
1393 Ga0496101_0463067
1394 Ga0496102_0032556
1395 Ga0496102_0044963
1396 Ga0496102_0078824
1397 Ga0496102_0249098
1398 Ga0496102_0581166
1399 Ga0496103_0013549
1400 Ga0496103_0014670
1401 Ga0496104_0007088
1402 Ga0496104_0019956
1403 Ga0496104_0030064
1404 Ga0496104_0043700
1405 Ga0496104_0052870
1406 Ga0496104_0158497
1407 Ga0496104_0164946
1408 Ga0496104_0171236
1409 Ga0496104_0184555
1410 Ga0496104_0427273
1411 Ga0496105_0014328
1412 Ga0496105_0034236
1413 Ga0496105_0198669
1414 Ga0496105_0214917
1415 Ga0496105_0409080
1416 Ga0496106_0028616
1417 Ga0496106_0071074
1418 Ga0496106_0083855
1419 Ga0496106_0196409
1420 Ga0496106_0244803
1421 Ga0496107_0007139
1422 Ga0496108_0055779
1423 Ga0496108_0060876
1424 Ga0496108_0113253
1425 Ga0496108_0113419
1426 Ga0496108_0114649
1427 Ga0496108_0140069
1428 Ga0496108_0163447
1429 Ga0496108_0348926
1430 Ga0496109_0058834
1431 Ga0496109_0065255
1432 Ga0496109_0079220
1433 Ga0496109_0103582
1434 Ga0496109_0119076
1435 Ga0496109_0134886
1436 Ga0496109_0160686
1437 Ga0496109_0308344
1438 Ga0496110_0018589
1439 Ga0496110_0049279
1440 Ga0496110_0070997
1441 Ga0496110_0179932
1442 Ga0496110_0323475
1443 Ga0496111_0014234
1444 Ga0496111_0020997
1445 Ga0496111_0051617
1446 Ga0496111_0118034
1447 Ga0496111_0141060
1448 Ga0496111_0221657
1449 Ga0496111_0225113
1450 Ga0496112_0000075
1451 Ga0496112_0008373
1452 Ga0496112_0033410
1453 Ga0496112_0058218
1454 Ga0496112_0075037
1455 Ga0496112_0078179
1456 Ga0496112_0120163
1457 Ga0496112_0168549
1458 Ga0496112_0587560
1459 Ga0496113_0024570
1460 Ga0496113_0038151
1461 Ga0496113_0045280
1462 Ga0496113_0062406
1463 Ga0496113_0081864
1464 Ga0496113_0119621
1465 Ga0496113_0163996
1466 Ga0496113_0196748
1467 Ga0496114_0004631
1468 Ga0496114_0014886
1469 Ga0496114_0051019
1470 Ga0496114_0079316
1471 Ga0496114_0457063
1472 Ga0496114_0581407
1473 Ga0496115_0099377
1474 Ga0496115_0215575
1475 Ga0496126_0006685
1476 Ga0496126_0015703
1477 Ga0496126_0058059
1478 Ga0495682_0021937
1479 Ga0501318_004964
1480 Ga0501031_0041859
1481 Ga0501031_0062020
1482 Ga0501033_0001291
1483 Ga0501033_0002560
1484 Ga0501033_0039647
1485 Ga0501033_0056386
1486 Ga0501033_0194542
1487 Ga0501033_0227249
1488 Ga0501034_0553819
1489 Ga0501036_0087436
1490 Ga0501036_0091666
1491 Ga0501036_0141514
1492 Ga0501037_0005388
1493 Ga0501037_0083006
1494 Ga0501038_0003048
1495 Ga0501038_0003106
1496 Ga0501038_0004443
1497 Ga0501038_0083857
1498 Ga0501038_0127586
1499 Ga0501038_0289838
1500 Ga0501039_0093355
1501 Ga0501039_0149340
1502 Ga0501040_0141230
1503 Ga0501040_0299451
1504 Ga0501041_0250978
1505 Ga0501042_0096538
1506 Ga0501042_0138828
1507 Ga0501042_0155814
1508 Ga0501043_0007412
1509 Ga0501043_0199711
1510 Ga0501046_0014709
1511 Ga0501046_0034395
1512 Ga0501046_0121103
1513 Ga0501047_0000005
1514 Ga0501047_0003094
1515 Ga0501047_0030085
1516 Ga0501047_0083382
1517 Ga0501047_0094101
1518 Ga0501047_0111239
1519 Ga0501047_0127199
1520 Ga0501047_0140621
1521 Ga0501047_0229804
1522 Ga0501048_0007309
1523 Ga0501067_0004493
1524 Ga0501067_0026010
1525 Ga0501068_0037962
1526 Ga0501068_0073469
1527 Ga0501068_0077790
1528 Ga0501068_0085592
1529 Ga0501068_0180787
1530 Ga0501069_0023163
1531 Ga0501069_0244199
1532 Ga0501070_0391881
1533 Ga0501072_0027141
1534 Ga0501073_0027215
1535 Ga0501074_0002170
1536 Ga0501074_0055498
1537 Ga0501074_0126830
1538 Ga0501075_0018269
1539 Ga0501075_0201415
1540 Ga0501075_0205479
1541 Ga0501076_0075425
1542 Ga0501076_0164426
1543 Ga0501076_0214071
1544 Ga0501076_0285630
1545 Ga0501076_0358835
1546 Ga0501077_0046472
1547 Ga0501077_0051486
1548 Ga0501077_0079184
1549 Ga0501079_0076032
1550 Ga0501079_0363860
1551 Ga0501080_0350105
1552 Ga0501081_0180463
1553 Ga0501083_0116602
1554 Ga0501035_0004383
1555 Ga0501035_0032380
1556 Ga0501035_0054230
1557 Ga0501044_0004786
1558 Ga0501044_0070542
1559 Ga0501044_0077035
1560 Ga0501044_0107851
1561 Ga0501044_0113200
1562 Ga0501044_0228505
1563 Ga0501044_0532473
1564 Ga0501045_0049156
1565 Ga0501045_0115914
1566 Ga0501045_0247273
1567 nmdc:mga03683_92328_c1
1568 nmdc:mga00v17_4189_c1
1569 nmdc:mga0yw44_231461_c1
1570 nmdc:mga0yw44_262860_c1
1571 nmdc:mga06z11_52138_c1
1572 nmdc:mga06z11_560_c1
1573 nmdc:mga06z11_86771_c1
1574 nmdc:mga07m45_112576_c1
1575 nmdc:mga07m45_2260_c1
1576 nmdc:mga05p37_12604_c1
1577 nmdc:mga05p37_600_c1
1578 nmdc:mga09592_1919_c1
1579 nmdc:mga09592_46336_c1
1580 nmdc:mga0qj67_16412_c1
1581 nmdc:mga06r32_288_c1
1582 nmdc:mga06r32_449213_c1
1583 nmdc:mga06r32_4639_c1
1584 nmdc:mga08y16_19267_c1
1585 nmdc:mga08y16_347340_c1
1586 nmdc:mga0n895_231105_c1
1587 nmdc:mga0n895_332272_c1
1588 nmdc:mga0rr50_76862_c1
1589 nmdc:mga0a205_189986_c1
1590 nmdc:mga0a205_27527_c1
1591 nmdc:mga0a205_32809_c1
1592 nmdc:mga0a205_44881_c1
1593 Ga0495601_0007889
1594 Ga0495601_0026064
1595 Ga0495612_0000297
1596 Ga0495612_0030672
1597 Ga0500610_0091615
1598 Ga0495595_0028906
1599 Ga0495619_0019837
1600 Ga0495619_0053330
1601 Ga0500644_0000495
1602 Ga0500644_0027398
1603 Ga0500583_0114065
1604 Ga0500600_0154629
1605 Ga0501084_0052232
1606 Ga0501084_0092070
1607 Ga0501084_0196410
1608 Ga0501084_0217760
1609 Ga0590071_005637
1610 Ga0590075_005423
1611 Ga0590077_009602
1612 Ga0501082_0197932
1613 Ga0501082_0297742
1614 Ga0501082_0553342
1615 Ga0466962_0001014
1616 Ga0466962_0011061
1617 Ga0466962_0018185
1618 Ga0466962_0202434
1619 Ga0530510_0007663
1620 Ga0530510_0120311
1621 Ga0530510_0169388
1622 Ga0530510_0219173
1623 2547411876
1624 2554256594
1625 2585306110
1626 2616696500
1627 2644261327
1628 2644439572
1629 2644611235
1630 2644633080
1631 2676492279
1632 2768643712
1633 2785341641
1634 2785371036
1635 2786672234
1636 2804845248
1637 2808843582
1638 2808913143
1639 2809233635
1640 2812375650
1641 2812479205
1642 2819424517
1643 2819668089
1644 2819691958
1645 2819729701
1646 2862287248
1647 2862294763
1648 2862390844
1649 2862710434
1650 2863411325
1651 2867435113
1652 2868092750
1653 2877679543
1654 2918506027
1655 2919470454
1656 2946048363
1657 2946077314
1658 2954384442
1659 2954678510
1660 2954685645
1661 2954695304
1662 2954710495
1663 2954714741
1664 2954724686
1665 2954737131
1666 2954743610
1667 2954755984
1668 2954762562
1669 2990044988
1670 2997600569
1671 3006324143
1672 3006499038
1673 8001782414
1674 8008491413
1675 8008566793
1676 8023625622
1677 8025415464
1678 8025530743
1679 8025532418
1680 8033691186
1681 8048406907
1682 8056670523

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

77

322

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zum-assembly2.cif.gz_E human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form 0.9572 11 227
1zum-assembly3.cif.gz_J human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form 0.9568 11 227
1zum-assembly2.cif.gz_F human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form 0.9568 11 227
1zum-assembly3.cif.gz_I human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form 0.9565 11 227
1zum-assembly3.cif.gz_K human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form 0.9564 11 226
ID Description Score Start End Superfamily
af_A0A0R0ESV8_56_300_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9493 12 227 3.40.605.10
af_Q84LK3_9_267_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9453 12 256 3.40.605.10
af_A0A1D6MRK0_1_96_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9449 164 253 3.40.605.10
af_Q2FV10_3_257_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9436 12 253 3.40.605.10
af_Q9URW9_34_486_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9421 26 252 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A5M3X375-F1-model_v4 Aldehyde dehydrogenase 0.9824 30 284 GO:0016491
AF-A0A7Y0DBV1-F1-model_v4 Aldehyde dehydrogenase family protein 0.9763 2 250 GO:0016491
AF-A0A4P6Q1V1-F1-model_v4 NAD/NADP-dependent betaine aldehyde dehydrogenase (EC 1.2.1.8) 0.9747 1 284 GO:0008802
AF-A0A7Y6AB86-F1-model_v4 Aldehyde dehydrogenase family protein 0.973 2 231 GO:0016491
AF-A0A4P6Q1V1-F1-model_v4 NAD/NADP-dependent betaine aldehyde dehydrogenase (EC 1.2.1.8) 0.9713 1 284 GO:0008802

Map