F483091
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 841 | 417 | 1682 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10126540|Ga0207661_101265402 |
| Length | 344 |
| Sequence | VAGTGWPRTLMPDRADRKATGARAGQGSSKSGGKTTAKAPKKMPNETGRPPDAAASSNGARLTVLKTYKLFIGGAFPRSESGRSYPARTPDGDLLANAARASRKDVRDAVKAARGAFGRWSGATAYNRGQVLYRVAEMLEGRAGQFAAEVAAAEGAAPRAAQEQVAAAIDRWVWYAGWTDKVAQVTGGANPVAGPFVNFSVPEPAGVAALIAPPQSSLLGLVSVLAPVIATGNTAVVVASPDRPLPAITLAEVLATSDVPGGVVNLLTGYVAELAPVLAGHMDVDAIDVSGADPEMAAELERLAAGNLKRVLRAVPGEDWSAAPGTRRLTAFLETKTFWHPAGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 109 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 204 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 205 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 206 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 207 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 208 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 209 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 210 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 211 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 212 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 213 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 350 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 353 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 354 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 358 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 359 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 360 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 361 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 362 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 363 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 364 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 365 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 366 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 367 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 368 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 369 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 370 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 371 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 372 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 373 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 374 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 375 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 376 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 377 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 378 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 379 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 380 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 381 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 382 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 383 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 384 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 385 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 386 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 387 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 388 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 389 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 390 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 391 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 392 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 393 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 394 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 395 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 396 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 397 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 398 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 399 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 400 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 401 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 402 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 403 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 404 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 405 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 406 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 407 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 408 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 409 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 410 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 411 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 412 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 413 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 414 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 415 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 416 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 417 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.91 |
| Metatranscriptomes | 0.95 |
| Isolates | 7.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.8 |
| Nodule | 0.24 |
| Rhizoplane | 10.82 |
| Rhizosphere | 79.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207661_10126540 | 3300025944 | Bacteria | 2183 |
| 2 | LJQas_1008776 | 3300000549 | Bacteria | 1225 |
| 3 | rootL2_10065946 | 3300003322 | Bacteria | 5700 |
| 4 | rootL2_10216345 | 3300003322 | Bacteria | 1479 |
| 5 | rootH1_10000873 | 3300003323 | Bacteria | 3387 |
| 6 | JGI25160J50197_1005091 | 3300003354 | Bacteria | 5537 |
| 7 | JGI25160J50197_1018265 | 3300003354 | Bacteria | 2191 |
| 8 | Ga0006562J51391_1130078 | 3300003578 | Bacteria | 1800 |
| 9 | Ga0006562J51391_1130079 | 3300003578 | Bacteria | 1743 |
| 10 | Ga0070658_10001223 | 3300005327 | Bacteria | 22027 |
| 11 | Ga0070658_10004318 | 3300005327 | Bacteria | 11612 |
| 12 | Ga0070658_10006650 | 3300005327 | Bacteria | 9367 |
| 13 | Ga0070658_10033497 | 3300005327 | Bacteria | 4134 |
| 14 | Ga0070683_100023938 | 3300005329 | Bacteria | 5466 |
| 15 | Ga0070683_100090637 | 3300005329 | Bacteria | 2871 |
| 16 | Ga0070683_100159764 | 3300005329 | Bacteria | 2138 |
| 17 | Ga0070683_100200548 | 3300005329 | Bacteria | 1895 |
| 18 | Ga0070690_100052304 | 3300005330 | Bacteria | 2610 |
| 19 | Ga0068869_100020772 | 3300005334 | Bacteria | 4508 |
| 20 | Ga0070680_100000001 | 3300005336 | Bacteria | 276263 |
| 21 | Ga0070680_100060843 | 3300005336 | Bacteria | 3090 |
| 22 | Ga0070680_100281138 | 3300005336 | Bacteria | 1410 |
| 23 | Ga0070680_100376407 | 3300005336 | Bacteria | 1209 |
| 24 | Ga0070682_100058084 | 3300005337 | Bacteria | 2439 |
| 25 | Ga0070682_100128678 | 3300005337 | Bacteria | 1711 |
| 26 | Ga0070682_100210140 | 3300005337 | Bacteria | 1378 |
| 27 | Ga0070682_100287621 | 3300005337 | Bacteria | 1201 |
| 28 | Ga0070660_100089079 | 3300005339 | Bacteria | 2431 |
| 29 | Ga0070689_100004630 | 3300005340 | Bacteria | 9314 |
| 30 | Ga0070691_10021982 | 3300005341 | Bacteria | 2956 |
| 31 | Ga0070687_100001722 | 3300005343 | Bacteria | 7865 |
| 32 | Ga0070687_100013788 | 3300005343 | Bacteria | 3613 |
| 33 | Ga0070687_100093103 | 3300005343 | Bacteria | 1671 |
| 34 | Ga0070661_100030319 | 3300005344 | Bacteria | 3906 |
| 35 | Ga0070692_10030527 | 3300005345 | Bacteria | 2695 |
| 36 | Ga0070692_10070095 | 3300005345 | Bacteria | 1866 |
| 37 | Ga0070675_100018710 | 3300005354 | Bacteria | 5514 |
| 38 | Ga0070671_100113031 | 3300005355 | Bacteria | 2281 |
| 39 | Ga0070674_100005758 | 3300005356 | Bacteria | 7190 |
| 40 | Ga0070688_100006693 | 3300005365 | Bacteria | 6177 |
| 41 | Ga0070659_100007264 | 3300005366 | Bacteria | 8042 |
| 42 | Ga0070659_100135111 | 3300005366 | Bacteria | 2005 |
| 43 | Ga0070659_100356790 | 3300005366 | Bacteria | 1228 |
| 44 | Ga0070703_10000129 | 3300005406 | Bacteria | 39084 |
| 45 | Ga0070709_10028642 | 3300005434 | Bacteria | 3324 |
| 46 | Ga0070709_10045059 | 3300005434 | Bacteria | 2735 |
| 47 | Ga0070714_100000013 | 3300005435 | Bacteria | 211756 |
| 48 | Ga0070714_100002811 | 3300005435 | Bacteria | 12847 |
| 49 | Ga0070714_100023225 | 3300005435 | Bacteria | 5091 |
| 50 | Ga0070714_100352332 | 3300005435 | Bacteria | 1383 |
| 51 | Ga0070713_100037570 | 3300005436 | Bacteria | 3916 |
| 52 | Ga0070701_10007733 | 3300005438 | Bacteria | 4611 |
| 53 | Ga0070705_100006178 | 3300005440 | Bacteria | 5865 |
| 54 | Ga0070705_100016636 | 3300005440 | Bacteria | 3824 |
| 55 | Ga0070705_100031130 | 3300005440 | Bacteria | 2952 |
| 56 | Ga0070705_100079581 | 3300005440 | Bacteria | 2008 |
| 57 | Ga0070700_100006665 | 3300005441 | Bacteria | 6186 |
| 58 | Ga0070694_100005027 | 3300005444 | Bacteria | 7980 |
| 59 | Ga0070694_100234954 | 3300005444 | Bacteria | 1381 |
| 60 | Ga0070708_100001218 | 3300005445 | Bacteria | 19787 |
| 61 | Ga0070708_100002638 | 3300005445 | Bacteria | 13882 |
| 62 | Ga0070708_100225561 | 3300005445 | Bacteria | 1758 |
| 63 | Ga0070663_100262994 | 3300005455 | Bacteria | 1369 |
| 64 | Ga0070663_100353253 | 3300005455 | Bacteria | 1191 |
| 65 | Ga0070663_100391867 | 3300005455 | Bacteria | 1133 |
| 66 | Ga0070678_100183300 | 3300005456 | Bacteria | 1716 |
| 67 | Ga0070662_100020576 | 3300005457 | Bacteria | 4496 |
| 68 | Ga0070662_100251836 | 3300005457 | Bacteria | 1420 |
| 69 | Ga0070681_10137053 | 3300005458 | Bacteria | 2378 |
| 70 | Ga0070681_10246028 | 3300005458 | Bacteria | 1701 |
| 71 | Ga0068867_100286959 | 3300005459 | Bacteria | 1351 |
| 72 | Ga0070685_10077897 | 3300005466 | Bacteria | 1980 |
| 73 | Ga0070685_10101147 | 3300005466 | Bacteria | 1761 |
| 74 | Ga0070706_100000807 | 3300005467 | Bacteria | 34728 |
| 75 | Ga0070706_100010398 | 3300005467 | Bacteria | 8642 |
| 76 | Ga0070706_100191776 | 3300005467 | Bacteria | 1909 |
| 77 | Ga0070707_100006986 | 3300005468 | Bacteria | 10466 |
| 78 | Ga0070707_100010232 | 3300005468 | Bacteria | 8736 |
| 79 | Ga0070707_100015743 | 3300005468 | Bacteria | 7099 |
| 80 | Ga0070707_100017966 | 3300005468 | Bacteria | 6651 |
| 81 | Ga0070707_100090372 | 3300005468 | Bacteria | 2964 |
| 82 | Ga0070707_100107716 | 3300005468 | Bacteria | 2704 |
| 83 | Ga0070707_100153627 | 3300005468 | Bacteria | 2241 |
| 84 | Ga0070707_100174077 | 3300005468 | Bacteria | 2097 |
| 85 | Ga0070707_100250296 | 3300005468 | Bacteria | 1724 |
| 86 | Ga0070698_100025796 | 3300005471 | Bacteria | 6125 |
| 87 | Ga0070698_100057224 | 3300005471 | Bacteria | 3946 |
| 88 | Ga0070698_100057863 | 3300005471 | Bacteria | 3921 |
| 89 | Ga0070698_100072108 | 3300005471 | Bacteria | 3462 |
| 90 | Ga0070699_100003016 | 3300005518 | Bacteria | 14946 |
| 91 | Ga0070699_100027295 | 3300005518 | Bacteria | 4926 |
| 92 | Ga0070699_100441878 | 3300005518 | Bacteria | 1179 |
| 93 | Ga0070679_100238425 | 3300005530 | Bacteria | 1777 |
| 94 | Ga0070679_100257349 | 3300005530 | Bacteria | 1701 |
| 95 | Ga0070679_100481758 | 3300005530 | Bacteria | 1185 |
| 96 | Ga0070684_100022730 | 3300005535 | Bacteria | 5234 |
| 97 | Ga0070684_100330671 | 3300005535 | Bacteria | 1400 |
| 98 | Ga0070697_100007052 | 3300005536 | Bacteria | 8734 |
| 99 | Ga0070697_100053440 | 3300005536 | Bacteria | 3283 |
| 100 | Ga0070697_100100386 | 3300005536 | Bacteria | 2404 |
| 101 | Ga0070686_100104438 | 3300005544 | Bacteria | 1919 |
| 102 | Ga0070686_100163433 | 3300005544 | Bacteria | 1569 |
| 103 | Ga0070686_100379371 | 3300005544 | Bacteria | 1070 |
| 104 | Ga0070695_100037348 | 3300005545 | Bacteria | 3060 |
| 105 | Ga0070695_100255936 | 3300005545 | Bacteria | 1276 |
| 106 | Ga0070696_100016636 | 3300005546 | Bacteria | 4958 |
| 107 | Ga0070696_100032706 | 3300005546 | Bacteria | 3569 |
| 108 | Ga0070696_100054813 | 3300005546 | Bacteria | 2779 |
| 109 | Ga0070696_100073792 | 3300005546 | Bacteria | 2405 |
| 110 | Ga0070696_100085168 | 3300005546 | Bacteria | 2243 |
| 111 | Ga0070696_100139093 | 3300005546 | Bacteria | 1773 |
| 112 | Ga0070696_100169816 | 3300005546 | Bacteria | 1612 |
| 113 | Ga0070665_100093907 | 3300005548 | Bacteria | 3005 |
| 114 | Ga0070704_100008091 | 3300005549 | Bacteria | 6282 |
| 115 | Ga0070704_100021796 | 3300005549 | Bacteria | 4159 |
| 116 | Ga0070704_100040313 | 3300005549 | Bacteria | 3214 |
| 117 | Ga0068855_100011359 | 3300005563 | Bacteria | 10751 |
| 118 | Ga0070664_100175336 | 3300005564 | Bacteria | 1903 |
| 119 | Ga0068857_100222744 | 3300005577 | Bacteria | 1723 |
| 120 | Ga0068856_100165771 | 3300005614 | Bacteria | 2220 |
| 121 | Ga0068856_100172273 | 3300005614 | Bacteria | 2176 |
| 122 | Ga0068856_100416995 | 3300005614 | Bacteria | 1362 |
| 123 | Ga0070702_100015401 | 3300005615 | Bacteria | 3904 |
| 124 | Ga0068864_100041198 | 3300005618 | Bacteria | 3950 |
| 125 | Ga0068864_100077863 | 3300005618 | Bacteria | 2901 |
| 126 | Ga0068864_100080226 | 3300005618 | Bacteria | 2858 |
| 127 | Ga0068864_100089740 | 3300005618 | Bacteria | 2708 |
| 128 | Ga0068864_100180467 | 3300005618 | Bacteria | 1930 |
| 129 | Ga0068866_10026048 | 3300005718 | Bacteria | 2756 |
| 130 | Ga0068866_10172172 | 3300005718 | Bacteria | 1272 |
| 131 | Ga0068861_100206869 | 3300005719 | Bacteria | 1651 |
| 132 | Ga0068863_100000632 | 3300005841 | Bacteria | 35693 |
| 133 | Ga0068863_100019372 | 3300005841 | Bacteria | 6508 |
| 134 | Ga0068863_100324563 | 3300005841 | Bacteria | 1496 |
| 135 | Ga0068858_100045979 | 3300005842 | Bacteria | 4047 |
| 136 | Ga0068860_100162043 | 3300005843 | Bacteria | 2157 |
| 137 | Ga0068862_100527254 | 3300005844 | Bacteria | 1125 |
| 138 | Ga0081455_10000683 | 3300005937 | Bacteria | 44068 |
| 139 | Ga0081455_10001095 | 3300005937 | Bacteria | 33996 |
| 140 | Ga0081455_10082451 | 3300005937 | Bacteria | 2630 |
| 141 | Ga0081539_10020888 | 3300005985 | Bacteria | 4399 |
| 142 | Ga0081539_10040803 | 3300005985 | Bacteria | 2721 |
| 143 | Ga0075365_10011126 | 3300006038 | Bacteria | 5279 |
| 144 | Ga0075365_10051612 | 3300006038 | Bacteria | 2717 |
| 145 | Ga0075368_10000633 | 3300006042 | Bacteria | 10650 |
| 146 | Ga0075368_10043329 | 3300006042 | Bacteria | 1773 |
| 147 | Ga0075363_100001382 | 3300006048 | Bacteria | 9146 |
| 148 | Ga0075364_10035588 | 3300006051 | Bacteria | 3218 |
| 149 | Ga0075364_10048981 | 3300006051 | Bacteria | 2754 |
| 150 | Ga0070716_100036774 | 3300006173 | Bacteria | 2701 |
| 151 | Ga0070712_100176077 | 3300006175 | Bacteria | 1663 |
| 152 | Ga0075362_10116532 | 3300006177 | Bacteria | 1261 |
| 153 | Ga0075367_10000576 | 3300006178 | Bacteria | 14012 |
| 154 | Ga0075367_10033026 | 3300006178 | Bacteria | 2980 |
| 155 | Ga0075367_10053490 | 3300006178 | Bacteria | 2392 |
| 156 | Ga0075370_10001568 | 3300006353 | Bacteria | 10043 |
| 157 | Ga0075370_10012320 | 3300006353 | Bacteria | 4515 |
| 158 | Ga0075370_10130274 | 3300006353 | Bacteria | 1467 |
| 159 | Ga0075428_100000323 | 3300006844 | Bacteria | 47418 |
| 160 | Ga0075428_100008365 | 3300006844 | Bacteria | 11472 |
| 161 | Ga0075428_100038044 | 3300006844 | Bacteria | 5295 |
| 162 | Ga0075428_100371321 | 3300006844 | Bacteria | 1534 |
| 163 | Ga0075430_100001867 | 3300006846 | Bacteria | 17230 |
| 164 | Ga0075430_100090486 | 3300006846 | Bacteria | 2560 |
| 165 | Ga0075431_100012098 | 3300006847 | Bacteria | 8707 |
| 166 | Ga0075431_100105822 | 3300006847 | Bacteria | 2903 |
| 167 | Ga0075431_100152366 | 3300006847 | Bacteria | 2380 |
| 168 | Ga0075433_10046905 | 3300006852 | Bacteria | 3758 |
| 169 | Ga0075433_10078018 | 3300006852 | Bacteria | 2918 |
| 170 | Ga0075433_10161594 | 3300006852 | Bacteria | 1994 |
| 171 | Ga0075434_100337403 | 3300006871 | Bacteria | 1528 |
| 172 | Ga0075434_100408005 | 3300006871 | Bacteria | 1380 |
| 173 | Ga0075429_100000390 | 3300006880 | Bacteria | 32202 |
| 174 | Ga0075429_100032720 | 3300006880 | Bacteria | 4519 |
| 175 | Ga0075435_100072506 | 3300007076 | Bacteria | 2813 |
| 176 | Ga0105240_10090564 | 3300009093 | Bacteria | 3738 |
| 177 | Ga0105240_10525030 | 3300009093 | Bacteria | 1313 |
| 178 | Ga0111539_10037320 | 3300009094 | Bacteria | 5868 |
| 179 | Ga0111539_10692531 | 3300009094 | Bacteria | 1186 |
| 180 | Ga0105245_10020726 | 3300009098 | Bacteria | 5763 |
| 181 | Ga0105245_10163833 | 3300009098 | Bacteria | 2112 |
| 182 | Ga0105247_10020007 | 3300009101 | Bacteria | 4023 |
| 183 | Ga0105247_10459479 | 3300009101 | Bacteria | 919 |
| 184 | Ga0114129_10000680 | 3300009147 | Bacteria | 42864 |
| 185 | Ga0114129_10122194 | 3300009147 | Bacteria | 3583 |
| 186 | Ga0114129_10542573 | 3300009147 | Bacteria | 1513 |
| 187 | Ga0105243_10020293 | 3300009148 | Bacteria | 5039 |
| 188 | Ga0105243_10028126 | 3300009148 | Bacteria | 4313 |
| 189 | Ga0105242_10025657 | 3300009176 | Bacteria | 4666 |
| 190 | Ga0105242_10035063 | 3300009176 | Bacteria | 4024 |
| 191 | Ga0105248_10598231 | 3300009177 | Bacteria | 1244 |
| 192 | Ga0105237_10244969 | 3300009545 | Bacteria | 1794 |
| 193 | Ga0105238_10136744 | 3300009551 | Bacteria | 2428 |
| 194 | Ga0105249_10015393 | 3300009553 | Bacteria | 6769 |
| 195 | Ga0105249_10542888 | 3300009553 | Bacteria | 1212 |
| 196 | Ga0105239_10015560 | 3300010375 | Bacteria | 8425 |
| 197 | Ga0105239_10099219 | 3300010375 | Bacteria | 3219 |
| 198 | Ga0105239_10135604 | 3300010375 | Bacteria | 2740 |
| 199 | Ga0105246_10011160 | 3300011119 | Bacteria | 5569 |
| 200 | Ga0157369_10044896 | 3300013105 | Bacteria | 4808 |
| 201 | Ga0157378_10002433 | 3300013297 | Bacteria | 16558 |
| 202 | Ga0157378_10015654 | 3300013297 | Bacteria | 6643 |
| 203 | Ga0157378_10073764 | 3300013297 | Bacteria | 3069 |
| 204 | Ga0157378_10250606 | 3300013297 | Bacteria | 1695 |
| 205 | Ga0163162_10018280 | 3300013306 | Bacteria | 6866 |
| 206 | Ga0157372_10876626 | 3300013307 | Bacteria | 1042 |
| 207 | Ga0157375_10026881 | 3300013308 | Bacteria | 5371 |
| 208 | Ga0157375_10157963 | 3300013308 | Bacteria | 2408 |
| 209 | Ga0163163_10024613 | 3300014325 | Bacteria | 5731 |
| 210 | Ga0163163_10052447 | 3300014325 | Bacteria | 4023 |
| 211 | Ga0163163_10151532 | 3300014325 | Bacteria | 2362 |
| 212 | Ga0163163_10305206 | 3300014325 | Bacteria | 1644 |
| 213 | Ga0157380_10012180 | 3300014326 | Bacteria | 6230 |
| 214 | Ga0182008_10001225 | 3300014497 | Bacteria | 17696 |
| 215 | Ga0157377_10166068 | 3300014745 | Bacteria | 1376 |
| 216 | Ga0157379_10095834 | 3300014968 | Bacteria | 2663 |
| 217 | Ga0157379_10193178 | 3300014968 | Bacteria | 1840 |
| 218 | Ga0157379_10286796 | 3300014968 | Bacteria | 1499 |
| 219 | Ga0157379_10369962 | 3300014968 | Bacteria | 1314 |
| 220 | Ga0157376_10222505 | 3300014969 | Bacteria | 1749 |
| 221 | Ga0182007_10000750 | 3300015262 | Bacteria | 18258 |
| 222 | Ga0206353_10341901 | 3300020082 | Bacteria | 1212 |
| 223 | Ga0206353_10728699 | 3300020082 | Bacteria | 1522 |
| 224 | Ga0206353_11878516 | 3300020082 | Bacteria | 3370 |
| 225 | Ga0224712_10001707 | 3300022467 | Bacteria | 5208 |
| 226 | Ga0224572_1007699 | 3300024225 | Bacteria | 1979 |
| 227 | Ga0224572_1033250 | 3300024225 | Bacteria | 981 |
| 228 | Ga0207426_1004416 | 3300025302 | Bacteria | 6876 |
| 229 | Ga0207426_1014300 | 3300025302 | Bacteria | 2909 |
| 230 | Ga0207653_10000241 | 3300025885 | Bacteria | 36454 |
| 231 | Ga0207692_10036265 | 3300025898 | Bacteria | 2403 |
| 232 | Ga0207642_10146028 | 3300025899 | Bacteria | 1253 |
| 233 | Ga0207699_10023834 | 3300025906 | Bacteria | 3337 |
| 234 | Ga0207643_10007289 | 3300025908 | Bacteria | 5935 |
| 235 | Ga0207705_10016639 | 3300025909 | Bacteria | 5267 |
| 236 | Ga0207705_10055520 | 3300025909 | Bacteria | 2856 |
| 237 | Ga0207684_10000862 | 3300025910 | Bacteria | 34728 |
| 238 | Ga0207684_10002316 | 3300025910 | Bacteria | 19331 |
| 239 | Ga0207684_10003968 | 3300025910 | Bacteria | 14168 |
| 240 | Ga0207684_10015993 | 3300025910 | Bacteria | 6444 |
| 241 | Ga0207684_10151894 | 3300025910 | Bacteria | 1992 |
| 242 | Ga0207707_10124549 | 3300025912 | Bacteria | 2254 |
| 243 | Ga0207695_10050262 | 3300025913 | Bacteria | 4387 |
| 244 | Ga0207693_10161543 | 3300025915 | Bacteria | 1763 |
| 245 | Ga0207660_10000001 | 3300025917 | Bacteria | 1034169 |
| 246 | Ga0207662_10000425 | 3300025918 | Bacteria | 18634 |
| 247 | Ga0207657_10075540 | 3300025919 | Bacteria | 2843 |
| 248 | Ga0207652_10096303 | 3300025921 | Bacteria | 2607 |
| 249 | Ga0207652_10188662 | 3300025921 | Bacteria | 1854 |
| 250 | Ga0207652_10242033 | 3300025921 | Bacteria | 1626 |
| 251 | Ga0207646_10000033 | 3300025922 | Bacteria | 213090 |
| 252 | Ga0207646_10002777 | 3300025922 | Bacteria | 20446 |
| 253 | Ga0207646_10004969 | 3300025922 | Bacteria | 14205 |
| 254 | Ga0207646_10016710 | 3300025922 | Bacteria | 6884 |
| 255 | Ga0207646_10029948 | 3300025922 | Bacteria | 4941 |
| 256 | Ga0207646_10051384 | 3300025922 | Bacteria | 3689 |
| 257 | Ga0207646_10073152 | 3300025922 | Bacteria | 3062 |
| 258 | Ga0207646_10112623 | 3300025922 | Bacteria | 2442 |
| 259 | Ga0207646_10112983 | 3300025922 | Bacteria | 2438 |
| 260 | Ga0207694_10259117 | 3300025924 | Bacteria | 1424 |
| 261 | Ga0207659_10037424 | 3300025926 | Bacteria | 3369 |
| 262 | Ga0207687_10046798 | 3300025927 | Bacteria | 2996 |
| 263 | Ga0207687_10448903 | 3300025927 | Bacteria | 1069 |
| 264 | Ga0207687_10480014 | 3300025927 | Bacteria | 1035 |
| 265 | Ga0207700_10021038 | 3300025928 | Bacteria | 4447 |
| 266 | Ga0207700_10336715 | 3300025928 | Bacteria | 1311 |
| 267 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 268 | Ga0207664_10001979 | 3300025929 | Bacteria | 13484 |
| 269 | Ga0207664_10024558 | 3300025929 | Bacteria | 4530 |
| 270 | Ga0207664_10027923 | 3300025929 | Bacteria | 4284 |
| 271 | Ga0207664_10066230 | 3300025929 | Bacteria | 2895 |
| 272 | Ga0207664_10070066 | 3300025929 | Bacteria | 2821 |
| 273 | Ga0207690_10173995 | 3300025932 | Bacteria | 1615 |
| 274 | Ga0207706_10118468 | 3300025933 | Bacteria | 2328 |
| 275 | Ga0207706_10188970 | 3300025933 | Bacteria | 1808 |
| 276 | Ga0207706_10372747 | 3300025933 | Bacteria | 1239 |
| 277 | Ga0207709_10021724 | 3300025935 | Bacteria | 3634 |
| 278 | Ga0207711_10013333 | 3300025941 | Bacteria | 6827 |
| 279 | Ga0207711_10457107 | 3300025941 | Bacteria | 1189 |
| 280 | Ga0207689_10031711 | 3300025942 | Bacteria | 4397 |
| 281 | Ga0207689_10113354 | 3300025942 | Bacteria | 2229 |
| 282 | Ga0207661_10012386 | 3300025944 | Bacteria | 6195 |
| 283 | Ga0207661_10148368 | 3300025944 | Bacteria | 2025 |
| 284 | Ga0207661_10175061 | 3300025944 | Bacteria | 1870 |
| 285 | Ga0207661_10373229 | 3300025944 | Bacteria | 1290 |
| 286 | Ga0207661_10676644 | 3300025944 | Bacteria | 949 |
| 287 | Ga0207679_10078673 | 3300025945 | Bacteria | 2512 |
| 288 | Ga0207679_10246389 | 3300025945 | Bacteria | 1517 |
| 289 | Ga0207679_10305687 | 3300025945 | Bacteria | 1372 |
| 290 | Ga0207667_10025976 | 3300025949 | Bacteria | 6405 |
| 291 | Ga0207667_10335396 | 3300025949 | Bacteria | 1544 |
| 292 | Ga0207712_10026410 | 3300025961 | Bacteria | 3869 |
| 293 | Ga0207712_10114434 | 3300025961 | Bacteria | 2029 |
| 294 | Ga0207677_10024329 | 3300026023 | Bacteria | 3760 |
| 295 | Ga0207703_10170845 | 3300026035 | Bacteria | 1912 |
| 296 | Ga0207678_10018654 | 3300026067 | Bacteria | 6090 |
| 297 | Ga0207678_10027932 | 3300026067 | Bacteria | 4926 |
| 298 | Ga0207678_10237546 | 3300026067 | Bacteria | 1561 |
| 299 | Ga0207708_10001184 | 3300026075 | Bacteria | 19642 |
| 300 | Ga0207702_10267808 | 3300026078 | Bacteria | 1611 |
| 301 | Ga0207702_10297492 | 3300026078 | Bacteria | 1531 |
| 302 | Ga0207702_10361451 | 3300026078 | Bacteria | 1391 |
| 303 | Ga0207641_10038082 | 3300026088 | Bacteria | 4019 |
| 304 | Ga0207641_10122480 | 3300026088 | Bacteria | 2323 |
| 305 | Ga0207648_10002936 | 3300026089 | Bacteria | 18044 |
| 306 | Ga0207648_10080631 | 3300026089 | Bacteria | 2839 |
| 307 | Ga0207648_10310667 | 3300026089 | Bacteria | 1415 |
| 308 | Ga0207676_10084492 | 3300026095 | Bacteria | 2588 |
| 309 | Ga0207676_10133200 | 3300026095 | Bacteria | 2116 |
| 310 | Ga0207676_10152388 | 3300026095 | Bacteria | 1993 |
| 311 | Ga0207674_10013399 | 3300026116 | Bacteria | 9101 |
| 312 | Ga0207674_10042954 | 3300026116 | Bacteria | 4664 |
| 313 | Ga0207674_10045818 | 3300026116 | Bacteria | 4495 |
| 314 | Ga0207674_10064149 | 3300026116 | Bacteria | 3706 |
| 315 | Ga0207675_100108728 | 3300026118 | Bacteria | 2615 |
| 316 | Ga0207683_10062250 | 3300026121 | Bacteria | 3286 |
| 317 | Ga0207683_10390442 | 3300026121 | Bacteria | 1280 |
| 318 | Ga0207698_10060308 | 3300026142 | Bacteria | 2950 |
| 319 | Ga0209371_1015601 | 3300027312 | Bacteria | 2034 |
| 320 | Ga0209974_10001189 | 3300027876 | Bacteria | 9301 |
| 321 | Ga0207428_10010598 | 3300027907 | Bacteria | 8226 |
| 322 | Ga0268266_10018552 | 3300028379 | Bacteria | 5930 |
| 323 | Ga0268266_10067027 | 3300028379 | Bacteria | 3106 |
| 324 | Ga0268266_10196398 | 3300028379 | Bacteria | 1845 |
| 325 | Ga0268264_10144041 | 3300028381 | Bacteria | 2128 |
| 326 | Ga0265326_10001207 | 3300028558 | Bacteria | 9253 |
| 327 | Ga0265334_10000742 | 3300028573 | Bacteria | 16338 |
| 328 | Ga0265318_10015205 | 3300028577 | Bacteria | 3208 |
| 329 | Ga0265323_10003324 | 3300028653 | Bacteria | 7137 |
| 330 | Ga0265322_10003953 | 3300028654 | Bacteria | 4441 |
| 331 | Ga0265336_10001768 | 3300028666 | Bacteria | 9450 |
| 332 | Ga0307517_10010838 | 3300028786 | Bacteria | 12707 |
| 333 | Ga0307515_10141865 | 3300028794 | Bacteria | 2571 |
| 334 | Ga0265338_10000288 | 3300028800 | Bacteria | 90670 |
| 335 | Ga0265338_10001573 | 3300028800 | Bacteria | 36794 |
| 336 | Ga0265338_10005567 | 3300028800 | Bacteria | 16386 |
| 337 | Ga0265338_10093316 | 3300028800 | Bacteria | 2480 |
| 338 | Ga0265338_10358295 | 3300028800 | Bacteria | 1047 |
| 339 | Ga0265324_10002842 | 3300029957 | Bacteria | 8531 |
| 340 | Ga0265760_10013690 | 3300031090 | Bacteria | 2322 |
| 341 | Ga0265332_10001336 | 3300031238 | Bacteria | 13970 |
| 342 | Ga0265320_10010891 | 3300031240 | Bacteria | 5383 |
| 343 | Ga0265320_10018211 | 3300031240 | Bacteria | 3874 |
| 344 | Ga0265325_10029814 | 3300031241 | Bacteria | 2929 |
| 345 | Ga0265325_10100348 | 3300031241 | Bacteria | 1418 |
| 346 | Ga0265340_10061154 | 3300031247 | Bacteria | 1802 |
| 347 | Ga0265331_10086387 | 3300031250 | Bacteria | 1453 |
| 348 | Ga0307513_10030783 | 3300031456 | Bacteria | 6091 |
| 349 | Ga0307513_10136979 | 3300031456 | Bacteria | 2382 |
| 350 | Ga0265313_10013884 | 3300031595 | Bacteria | 4798 |
| 351 | Ga0265313_10022785 | 3300031595 | Bacteria | 3389 |
| 352 | Ga0307508_10005648 | 3300031616 | Bacteria | 11855 |
| 353 | Ga0307508_10080284 | 3300031616 | Bacteria | 2844 |
| 354 | Ga0307508_10268091 | 3300031616 | Bacteria | 1301 |
| 355 | Ga0307514_10021933 | 3300031649 | Bacteria | 5198 |
| 356 | Ga0307514_10057870 | 3300031649 | Bacteria | 2968 |
| 357 | Ga0307514_10092657 | 3300031649 | Bacteria | 2197 |
| 358 | Ga0265314_10010683 | 3300031711 | Bacteria | 7640 |
| 359 | Ga0265314_10014312 | 3300031711 | Bacteria | 6358 |
| 360 | Ga0265342_10022487 | 3300031712 | Bacteria | 4007 |
| 361 | Ga0265342_10092069 | 3300031712 | Bacteria | 1737 |
| 362 | Ga0307516_10045157 | 3300031730 | Bacteria | 4353 |
| 363 | Ga0307405_10060158 | 3300031731 | Bacteria | 2396 |
| 364 | Ga0307405_10309595 | 3300031731 | Bacteria | 1202 |
| 365 | Ga0307413_10093453 | 3300031824 | Bacteria | 1966 |
| 366 | Ga0307518_10155664 | 3300031838 | Bacteria | 1576 |
| 367 | Ga0307410_10014555 | 3300031852 | Bacteria | 4634 |
| 368 | Ga0307406_10022300 | 3300031901 | Bacteria | 3755 |
| 369 | Ga0307406_10146626 | 3300031901 | Bacteria | 1678 |
| 370 | Ga0307407_10351320 | 3300031903 | Bacteria | 1044 |
| 371 | Ga0307412_10036178 | 3300031911 | Bacteria | 3160 |
| 372 | Ga0307412_10333803 | 3300031911 | Bacteria | 1211 |
| 373 | Ga0307409_100129519 | 3300031995 | Bacteria | 2153 |
| 374 | Ga0307409_100204443 | 3300031995 | Bacteria | 1770 |
| 375 | Ga0307409_100494175 | 3300031995 | Bacteria | 1190 |
| 376 | Ga0307416_100015846 | 3300032002 | Bacteria | 5220 |
| 377 | Ga0307416_100055822 | 3300032002 | Bacteria | 3183 |
| 378 | Ga0307416_100109395 | 3300032002 | Bacteria | 2431 |
| 379 | Ga0307411_10127386 | 3300032005 | Bacteria | 1854 |
| 380 | Ga0307415_100000215 | 3300032126 | Bacteria | 25330 |
| 381 | Ga0307415_100040887 | 3300032126 | Bacteria | 3075 |
| 382 | Ga0307415_100076655 | 3300032126 | Bacteria | 2371 |
| 383 | Ga0307415_100097348 | 3300032126 | Bacteria | 2147 |
| 384 | Ga0307415_100174319 | 3300032126 | Bacteria | 1680 |
| 385 | Ga0307507_10000004 | 3300033179 | Bacteria | 289641 |
| 386 | Ga0307507_10168127 | 3300033179 | Bacteria | 1601 |
| 387 | Ga0307510_10036759 | 3300033180 | Bacteria | 5448 |
| 388 | Ga0373957_0016606 | 3300035120 | Bacteria | 2551 |
| 389 | Ga0373955_0068113 | 3300035172 | Bacteria | 1983 |
| 390 | Ga0373947_0188032 | 3300035725 | Bacteria | 1347 |
| 391 | Ga0373937_0282052 | 3300036401 | Bacteria | 1569 |
| 392 | Ga0373925_0000157 | 3300037068 | Bacteria | 72993 |
| 393 | Ga0373925_0001598 | 3300037068 | Bacteria | 19142 |
| 394 | Ga0373925_0052056 | 3300037068 | Bacteria | 3058 |
| 395 | Ga0395899_0022634 | 3300037312 | Bacteria | 4761 |
| 396 | Ga0395898_0001784 | 3300037466 | Bacteria | 27962 |
| 397 | Ga0395898_0024405 | 3300037466 | Bacteria | 6098 |
| 398 | Ga0395898_0030181 | 3300037466 | Bacteria | 5426 |
| 399 | Ga0395898_0039715 | 3300037466 | Bacteria | 4656 |
| 400 | Ga0395898_0048999 | 3300037466 | Bacteria | 4141 |
| 401 | Ga0395898_0053373 | 3300037466 | Bacteria | 3948 |
| 402 | Ga0395898_0139922 | 3300037466 | Bacteria | 2317 |
| 403 | Ga0395898_0601044 | 3300037466 | Bacteria | 1043 |
| 404 | Ga0395905_0344416 | 3300037471 | Bacteria | 1382 |
| 405 | Ga0395901_0022869 | 3300038443 | Bacteria | 6409 |
| 406 | Ga0395901_0025426 | 3300038443 | Bacteria | 6077 |
| 407 | Ga0395901_0036323 | 3300038443 | Bacteria | 5092 |
| 408 | Ga0395901_0082296 | 3300038443 | Bacteria | 3363 |
| 409 | Ga0395901_0360776 | 3300038443 | Bacteria | 1498 |
| 410 | Ga0451797_0688976 | 3300041453 | Bacteria | 1354 |
| 411 | Ga0451807_1563351 | 3300041486 | Bacteria | 1008 |
| 412 | Ga0451853_0579279 | 3300041512 | Bacteria | 2127 |
| 413 | Ga0451853_4019717 | 3300041512 | Bacteria | 1708 |
| 414 | Ga0439441_003378 | 3300042001 | Bacteria | 2350 |
| 415 | Ga0439448_0001907 | 3300042005 | Bacteria | 5551 |
| 416 | Ga0439449_0023072 | 3300042007 | Bacteria | 2329 |
| 417 | Ga0439449_0035985 | 3300042007 | Bacteria | 1841 |
| 418 | Ga0439450_030404 | 3300042008 | Bacteria | 1212 |
| 419 | Ga0439457_000565 | 3300042014 | Bacteria | 10815 |
| 420 | Ga0450894_000053 | 3300042131 | Bacteria | 17593 |
| 421 | Ga0450896_008117 | 3300042133 | Bacteria | 1453 |
| 422 | Ga0450899_001403 | 3300042135 | Bacteria | 2692 |
| 423 | Ga0450903_000489 | 3300042138 | Bacteria | 8298 |
| 424 | Ga0450906_001299 | 3300042145 | Bacteria | 5483 |
| 425 | Ga0450907_002007 | 3300042146 | Bacteria | 4075 |
| 426 | Ga0439446_0015826 | 3300042156 | Bacteria | 2096 |
| 427 | Ga0439435_0034646 | 3300042436 | Bacteria | 1389 |
| 428 | Ga0466969_0021066 | 3300044656 | Bacteria | 3372 |
| 429 | Ga0466972_0031810 | 3300044658 | Bacteria | 2593 |
| 430 | Ga0466965_0008209 | 3300044683 | Bacteria | 4823 |
| 431 | Ga0466965_0024809 | 3300044683 | Bacteria | 2901 |
| 432 | Ga0466966_0012046 | 3300044684 | Bacteria | 5731 |
| 433 | Ga0466966_0072900 | 3300044684 | Bacteria | 2149 |
| 434 | Ga0466961_0003374 | 3300044693 | Bacteria | 9971 |
| 435 | Ga0466961_0016795 | 3300044693 | Bacteria | 4705 |
| 436 | Ga0466961_0021305 | 3300044693 | Bacteria | 4172 |
| 437 | Ga0466961_0080966 | 3300044693 | Bacteria | 2055 |
| 438 | Ga0466963_0005036 | 3300044694 | Bacteria | 7719 |
| 439 | Ga0466963_0009925 | 3300044694 | Bacteria | 5750 |
| 440 | Ga0466963_0019787 | 3300044694 | Bacteria | 4228 |
| 441 | Ga0466963_0201406 | 3300044694 | Bacteria | 1392 |
| 442 | Ga0466964_0006222 | 3300044706 | Bacteria | 4449 |
| 443 | Ga0466971_0000404 | 3300044719 | Bacteria | 16780 |
| 444 | Ga0466971_0004275 | 3300044719 | Bacteria | 6158 |
| 445 | Ga0466971_0031388 | 3300044719 | Bacteria | 2379 |
| 446 | Ga0466971_0031391 | 3300044719 | Bacteria | 2379 |
| 447 | Ga0466971_0218846 | 3300044719 | Bacteria | 902 |
| 448 | Ga0466968_0011702 | 3300044735 | Bacteria | 3423 |
| 449 | Ga0466970_0012682 | 3300044765 | Bacteria | 4311 |
| 450 | Ga0466957_0022441 | 3300044842 | Bacteria | 3724 |
| 451 | Ga0466957_0033822 | 3300044842 | Bacteria | 3067 |
| 452 | Ga0466957_0053642 | 3300044842 | Bacteria | 2458 |
| 453 | Ga0466957_0055087 | 3300044842 | Bacteria | 2429 |
| 454 | Ga0466957_0120811 | 3300044842 | Bacteria | 1670 |
| 455 | Ga0466960_0007211 | 3300044901 | Bacteria | 4501 |
| 456 | Ga0466960_0035797 | 3300044901 | Bacteria | 2322 |
| 457 | Ga0466959_0036600 | 3300045049 | Bacteria | 3626 |
| 458 | Ga0466959_0037801 | 3300045049 | Bacteria | 3567 |
| 459 | Ga0466959_0121221 | 3300045049 | Bacteria | 1859 |
| 460 | Ga0466959_0147111 | 3300045049 | Bacteria | 1662 |
| 461 | Ga0466959_0281960 | 3300045049 | Bacteria | 1140 |
| 462 | Ga0451576_0309046 | 3300045051 | Bacteria | 1654 |
| 463 | Ga0466958_0007605 | 3300045836 | Bacteria | 5968 |
| 464 | Ga0466958_0042249 | 3300045836 | Bacteria | 2745 |
| 465 | Ga0466958_0067078 | 3300045836 | Bacteria | 2191 |
| 466 | Ga0466958_0071063 | 3300045836 | Bacteria | 2131 |
| 467 | Ga0466967_0046897 | 3300045976 | Bacteria | 3765 |
| 468 | Ga0466967_0075941 | 3300045976 | Bacteria | 3021 |
| 469 | Ga0466967_0208609 | 3300045976 | Bacteria | 1852 |
| 470 | Ga0466967_0286573 | 3300045976 | Bacteria | 1581 |
| 471 | Ga0466967_0401117 | 3300045976 | Bacteria | 1334 |
| 472 | Ga0495603_0005814 | 3300046455 | Bacteria | 7378 |
| 473 | Ga0495603_0008145 | 3300046455 | Bacteria | 6333 |
| 474 | Ga0495590_0106535 | 3300046457 | Bacteria | 998 |
| 475 | Ga0495641_0080810 | 3300046461 | Bacteria | 1456 |
| 476 | Ga0495580_0101618 | 3300046472 | Bacteria | 1999 |
| 477 | Ga0495605_0026071 | 3300046474 | Bacteria | 3040 |
| 478 | Ga0495594_0011850 | 3300046499 | Bacteria | 4536 |
| 479 | Ga0495594_0042463 | 3300046499 | Bacteria | 2490 |
| 480 | Ga0495594_0078419 | 3300046499 | Bacteria | 1843 |
| 481 | Ga0495583_0031093 | 3300046506 | Bacteria | 2592 |
| 482 | Ga0495606_0018653 | 3300046507 | Bacteria | 5193 |
| 483 | Ga0495608_0066915 | 3300046511 | Bacteria | 2351 |
| 484 | Ga0495610_0016941 | 3300046512 | Bacteria | 4173 |
| 485 | Ga0495610_0146392 | 3300046512 | Bacteria | 1012 |
| 486 | Ga0495616_0023993 | 3300046513 | Bacteria | 3276 |
| 487 | Ga0495618_0009955 | 3300046514 | Bacteria | 5750 |
| 488 | Ga0495618_0057465 | 3300046514 | Bacteria | 2463 |
| 489 | Ga0495620_0014341 | 3300046515 | Bacteria | 4030 |
| 490 | Ga0495620_0059562 | 3300046515 | Bacteria | 1595 |
| 491 | Ga0495628_0016920 | 3300046516 | Bacteria | 6077 |
| 492 | Ga0495628_0057356 | 3300046516 | Bacteria | 3063 |
| 493 | Ga0495628_0130257 | 3300046516 | Bacteria | 1924 |
| 494 | Ga0495637_0033553 | 3300046520 | Bacteria | 2253 |
| 495 | Ga0495643_0079397 | 3300046522 | Bacteria | 1710 |
| 496 | Ga0495648_0033636 | 3300046524 | Bacteria | 3345 |
| 497 | Ga0495652_0034046 | 3300046529 | Bacteria | 4442 |
| 498 | Ga0495652_0233631 | 3300046529 | Bacteria | 1373 |
| 499 | Ga0495654_0018579 | 3300046530 | Bacteria | 3641 |
| 500 | Ga0495640_0015572 | 3300046533 | Bacteria | 5718 |
| 501 | Ga0495640_0033441 | 3300046533 | Bacteria | 3651 |
| 502 | Ga0495645_0197569 | 3300046543 | Bacteria | 1366 |
| 503 | Ga0495633_0014210 | 3300046558 | Bacteria | 4170 |
| 504 | Ga0495667_0128572 | 3300046559 | Bacteria | 1634 |
| 505 | Ga0495667_0128884 | 3300046559 | Bacteria | 1632 |
| 506 | Ga0495656_0181864 | 3300046615 | Bacteria | 1034 |
| 507 | Ga0495634_0063649 | 3300046642 | Bacteria | 2447 |
| 508 | Ga0495634_0072265 | 3300046642 | Bacteria | 2269 |
| 509 | Ga0495625_0048468 | 3300046660 | Bacteria | 3058 |
| 510 | Ga0495635_0003194 | 3300046663 | Bacteria | 11297 |
| 511 | Ga0495661_0050122 | 3300046665 | Bacteria | 2529 |
| 512 | Ga0495657_0032151 | 3300046675 | Bacteria | 3664 |
| 513 | Ga0495657_0082740 | 3300046675 | Bacteria | 2073 |
| 514 | Ga0495623_0137890 | 3300046679 | Bacteria | 1454 |
| 515 | Ga0495658_0099713 | 3300046683 | Bacteria | 1732 |
| 516 | Ga0495613_0022324 | 3300046689 | Bacteria | 4716 |
| 517 | Ga0495649_0003017 | 3300046694 | Bacteria | 11552 |
| 518 | Ga0495649_0177194 | 3300046694 | Bacteria | 1113 |
| 519 | Ga0495589_0021998 | 3300046794 | Bacteria | 3257 |
| 520 | Ga0495600_0043084 | 3300046809 | Bacteria | 2942 |
| 521 | Ga0495600_0110571 | 3300046809 | Bacteria | 1789 |
| 522 | Ga0495660_0077902 | 3300046810 | Bacteria | 1743 |
| 523 | Ga0495660_0123269 | 3300046810 | Bacteria | 1308 |
| 524 | Ga0495581_0056352 | 3300047315 | Bacteria | 2268 |
| 525 | Ga0495581_0122532 | 3300047315 | Bacteria | 1513 |
| 526 | Ga0495604_0044817 | 3300047317 | Bacteria | 3453 |
| 527 | Ga0495636_0021952 | 3300047318 | Bacteria | 2579 |
| 528 | Ga0495636_0034409 | 3300047318 | Bacteria | 2085 |
| 529 | Ga0495636_0047369 | 3300047318 | Bacteria | 1795 |
| 530 | Ga0495674_0062035 | 3300047319 | Bacteria | 3256 |
| 531 | Ga0495674_0196585 | 3300047319 | Bacteria | 1675 |
| 532 | Ga0495676_0021113 | 3300047321 | Bacteria | 5698 |
| 533 | Ga0495676_0028112 | 3300047321 | Bacteria | 4810 |
| 534 | Ga0495680_0004298 | 3300047322 | Bacteria | 13666 |
| 535 | Ga0495687_006388 | 3300047443 | Bacteria | 7236 |
| 536 | Ga0495687_031996 | 3300047443 | Bacteria | 2407 |
| 537 | Ga0495687_042063 | 3300047443 | Bacteria | 1999 |
| 538 | Ga0495675_0000649 | 3300047444 | Bacteria | 22067 |
| 539 | Ga0495675_0250439 | 3300047444 | Bacteria | 1064 |
| 540 | Ga0495685_005860 | 3300047447 | Bacteria | 4013 |
| 541 | Ga0495685_017836 | 3300047447 | Bacteria | 2432 |
| 542 | Ga0495686_0140821 | 3300047472 | Bacteria | 1423 |
| 543 | Ga0495614_0084056 | 3300048089 | Bacteria | 1380 |
| 544 | Ga0495626_0014010 | 3300048091 | Bacteria | 4149 |
| 545 | Ga0496100_0033536 | 3300048903 | Bacteria | 3213 |
| 546 | Ga0496100_0223944 | 3300048903 | Bacteria | 1381 |
| 547 | Ga0496100_0277176 | 3300048903 | Bacteria | 1249 |
| 548 | Ga0496100_0369584 | 3300048903 | Bacteria | 1087 |
| 549 | Ga0496101_0147921 | 3300048904 | Bacteria | 1795 |
| 550 | Ga0496101_0150798 | 3300048904 | Bacteria | 1778 |
| 551 | Ga0496101_0295023 | 3300048904 | Bacteria | 1269 |
| 552 | Ga0496101_0463067 | 3300048904 | Bacteria | 1000 |
| 553 | Ga0496102_0032556 | 3300048905 | Bacteria | 4683 |
| 554 | Ga0496102_0044963 | 3300048905 | Bacteria | 4007 |
| 555 | Ga0496102_0078824 | 3300048905 | Bacteria | 3033 |
| 556 | Ga0496102_0249098 | 3300048905 | Bacteria | 1675 |
| 557 | Ga0496102_0581166 | 3300048905 | Bacteria | 1043 |
| 558 | Ga0496103_0013549 | 3300048906 | Bacteria | 4835 |
| 559 | Ga0496103_0014670 | 3300048906 | Bacteria | 4656 |
| 560 | Ga0496104_0007088 | 3300048907 | Bacteria | 9886 |
| 561 | Ga0496104_0019956 | 3300048907 | Bacteria | 6137 |
| 562 | Ga0496104_0030064 | 3300048907 | Bacteria | 5045 |
| 563 | Ga0496104_0043700 | 3300048907 | Bacteria | 4208 |
| 564 | Ga0496104_0052870 | 3300048907 | Bacteria | 3836 |
| 565 | Ga0496104_0158497 | 3300048907 | Bacteria | 2172 |
| 566 | Ga0496104_0164946 | 3300048907 | Bacteria | 2124 |
| 567 | Ga0496104_0171236 | 3300048907 | Bacteria | 2082 |
| 568 | Ga0496104_0184555 | 3300048907 | Bacteria | 1997 |
| 569 | Ga0496104_0427273 | 3300048907 | Bacteria | 1237 |
| 570 | Ga0496105_0014328 | 3300048908 | Bacteria | 6310 |
| 571 | Ga0496105_0034236 | 3300048908 | Bacteria | 4177 |
| 572 | Ga0496105_0198669 | 3300048908 | Bacteria | 1637 |
| 573 | Ga0496105_0214917 | 3300048908 | Bacteria | 1566 |
| 574 | Ga0496105_0409080 | 3300048908 | Bacteria | 1076 |
| 575 | Ga0496106_0028616 | 3300048909 | Bacteria | 4151 |
| 576 | Ga0496106_0071074 | 3300048909 | Bacteria | 2659 |
| 577 | Ga0496106_0083855 | 3300048909 | Bacteria | 2451 |
| 578 | Ga0496106_0196409 | 3300048909 | Bacteria | 1605 |
| 579 | Ga0496106_0244803 | 3300048909 | Bacteria | 1433 |
| 580 | Ga0496107_0007139 | 3300048910 | Bacteria | 7697 |
| 581 | Ga0496108_0055779 | 3300048911 | Bacteria | 3318 |
| 582 | Ga0496108_0060876 | 3300048911 | Bacteria | 3176 |
| 583 | Ga0496108_0113253 | 3300048911 | Bacteria | 2321 |
| 584 | Ga0496108_0113419 | 3300048911 | Bacteria | 2320 |
| 585 | Ga0496108_0114649 | 3300048911 | Bacteria | 2307 |
| 586 | Ga0496108_0140069 | 3300048911 | Bacteria | 2084 |
| 587 | Ga0496108_0163447 | 3300048911 | Bacteria | 1925 |
| 588 | Ga0496108_0348926 | 3300048911 | Bacteria | 1291 |
| 589 | Ga0496109_0058834 | 3300048912 | Bacteria | 3511 |
| 590 | Ga0496109_0065255 | 3300048912 | Bacteria | 3333 |
| 591 | Ga0496109_0079220 | 3300048912 | Bacteria | 3026 |
| 592 | Ga0496109_0103582 | 3300048912 | Bacteria | 2641 |
| 593 | Ga0496109_0119076 | 3300048912 | Bacteria | 2458 |
| 594 | Ga0496109_0134886 | 3300048912 | Bacteria | 2306 |
| 595 | Ga0496109_0160686 | 3300048912 | Bacteria | 2105 |
| 596 | Ga0496109_0308344 | 3300048912 | Bacteria | 1493 |
| 597 | Ga0496110_0018589 | 3300048913 | Bacteria | 5830 |
| 598 | Ga0496110_0049279 | 3300048913 | Bacteria | 3694 |
| 599 | Ga0496110_0070997 | 3300048913 | Bacteria | 3086 |
| 600 | Ga0496110_0179932 | 3300048913 | Bacteria | 1920 |
| 601 | Ga0496110_0323475 | 3300048913 | Bacteria | 1405 |
| 602 | Ga0496111_0014234 | 3300048914 | Bacteria | 5429 |
| 603 | Ga0496111_0020997 | 3300048914 | Bacteria | 4553 |
| 604 | Ga0496111_0051617 | 3300048914 | Bacteria | 2968 |
| 605 | Ga0496111_0118034 | 3300048914 | Bacteria | 1958 |
| 606 | Ga0496111_0141060 | 3300048914 | Bacteria | 1785 |
| 607 | Ga0496111_0221657 | 3300048914 | Bacteria | 1405 |
| 608 | Ga0496111_0225113 | 3300048914 | Bacteria | 1393 |
| 609 | Ga0496112_0000075 | 3300048915 | Bacteria | 65390 |
| 610 | Ga0496112_0008373 | 3300048915 | Bacteria | 9262 |
| 611 | Ga0496112_0033410 | 3300048915 | Bacteria | 5001 |
| 612 | Ga0496112_0058218 | 3300048915 | Bacteria | 3805 |
| 613 | Ga0496112_0075037 | 3300048915 | Bacteria | 3344 |
| 614 | Ga0496112_0078179 | 3300048915 | Bacteria | 3272 |
| 615 | Ga0496112_0120163 | 3300048915 | Bacteria | 2597 |
| 616 | Ga0496112_0168549 | 3300048915 | Bacteria | 2155 |
| 617 | Ga0496112_0587560 | 3300048915 | Bacteria | 1046 |
| 618 | Ga0496113_0024570 | 3300048916 | Bacteria | 4284 |
| 619 | Ga0496113_0038151 | 3300048916 | Bacteria | 3531 |
| 620 | Ga0496113_0045280 | 3300048916 | Bacteria | 3262 |
| 621 | Ga0496113_0062406 | 3300048916 | Bacteria | 2814 |
| 622 | Ga0496113_0081864 | 3300048916 | Bacteria | 2475 |
| 623 | Ga0496113_0119621 | 3300048916 | Bacteria | 2058 |
| 624 | Ga0496113_0163996 | 3300048916 | Bacteria | 1758 |
| 625 | Ga0496113_0196748 | 3300048916 | Bacteria | 1601 |
| 626 | Ga0496114_0004631 | 3300048917 | Bacteria | 10687 |
| 627 | Ga0496114_0014886 | 3300048917 | Bacteria | 6251 |
| 628 | Ga0496114_0051019 | 3300048917 | Bacteria | 3444 |
| 629 | Ga0496114_0079316 | 3300048917 | Bacteria | 2771 |
| 630 | Ga0496114_0457063 | 3300048917 | Bacteria | 1130 |
| 631 | Ga0496114_0581407 | 3300048917 | Bacteria | 988 |
| 632 | Ga0496115_0099377 | 3300048918 | Bacteria | 2384 |
| 633 | Ga0496115_0215575 | 3300048918 | Bacteria | 1585 |
| 634 | Ga0496126_0006685 | 3300048929 | Bacteria | 12814 |
| 635 | Ga0496126_0015703 | 3300048929 | Bacteria | 7609 |
| 636 | Ga0496126_0058059 | 3300048929 | Bacteria | 3489 |
| 637 | Ga0495682_0021937 | 3300049460 | Bacteria | 2391 |
| 638 | Ga0501318_004964 | 3300049534 | Bacteria | 1300 |
| 639 | Ga0501031_0041859 | 3300049568 | Bacteria | 2991 |
| 640 | Ga0501031_0062020 | 3300049568 | Bacteria | 2436 |
| 641 | Ga0501033_0001291 | 3300049570 | Bacteria | 22291 |
| 642 | Ga0501033_0002560 | 3300049570 | Bacteria | 15356 |
| 643 | Ga0501033_0039647 | 3300049570 | Bacteria | 3518 |
| 644 | Ga0501033_0056386 | 3300049570 | Bacteria | 2904 |
| 645 | Ga0501033_0194542 | 3300049570 | Bacteria | 1450 |
| 646 | Ga0501033_0227249 | 3300049570 | Bacteria | 1327 |
| 647 | Ga0501034_0553819 | 3300049571 | Bacteria | 1059 |
| 648 | Ga0501036_0087436 | 3300049572 | Bacteria | 2634 |
| 649 | Ga0501036_0091666 | 3300049572 | Bacteria | 2567 |
| 650 | Ga0501036_0141514 | 3300049572 | Bacteria | 2030 |
| 651 | Ga0501037_0005388 | 3300049573 | Bacteria | 9313 |
| 652 | Ga0501037_0083006 | 3300049573 | Bacteria | 2321 |
| 653 | Ga0501038_0003048 | 3300049574 | Bacteria | 15622 |
| 654 | Ga0501038_0003106 | 3300049574 | Bacteria | 15492 |
| 655 | Ga0501038_0004443 | 3300049574 | Bacteria | 13032 |
| 656 | Ga0501038_0083857 | 3300049574 | Bacteria | 2682 |
| 657 | Ga0501038_0127586 | 3300049574 | Bacteria | 2092 |
| 658 | Ga0501038_0289838 | 3300049574 | Bacteria | 1287 |
| 659 | Ga0501039_0093355 | 3300049575 | Bacteria | 2345 |
| 660 | Ga0501039_0149340 | 3300049575 | Bacteria | 1836 |
| 661 | Ga0501040_0141230 | 3300049576 | Bacteria | 1697 |
| 662 | Ga0501040_0299451 | 3300049576 | Bacteria | 1150 |
| 663 | Ga0501041_0250978 | 3300049577 | Bacteria | 1112 |
| 664 | Ga0501042_0096538 | 3300049578 | Bacteria | 2123 |
| 665 | Ga0501042_0138828 | 3300049578 | Bacteria | 1752 |
| 666 | Ga0501042_0155814 | 3300049578 | Bacteria | 1648 |
| 667 | Ga0501043_0007412 | 3300049579 | Bacteria | 8705 |
| 668 | Ga0501043_0199711 | 3300049579 | Bacteria | 1552 |
| 669 | Ga0501046_0014709 | 3300049580 | Bacteria | 6589 |
| 670 | Ga0501046_0034395 | 3300049580 | Bacteria | 4090 |
| 671 | Ga0501046_0121103 | 3300049580 | Bacteria | 1990 |
| 672 | Ga0501047_0000005 | 3300049581 | Bacteria | 456524 |
| 673 | Ga0501047_0003094 | 3300049581 | Bacteria | 15789 |
| 674 | Ga0501047_0030085 | 3300049581 | Bacteria | 5235 |
| 675 | Ga0501047_0083382 | 3300049581 | Bacteria | 3072 |
| 676 | Ga0501047_0094101 | 3300049581 | Bacteria | 2875 |
| 677 | Ga0501047_0111239 | 3300049581 | Bacteria | 2622 |
| 678 | Ga0501047_0127199 | 3300049581 | Bacteria | 2428 |
| 679 | Ga0501047_0140621 | 3300049581 | Bacteria | 2292 |
| 680 | Ga0501047_0229804 | 3300049581 | Bacteria | 1709 |
| 681 | Ga0501048_0007309 | 3300049582 | Bacteria | 8372 |
| 682 | Ga0501067_0004493 | 3300049583 | Bacteria | 7694 |
| 683 | Ga0501067_0026010 | 3300049583 | Bacteria | 3243 |
| 684 | Ga0501068_0037962 | 3300049584 | Bacteria | 2884 |
| 685 | Ga0501068_0073469 | 3300049584 | Bacteria | 2089 |
| 686 | Ga0501068_0077790 | 3300049584 | Bacteria | 2032 |
| 687 | Ga0501068_0085592 | 3300049584 | Bacteria | 1940 |
| 688 | Ga0501068_0180787 | 3300049584 | Bacteria | 1333 |
| 689 | Ga0501069_0023163 | 3300049585 | Bacteria | 3384 |
| 690 | Ga0501069_0244199 | 3300049585 | Bacteria | 1047 |
| 691 | Ga0501070_0391881 | 3300049586 | Bacteria | 1124 |
| 692 | Ga0501072_0027141 | 3300049588 | Bacteria | 4468 |
| 693 | Ga0501073_0027215 | 3300049589 | Bacteria | 4092 |
| 694 | Ga0501074_0002170 | 3300049590 | Bacteria | 13599 |
| 695 | Ga0501074_0055498 | 3300049590 | Bacteria | 2855 |
| 696 | Ga0501074_0126830 | 3300049590 | Bacteria | 1826 |
| 697 | Ga0501075_0018269 | 3300049591 | Bacteria | 5073 |
| 698 | Ga0501075_0201415 | 3300049591 | Bacteria | 1518 |
| 699 | Ga0501075_0205479 | 3300049591 | Bacteria | 1502 |
| 700 | Ga0501076_0075425 | 3300049592 | Bacteria | 2703 |
| 701 | Ga0501076_0164426 | 3300049592 | Bacteria | 1809 |
| 702 | Ga0501076_0214071 | 3300049592 | Bacteria | 1575 |
| 703 | Ga0501076_0285630 | 3300049592 | Bacteria | 1352 |
| 704 | Ga0501076_0358835 | 3300049592 | Bacteria | 1197 |
| 705 | Ga0501077_0046472 | 3300049593 | Bacteria | 2758 |
| 706 | Ga0501077_0051486 | 3300049593 | Bacteria | 2617 |
| 707 | Ga0501077_0079184 | 3300049593 | Bacteria | 2082 |
| 708 | Ga0501079_0076032 | 3300049741 | Bacteria | 2597 |
| 709 | Ga0501079_0363860 | 3300049741 | Bacteria | 1134 |
| 710 | Ga0501080_0350105 | 3300049742 | Bacteria | 1334 |
| 711 | Ga0501081_0180463 | 3300049743 | Bacteria | 1527 |
| 712 | Ga0501083_0116602 | 3300049744 | Bacteria | 1753 |
| 713 | Ga0501035_0004383 | 3300049822 | Bacteria | 13400 |
| 714 | Ga0501035_0032380 | 3300049822 | Bacteria | 4756 |
| 715 | Ga0501035_0054230 | 3300049822 | Bacteria | 3583 |
| 716 | Ga0501044_0004786 | 3300049823 | Bacteria | 15144 |
| 717 | Ga0501044_0070542 | 3300049823 | Bacteria | 3554 |
| 718 | Ga0501044_0077035 | 3300049823 | Bacteria | 3382 |
| 719 | Ga0501044_0107851 | 3300049823 | Bacteria | 2795 |
| 720 | Ga0501044_0113200 | 3300049823 | Bacteria | 2720 |
| 721 | Ga0501044_0228505 | 3300049823 | Bacteria | 1809 |
| 722 | Ga0501044_0532473 | 3300049823 | Bacteria | 1073 |
| 723 | Ga0501045_0049156 | 3300049824 | Bacteria | 3075 |
| 724 | Ga0501045_0115914 | 3300049824 | Bacteria | 1987 |
| 725 | Ga0501045_0247273 | 3300049824 | Bacteria | 1328 |
| 726 | nmdc:mga03683_92328_c1 | 3300050489 | Bacteria | 1321 |
| 727 | nmdc:mga00v17_4189_c1 | 3300050491 | Bacteria | 7482 |
| 728 | nmdc:mga0yw44_231461_c1 | 3300050492 | Bacteria | 1227 |
| 729 | nmdc:mga0yw44_262860_c1 | 3300050492 | Bacteria | 1150 |
| 730 | nmdc:mga06z11_52138_c1 | 3300050494 | Bacteria | 2098 |
| 731 | nmdc:mga06z11_560_c1 | 3300050494 | Bacteria | 13606 |
| 732 | nmdc:mga06z11_86771_c1 | 3300050494 | Bacteria | 1691 |
| 733 | nmdc:mga07m45_112576_c1 | 3300050496 | Bacteria | 1568 |
| 734 | nmdc:mga07m45_2260_c1 | 3300050496 | Bacteria | 8998 |
| 735 | nmdc:mga05p37_12604_c1 | 3300050507 | Bacteria | 10096 |
| 736 | nmdc:mga05p37_600_c1 | 3300050507 | Bacteria | 39739 |
| 737 | nmdc:mga09592_1919_c1 | 3300050508 | Bacteria | 16710 |
| 738 | nmdc:mga09592_46336_c1 | 3300050508 | Bacteria | 3663 |
| 739 | nmdc:mga0qj67_16412_c1 | 3300050509 | Bacteria | 5616 |
| 740 | nmdc:mga06r32_288_c1 | 3300050510 | Bacteria | 41844 |
| 741 | nmdc:mga06r32_449213_c1 | 3300050510 | Bacteria | 1269 |
| 742 | nmdc:mga06r32_4639_c1 | 3300050510 | Bacteria | 12328 |
| 743 | nmdc:mga08y16_19267_c1 | 3300050511 | Bacteria | 7190 |
| 744 | nmdc:mga08y16_347340_c1 | 3300050511 | Bacteria | 1524 |
| 745 | nmdc:mga0n895_231105_c1 | 3300050512 | Bacteria | 1877 |
| 746 | nmdc:mga0n895_332272_c1 | 3300050512 | Bacteria | 1540 |
| 747 | nmdc:mga0rr50_76862_c1 | 3300050513 | Bacteria | 2564 |
| 748 | nmdc:mga0a205_189986_c1 | 3300050515 | Bacteria | 1946 |
| 749 | nmdc:mga0a205_27527_c1 | 3300050515 | Bacteria | 5428 |
| 750 | nmdc:mga0a205_32809_c1 | 3300050515 | Bacteria | 4978 |
| 751 | nmdc:mga0a205_44881_c1 | 3300050515 | Bacteria | 4262 |
| 752 | Ga0495601_0007889 | 3300053077 | Bacteria | 6270 |
| 753 | Ga0495601_0026064 | 3300053077 | Bacteria | 3607 |
| 754 | Ga0495612_0000297 | 3300053078 | Bacteria | 20179 |
| 755 | Ga0495612_0030672 | 3300053078 | Unclassified | 2166 |
| 756 | Ga0500610_0091615 | 3300053079 | Bacteria | 1579 |
| 757 | Ga0495595_0028906 | 3300053084 | Bacteria | 2477 |
| 758 | Ga0495619_0019837 | 3300053085 | Bacteria | 4278 |
| 759 | Ga0495619_0053330 | 3300053085 | Bacteria | 2675 |
| 760 | Ga0500644_0000495 | 3300053088 | Bacteria | 17150 |
| 761 | Ga0500644_0027398 | 3300053088 | Bacteria | 1773 |
| 762 | Ga0500583_0114065 | 3300053092 | Bacteria | 1333 |
| 763 | Ga0500600_0154629 | 3300053149 | Bacteria | 1136 |
| 764 | Ga0501084_0052232 | 3300054114 | Bacteria | 3420 |
| 765 | Ga0501084_0092070 | 3300054114 | Bacteria | 2546 |
| 766 | Ga0501084_0196410 | 3300054114 | Bacteria | 1702 |
| 767 | Ga0501084_0217760 | 3300054114 | Bacteria | 1611 |
| 768 | Ga0590071_005637 | 3300059421 | Bacteria | 3007 |
| 769 | Ga0590075_005423 | 3300059424 | Bacteria | 3012 |
| 770 | Ga0590077_009602 | 3300059426 | Bacteria | 1987 |
| 771 | Ga0501082_0197932 | 3300060353 | Bacteria | 1748 |
| 772 | Ga0501082_0297742 | 3300060353 | Bacteria | 1405 |
| 773 | Ga0501082_0553342 | 3300060353 | Bacteria | 1006 |
| 774 | Ga0466962_0001014 | 3300061719 | Bacteria | 12829 |
| 775 | Ga0466962_0011061 | 3300061719 | Bacteria | 4345 |
| 776 | Ga0466962_0018185 | 3300061719 | Bacteria | 3381 |
| 777 | Ga0466962_0202434 | 3300061719 | Bacteria | 970 |
| 778 | Ga0530510_0007663 | 3300061734 | Bacteria | 7519 |
| 779 | Ga0530510_0120311 | 3300061734 | Bacteria | 1927 |
| 780 | Ga0530510_0169388 | 3300061734 | Bacteria | 1617 |
| 781 | Ga0530510_0219173 | 3300061734 | Bacteria | 1414 |
| 782 | 2547411876 | 2547132111 | Bacteria | 8013147 |
| 783 | 2554256594 | 2554235005 | Bacteria | 6457341 |
| 784 | 2585306110 | 2582581313 | Bacteria | 10042643 |
| 785 | 2616696500 | 2616644814 | Bacteria | 11555299 |
| 786 | 2644261327 | 2643221647 | Bacteria | 10741251 |
| 787 | 2644439572 | 2643221678 | Bacteria | 9540101 |
| 788 | 2644611235 | 2643221711 | Bacteria | 4865335 |
| 789 | 2644633080 | 2643221714 | Bacteria | 9015452 |
| 790 | 2676492279 | 2675903060 | Bacteria | 10051191 |
| 791 | 2768643712 | 2767802112 | Bacteria | 6465194 |
| 792 | 2785341641 | 2784746763 | Bacteria | 9783172 |
| 793 | 2785371036 | 2784746768 | Bacteria | 10036182 |
| 794 | 2786672234 | 2786546132 | Bacteria | 10419719 |
| 795 | 2804845248 | 2802429296 | Bacteria | 7227771 |
| 796 | 2808843582 | 2808606359 | Bacteria | 9866990 |
| 797 | 2808913143 | 2808606375 | Bacteria | 9466072 |
| 798 | 2809233635 | 2808606448 | Bacteria | 8656184 |
| 799 | 2812375650 | 2811994882 | Bacteria | 4688362 |
| 800 | 2812479205 | 2811994917 | Bacteria | 7761064 |
| 801 | 2819424517 | 2818991318 | Bacteria | 5266538 |
| 802 | 2819668089 | 2818991458 | Bacteria | 4794049 |
| 803 | 2819691958 | 2818991462 | Bacteria | 4320267 |
| 804 | 2819729701 | 2818991469 | Bacteria | 4644110 |
| 805 | 2862287248 | 2862281513 | Bacteria | 9621493 |
| 806 | 2862294763 | 2862290372 | Bacteria | 7471434 |
| 807 | 2862390844 | 2862382967 | Bacteria | 10317375 |
| 808 | 2862710434 | 2862705112 | Bacteria | 6563286 |
| 809 | 2863411325 | 2863404153 | Bacteria | 9672205 |
| 810 | 2867435113 | 2867428634 | Bacteria | 9590268 |
| 811 | 2868092750 | 2868088558 | Bacteria | 7609351 |
| 812 | 2877679543 | 2877676314 | Bacteria | 9512378 |
| 813 | 2918506027 | 2918501144 | Bacteria | 8668083 |
| 814 | 2919470454 | 2919468124 | Bacteria | 9133025 |
| 815 | 2946048363 | 2946045630 | Bacteria | 8527308 |
| 816 | 2946077314 | 2946072368 | Bacteria | 8999607 |
| 817 | 2954384442 | 2954380949 | Bacteria | 10050426 |
| 818 | 2954678510 | 2954673503 | Bacteria | 9685905 |
| 819 | 2954685645 | 2954682443 | Bacteria | 9862841 |
| 820 | 2954695304 | 2954691527 | Bacteria | 10720516 |
| 821 | 2954710495 | 2954701450 | Bacteria | 10834262 |
| 822 | 2954714741 | 2954711539 | Bacteria | 10867210 |
| 823 | 2954724686 | 2954721474 | Bacteria | 10456478 |
| 824 | 2954737131 | 2954731030 | Bacteria | 10243860 |
| 825 | 2954743610 | 2954740390 | Bacteria | 10229294 |
| 826 | 2954755984 | 2954749733 | Bacteria | 10366972 |
| 827 | 2954762562 | 2954759201 | Bacteria | 9358192 |
| 828 | 2990044988 | 2990044586 | Bacteria | 6603797 |
| 829 | 2997600569 | 2997600082 | Bacteria | 9896405 |
| 830 | 3006324143 | 3006321560 | Bacteria | 8247479 |
| 831 | 3006499038 | 3006493962 | Bacteria | 8825450 |
| 832 | 8001782414 | 8001781756 | Bacteria | 9586736 |
| 833 | 8008491413 | 8008485437 | Bacteria | 7198341 |
| 834 | 8008566793 | 8008558824 | Bacteria | 10610750 |
| 835 | 8023625622 | 8023623736 | Bacteria | 8593882 |
| 836 | 8025415464 | 8025413630 | Bacteria | 7014048 |
| 837 | 8025530743 | 8025524527 | Bacteria | 7197316 |
| 838 | 8025532418 | 8025530807 | Bacteria | 8495698 |
| 839 | 8033691186 | 8033684223 | Bacteria | 6906479 |
| 840 | 8048406907 | 8048406513 | Bacteria | 8936924 |
| 841 | 8056670523 | 8056667051 | Bacteria | 6953971 |
| 842 | Ga0207661_10126540 | |||
| 843 | LJQas_1008776 | |||
| 844 | rootL2_10065946 | |||
| 845 | rootL2_10216345 | |||
| 846 | rootH1_10000873 | |||
| 847 | JGI25160J50197_1005091 | |||
| 848 | JGI25160J50197_1018265 | |||
| 849 | Ga0006562J51391_1130078 | |||
| 850 | Ga0006562J51391_1130079 | |||
| 851 | Ga0070658_10001223 | |||
| 852 | Ga0070658_10004318 | |||
| 853 | Ga0070658_10006650 | |||
| 854 | Ga0070658_10033497 | |||
| 855 | Ga0070683_100023938 | |||
| 856 | Ga0070683_100090637 | |||
| 857 | Ga0070683_100159764 | |||
| 858 | Ga0070683_100200548 | |||
| 859 | Ga0070690_100052304 | |||
| 860 | Ga0068869_100020772 | |||
| 861 | Ga0070680_100000001 | |||
| 862 | Ga0070680_100060843 | |||
| 863 | Ga0070680_100281138 | |||
| 864 | Ga0070680_100376407 | |||
| 865 | Ga0070682_100058084 | |||
| 866 | Ga0070682_100128678 | |||
| 867 | Ga0070682_100210140 | |||
| 868 | Ga0070682_100287621 | |||
| 869 | Ga0070660_100089079 | |||
| 870 | Ga0070689_100004630 | |||
| 871 | Ga0070691_10021982 | |||
| 872 | Ga0070687_100001722 | |||
| 873 | Ga0070687_100013788 | |||
| 874 | Ga0070687_100093103 | |||
| 875 | Ga0070661_100030319 | |||
| 876 | Ga0070692_10030527 | |||
| 877 | Ga0070692_10070095 | |||
| 878 | Ga0070675_100018710 | |||
| 879 | Ga0070671_100113031 | |||
| 880 | Ga0070674_100005758 | |||
| 881 | Ga0070688_100006693 | |||
| 882 | Ga0070659_100007264 | |||
| 883 | Ga0070659_100135111 | |||
| 884 | Ga0070659_100356790 | |||
| 885 | Ga0070703_10000129 | |||
| 886 | Ga0070709_10028642 | |||
| 887 | Ga0070709_10045059 | |||
| 888 | Ga0070714_100000013 | |||
| 889 | Ga0070714_100002811 | |||
| 890 | Ga0070714_100023225 | |||
| 891 | Ga0070714_100352332 | |||
| 892 | Ga0070713_100037570 | |||
| 893 | Ga0070701_10007733 | |||
| 894 | Ga0070705_100006178 | |||
| 895 | Ga0070705_100016636 | |||
| 896 | Ga0070705_100031130 | |||
| 897 | Ga0070705_100079581 | |||
| 898 | Ga0070700_100006665 | |||
| 899 | Ga0070694_100005027 | |||
| 900 | Ga0070694_100234954 | |||
| 901 | Ga0070708_100001218 | |||
| 902 | Ga0070708_100002638 | |||
| 903 | Ga0070708_100225561 | |||
| 904 | Ga0070663_100262994 | |||
| 905 | Ga0070663_100353253 | |||
| 906 | Ga0070663_100391867 | |||
| 907 | Ga0070678_100183300 | |||
| 908 | Ga0070662_100020576 | |||
| 909 | Ga0070662_100251836 | |||
| 910 | Ga0070681_10137053 | |||
| 911 | Ga0070681_10246028 | |||
| 912 | Ga0068867_100286959 | |||
| 913 | Ga0070685_10077897 | |||
| 914 | Ga0070685_10101147 | |||
| 915 | Ga0070706_100000807 | |||
| 916 | Ga0070706_100010398 | |||
| 917 | Ga0070706_100191776 | |||
| 918 | Ga0070707_100006986 | |||
| 919 | Ga0070707_100010232 | |||
| 920 | Ga0070707_100015743 | |||
| 921 | Ga0070707_100017966 | |||
| 922 | Ga0070707_100090372 | |||
| 923 | Ga0070707_100107716 | |||
| 924 | Ga0070707_100153627 | |||
| 925 | Ga0070707_100174077 | |||
| 926 | Ga0070707_100250296 | |||
| 927 | Ga0070698_100025796 | |||
| 928 | Ga0070698_100057224 | |||
| 929 | Ga0070698_100057863 | |||
| 930 | Ga0070698_100072108 | |||
| 931 | Ga0070699_100003016 | |||
| 932 | Ga0070699_100027295 | |||
| 933 | Ga0070699_100441878 | |||
| 934 | Ga0070679_100238425 | |||
| 935 | Ga0070679_100257349 | |||
| 936 | Ga0070679_100481758 | |||
| 937 | Ga0070684_100022730 | |||
| 938 | Ga0070684_100330671 | |||
| 939 | Ga0070697_100007052 | |||
| 940 | Ga0070697_100053440 | |||
| 941 | Ga0070697_100100386 | |||
| 942 | Ga0070686_100104438 | |||
| 943 | Ga0070686_100163433 | |||
| 944 | Ga0070686_100379371 | |||
| 945 | Ga0070695_100037348 | |||
| 946 | Ga0070695_100255936 | |||
| 947 | Ga0070696_100016636 | |||
| 948 | Ga0070696_100032706 | |||
| 949 | Ga0070696_100054813 | |||
| 950 | Ga0070696_100073792 | |||
| 951 | Ga0070696_100085168 | |||
| 952 | Ga0070696_100139093 | |||
| 953 | Ga0070696_100169816 | |||
| 954 | Ga0070665_100093907 | |||
| 955 | Ga0070704_100008091 | |||
| 956 | Ga0070704_100021796 | |||
| 957 | Ga0070704_100040313 | |||
| 958 | Ga0068855_100011359 | |||
| 959 | Ga0070664_100175336 | |||
| 960 | Ga0068857_100222744 | |||
| 961 | Ga0068856_100165771 | |||
| 962 | Ga0068856_100172273 | |||
| 963 | Ga0068856_100416995 | |||
| 964 | Ga0070702_100015401 | |||
| 965 | Ga0068864_100041198 | |||
| 966 | Ga0068864_100077863 | |||
| 967 | Ga0068864_100080226 | |||
| 968 | Ga0068864_100089740 | |||
| 969 | Ga0068864_100180467 | |||
| 970 | Ga0068866_10026048 | |||
| 971 | Ga0068866_10172172 | |||
| 972 | Ga0068861_100206869 | |||
| 973 | Ga0068863_100000632 | |||
| 974 | Ga0068863_100019372 | |||
| 975 | Ga0068863_100324563 | |||
| 976 | Ga0068858_100045979 | |||
| 977 | Ga0068860_100162043 | |||
| 978 | Ga0068862_100527254 | |||
| 979 | Ga0081455_10000683 | |||
| 980 | Ga0081455_10001095 | |||
| 981 | Ga0081455_10082451 | |||
| 982 | Ga0081539_10020888 | |||
| 983 | Ga0081539_10040803 | |||
| 984 | Ga0075365_10011126 | |||
| 985 | Ga0075365_10051612 | |||
| 986 | Ga0075368_10000633 | |||
| 987 | Ga0075368_10043329 | |||
| 988 | Ga0075363_100001382 | |||
| 989 | Ga0075364_10035588 | |||
| 990 | Ga0075364_10048981 | |||
| 991 | Ga0070716_100036774 | |||
| 992 | Ga0070712_100176077 | |||
| 993 | Ga0075362_10116532 | |||
| 994 | Ga0075367_10000576 | |||
| 995 | Ga0075367_10033026 | |||
| 996 | Ga0075367_10053490 | |||
| 997 | Ga0075370_10001568 | |||
| 998 | Ga0075370_10012320 | |||
| 999 | Ga0075370_10130274 | |||
| 1000 | Ga0075428_100000323 | |||
| 1001 | Ga0075428_100008365 | |||
| 1002 | Ga0075428_100038044 | |||
| 1003 | Ga0075428_100371321 | |||
| 1004 | Ga0075430_100001867 | |||
| 1005 | Ga0075430_100090486 | |||
| 1006 | Ga0075431_100012098 | |||
| 1007 | Ga0075431_100105822 | |||
| 1008 | Ga0075431_100152366 | |||
| 1009 | Ga0075433_10046905 | |||
| 1010 | Ga0075433_10078018 | |||
| 1011 | Ga0075433_10161594 | |||
| 1012 | Ga0075434_100337403 | |||
| 1013 | Ga0075434_100408005 | |||
| 1014 | Ga0075429_100000390 | |||
| 1015 | Ga0075429_100032720 | |||
| 1016 | Ga0075435_100072506 | |||
| 1017 | Ga0105240_10090564 | |||
| 1018 | Ga0105240_10525030 | |||
| 1019 | Ga0111539_10037320 | |||
| 1020 | Ga0111539_10692531 | |||
| 1021 | Ga0105245_10020726 | |||
| 1022 | Ga0105245_10163833 | |||
| 1023 | Ga0105247_10020007 | |||
| 1024 | Ga0105247_10459479 | |||
| 1025 | Ga0114129_10000680 | |||
| 1026 | Ga0114129_10122194 | |||
| 1027 | Ga0114129_10542573 | |||
| 1028 | Ga0105243_10020293 | |||
| 1029 | Ga0105243_10028126 | |||
| 1030 | Ga0105242_10025657 | |||
| 1031 | Ga0105242_10035063 | |||
| 1032 | Ga0105248_10598231 | |||
| 1033 | Ga0105237_10244969 | |||
| 1034 | Ga0105238_10136744 | |||
| 1035 | Ga0105249_10015393 | |||
| 1036 | Ga0105249_10542888 | |||
| 1037 | Ga0105239_10015560 | |||
| 1038 | Ga0105239_10099219 | |||
| 1039 | Ga0105239_10135604 | |||
| 1040 | Ga0105246_10011160 | |||
| 1041 | Ga0157369_10044896 | |||
| 1042 | Ga0157378_10002433 | |||
| 1043 | Ga0157378_10015654 | |||
| 1044 | Ga0157378_10073764 | |||
| 1045 | Ga0157378_10250606 | |||
| 1046 | Ga0163162_10018280 | |||
| 1047 | Ga0157372_10876626 | |||
| 1048 | Ga0157375_10026881 | |||
| 1049 | Ga0157375_10157963 | |||
| 1050 | Ga0163163_10024613 | |||
| 1051 | Ga0163163_10052447 | |||
| 1052 | Ga0163163_10151532 | |||
| 1053 | Ga0163163_10305206 | |||
| 1054 | Ga0157380_10012180 | |||
| 1055 | Ga0182008_10001225 | |||
| 1056 | Ga0157377_10166068 | |||
| 1057 | Ga0157379_10095834 | |||
| 1058 | Ga0157379_10193178 | |||
| 1059 | Ga0157379_10286796 | |||
| 1060 | Ga0157379_10369962 | |||
| 1061 | Ga0157376_10222505 | |||
| 1062 | Ga0182007_10000750 | |||
| 1063 | Ga0206353_10341901 | |||
| 1064 | Ga0206353_10728699 | |||
| 1065 | Ga0206353_11878516 | |||
| 1066 | Ga0224712_10001707 | |||
| 1067 | Ga0224572_1007699 | |||
| 1068 | Ga0224572_1033250 | |||
| 1069 | Ga0207426_1004416 | |||
| 1070 | Ga0207426_1014300 | |||
| 1071 | Ga0207653_10000241 | |||
| 1072 | Ga0207692_10036265 | |||
| 1073 | Ga0207642_10146028 | |||
| 1074 | Ga0207699_10023834 | |||
| 1075 | Ga0207643_10007289 | |||
| 1076 | Ga0207705_10016639 | |||
| 1077 | Ga0207705_10055520 | |||
| 1078 | Ga0207684_10000862 | |||
| 1079 | Ga0207684_10002316 | |||
| 1080 | Ga0207684_10003968 | |||
| 1081 | Ga0207684_10015993 | |||
| 1082 | Ga0207684_10151894 | |||
| 1083 | Ga0207707_10124549 | |||
| 1084 | Ga0207695_10050262 | |||
| 1085 | Ga0207693_10161543 | |||
| 1086 | Ga0207660_10000001 | |||
| 1087 | Ga0207662_10000425 | |||
| 1088 | Ga0207657_10075540 | |||
| 1089 | Ga0207652_10096303 | |||
| 1090 | Ga0207652_10188662 | |||
| 1091 | Ga0207652_10242033 | |||
| 1092 | Ga0207646_10000033 | |||
| 1093 | Ga0207646_10002777 | |||
| 1094 | Ga0207646_10004969 | |||
| 1095 | Ga0207646_10016710 | |||
| 1096 | Ga0207646_10029948 | |||
| 1097 | Ga0207646_10051384 | |||
| 1098 | Ga0207646_10073152 | |||
| 1099 | Ga0207646_10112623 | |||
| 1100 | Ga0207646_10112983 | |||
| 1101 | Ga0207694_10259117 | |||
| 1102 | Ga0207659_10037424 | |||
| 1103 | Ga0207687_10046798 | |||
| 1104 | Ga0207687_10448903 | |||
| 1105 | Ga0207687_10480014 | |||
| 1106 | Ga0207700_10021038 | |||
| 1107 | Ga0207700_10336715 | |||
| 1108 | Ga0207664_10000001 | |||
| 1109 | Ga0207664_10001979 | |||
| 1110 | Ga0207664_10024558 | |||
| 1111 | Ga0207664_10027923 | |||
| 1112 | Ga0207664_10066230 | |||
| 1113 | Ga0207664_10070066 | |||
| 1114 | Ga0207690_10173995 | |||
| 1115 | Ga0207706_10118468 | |||
| 1116 | Ga0207706_10188970 | |||
| 1117 | Ga0207706_10372747 | |||
| 1118 | Ga0207709_10021724 | |||
| 1119 | Ga0207711_10013333 | |||
| 1120 | Ga0207711_10457107 | |||
| 1121 | Ga0207689_10031711 | |||
| 1122 | Ga0207689_10113354 | |||
| 1123 | Ga0207661_10012386 | |||
| 1124 | Ga0207661_10148368 | |||
| 1125 | Ga0207661_10175061 | |||
| 1126 | Ga0207661_10373229 | |||
| 1127 | Ga0207661_10676644 | |||
| 1128 | Ga0207679_10078673 | |||
| 1129 | Ga0207679_10246389 | |||
| 1130 | Ga0207679_10305687 | |||
| 1131 | Ga0207667_10025976 | |||
| 1132 | Ga0207667_10335396 | |||
| 1133 | Ga0207712_10026410 | |||
| 1134 | Ga0207712_10114434 | |||
| 1135 | Ga0207677_10024329 | |||
| 1136 | Ga0207703_10170845 | |||
| 1137 | Ga0207678_10018654 | |||
| 1138 | Ga0207678_10027932 | |||
| 1139 | Ga0207678_10237546 | |||
| 1140 | Ga0207708_10001184 | |||
| 1141 | Ga0207702_10267808 | |||
| 1142 | Ga0207702_10297492 | |||
| 1143 | Ga0207702_10361451 | |||
| 1144 | Ga0207641_10038082 | |||
| 1145 | Ga0207641_10122480 | |||
| 1146 | Ga0207648_10002936 | |||
| 1147 | Ga0207648_10080631 | |||
| 1148 | Ga0207648_10310667 | |||
| 1149 | Ga0207676_10084492 | |||
| 1150 | Ga0207676_10133200 | |||
| 1151 | Ga0207676_10152388 | |||
| 1152 | Ga0207674_10013399 | |||
| 1153 | Ga0207674_10042954 | |||
| 1154 | Ga0207674_10045818 | |||
| 1155 | Ga0207674_10064149 | |||
| 1156 | Ga0207675_100108728 | |||
| 1157 | Ga0207683_10062250 | |||
| 1158 | Ga0207683_10390442 | |||
| 1159 | Ga0207698_10060308 | |||
| 1160 | Ga0209371_1015601 | |||
| 1161 | Ga0209974_10001189 | |||
| 1162 | Ga0207428_10010598 | |||
| 1163 | Ga0268266_10018552 | |||
| 1164 | Ga0268266_10067027 | |||
| 1165 | Ga0268266_10196398 | |||
| 1166 | Ga0268264_10144041 | |||
| 1167 | Ga0265326_10001207 | |||
| 1168 | Ga0265334_10000742 | |||
| 1169 | Ga0265318_10015205 | |||
| 1170 | Ga0265323_10003324 | |||
| 1171 | Ga0265322_10003953 | |||
| 1172 | Ga0265336_10001768 | |||
| 1173 | Ga0307517_10010838 | |||
| 1174 | Ga0307515_10141865 | |||
| 1175 | Ga0265338_10000288 | |||
| 1176 | Ga0265338_10001573 | |||
| 1177 | Ga0265338_10005567 | |||
| 1178 | Ga0265338_10093316 | |||
| 1179 | Ga0265338_10358295 | |||
| 1180 | Ga0265324_10002842 | |||
| 1181 | Ga0265760_10013690 | |||
| 1182 | Ga0265332_10001336 | |||
| 1183 | Ga0265320_10010891 | |||
| 1184 | Ga0265320_10018211 | |||
| 1185 | Ga0265325_10029814 | |||
| 1186 | Ga0265325_10100348 | |||
| 1187 | Ga0265340_10061154 | |||
| 1188 | Ga0265331_10086387 | |||
| 1189 | Ga0307513_10030783 | |||
| 1190 | Ga0307513_10136979 | |||
| 1191 | Ga0265313_10013884 | |||
| 1192 | Ga0265313_10022785 | |||
| 1193 | Ga0307508_10005648 | |||
| 1194 | Ga0307508_10080284 | |||
| 1195 | Ga0307508_10268091 | |||
| 1196 | Ga0307514_10021933 | |||
| 1197 | Ga0307514_10057870 | |||
| 1198 | Ga0307514_10092657 | |||
| 1199 | Ga0265314_10010683 | |||
| 1200 | Ga0265314_10014312 | |||
| 1201 | Ga0265342_10022487 | |||
| 1202 | Ga0265342_10092069 | |||
| 1203 | Ga0307516_10045157 | |||
| 1204 | Ga0307405_10060158 | |||
| 1205 | Ga0307405_10309595 | |||
| 1206 | Ga0307413_10093453 | |||
| 1207 | Ga0307518_10155664 | |||
| 1208 | Ga0307410_10014555 | |||
| 1209 | Ga0307406_10022300 | |||
| 1210 | Ga0307406_10146626 | |||
| 1211 | Ga0307407_10351320 | |||
| 1212 | Ga0307412_10036178 | |||
| 1213 | Ga0307412_10333803 | |||
| 1214 | Ga0307409_100129519 | |||
| 1215 | Ga0307409_100204443 | |||
| 1216 | Ga0307409_100494175 | |||
| 1217 | Ga0307416_100015846 | |||
| 1218 | Ga0307416_100055822 | |||
| 1219 | Ga0307416_100109395 | |||
| 1220 | Ga0307411_10127386 | |||
| 1221 | Ga0307415_100000215 | |||
| 1222 | Ga0307415_100040887 | |||
| 1223 | Ga0307415_100076655 | |||
| 1224 | Ga0307415_100097348 | |||
| 1225 | Ga0307415_100174319 | |||
| 1226 | Ga0307507_10000004 | |||
| 1227 | Ga0307507_10168127 | |||
| 1228 | Ga0307510_10036759 | |||
| 1229 | Ga0373957_0016606 | |||
| 1230 | Ga0373955_0068113 | |||
| 1231 | Ga0373947_0188032 | |||
| 1232 | Ga0373937_0282052 | |||
| 1233 | Ga0373925_0000157 | |||
| 1234 | Ga0373925_0001598 | |||
| 1235 | Ga0373925_0052056 | |||
| 1236 | Ga0395899_0022634 | |||
| 1237 | Ga0395898_0001784 | |||
| 1238 | Ga0395898_0024405 | |||
| 1239 | Ga0395898_0030181 | |||
| 1240 | Ga0395898_0039715 | |||
| 1241 | Ga0395898_0048999 | |||
| 1242 | Ga0395898_0053373 | |||
| 1243 | Ga0395898_0139922 | |||
| 1244 | Ga0395898_0601044 | |||
| 1245 | Ga0395905_0344416 | |||
| 1246 | Ga0395901_0022869 | |||
| 1247 | Ga0395901_0025426 | |||
| 1248 | Ga0395901_0036323 | |||
| 1249 | Ga0395901_0082296 | |||
| 1250 | Ga0395901_0360776 | |||
| 1251 | Ga0451797_0688976 | |||
| 1252 | Ga0451807_1563351 | |||
| 1253 | Ga0451853_0579279 | |||
| 1254 | Ga0451853_4019717 | |||
| 1255 | Ga0439441_003378 | |||
| 1256 | Ga0439448_0001907 | |||
| 1257 | Ga0439449_0023072 | |||
| 1258 | Ga0439449_0035985 | |||
| 1259 | Ga0439450_030404 | |||
| 1260 | Ga0439457_000565 | |||
| 1261 | Ga0450894_000053 | |||
| 1262 | Ga0450896_008117 | |||
| 1263 | Ga0450899_001403 | |||
| 1264 | Ga0450903_000489 | |||
| 1265 | Ga0450906_001299 | |||
| 1266 | Ga0450907_002007 | |||
| 1267 | Ga0439446_0015826 | |||
| 1268 | Ga0439435_0034646 | |||
| 1269 | Ga0466969_0021066 | |||
| 1270 | Ga0466972_0031810 | |||
| 1271 | Ga0466965_0008209 | |||
| 1272 | Ga0466965_0024809 | |||
| 1273 | Ga0466966_0012046 | |||
| 1274 | Ga0466966_0072900 | |||
| 1275 | Ga0466961_0003374 | |||
| 1276 | Ga0466961_0016795 | |||
| 1277 | Ga0466961_0021305 | |||
| 1278 | Ga0466961_0080966 | |||
| 1279 | Ga0466963_0005036 | |||
| 1280 | Ga0466963_0009925 | |||
| 1281 | Ga0466963_0019787 | |||
| 1282 | Ga0466963_0201406 | |||
| 1283 | Ga0466964_0006222 | |||
| 1284 | Ga0466971_0000404 | |||
| 1285 | Ga0466971_0004275 | |||
| 1286 | Ga0466971_0031388 | |||
| 1287 | Ga0466971_0031391 | |||
| 1288 | Ga0466971_0218846 | |||
| 1289 | Ga0466968_0011702 | |||
| 1290 | Ga0466970_0012682 | |||
| 1291 | Ga0466957_0022441 | |||
| 1292 | Ga0466957_0033822 | |||
| 1293 | Ga0466957_0053642 | |||
| 1294 | Ga0466957_0055087 | |||
| 1295 | Ga0466957_0120811 | |||
| 1296 | Ga0466960_0007211 | |||
| 1297 | Ga0466960_0035797 | |||
| 1298 | Ga0466959_0036600 | |||
| 1299 | Ga0466959_0037801 | |||
| 1300 | Ga0466959_0121221 | |||
| 1301 | Ga0466959_0147111 | |||
| 1302 | Ga0466959_0281960 | |||
| 1303 | Ga0451576_0309046 | |||
| 1304 | Ga0466958_0007605 | |||
| 1305 | Ga0466958_0042249 | |||
| 1306 | Ga0466958_0067078 | |||
| 1307 | Ga0466958_0071063 | |||
| 1308 | Ga0466967_0046897 | |||
| 1309 | Ga0466967_0075941 | |||
| 1310 | Ga0466967_0208609 | |||
| 1311 | Ga0466967_0286573 | |||
| 1312 | Ga0466967_0401117 | |||
| 1313 | Ga0495603_0005814 | |||
| 1314 | Ga0495603_0008145 | |||
| 1315 | Ga0495590_0106535 | |||
| 1316 | Ga0495641_0080810 | |||
| 1317 | Ga0495580_0101618 | |||
| 1318 | Ga0495605_0026071 | |||
| 1319 | Ga0495594_0011850 | |||
| 1320 | Ga0495594_0042463 | |||
| 1321 | Ga0495594_0078419 | |||
| 1322 | Ga0495583_0031093 | |||
| 1323 | Ga0495606_0018653 | |||
| 1324 | Ga0495608_0066915 | |||
| 1325 | Ga0495610_0016941 | |||
| 1326 | Ga0495610_0146392 | |||
| 1327 | Ga0495616_0023993 | |||
| 1328 | Ga0495618_0009955 | |||
| 1329 | Ga0495618_0057465 | |||
| 1330 | Ga0495620_0014341 | |||
| 1331 | Ga0495620_0059562 | |||
| 1332 | Ga0495628_0016920 | |||
| 1333 | Ga0495628_0057356 | |||
| 1334 | Ga0495628_0130257 | |||
| 1335 | Ga0495637_0033553 | |||
| 1336 | Ga0495643_0079397 | |||
| 1337 | Ga0495648_0033636 | |||
| 1338 | Ga0495652_0034046 | |||
| 1339 | Ga0495652_0233631 | |||
| 1340 | Ga0495654_0018579 | |||
| 1341 | Ga0495640_0015572 | |||
| 1342 | Ga0495640_0033441 | |||
| 1343 | Ga0495645_0197569 | |||
| 1344 | Ga0495633_0014210 | |||
| 1345 | Ga0495667_0128572 | |||
| 1346 | Ga0495667_0128884 | |||
| 1347 | Ga0495656_0181864 | |||
| 1348 | Ga0495634_0063649 | |||
| 1349 | Ga0495634_0072265 | |||
| 1350 | Ga0495625_0048468 | |||
| 1351 | Ga0495635_0003194 | |||
| 1352 | Ga0495661_0050122 | |||
| 1353 | Ga0495657_0032151 | |||
| 1354 | Ga0495657_0082740 | |||
| 1355 | Ga0495623_0137890 | |||
| 1356 | Ga0495658_0099713 | |||
| 1357 | Ga0495613_0022324 | |||
| 1358 | Ga0495649_0003017 | |||
| 1359 | Ga0495649_0177194 | |||
| 1360 | Ga0495589_0021998 | |||
| 1361 | Ga0495600_0043084 | |||
| 1362 | Ga0495600_0110571 | |||
| 1363 | Ga0495660_0077902 | |||
| 1364 | Ga0495660_0123269 | |||
| 1365 | Ga0495581_0056352 | |||
| 1366 | Ga0495581_0122532 | |||
| 1367 | Ga0495604_0044817 | |||
| 1368 | Ga0495636_0021952 | |||
| 1369 | Ga0495636_0034409 | |||
| 1370 | Ga0495636_0047369 | |||
| 1371 | Ga0495674_0062035 | |||
| 1372 | Ga0495674_0196585 | |||
| 1373 | Ga0495676_0021113 | |||
| 1374 | Ga0495676_0028112 | |||
| 1375 | Ga0495680_0004298 | |||
| 1376 | Ga0495687_006388 | |||
| 1377 | Ga0495687_031996 | |||
| 1378 | Ga0495687_042063 | |||
| 1379 | Ga0495675_0000649 | |||
| 1380 | Ga0495675_0250439 | |||
| 1381 | Ga0495685_005860 | |||
| 1382 | Ga0495685_017836 | |||
| 1383 | Ga0495686_0140821 | |||
| 1384 | Ga0495614_0084056 | |||
| 1385 | Ga0495626_0014010 | |||
| 1386 | Ga0496100_0033536 | |||
| 1387 | Ga0496100_0223944 | |||
| 1388 | Ga0496100_0277176 | |||
| 1389 | Ga0496100_0369584 | |||
| 1390 | Ga0496101_0147921 | |||
| 1391 | Ga0496101_0150798 | |||
| 1392 | Ga0496101_0295023 | |||
| 1393 | Ga0496101_0463067 | |||
| 1394 | Ga0496102_0032556 | |||
| 1395 | Ga0496102_0044963 | |||
| 1396 | Ga0496102_0078824 | |||
| 1397 | Ga0496102_0249098 | |||
| 1398 | Ga0496102_0581166 | |||
| 1399 | Ga0496103_0013549 | |||
| 1400 | Ga0496103_0014670 | |||
| 1401 | Ga0496104_0007088 | |||
| 1402 | Ga0496104_0019956 | |||
| 1403 | Ga0496104_0030064 | |||
| 1404 | Ga0496104_0043700 | |||
| 1405 | Ga0496104_0052870 | |||
| 1406 | Ga0496104_0158497 | |||
| 1407 | Ga0496104_0164946 | |||
| 1408 | Ga0496104_0171236 | |||
| 1409 | Ga0496104_0184555 | |||
| 1410 | Ga0496104_0427273 | |||
| 1411 | Ga0496105_0014328 | |||
| 1412 | Ga0496105_0034236 | |||
| 1413 | Ga0496105_0198669 | |||
| 1414 | Ga0496105_0214917 | |||
| 1415 | Ga0496105_0409080 | |||
| 1416 | Ga0496106_0028616 | |||
| 1417 | Ga0496106_0071074 | |||
| 1418 | Ga0496106_0083855 | |||
| 1419 | Ga0496106_0196409 | |||
| 1420 | Ga0496106_0244803 | |||
| 1421 | Ga0496107_0007139 | |||
| 1422 | Ga0496108_0055779 | |||
| 1423 | Ga0496108_0060876 | |||
| 1424 | Ga0496108_0113253 | |||
| 1425 | Ga0496108_0113419 | |||
| 1426 | Ga0496108_0114649 | |||
| 1427 | Ga0496108_0140069 | |||
| 1428 | Ga0496108_0163447 | |||
| 1429 | Ga0496108_0348926 | |||
| 1430 | Ga0496109_0058834 | |||
| 1431 | Ga0496109_0065255 | |||
| 1432 | Ga0496109_0079220 | |||
| 1433 | Ga0496109_0103582 | |||
| 1434 | Ga0496109_0119076 | |||
| 1435 | Ga0496109_0134886 | |||
| 1436 | Ga0496109_0160686 | |||
| 1437 | Ga0496109_0308344 | |||
| 1438 | Ga0496110_0018589 | |||
| 1439 | Ga0496110_0049279 | |||
| 1440 | Ga0496110_0070997 | |||
| 1441 | Ga0496110_0179932 | |||
| 1442 | Ga0496110_0323475 | |||
| 1443 | Ga0496111_0014234 | |||
| 1444 | Ga0496111_0020997 | |||
| 1445 | Ga0496111_0051617 | |||
| 1446 | Ga0496111_0118034 | |||
| 1447 | Ga0496111_0141060 | |||
| 1448 | Ga0496111_0221657 | |||
| 1449 | Ga0496111_0225113 | |||
| 1450 | Ga0496112_0000075 | |||
| 1451 | Ga0496112_0008373 | |||
| 1452 | Ga0496112_0033410 | |||
| 1453 | Ga0496112_0058218 | |||
| 1454 | Ga0496112_0075037 | |||
| 1455 | Ga0496112_0078179 | |||
| 1456 | Ga0496112_0120163 | |||
| 1457 | Ga0496112_0168549 | |||
| 1458 | Ga0496112_0587560 | |||
| 1459 | Ga0496113_0024570 | |||
| 1460 | Ga0496113_0038151 | |||
| 1461 | Ga0496113_0045280 | |||
| 1462 | Ga0496113_0062406 | |||
| 1463 | Ga0496113_0081864 | |||
| 1464 | Ga0496113_0119621 | |||
| 1465 | Ga0496113_0163996 | |||
| 1466 | Ga0496113_0196748 | |||
| 1467 | Ga0496114_0004631 | |||
| 1468 | Ga0496114_0014886 | |||
| 1469 | Ga0496114_0051019 | |||
| 1470 | Ga0496114_0079316 | |||
| 1471 | Ga0496114_0457063 | |||
| 1472 | Ga0496114_0581407 | |||
| 1473 | Ga0496115_0099377 | |||
| 1474 | Ga0496115_0215575 | |||
| 1475 | Ga0496126_0006685 | |||
| 1476 | Ga0496126_0015703 | |||
| 1477 | Ga0496126_0058059 | |||
| 1478 | Ga0495682_0021937 | |||
| 1479 | Ga0501318_004964 | |||
| 1480 | Ga0501031_0041859 | |||
| 1481 | Ga0501031_0062020 | |||
| 1482 | Ga0501033_0001291 | |||
| 1483 | Ga0501033_0002560 | |||
| 1484 | Ga0501033_0039647 | |||
| 1485 | Ga0501033_0056386 | |||
| 1486 | Ga0501033_0194542 | |||
| 1487 | Ga0501033_0227249 | |||
| 1488 | Ga0501034_0553819 | |||
| 1489 | Ga0501036_0087436 | |||
| 1490 | Ga0501036_0091666 | |||
| 1491 | Ga0501036_0141514 | |||
| 1492 | Ga0501037_0005388 | |||
| 1493 | Ga0501037_0083006 | |||
| 1494 | Ga0501038_0003048 | |||
| 1495 | Ga0501038_0003106 | |||
| 1496 | Ga0501038_0004443 | |||
| 1497 | Ga0501038_0083857 | |||
| 1498 | Ga0501038_0127586 | |||
| 1499 | Ga0501038_0289838 | |||
| 1500 | Ga0501039_0093355 | |||
| 1501 | Ga0501039_0149340 | |||
| 1502 | Ga0501040_0141230 | |||
| 1503 | Ga0501040_0299451 | |||
| 1504 | Ga0501041_0250978 | |||
| 1505 | Ga0501042_0096538 | |||
| 1506 | Ga0501042_0138828 | |||
| 1507 | Ga0501042_0155814 | |||
| 1508 | Ga0501043_0007412 | |||
| 1509 | Ga0501043_0199711 | |||
| 1510 | Ga0501046_0014709 | |||
| 1511 | Ga0501046_0034395 | |||
| 1512 | Ga0501046_0121103 | |||
| 1513 | Ga0501047_0000005 | |||
| 1514 | Ga0501047_0003094 | |||
| 1515 | Ga0501047_0030085 | |||
| 1516 | Ga0501047_0083382 | |||
| 1517 | Ga0501047_0094101 | |||
| 1518 | Ga0501047_0111239 | |||
| 1519 | Ga0501047_0127199 | |||
| 1520 | Ga0501047_0140621 | |||
| 1521 | Ga0501047_0229804 | |||
| 1522 | Ga0501048_0007309 | |||
| 1523 | Ga0501067_0004493 | |||
| 1524 | Ga0501067_0026010 | |||
| 1525 | Ga0501068_0037962 | |||
| 1526 | Ga0501068_0073469 | |||
| 1527 | Ga0501068_0077790 | |||
| 1528 | Ga0501068_0085592 | |||
| 1529 | Ga0501068_0180787 | |||
| 1530 | Ga0501069_0023163 | |||
| 1531 | Ga0501069_0244199 | |||
| 1532 | Ga0501070_0391881 | |||
| 1533 | Ga0501072_0027141 | |||
| 1534 | Ga0501073_0027215 | |||
| 1535 | Ga0501074_0002170 | |||
| 1536 | Ga0501074_0055498 | |||
| 1537 | Ga0501074_0126830 | |||
| 1538 | Ga0501075_0018269 | |||
| 1539 | Ga0501075_0201415 | |||
| 1540 | Ga0501075_0205479 | |||
| 1541 | Ga0501076_0075425 | |||
| 1542 | Ga0501076_0164426 | |||
| 1543 | Ga0501076_0214071 | |||
| 1544 | Ga0501076_0285630 | |||
| 1545 | Ga0501076_0358835 | |||
| 1546 | Ga0501077_0046472 | |||
| 1547 | Ga0501077_0051486 | |||
| 1548 | Ga0501077_0079184 | |||
| 1549 | Ga0501079_0076032 | |||
| 1550 | Ga0501079_0363860 | |||
| 1551 | Ga0501080_0350105 | |||
| 1552 | Ga0501081_0180463 | |||
| 1553 | Ga0501083_0116602 | |||
| 1554 | Ga0501035_0004383 | |||
| 1555 | Ga0501035_0032380 | |||
| 1556 | Ga0501035_0054230 | |||
| 1557 | Ga0501044_0004786 | |||
| 1558 | Ga0501044_0070542 | |||
| 1559 | Ga0501044_0077035 | |||
| 1560 | Ga0501044_0107851 | |||
| 1561 | Ga0501044_0113200 | |||
| 1562 | Ga0501044_0228505 | |||
| 1563 | Ga0501044_0532473 | |||
| 1564 | Ga0501045_0049156 | |||
| 1565 | Ga0501045_0115914 | |||
| 1566 | Ga0501045_0247273 | |||
| 1567 | nmdc:mga03683_92328_c1 | |||
| 1568 | nmdc:mga00v17_4189_c1 | |||
| 1569 | nmdc:mga0yw44_231461_c1 | |||
| 1570 | nmdc:mga0yw44_262860_c1 | |||
| 1571 | nmdc:mga06z11_52138_c1 | |||
| 1572 | nmdc:mga06z11_560_c1 | |||
| 1573 | nmdc:mga06z11_86771_c1 | |||
| 1574 | nmdc:mga07m45_112576_c1 | |||
| 1575 | nmdc:mga07m45_2260_c1 | |||
| 1576 | nmdc:mga05p37_12604_c1 | |||
| 1577 | nmdc:mga05p37_600_c1 | |||
| 1578 | nmdc:mga09592_1919_c1 | |||
| 1579 | nmdc:mga09592_46336_c1 | |||
| 1580 | nmdc:mga0qj67_16412_c1 | |||
| 1581 | nmdc:mga06r32_288_c1 | |||
| 1582 | nmdc:mga06r32_449213_c1 | |||
| 1583 | nmdc:mga06r32_4639_c1 | |||
| 1584 | nmdc:mga08y16_19267_c1 | |||
| 1585 | nmdc:mga08y16_347340_c1 | |||
| 1586 | nmdc:mga0n895_231105_c1 | |||
| 1587 | nmdc:mga0n895_332272_c1 | |||
| 1588 | nmdc:mga0rr50_76862_c1 | |||
| 1589 | nmdc:mga0a205_189986_c1 | |||
| 1590 | nmdc:mga0a205_27527_c1 | |||
| 1591 | nmdc:mga0a205_32809_c1 | |||
| 1592 | nmdc:mga0a205_44881_c1 | |||
| 1593 | Ga0495601_0007889 | |||
| 1594 | Ga0495601_0026064 | |||
| 1595 | Ga0495612_0000297 | |||
| 1596 | Ga0495612_0030672 | |||
| 1597 | Ga0500610_0091615 | |||
| 1598 | Ga0495595_0028906 | |||
| 1599 | Ga0495619_0019837 | |||
| 1600 | Ga0495619_0053330 | |||
| 1601 | Ga0500644_0000495 | |||
| 1602 | Ga0500644_0027398 | |||
| 1603 | Ga0500583_0114065 | |||
| 1604 | Ga0500600_0154629 | |||
| 1605 | Ga0501084_0052232 | |||
| 1606 | Ga0501084_0092070 | |||
| 1607 | Ga0501084_0196410 | |||
| 1608 | Ga0501084_0217760 | |||
| 1609 | Ga0590071_005637 | |||
| 1610 | Ga0590075_005423 | |||
| 1611 | Ga0590077_009602 | |||
| 1612 | Ga0501082_0197932 | |||
| 1613 | Ga0501082_0297742 | |||
| 1614 | Ga0501082_0553342 | |||
| 1615 | Ga0466962_0001014 | |||
| 1616 | Ga0466962_0011061 | |||
| 1617 | Ga0466962_0018185 | |||
| 1618 | Ga0466962_0202434 | |||
| 1619 | Ga0530510_0007663 | |||
| 1620 | Ga0530510_0120311 | |||
| 1621 | Ga0530510_0169388 | |||
| 1622 | Ga0530510_0219173 | |||
| 1623 | 2547411876 | |||
| 1624 | 2554256594 | |||
| 1625 | 2585306110 | |||
| 1626 | 2616696500 | |||
| 1627 | 2644261327 | |||
| 1628 | 2644439572 | |||
| 1629 | 2644611235 | |||
| 1630 | 2644633080 | |||
| 1631 | 2676492279 | |||
| 1632 | 2768643712 | |||
| 1633 | 2785341641 | |||
| 1634 | 2785371036 | |||
| 1635 | 2786672234 | |||
| 1636 | 2804845248 | |||
| 1637 | 2808843582 | |||
| 1638 | 2808913143 | |||
| 1639 | 2809233635 | |||
| 1640 | 2812375650 | |||
| 1641 | 2812479205 | |||
| 1642 | 2819424517 | |||
| 1643 | 2819668089 | |||
| 1644 | 2819691958 | |||
| 1645 | 2819729701 | |||
| 1646 | 2862287248 | |||
| 1647 | 2862294763 | |||
| 1648 | 2862390844 | |||
| 1649 | 2862710434 | |||
| 1650 | 2863411325 | |||
| 1651 | 2867435113 | |||
| 1652 | 2868092750 | |||
| 1653 | 2877679543 | |||
| 1654 | 2918506027 | |||
| 1655 | 2919470454 | |||
| 1656 | 2946048363 | |||
| 1657 | 2946077314 | |||
| 1658 | 2954384442 | |||
| 1659 | 2954678510 | |||
| 1660 | 2954685645 | |||
| 1661 | 2954695304 | |||
| 1662 | 2954710495 | |||
| 1663 | 2954714741 | |||
| 1664 | 2954724686 | |||
| 1665 | 2954737131 | |||
| 1666 | 2954743610 | |||
| 1667 | 2954755984 | |||
| 1668 | 2954762562 | |||
| 1669 | 2990044988 | |||
| 1670 | 2997600569 | |||
| 1671 | 3006324143 | |||
| 1672 | 3006499038 | |||
| 1673 | 8001782414 | |||
| 1674 | 8008491413 | |||
| 1675 | 8008566793 | |||
| 1676 | 8023625622 | |||
| 1677 | 8025415464 | |||
| 1678 | 8025530743 | |||
| 1679 | 8025532418 | |||
| 1680 | 8033691186 | |||
| 1681 | 8048406907 | |||
| 1682 | 8056670523 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zum-assembly2.cif.gz_E | human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form | 0.9572 | 11 | 227 |
| 1zum-assembly3.cif.gz_J | human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form | 0.9568 | 11 | 227 |
| 1zum-assembly2.cif.gz_F | human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form | 0.9568 | 11 | 227 |
| 1zum-assembly3.cif.gz_I | human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form | 0.9565 | 11 | 227 |
| 1zum-assembly3.cif.gz_K | human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form | 0.9564 | 11 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0ESV8_56_300_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9493 | 12 | 227 | 3.40.605.10 |
| af_Q84LK3_9_267_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9453 | 12 | 256 | 3.40.605.10 |
| af_A0A1D6MRK0_1_96_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9449 | 164 | 253 | 3.40.605.10 |
| af_Q2FV10_3_257_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9436 | 12 | 253 | 3.40.605.10 |
| af_Q9URW9_34_486_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9421 | 26 | 252 | 3.40.605.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M3X375-F1-model_v4 | Aldehyde dehydrogenase | 0.9824 | 30 | 284 |
GO:0016491
|
| AF-A0A7Y0DBV1-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9763 | 2 | 250 |
GO:0016491
|
| AF-A0A4P6Q1V1-F1-model_v4 | NAD/NADP-dependent betaine aldehyde dehydrogenase (EC 1.2.1.8) | 0.9747 | 1 | 284 |
GO:0008802
|
| AF-A0A7Y6AB86-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.973 | 2 | 231 |
GO:0016491
|
| AF-A0A4P6Q1V1-F1-model_v4 | NAD/NADP-dependent betaine aldehyde dehydrogenase (EC 1.2.1.8) | 0.9713 | 1 | 284 |
GO:0008802
|