F483203

General Info

Members Datasets Scaffolds Average Seq Length
844 556 1688 233

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1013091|JGI25154J39366_10130912
Length 226
Sequence MTQRPLTTIGFDADDTLWQNEQFYRLTELQFTELLADHAPSDVISARLLEAEKRNLRHYGFGIKGFTLSMIETAIEITEGEVPSTVIAQILDIGRDLLAHPVETLPHSGKYLLVLITKGDLFDQERKLAQSGLGDLFDAVEIVSDKNASTYRRIFSKVGDGPERAMMIGNSLKSDIVPALAAGSYGVFVPHELTWSFEHVEEPTDAPRFRKIGHLGELHDVIEALQ

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
56 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
57 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
60 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
70 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
126 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
130 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
131 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
233 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
238 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
239 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
243 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
244 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
247 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
252 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
253 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
254 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
255 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
256 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
257 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
258 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
259 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
260 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
261 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
262 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
263 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
264 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
265 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
266 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
267 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
268 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
269 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
270 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
271 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
272 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
273 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
274 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
275 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
276 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
277 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
278 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
279 2519899620 Rhizobium sp. Pop5 Isolate Nodule
280 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
281 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
282 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
283 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
284 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
285 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
286 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
287 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
288 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
289 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
290 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
291 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
292 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
293 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
294 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
295 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
296 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
297 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
298 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
299 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
300 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
301 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
302 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
303 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
304 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
305 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
306 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
307 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
308 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
309 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
310 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
311 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
312 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
313 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
314 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
315 2643221557 Ensifer sp. Root558 Isolate Unclassified
316 2643221558 Rhizobium sp. Root149 Isolate Unclassified
317 2643221599 Rhizobium sp. Root708 Isolate Unclassified
318 2643221610 Ensifer sp. Root74 Isolate Unclassified
319 2643221618 Ensifer sp. Root231 Isolate Unclassified
320 2643221626 Ensifer sp. Root31 Isolate Unclassified
321 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
322 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
323 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
324 2643221655 Ensifer sp. Root1252 Isolate Unclassified
325 2643221659 Ensifer sp. Root127 Isolate Unclassified
326 2643221668 Ensifer sp. Root423 Isolate Unclassified
327 2643221675 Ensifer sp. Root1298 Isolate Unclassified
328 2643221680 Ensifer sp. Root1312 Isolate Unclassified
329 2643221698 Ensifer sp. Root142 Isolate Unclassified
330 2643221712 Ensifer sp. Root258 Isolate Unclassified
331 2643221719 Rhizobium sp. Root274 Isolate Unclassified
332 2643221723 Ensifer sp. Root278 Isolate Unclassified
333 2643221726 Ensifer sp. Root954 Isolate Unclassified
334 2643221734 Bosea sp. Root670 Isolate Unclassified
335 2643221736 Bosea sp. Root483D1 Isolate Unclassified
336 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
337 2718217882 Rhizobium sp. N741 Isolate Nodule
338 2718217927 Rhizobium sp. N324 Isolate Nodule
339 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
340 2718218009 Rhizobium sp. N561 Isolate Nodule
341 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
342 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
343 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
344 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
345 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
346 2718218363 Rhizobium sp. N113 Isolate Nodule
347 2718218365 Rhizobium sp. N731 Isolate Nodule
348 2718218366 Rhizobium sp. N621 Isolate Nodule
349 2718218423 Rhizobium sp. N941 Isolate Nodule
350 2721755514 Rhizobium sp. N6212 Isolate Nodule
351 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
352 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
353 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
354 2721755809 Rhizobium sp. N541 Isolate Nodule
355 2721755810 Rhizobium sp. N871 Isolate Nodule
356 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
357 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
358 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
359 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
360 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
361 2728369365 Rhizobium sp. N1341 Isolate Nodule
362 2728369397 Rhizobium sp. N1314 Isolate Nodule
363 2738541293 Rhizobium sp. GV031 Isolate Unclassified
364 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
365 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
366 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
367 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
368 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
369 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
370 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
371 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
372 2791355256 Rhizobium sp. M10 Isolate Nodule
373 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
374 2791355260 Rhizobium sp. L9 Isolate Nodule
375 2791355261 Rhizobium sp. J15 Isolate Nodule
376 2791355262 Rhizobium sp. M1 Isolate Nodule
377 2791355263 Rhizobium chutanense C5 Isolate Nodule
378 2791355264 Rhizobium sp. S9 Isolate Nodule
379 2791355265 Rhizobium sp. H4 Isolate Nodule
380 2791355266 Rhizobium sp. L43 Isolate Nodule
381 2791355267 Rhizobium sp. L18 Isolate Nodule
382 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
383 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
384 2802429633 Rhizobium anhuiense J3 Isolate Nodule
385 2802429634 Rhizobium anhuiense S10 Isolate Nodule
386 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
387 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
388 2802429637 Rhizobium anhuiense C15 Isolate Nodule
389 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
390 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
391 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
392 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
393 2818991467 Bosea vestrisii 3192 Isolate Unclassified
394 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
395 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
396 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
397 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
398 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
399 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
400 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
401 2838048938 Rhizobium pisi 27/80 Isolate Nodule
402 2838061910 Rhizobium phaseoli L15 Isolate Nodule
403 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
404 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
405 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
406 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
407 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
408 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
409 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
410 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
411 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
412 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
413 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
414 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
415 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
416 2841760612 Bosea sp. Tri-49 Isolate Nodule
417 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
418 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
419 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
420 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
421 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
422 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
423 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
424 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
425 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
426 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
427 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
428 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
429 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
430 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
431 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
432 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
433 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
434 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
435 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
436 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
437 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
438 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
439 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
440 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
441 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
442 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
443 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
444 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
445 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
446 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
447 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
448 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
449 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
450 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
451 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
452 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
453 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
454 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
455 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
456 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
457 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
458 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
459 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
460 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
461 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
462 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
463 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
464 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
465 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
466 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
467 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
468 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
469 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
470 2844104063 Bosea sp. Tri-39 Isolate Nodule
471 2844163670 Ensifer sp. 1H6 Isolate Unclassified
472 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
473 2851182111 Bosea sp. Tri-44 Isolate Nodule
474 2851246043 Bosea sp. Tri-54 Isolate Nodule
475 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
476 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
477 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
478 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
479 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
480 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
481 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
482 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
483 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
484 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
485 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
486 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
487 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
488 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
489 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
490 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
491 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
492 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
493 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
494 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
495 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
496 2933599457 Rhizobium phaseoli M3 Isolate Nodule
497 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
498 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
499 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
500 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
501 2936381700 Rhizobium chutanense C16 Isolate Unclassified
502 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
503 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
504 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
505 2996887358 Rhizobium sp. R711 Isolate Nodule
506 2996893221 Rhizobium sp. R635 Isolate Nodule
507 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
508 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
509 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
510 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
511 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
512 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
513 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
514 8005258706 Rhizobium sp. R693 Isolate Nodule
515 8005275841 Rhizobium sp. N4311 Isolate Nodule
516 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
517 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
518 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
519 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
520 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
521 8005321885 Rhizobium sp. R72 Isolate Nodule
522 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
523 8005382845 Rhizobium sp. R634 Isolate Nodule
524 8005395548 Rhizobium sp. R339 Isolate Nodule
525 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
526 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
527 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
528 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
529 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
530 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
531 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
532 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
533 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
534 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
535 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
536 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
537 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
538 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
539 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
540 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
541 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
542 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
543 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
544 8018176218 Rhizobium sp. N122 Isolate Nodule
545 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
546 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
547 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
548 8024501048 Rhizobium sp. H4 Isolate Nodule
549 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
550 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
551 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
552 8056382006 Rhizobium croatiense 13T Isolate Nodule
553 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
554 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
555 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
556 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.74
Metatranscriptomes 0
Isolates 36.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.13
Nodule 23.7
Rhizoplane 1.78
Rhizosphere 28.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1013091 3300002738 Bacteria 899
2 JGI24740J21852_10000263 3300001979 Bacteria 22167
3 JGI25155J39150_1000023 3300002704 Bacteria 136961
4 JGI25156J39149_1000094 3300002705 Bacteria 65145
5 JGI25162J39368_1000177 3300002737 Bacteria 68786
6 JGI25162J39368_1000788 3300002737 Bacteria 21288
7 JGI25154J39366_1000213 3300002738 Bacteria 40261
8 JGI25154J39366_1013929 3300002738 Bacteria 854
9 JGI25158J39367_1000158 3300002739 Bacteria 16044
10 JGI25158J39367_1001611 3300002739 Bacteria 3897
11 JGI25157J39369_1000043 3300002741 Bacteria 122537
12 JGI25152J39213_1001662 3300002773 Bacteria 9230
13 JGI25152J39213_1003959 3300002773 Bacteria 4837
14 JGI25152J39213_1004756 3300002773 Bacteria 4178
15 JGI25152J39213_1012579 3300002773 Bacteria 1805
16 JGI25152J39213_1014458 3300002773 Bacteria 1600
17 JGI25152J39213_1015644 3300002773 Bacteria 1490
18 JGI25150J39212_1000378 3300002774 Bacteria 21367
19 JGI25150J39212_1004689 3300002774 Bacteria 3007
20 JGI25150J39212_1006376 3300002774 Bacteria 2439
21 JGI25150J39212_1010896 3300002774 Bacteria 1670
22 JGI25150J39212_1023141 3300002774 Bacteria 926
23 JGI25159J45721_1000034 3300002987 Bacteria 87743
24 JGI25159J45721_1000489 3300002987 Bacteria 18119
25 JGI25159J45721_1009426 3300002987 Bacteria 2578
26 JGI25151J46595_10000565 3300003187 Bacteria 33453
27 JGI25151J46595_10001463 3300003187 Bacteria 16008
28 JGI25151J46595_10002461 3300003187 Bacteria 11106
29 JGI25151J46595_10006390 3300003187 Bacteria 5925
30 JGI25151J46595_10022314 3300003187 Bacteria 2631
31 JGI25151J46595_10048823 3300003187 Bacteria 1458
32 JGI25151J46595_10062025 3300003187 Bacteria 1186
33 JGI25165J46597_1000415 3300003214 Bacteria 44714
34 JGI25165J46597_1000555 3300003214 Bacteria 34009
35 JGI25165J46597_1003155 3300003214 Bacteria 4374
36 JGI25153J46596_10000833 3300003215 Bacteria 18843
37 JGI25153J46596_10007280 3300003215 Bacteria 5470
38 JGI25153J46596_10010202 3300003215 Bacteria 4271
39 JGI25153J46596_10026027 3300003215 Bacteria 2079
40 JGI25153J46596_10037224 3300003215 Bacteria 1550
41 JGI25153J46596_10037406 3300003215 Bacteria 1543
42 rootH1_10012486 3300003323 Bacteria 7405
43 rootH1_10156603 3300003323 Bacteria 1618
44 JGI25160J50197_1000046 3300003354 Bacteria 141352
45 JGI25160J50197_1000096 3300003354 Bacteria 87743
46 JGI25160J50197_1000703 3300003354 Bacteria 18438
47 JGI25160J50197_1008324 3300003354 Bacteria 3960
48 JGI25160J50197_1029684 3300003354 Bacteria 1440
49 JGI25161J50226_1000031 3300003374 Bacteria 141352
50 JGI25161J50226_1000735 3300003374 Bacteria 12661
51 JGI25161J50226_1001481 3300003374 Bacteria 7029
52 Ga0055526_1002004 3300003771 Bacteria 14027
53 Ga0055526_1004323 3300003771 Bacteria 8579
54 Ga0055526_1004833 3300003771 Bacteria 7955
55 Ga0055526_1016842 3300003771 Bacteria 2830
56 Ga0055524_1001011 3300003775 Bacteria 17415
57 Ga0055524_1003205 3300003775 Bacteria 8026
58 Ga0055524_1006519 3300003775 Bacteria 5053
59 Ga0055524_1007117 3300003775 Bacteria 4792
60 Ga0055524_1018423 3300003775 Bacteria 2425
61 Ga0055536_1012982 3300003781 Bacteria 3041
62 Ga0055528_1000146 3300003790 Bacteria 57915
63 Ga0055528_1000636 3300003790 Bacteria 25725
64 Ga0055528_1002006 3300003790 Bacteria 11423
65 Ga0055528_1006732 3300003790 Bacteria 5175
66 Ga0055528_1011522 3300003790 Bacteria 3502
67 Ga0055528_1017754 3300003790 Bacteria 2449
68 Ga0055530_10037531 3300003791 Bacteria 1211
69 Ga0055540_1000111 3300003792 Bacteria 88263
70 Ga0055540_1008488 3300003792 Bacteria 3693
71 Ga0055540_1008672 3300003792 Bacteria 3627
72 Ga0055540_1017841 3300003792 Bacteria 1966
73 Ga0055540_1021187 3300003792 Bacteria 1696
74 Ga0055540_1024277 3300003792 Bacteria 1507
75 Ga0055531_10009694 3300003794 Bacteria 4895
76 Ga0055531_10012435 3300003794 Bacteria 4005
77 Ga0055531_10014881 3300003794 Bacteria 3474
78 Ga0055543_1000208 3300004625 Bacteria 47499
79 Ga0055543_1000402 3300004625 Bacteria 27634
80 Ga0055543_1000637 3300004625 Bacteria 18741
81 Ga0055543_1003374 3300004625 Bacteria 4751
82 Ga0055543_1006055 3300004625 Bacteria 2987
83 Ga0065165_1000389 3300005262 Bacteria 71369
84 Ga0065165_1000468 3300005262 Bacteria 63190
85 Ga0065165_1000693 3300005262 Bacteria 48076
86 Ga0065165_1003090 3300005262 Bacteria 12404
87 Ga0065165_1008980 3300005262 Bacteria 4569
88 Ga0065165_1010930 3300005262 Bacteria 3856
89 Ga0065165_1028682 3300005262 Bacteria 1794
90 Ga0070670_100000173 3300005331 Bacteria 58127
91 Ga0070666_10107996 3300005335 Bacteria 1923
92 Ga0070682_100181413 3300005337 Bacteria 1471
93 Ga0070668_100093172 3300005347 Bacteria 2377
94 Ga0070669_100624789 3300005353 Bacteria 904
95 Ga0070671_100012822 3300005355 Bacteria 6758
96 Ga0070671_100357284 3300005355 Bacteria 1247
97 Ga0070667_100146697 3300005367 Bacteria 2070
98 Ga0070663_100067648 3300005455 Bacteria 2592
99 Ga0068853_100255608 3300005539 Bacteria 1609
100 Ga0070665_100018373 3300005548 Bacteria 7008
101 Ga0070665_100060832 3300005548 Bacteria 3786
102 Ga0068855_100345760 3300005563 Bacteria 1639
103 Ga0068856_100083561 3300005614 Bacteria 3171
104 Ga0068856_100135663 3300005614 Bacteria 2466
105 Ga0068852_100080225 3300005616 Bacteria 2892
106 Ga0068863_100510787 3300005841 Bacteria 1184
107 Ga0075365_10009533 3300006038 Bacteria 5590
108 Ga0075365_10012660 3300006038 Bacteria 5019
109 Ga0075365_10033219 3300006038 Bacteria 3323
110 Ga0075365_10273664 3300006038 Bacteria 1188
111 Ga0075363_100286759 3300006048 Bacteria 954
112 Ga0075364_10000875 3300006051 Bacteria 15886
113 Ga0075362_10068711 3300006177 Bacteria 1614
114 Ga0075369_10002530 3300006186 Bacteria 6541
115 Ga0075369_10009993 3300006186 Bacteria 3705
116 Ga0075366_10011977 3300006195 Bacteria 4911
117 Ga0075366_10432235 3300006195 Bacteria 812
118 Ga0075370_10021085 3300006353 Bacteria 3569
119 Ga0075370_10023191 3300006353 Bacteria 3416
120 Ga0079104_1000069 3300006946 Bacteria 153993
121 Ga0105251_10010923 3300009011 Bacteria 5225
122 Ga0105250_10030703 3300009092 Bacteria 2160
123 Ga0105240_10006772 3300009093 Bacteria 16763
124 Ga0105247_10206393 3300009101 Bacteria 1323
125 Ga0105243_10044233 3300009148 Bacteria 3493
126 Ga0105243_10162016 3300009148 Bacteria 1930
127 Ga0105248_10005517 3300009177 Bacteria 13892
128 Ga0105237_10010394 3300009545 Bacteria 9906
129 Ga0105237_10283757 3300009545 Bacteria 1658
130 Ga0123340_1057202 3300009763 Bacteria 1224
131 Ga0123341_1000452 3300009765 Bacteria 24837
132 Ga0123341_1082950 3300009765 Bacteria 1233
133 Ga0123341_1083348 3300009765 Bacteria 1226
134 Ga0123342_1014969 3300009766 Bacteria 7225
135 Ga0123342_1029957 3300009766 Bacteria 2778
136 Ga0105239_10012926 3300010375 Bacteria 9287
137 Ga0157322_1003048 3300012490 Bacteria 997
138 Ga0157314_1004303 3300012500 Bacteria 1043
139 Ga0157373_10017343 3300013100 Bacteria 5243
140 Ga0157373_10087897 3300013100 Bacteria 2190
141 Ga0157370_10003911 3300013104 Bacteria 17347
142 Ga0157369_10127636 3300013105 Bacteria 2696
143 Ga0157369_10137547 3300013105 Bacteria 2585
144 Ga0171463_1008 3300013249 Bacteria 299022
145 Ga0163162_10400123 3300013306 Bacteria 1506
146 Ga0163163_10401145 3300014325 Bacteria 1429
147 Ga0157379_10457298 3300014968 Bacteria 1179
148 Ga0182005_1003486 3300015265 Bacteria 5320
149 Ga0183363_1335 3300015690 Bacteria 5852
150 Ga0209435_100011 3300025206 Bacteria 413027
151 Ga0209436_100077 3300025208 Bacteria 49473
152 Ga0209436_100305 3300025208 Bacteria 22585
153 Ga0209437_100036 3300025233 Bacteria 469153
154 Ga0209437_100086 3300025233 Bacteria 254578
155 Ga0207425_1000012 3300025245 Bacteria 528324
156 Ga0207425_1008931 3300025245 Bacteria 2525
157 Ga0207425_1010568 3300025245 Bacteria 2239
158 Ga0207425_1017543 3300025245 Bacteria 1570
159 Ga0209646_1000024 3300025246 Bacteria 413027
160 Ga0209646_1006810 3300025246 Bacteria 1900
161 Ga0209646_1009330 3300025246 Bacteria 1559
162 Ga0209026_1000030 3300025250 Bacteria 329811
163 Ga0209677_100267 3300025253 Bacteria 35499
164 Ga0209759_1000011 3300025256 Bacteria 413027
165 Ga0209759_1025982 3300025256 Bacteria 1236
166 Ga0209129_1000086 3300025258 Bacteria 181543
167 Ga0209129_1000123 3300025258 Bacteria 133661
168 Ga0209129_1000316 3300025258 Bacteria 42919
169 Ga0209129_1000472 3300025258 Bacteria 29524
170 Ga0209129_1000633 3300025258 Bacteria 23502
171 Ga0209129_1000710 3300025258 Bacteria 21515
172 Ga0209129_1006698 3300025258 Bacteria 3643
173 Ga0209233_1000110 3300025261 Bacteria 260825
174 Ga0209233_1000166 3300025261 Bacteria 152270
175 Ga0209233_1000350 3300025261 Bacteria 43454
176 Ga0209565_1031971 3300025263 Bacteria 1020
177 Ga0209455_1008242 3300025272 Bacteria 2850
178 Ga0209673_1000015 3300025273 Bacteria 530618
179 Ga0209673_1000091 3300025273 Bacteria 201875
180 Ga0209673_1000919 3300025273 Bacteria 37355
181 Ga0209673_1002462 3300025273 Bacteria 12800
182 Ga0209673_1002974 3300025273 Bacteria 10578
183 Ga0209673_1004455 3300025273 Bacteria 7495
184 Ga0209130_1000015 3300025284 Bacteria 409631
185 Ga0209130_1000182 3300025284 Bacteria 89233
186 Ga0209130_1000185 3300025284 Bacteria 87796
187 Ga0209130_1000312 3300025284 Bacteria 57303
188 Ga0209675_1030297 3300025291 Bacteria 1292
189 Ga0209676_1008100 3300025292 Bacteria 4767
190 Ga0209676_1009574 3300025292 Bacteria 4165
191 Ga0209676_1010076 3300025292 Bacteria 3987
192 Ga0209676_1012133 3300025292 Bacteria 3415
193 Ga0209676_1028044 3300025292 Bacteria 1761
194 Ga0209676_1031387 3300025292 Bacteria 1611
195 Ga0209676_1037030 3300025292 Bacteria 1412
196 Ga0209025_1000024 3300025294 Bacteria 528324
197 Ga0209025_1000033 3300025294 Bacteria 414511
198 Ga0209025_1000407 3300025294 Bacteria 87041
199 Ga0209025_1001232 3300025294 Bacteria 35695
200 Ga0209025_1002342 3300025294 Bacteria 20420
201 Ga0209025_1010470 3300025294 Bacteria 6279
202 Ga0209025_1014042 3300025294 Bacteria 4973
203 Ga0209025_1015556 3300025294 Bacteria 4575
204 Ga0209025_1018388 3300025294 Bacteria 3964
205 Ga0209025_1035721 3300025294 Bacteria 2239
206 Ga0209025_1050259 3300025294 Bacteria 1669
207 Ga0209564_1000152 3300025295 Bacteria 167572
208 Ga0209564_1000845 3300025295 Bacteria 41202
209 Ga0209564_1001802 3300025295 Bacteria 19770
210 Ga0209564_1002399 3300025295 Bacteria 14953
211 Ga0209564_1009840 3300025295 Bacteria 4486
212 Ga0209564_1013227 3300025295 Bacteria 3525
213 Ga0209564_1030461 3300025295 Bacteria 1671
214 Ga0209758_1000046 3300025297 Bacteria 364931
215 Ga0209758_1000336 3300025297 Bacteria 87439
216 Ga0209758_1000602 3300025297 Bacteria 55848
217 Ga0209758_1000877 3300025297 Bacteria 41329
218 Ga0209758_1004509 3300025297 Bacteria 11543
219 Ga0209758_1013040 3300025297 Bacteria 4575
220 Ga0209758_1019376 3300025297 Bacteria 3282
221 Ga0209758_1023591 3300025297 Bacteria 2776
222 Ga0209758_1060159 3300025297 Bacteria 1259
223 Ga0209050_1004756 3300025298 Bacteria 8971
224 Ga0209050_1009663 3300025298 Bacteria 4893
225 Ga0209050_1016427 3300025298 Bacteria 3029
226 Ga0209256_1000188 3300025299 Bacteria 117988
227 Ga0209256_1000218 3300025299 Bacteria 106228
228 Ga0209256_1000531 3300025299 Bacteria 55283
229 Ga0209256_1000759 3300025299 Bacteria 41913
230 Ga0209256_1002589 3300025299 Bacteria 14402
231 Ga0209256_1004329 3300025299 Bacteria 9015
232 Ga0209256_1006233 3300025299 Bacteria 6422
233 Ga0209256_1016158 3300025299 Bacteria 2562
234 Ga0207426_1000012 3300025302 Bacteria 730942
235 Ga0207426_1000063 3300025302 Bacteria 358920
236 Ga0207426_1000144 3300025302 Bacteria 191590
237 Ga0207426_1000340 3300025302 Bacteria 87796
238 Ga0207426_1004140 3300025302 Bacteria 7272
239 Ga0207426_1023549 3300025302 Bacteria 2099
240 Ga0209051_1000084 3300025303 Bacteria 190324
241 Ga0209051_1001336 3300025303 Bacteria 21465
242 Ga0209051_1004188 3300025303 Bacteria 9003
243 Ga0209051_1005881 3300025303 Bacteria 7046
244 Ga0209051_1009489 3300025303 Bacteria 5011
245 Ga0209051_1016530 3300025303 Bacteria 3331
246 Ga0209051_1055965 3300025303 Bacteria 1276
247 Ga0209257_1009030 3300025304 Bacteria 5463
248 Ga0209257_1009036 3300025304 Bacteria 5459
249 Ga0209257_1009123 3300025304 Bacteria 5411
250 Ga0209257_1015380 3300025304 Bacteria 3189
251 Ga0209257_1036948 3300025304 Bacteria 1495
252 Ga0209257_1044544 3300025304 Bacteria 1294
253 Ga0207713_1032483 3300025735 Bacteria 2291
254 Ga0207695_10005499 3300025913 Bacteria 16771
255 Ga0207671_10000176 3300025914 Bacteria 98289
256 Ga0207681_10196225 3300025923 Bacteria 1547
257 Ga0207681_10358434 3300025923 Bacteria 1169
258 Ga0207650_10016150 3300025925 Bacteria 5213
259 Ga0207709_10173314 3300025935 Bacteria 1516
260 Ga0207711_10199320 3300025941 Bacteria 1826
261 Ga0207667_10278046 3300025949 Bacteria 1711
262 Ga0207668_10086867 3300025972 Bacteria 2286
263 Ga0207640_10083001 3300025981 Bacteria 2196
264 Ga0207639_10267885 3300026041 Bacteria 1497
265 Ga0207678_10045153 3300026067 Bacteria 3810
266 Ga0207702_10331923 3300026078 Bacteria 1451
267 Ga0207702_10869565 3300026078 Bacteria 893
268 Ga0207698_10067092 3300026142 Bacteria 2828
269 Ga0207698_10689472 3300026142 Bacteria 1015
270 Ga0209281_1000192 3300027111 Bacteria 140252
271 Ga0209371_1002637 3300027312 Bacteria 9803
272 Ga0268266_10059328 3300028379 Bacteria 3297
273 Ga0268266_10081975 3300028379 Bacteria 2813
274 Ga0307515_10077394 3300028794 Bacteria 4394
275 Ga0268256_1002270 3300030500 Bacteria 10014
276 Ga0307513_10106022 3300031456 Bacteria 2818
277 Ga0307513_10167532 3300031456 Bacteria 2079
278 Ga0307405_10002585 3300031731 Bacteria 8026
279 Ga0307413_10482056 3300031824 Bacteria 992
280 Ga0307406_10001781 3300031901 Bacteria 11773
281 Ga0307406_10207269 3300031901 Bacteria 1448
282 Ga0307412_10001828 3300031911 Bacteria 11789
283 Ga0237816_01952 3300039145 Bacteria 1632
284 Ga0436360_1375654 3300039438 Bacteria 2090
285 Ga0436361_0616510 3300039447 Bacteria 1013
286 Ga0436363_0887411 3300039450 Bacteria 1624
287 Ga0439436_0039178 3300041404 Bacteria 1362
288 Ga0439438_042655 3300041405 Bacteria 1173
289 Ga0439465_0034291 3300041413 Bacteria 1625
290 Ga0439465_0039202 3300041413 Bacteria 1529
291 Ga0451787_682831 3300041441 Bacteria 2052
292 Ga0451833_1012096 3300041491 Bacteria 2187
293 Ga0451837_0259953 3300041494 Bacteria 2028
294 Ga0451841_1019185 3300041498 Bacteria 1542
295 Ga0451845_0396315 3300041501 Bacteria 1568
296 Ga0451847_0124849 3300041503 Bacteria 3817
297 Ga0451849_0241149 3300041505 Bacteria 1363
298 Ga0451855_0112266 3300041511 Bacteria 3124
299 Ga0451855_1309579 3300041511 Bacteria 1578
300 Ga0439449_0015161 3300042007 Bacteria 2896
301 Ga0466965_0082582 3300044683 Bacteria 1626
302 Ga0466966_0021690 3300044684 Bacteria 4216
303 Ga0466966_0082022 3300044684 Bacteria 2007
304 Ga0466970_0003121 3300044765 Bacteria 8047
305 Ga0466957_0064581 3300044842 Bacteria 2252
306 Ga0466958_0020796 3300045836 Bacteria 3830
307 Ga0495617_014356 3300046452 Bacteria 2693
308 Ga0495592_0050931 3300046454 Bacteria 3076
309 Ga0495629_0391167 3300046459 Bacteria 945
310 Ga0495638_0000299 3300046460 Bacteria 63971
311 Ga0495638_0127301 3300046460 Bacteria 1500
312 Ga0495605_0003759 3300046474 Bacteria 9007
313 Ga0495605_0050626 3300046474 Bacteria 2026
314 Ga0495605_0109147 3300046474 Bacteria 1264
315 Ga0495662_0027480 3300046476 Bacteria 2748
316 Ga0495584_0125661 3300046491 Bacteria 1300
317 Ga0495585_0023818 3300046492 Bacteria 3513
318 Ga0495585_0095321 3300046492 Bacteria 1598
319 Ga0495607_0027801 3300046501 Bacteria 3494
320 Ga0495607_0103965 3300046501 Bacteria 1516
321 Ga0495583_0001834 3300046506 Bacteria 19816
322 Ga0495583_0028985 3300046506 Bacteria 2714
323 Ga0495606_0004205 3300046507 Bacteria 14567
324 Ga0495606_0061334 3300046507 Bacteria 2405
325 Ga0495606_0070080 3300046507 Bacteria 2213
326 Ga0495606_0133784 3300046507 Bacteria 1471
327 Ga0495610_0003518 3300046512 Bacteria 12149
328 Ga0495610_0108342 3300046512 Bacteria 1234
329 Ga0495610_0137584 3300046512 Bacteria 1054
330 Ga0495616_0014369 3300046513 Bacteria 4434
331 Ga0495616_0082853 3300046513 Bacteria 1531
332 Ga0495620_0026849 3300046515 Bacteria 2702
333 Ga0495620_0041911 3300046515 Bacteria 2004
334 Ga0495620_0052126 3300046515 Bacteria 1739
335 Ga0495628_0225948 3300046516 Bacteria 1404
336 Ga0495631_0003621 3300046518 Bacteria 8427
337 Ga0495631_0090134 3300046518 Bacteria 1320
338 Ga0495631_0138793 3300046518 Bacteria 1044
339 Ga0495632_0001582 3300046519 Bacteria 18768
340 Ga0495632_0035888 3300046519 Bacteria 2525
341 Ga0495637_0098017 3300046520 Bacteria 1149
342 Ga0495637_0180455 3300046520 Bacteria 783
343 Ga0495643_0036604 3300046522 Bacteria 2695
344 Ga0495643_0075030 3300046522 Bacteria 1770
345 Ga0495643_0081163 3300046522 Bacteria 1687
346 Ga0495648_0204325 3300046524 Bacteria 986
347 Ga0495654_0002878 3300046530 Bacteria 10802
348 Ga0495609_0010561 3300046538 Bacteria 4425
349 Ga0495609_0022699 3300046538 Bacteria 2891
350 Ga0495597_0024726 3300046542 Bacteria 2770
351 Ga0495633_0045729 3300046558 Bacteria 2072
352 Ga0495633_0214659 3300046558 Bacteria 881
353 Ga0495656_0019612 3300046615 Bacteria 2612
354 Ga0495668_0007244 3300046616 Bacteria 7117
355 Ga0495634_0077167 3300046642 Bacteria 2186
356 Ga0495611_0015546 3300046648 Bacteria 3253
357 Ga0495625_0004364 3300046660 Bacteria 13428
358 Ga0495625_0044036 3300046660 Bacteria 3233
359 Ga0495625_0205281 3300046660 Bacteria 1298
360 Ga0495625_0409653 3300046660 Bacteria 845
361 Ga0495661_0142024 3300046665 Bacteria 1305
362 Ga0495588_0100587 3300046674 Bacteria 1519
363 Ga0495624_0081841 3300046690 Bacteria 1999
364 Ga0495671_0139155 3300046692 Bacteria 1183
365 Ga0495649_0025304 3300046694 Bacteria 3306
366 Ga0495649_0157157 3300046694 Bacteria 1193
367 Ga0495600_0070820 3300046809 Bacteria 2278
368 Ga0495660_0028650 3300046810 Bacteria 3144
369 Ga0495604_0020147 3300047317 Bacteria 5329
370 Ga0495636_0010645 3300047318 Bacteria 3635
371 Ga0495672_0015932 3300047320 Bacteria 5089
372 Ga0495683_0017508 3300047323 Bacteria 3714
373 Ga0495687_057508 3300047443 Bacteria 1617
374 Ga0495687_125710 3300047443 Bacteria 917
375 Ga0495685_052846 3300047447 Bacteria 1376
376 Ga0495681_0092572 3300047470 Bacteria 1332
377 Ga0495686_0000688 3300047472 Bacteria 45757
378 Ga0495686_0007326 3300047472 Bacteria 8281
379 Ga0495686_0019662 3300047472 Bacteria 4510
380 Ga0495686_0066988 3300047472 Bacteria 2217
381 Ga0495686_0231443 3300047472 Bacteria 1046
382 Ga0495686_0289687 3300047472 Bacteria 907
383 Ga0495686_0341145 3300047472 Bacteria 817
384 Ga0495615_0006719 3300048090 Bacteria 2149
385 Ga0496101_0166779 3300048904 Bacteria 1691
386 Ga0496102_0006951 3300048905 Bacteria 9655
387 Ga0496103_0006250 3300048906 Bacteria 7119
388 Ga0496106_0007956 3300048909 Bacteria 7835
389 Ga0496106_0073382 3300048909 Bacteria 2618
390 Ga0496110_0170901 3300048913 Bacteria 1972
391 Ga0496111_0003317 3300048914 Bacteria 9952
392 Ga0496113_0047872 3300048916 Bacteria 3179
393 Ga0496113_0379103 3300048916 Bacteria 1135
394 Ga0496116_0019214 3300048919 Bacteria 5238
395 Ga0496116_0026581 3300048919 Bacteria 4229
396 Ga0496116_0042281 3300048919 Bacteria 3117
397 Ga0496116_0074978 3300048919 Bacteria 2125
398 Ga0496116_0081922 3300048919 Bacteria 1998
399 Ga0496116_0176274 3300048919 Bacteria 1151
400 Ga0496117_0004211 3300048920 Bacteria 16063
401 Ga0496117_0007443 3300048920 Bacteria 10695
402 Ga0496117_0019788 3300048920 Bacteria 5516
403 Ga0496117_0039979 3300048920 Bacteria 3456
404 Ga0496117_0101682 3300048920 Bacteria 1816
405 Ga0496117_0160544 3300048920 Bacteria 1317
406 Ga0496118_0008854 3300048921 Bacteria 10298
407 Ga0496118_0009023 3300048921 Bacteria 10169
408 Ga0496118_0016254 3300048921 Bacteria 6835
409 Ga0496118_0022988 3300048921 Bacteria 5429
410 Ga0496119_0011852 3300048922 Bacteria 7158
411 Ga0496119_0016635 3300048922 Bacteria 5582
412 Ga0496120_0003587 3300048923 Bacteria 13945
413 Ga0496120_0108845 3300048923 Bacteria 1451
414 Ga0496121_0000581 3300048924 Bacteria 68614
415 Ga0496121_0005515 3300048924 Bacteria 16164
416 Ga0496121_0006088 3300048924 Bacteria 15178
417 Ga0496121_0009856 3300048924 Bacteria 10901
418 Ga0496121_0035493 3300048924 Bacteria 4468
419 Ga0496121_0048431 3300048924 Bacteria 3615
420 Ga0496121_0053577 3300048924 Bacteria 3378
421 Ga0496121_0072341 3300048924 Bacteria 2768
422 Ga0496121_0126312 3300048924 Bacteria 1922
423 Ga0496121_0213114 3300048924 Bacteria 1367
424 Ga0496121_0300078 3300048924 Bacteria 1090
425 Ga0496122_0000009 3300048925 Bacteria 584024
426 Ga0496122_0010110 3300048925 Bacteria 9790
427 Ga0496122_0018408 3300048925 Bacteria 6456
428 Ga0496122_0021974 3300048925 Bacteria 5687
429 Ga0496122_0026276 3300048925 Bacteria 5023
430 Ga0496122_0033043 3300048925 Bacteria 4263
431 Ga0496122_0039858 3300048925 Bacteria 3740
432 Ga0496122_0041423 3300048925 Bacteria 3641
433 Ga0496122_0049563 3300048925 Bacteria 3213
434 Ga0496122_0073942 3300048925 Bacteria 2413
435 Ga0496123_0000020 3300048926 Bacteria 388748
436 Ga0496123_0005995 3300048926 Bacteria 11950
437 Ga0496123_0007612 3300048926 Bacteria 10141
438 Ga0496123_0013530 3300048926 Bacteria 6834
439 Ga0496123_0025599 3300048926 Bacteria 4444
440 Ga0496123_0026213 3300048926 Bacteria 4374
441 Ga0496123_0042850 3300048926 Bacteria 3117
442 Ga0496123_0081438 3300048926 Bacteria 1967
443 Ga0496123_0164043 3300048926 Bacteria 1181
444 Ga0496123_0182720 3300048926 Bacteria 1093
445 Ga0496124_0004941 3300048927 Bacteria 15282
446 Ga0496124_0015396 3300048927 Bacteria 7331
447 Ga0496124_0035902 3300048927 Bacteria 4331
448 Ga0496124_0038092 3300048927 Bacteria 4177
449 Ga0496124_0047300 3300048927 Bacteria 3681
450 Ga0496124_0050244 3300048927 Bacteria 3554
451 Ga0496124_0062089 3300048927 Bacteria 3128
452 Ga0496124_0068333 3300048927 Bacteria 2953
453 Ga0496124_0174779 3300048927 Bacteria 1659
454 Ga0496124_0257429 3300048927 Bacteria 1287
455 Ga0496125_0002192 3300048928 Bacteria 26081
456 Ga0496125_0009453 3300048928 Bacteria 10011
457 Ga0496126_0017025 3300048929 Bacteria 7252
458 Ga0496126_0104013 3300048929 Bacteria 2481
459 Ga0496126_0176292 3300048929 Bacteria 1818
460 Ga0496126_0222981 3300048929 Bacteria 1582
461 Ga0495678_008193 3300049459 Bacteria 5305
462 Ga0495678_008483 3300049459 Bacteria 5178
463 Ga0495678_070657 3300049459 Bacteria 1281
464 Ga0495682_0051415 3300049460 Bacteria 1499
465 Ga0501031_0029846 3300049568 Bacteria 3557
466 Ga0501032_0082367 3300049569 Bacteria 2141
467 Ga0501032_0098084 3300049569 Bacteria 1942
468 Ga0501033_0000986 3300049570 Bacteria 25898
469 Ga0501034_0009938 3300049571 Bacteria 9945
470 Ga0501034_0033123 3300049571 Bacteria 5245
471 Ga0501034_0108890 3300049571 Bacteria 2762
472 Ga0501034_0365055 3300049571 Bacteria 1370
473 Ga0501036_0086253 3300049572 Bacteria 2654
474 Ga0501038_0311247 3300049574 Bacteria 1234
475 Ga0501039_0102104 3300049575 Bacteria 2238
476 Ga0501043_0295347 3300049579 Bacteria 1239
477 Ga0501046_0206111 3300049580 Bacteria 1461
478 Ga0501047_0204311 3300049581 Bacteria 1835
479 Ga0501048_0194381 3300049582 Bacteria 1438
480 Ga0501067_0000688 3300049583 Bacteria 18195
481 Ga0501067_0056919 3300049583 Bacteria 2166
482 Ga0501068_0079644 3300049584 Bacteria 2009
483 Ga0501073_0012900 3300049589 Bacteria 6092
484 Ga0501073_0028289 3300049589 Bacteria 4006
485 Ga0501073_0228449 3300049589 Bacteria 1286
486 Ga0501073_0279246 3300049589 Bacteria 1152
487 Ga0501080_0013741 3300049742 Bacteria 7454
488 Ga0501080_0098860 3300049742 Bacteria 2708
489 Ga0501083_0004419 3300049744 Bacteria 9919
490 Ga0501083_0007506 3300049744 Bacteria 7725
491 Ga0501280_001569 3300049776 Bacteria 4123
492 Ga0501035_0001767 3300049822 Bacteria 21812
493 Ga0501035_0203277 3300049822 Bacteria 1698
494 Ga0501044_0074123 3300049823 Bacteria 3459
495 nmdc:mga03683_59285_c1 3300050489 Bacteria 1614
496 nmdc:mga00v17_133_c2 3300050491 Bacteria 35968
497 nmdc:mga00v17_227463_c1 3300050491 Bacteria 1208
498 nmdc:mga0yw44_12807_c1 3300050492 Bacteria 4387
499 nmdc:mga0yw44_38792_c1 3300050492 Bacteria 2821
500 nmdc:mga0k408_54169_c1 3300050493 Bacteria 2325
501 nmdc:mga06z11_64413_c1 3300050494 Bacteria 1921
502 nmdc:mga07m45_131759_c1 3300050496 Bacteria 1446
503 nmdc:mga0sz30_68451_c1 3300050516 Bacteria 1525
504 Ga0500610_0051524 3300053079 Bacteria 2144
505 Ga0500578_0108565 3300053086 Bacteria 1750
506 Ga0500646_0060954 3300053090 Bacteria 1111
507 Ga0500650_0049985 3300053098 Bacteria 1941
508 Ga0500556_0051888 3300053104 Bacteria 1487
509 Ga0500557_019144 3300053105 Bacteria 1923
510 Ga0500569_003997 3300053109 Bacteria 3064
511 Ga0500594_0001496 3300053118 Bacteria 5082
512 Ga0500594_0016853 3300053118 Bacteria 1781
513 Ga0500607_163219 3300053121 Bacteria 1015
514 Ga0500618_000046 3300053125 Bacteria 109891
515 Ga0500618_007646 3300053125 Bacteria 3066
516 Ga0500618_013097 3300053125 Bacteria 2153
517 Ga0500618_013268 3300053125 Bacteria 2134
518 Ga0500618_017561 3300053125 Bacteria 1778
519 Ga0500658_0000767 3300053134 Bacteria 13217
520 Ga0500658_0038470 3300053134 Bacteria 1907
521 Ga0500568_0000108 3300053139 Bacteria 77013
522 Ga0500568_0002150 3300053139 Bacteria 11883
523 Ga0500568_0014071 3300053139 Bacteria 3625
524 Ga0500573_0001555 3300053140 Bacteria 11071
525 Ga0500577_0066311 3300053142 Bacteria 1404
526 Ga0500577_0166121 3300053142 Bacteria 942
527 Ga0500590_000222 3300053148 Bacteria 17111
528 Ga0500616_0001019 3300053153 Bacteria 29833
529 Ga0500616_0009546 3300053153 Bacteria 5896
530 Ga0500616_0155131 3300053153 Bacteria 1055
531 Ga0500622_0000653 3300053156 Bacteria 30881
532 Ga0500622_0066099 3300053156 Bacteria 1836
533 Ga0500633_0018749 3300053160 Bacteria 2056
534 Ga0500633_0054053 3300053160 Bacteria 1395
535 Ga0501084_0010280 3300054114 Bacteria 7742
536 Ga0501082_0004072 3300060353 Bacteria 12754
537 Ga0501082_0040155 3300060353 Bacteria 4037
538 Ga0466962_0161745 3300061719 Bacteria 1088
539 2509388340 2509276021 Bacteria 7634384
540 2509443904 2509276033 Bacteria 7180565
541 2510131549 2510065019 Bacteria 6903379
542 2510843118 2510461069 Bacteria 5505000
543 2510897855 2510461076 Bacteria 8618824
544 2511136218 2510917022 Bacteria 6504556
545 2511175364 2510917026 Bacteria 7046020
546 2511185619 2510917028 Bacteria 6185411
547 2511194414 2510917030 Bacteria 7460662
548 2511390098 2511231027 Bacteria 5013807
549 2513571139 2513237084 Bacteria 7231967
550 2513579316 2513237085 Bacteria 7695351
551 2513596791 2513237088 Bacteria 6927906
552 2513632232 2513237093 Bacteria 7545552
553 2513713282 2513237103 Bacteria 7647401
554 2513870285 2513237138 Bacteria 7368160
555 2513910431 2513237144 Bacteria 7530820
556 2513928383 2513237146 Bacteria 7166346
557 2514020939 2513237162 Bacteria 7468464
558 2515110482 2515075009 Bacteria 7288508
559 2515636916 2515154113 Bacteria 7807172
560 2515647121 2515154114 Bacteria 7848616
561 2515659533 2515154116 Bacteria 7552979
562 2515743006 2515154134 Bacteria 7220242
563 2517039183 2516653077 Bacteria 7555578
564 2517079429 2516653085 Bacteria 7346596
565 2517093373 2517093000 Bacteria 7412387
566 2517409599 2517287029 Bacteria 6905599
567 2520380020 2519899620 Bacteria 6499161
568 2524457583 2524023209 Bacteria 6679728
569 2530647724 2529292951 Bacteria 6916614
570 2535515163 2534681796 Bacteria 7146037
571 2561467365 2558860983 Bacteria 4133860
572 2585203741 2582581294 Bacteria 6626667
573 2585227530 2582581298 Bacteria 7315509
574 2585229055 2582581299 Bacteria 6518058
575 2585259509 2582581304 Bacteria 5831370
576 2585275381 2582581307 Bacteria 6597605
577 2585283442 2582581308 Bacteria 7413247
578 2585325913 2582581315 Bacteria 7318924
579 2585330084 2582581316 Bacteria 7774528
580 2585398482 2582581867 Bacteria 7184437
581 2585528386 2585427526 Bacteria 7258840
582 2585536382 2585427527 Bacteria 7273426
583 2585539777 2585427528 Bacteria 6842387
584 2585550963 2585427529 Bacteria 7395659
585 2585556947 2585427530 Bacteria 7383882
586 2585560176 2585427531 Bacteria 6992870
587 2585819371 2585427590 Bacteria 6824633
588 2585837760 2585427593 Bacteria 7141551
589 2585844586 2585427594 Bacteria 6180594
590 2585901554 2585427608 Bacteria 6544331
591 2585905642 2585427609 Bacteria 6667127
592 2585994506 2585427633 Bacteria 6413184
593 2585998953 2585427634 Bacteria 6455027
594 2587979242 2585428125 Bacteria 6662905
595 2599419103 2599185170 Bacteria 7295545
596 2599719492 2599185236 Bacteria 6875203
597 2600192490 2599185352 Bacteria 7228948
598 2600374781 2600254933 Bacteria 4750527
599 2616295748 2615840624 Bacteria 6557588
600 2616306257 2615840626 Bacteria 7921970
601 2616553479 2615840698 Bacteria 7319877
602 2617386652 2617270742 Bacteria 6808054
603 2643808651 2643221557 Bacteria 7184309
604 2643810481 2643221558 Bacteria 5460675
605 2644007417 2643221599 Bacteria 6292121
606 2644066327 2643221610 Bacteria 7480339
607 2644109354 2643221618 Bacteria 7717186
608 2644149957 2643221626 Bacteria 8069654
609 2644190668 2643221634 Bacteria 6705461
610 2644241476 2643221643 Bacteria 5749658
611 2644297495 2643221653 Bacteria 4569637
612 2644307619 2643221655 Bacteria 7722067
613 2644332394 2643221659 Bacteria 7890716
614 2644377879 2643221668 Bacteria 7306521
615 2644415460 2643221675 Bacteria 7473456
616 2644450138 2643221680 Bacteria 7473610
617 2644544128 2643221698 Bacteria 7756764
618 2644613708 2643221712 Bacteria 7729434
619 2644655748 2643221719 Bacteria 4568197
620 2644678067 2643221723 Bacteria 7095460
621 2644687695 2643221726 Bacteria 7455827
622 2644733656 2643221734 Bacteria 5365412
623 2644742118 2643221736 Bacteria 6608466
624 2671112433 2667528174 Bacteria 6435400
625 2719179647 2718217882 Bacteria 6556348
626 2719384259 2718217927 Bacteria 6972593
627 2719663993 2718217997 Bacteria 6740740
628 2719730317 2718218009 Bacteria 6478651
629 2720490412 2718218199 Bacteria 6740745
630 2720611790 2718218232 Bacteria 6720332
631 2720618647 2718218233 Bacteria 6662049
632 2720630046 2718218235 Bacteria 6630699
633 2720773741 2718218269 Bacteria 6906114
634 2721145740 2718218363 Bacteria 6524337
635 2721157272 2718218365 Bacteria 6274507
636 2721162619 2718218366 Bacteria 6425255
637 2721397973 2718218423 Bacteria 6438183
638 2722838789 2721755514 Bacteria 6424414
639 2723025411 2721755556 Bacteria 6745503
640 2723558994 2721755684 Bacteria 6859907
641 2723565601 2721755685 Bacteria 6704835
642 2724036783 2721755809 Bacteria 6438790
643 2724043073 2721755810 Bacteria 6479005
644 2724088348 2721755819 Bacteria 6906405
645 2724102866 2721755822 Bacteria 6726041
646 2724108733 2721755823 Bacteria 6752556
647 2725950167 2724679232 Bacteria 7646494
648 2730106347 2728369352 Bacteria 6745171
649 2730162884 2728369365 Bacteria 6555560
650 2730296904 2728369397 Bacteria 6274511
651 2738803768 2738541293 Bacteria 7065685
652 2738945652 2738541317 Bacteria 5340176
653 2739034636 2738541333 Bacteria 7106503
654 2757570762 2757320392 Bacteria 3737298
655 2766065619 2765235942 Bacteria 7445910
656 2776270476 2775506902 Bacteria 6208009
657 2776281605 2775506904 Bacteria 5954060
658 2776912216 2775507049 Bacteria 6284736
659 2778174238 2775507266 Bacteria 7392367
660 2793295137 2791355256 Bacteria 6798008
661 2793315346 2791355259 Bacteria 7254731
662 2793320207 2791355260 Bacteria 6598818
663 2793326073 2791355261 Bacteria 6661293
664 2793332509 2791355262 Bacteria 6774204
665 2793343253 2791355263 Bacteria 6872478
666 2793351046 2791355264 Bacteria 6429314
667 2793353302 2791355265 Bacteria 6539969
668 2793362685 2791355266 Bacteria 7116587
669 2793364756 2791355267 Bacteria 7222458
670 2805927507 2802429605 Bacteria 6875453
671 2805932291 2802429606 Bacteria 6346811
672 2806043933 2802429633 Bacteria 7341974
673 2806052249 2802429634 Bacteria 7083200
674 2806058550 2802429635 Bacteria 7650140
675 2806067046 2802429636 Bacteria 7597525
676 2806074791 2802429637 Bacteria 7067217
677 2819243155 2818991272 Bacteria 4622173
678 2819608340 2818991448 Bacteria 6772224
679 2819643396 2818991453 Bacteria 7181617
680 2819684636 2818991461 Bacteria 7026071
681 2819717078 2818991467 Bacteria 5893227
682 2821123703 2821123053 Bacteria 7836056
683 2837653283 2837651117 Bacteria 3772164
684 2838022154 2838016132 Bacteria 6577831
685 2838024567 2838022645 Bacteria 6494267
686 2838029229 2838029111 Bacteria 6603031
687 2838037210 2838035591 Bacteria 7166484
688 2838044338 2838042994 Bacteria 6046894
689 2838051397 2838048938 Bacteria 6044578
690 2838066658 2838061910 Bacteria 6794874
691 2838073711 2838068647 Bacteria 6208656
692 2838663602 2838661181 Bacteria 7385261
693 2838673140 2838668709 Bacteria 6671819
694 2838680673 2838680041 Bacteria 6545511
695 2838692667 2838686498 Bacteria 7807632
696 2838695294 2838694306 Bacteria 6853137
697 2838703942 2838701080 Bacteria 6669771
698 2838708670 2838707686 Bacteria 6619912
699 2838732739 2838729681 Bacteria 7400765
700 2838739266 2838736955 Bacteria 5760694
701 2838745634 2838742623 Bacteria 7396178
702 2839997451 2839993093 Bacteria 5512535
703 2840768923 2840764183 Bacteria 6358399
704 2841763533 2841760612 Bacteria 6454112
705 2841843164 2841840854 Bacteria 5761912
706 2841855278 2841851746 Bacteria 7532261
707 2841866730 2841864319 Bacteria 6742987
708 2842080095 2842077413 Bacteria 6508645
709 2842112288 2842110456 Bacteria 7656360
710 2842120715 2842118031 Bacteria 7033875
711 2842142946 2842140634 Bacteria 5759631
712 2842148266 2842146304 Bacteria 5957337
713 2842161692 2842156927 Bacteria 6894975
714 2842170095 2842163707 Bacteria 6916235
715 2842185309 2842180545 Bacteria 6888678
716 2842192980 2842192696 Bacteria 6147454
717 2842200328 2842198810 Bacteria 6608673
718 2842206851 2842205361 Bacteria 6340321
719 2842218711 2842217011 Bacteria 7497767
720 2842233247 2842229732 Bacteria 7475766
721 2842238082 2842237096 Bacteria 6620661
722 2842248749 2842243621 Bacteria 7421798
723 2842253331 2842250916 Bacteria 6579627
724 2842261892 2842257432 Bacteria 7401195
725 2842267363 2842264693 Bacteria 6472963
726 2842277044 2842271015 Bacteria 7807131
727 2842280456 2842278818 Bacteria 6340002
728 2842289403 2842285085 Bacteria 6011953
729 2842293755 2842291075 Bacteria 7076806
730 2842300803 2842298080 Bacteria 6123127
731 2842306401 2842304105 Bacteria 7023636
732 2842312545 2842311132 Bacteria 6616990
733 2842322577 2842317721 Bacteria 6793725
734 2842342993 2842341865 Bacteria 7003929
735 2842358078 2842357229 Bacteria 6485165
736 2842367283 2842363717 Bacteria 6844742
737 2842371136 2842370503 Bacteria 7038661
738 2842380152 2842377471 Bacteria 7140707
739 2842387223 2842384541 Bacteria 7057858
740 2842401247 2842395702 Bacteria 6780583
741 2842406751 2842402390 Bacteria 6681310
742 2842413753 2842409023 Bacteria 6687331
743 2842420285 2842415677 Bacteria 6596907
744 2842427159 2842422224 Bacteria 6239196
745 2842431385 2842428310 Bacteria 6767288
746 2842437720 2842434925 Bacteria 6502746
747 2842444535 2842441272 Bacteria 6769273
748 2842450282 2842447887 Bacteria 6754142
749 2842465637 2842462802 Bacteria 6588055
750 2842472447 2842469257 Bacteria 6752936
751 2842476341 2842475841 Bacteria 6603183
752 2842482417 2842482326 Bacteria 7212537
753 2842492381 2842489311 Bacteria 6620893
754 2842501940 2842495871 Bacteria 6820686
755 2842502757 2842502639 Bacteria 6604161
756 2842509275 2842509118 Bacteria 6850950
757 2842872088 2842871566 Bacteria 4827117
758 2844109563 2844104063 Bacteria 6440972
759 2844167239 2844163670 Bacteria 7266046
760 2844455893 2844454524 Bacteria 7952546
761 2851182780 2851182111 Bacteria 6047226
762 2851251670 2851246043 Bacteria 6439203
763 2852388561 2852387548 Bacteria 8025568
764 2854898356 2854896431 Bacteria 5869725
765 2854919069 2854916844 Bacteria 5725939
766 2857522171 2857516855 Bacteria 7787325
767 2857531265 2857531043 Bacteria 6754041
768 2889794269 2889790730 Bacteria 5689708
769 2889916772 2889914905 Bacteria 5702301
770 2894821591 2894817345 Bacteria 4892941
771 2899804420 2899803654 Bacteria 5577784
772 2913310669 2913308742 Bacteria 5350706
773 2917554680 2917554339 Bacteria 4987857
774 2917701427 2917699015 Bacteria 7043791
775 2919101268 2919100787 Bacteria 7710546
776 2919171998 2919171160 Bacteria 6499771
777 2919408867 2919408235 Bacteria 6149349
778 2920824404 2920822456 Bacteria 6897201
779 2923557265 2923556063 Bacteria 6793593
780 2928524026 2928521798 Bacteria 4960112
781 2933019475 2933016740 Bacteria 6355406
782 2933573470 2933570622 Bacteria 7023390
783 2933587617 2933586486 Bacteria 7667493
784 2933604139 2933599457 Bacteria 5858799
785 2935895817 2935894831 Bacteria 6620579
786 2935907734 2935901341 Bacteria 7341747
787 2936368835 2936367885 Bacteria 7324495
788 2936377085 2936375103 Bacteria 6652732
789 2936388338 2936381700 Bacteria 7006523
790 2941505088 2941499720 Bacteria 7599444
791 2954012971 2954011201 Bacteria 4762601
792 2989777586 2989776772 Bacteria 4843317
793 2996892112 2996887358 Bacteria 5795980
794 2996893535 2996893221 Bacteria 5823108
795 3002144913 3002141150 Bacteria 5254435
796 3005411297 3005409236 Bacteria 7188837
797 3005422745 3005416602 Bacteria 7064308
798 3005446251 3005445848 Bacteria 6906074
799 3005452904 3005452660 Bacteria 5889319
800 639646754 639633055 Bacteria 7751309
801 8005247249 8005246636 Bacteria 4933972
802 8005263561 8005258706 Bacteria 6184835
803 8005278973 8005275841 Bacteria 6929066
804 8005283659 8005282627 Bacteria 6675747
805 8005291003 8005289223 Bacteria 6634003
806 8005303927 8005301065 Bacteria 6614431
807 8005308747 8005307578 Bacteria 7395396
808 8005321719 8005314921 Bacteria 7072929
809 8005326639 8005321885 Bacteria 5795980
810 8005377341 8005376324 Bacteria 6590079
811 8005387212 8005382845 Bacteria 6732062
812 8005401971 8005395548 Bacteria 6806915
813 8005433011 8005430974 Bacteria 6689030
814 8005461121 8005460587 Bacteria 7157962
815 8005486075 8005484373 Bacteria 6297373
816 8005498735 8005497431 Bacteria 6477605
817 8005543839 8005542996 Bacteria 7077758
818 8005560721 8005556819 Bacteria 6908598
819 8005569703 8005563573 Bacteria 7153261
820 8005577012 8005570704 Bacteria 6957481
821 8005619930 8005619151 Bacteria 7030230
822 8005628527 8005626139 Bacteria 6534237
823 8005650213 8005645114 Bacteria 6950293
824 8005661833 8005658619 Bacteria 4500593
825 8005670146 8005668836 Bacteria 6953162
826 8005685051 8005682033 Bacteria 6726518
827 8005690354 8005688590 Bacteria 6610080
828 8005700295 8005695170 Bacteria 6912330
829 8018133210 8018127388 Bacteria 7351159
830 8018151980 8018150411 Bacteria 5549903
831 8018167809 8018163183 Bacteria 7277977
832 8018180234 8018176218 Bacteria 6896178
833 8023684131 8023680758 Bacteria 7729763
834 8024480378 8024479707 Bacteria 6954785
835 8024491360 8024486573 Bacteria 6540512
836 8024503599 8024501048 Bacteria 6427847
837 8045867261 8045864390 Bacteria 5043873
838 8046771101 8046767195 Bacteria 7547379
839 8056375713 8056375014 Bacteria 7006639
840 8056386034 8056382006 Bacteria 6408074
841 8056879205 8056875544 Bacteria 4355797
842 8057534542 8057529695 Bacteria 6306553
843 8057579869 8057575449 Bacteria 7367519
844 8057881009 8057874678 Bacteria 7494653
845 JGI25154J39366_1013091
846 JGI24740J21852_10000263
847 JGI25155J39150_1000023
848 JGI25156J39149_1000094
849 JGI25162J39368_1000177
850 JGI25162J39368_1000788
851 JGI25154J39366_1000213
852 JGI25154J39366_1013929
853 JGI25158J39367_1000158
854 JGI25158J39367_1001611
855 JGI25157J39369_1000043
856 JGI25152J39213_1001662
857 JGI25152J39213_1003959
858 JGI25152J39213_1004756
859 JGI25152J39213_1012579
860 JGI25152J39213_1014458
861 JGI25152J39213_1015644
862 JGI25150J39212_1000378
863 JGI25150J39212_1004689
864 JGI25150J39212_1006376
865 JGI25150J39212_1010896
866 JGI25150J39212_1023141
867 JGI25159J45721_1000034
868 JGI25159J45721_1000489
869 JGI25159J45721_1009426
870 JGI25151J46595_10000565
871 JGI25151J46595_10001463
872 JGI25151J46595_10002461
873 JGI25151J46595_10006390
874 JGI25151J46595_10022314
875 JGI25151J46595_10048823
876 JGI25151J46595_10062025
877 JGI25165J46597_1000415
878 JGI25165J46597_1000555
879 JGI25165J46597_1003155
880 JGI25153J46596_10000833
881 JGI25153J46596_10007280
882 JGI25153J46596_10010202
883 JGI25153J46596_10026027
884 JGI25153J46596_10037224
885 JGI25153J46596_10037406
886 rootH1_10012486
887 rootH1_10156603
888 JGI25160J50197_1000046
889 JGI25160J50197_1000096
890 JGI25160J50197_1000703
891 JGI25160J50197_1008324
892 JGI25160J50197_1029684
893 JGI25161J50226_1000031
894 JGI25161J50226_1000735
895 JGI25161J50226_1001481
896 Ga0055526_1002004
897 Ga0055526_1004323
898 Ga0055526_1004833
899 Ga0055526_1016842
900 Ga0055524_1001011
901 Ga0055524_1003205
902 Ga0055524_1006519
903 Ga0055524_1007117
904 Ga0055524_1018423
905 Ga0055536_1012982
906 Ga0055528_1000146
907 Ga0055528_1000636
908 Ga0055528_1002006
909 Ga0055528_1006732
910 Ga0055528_1011522
911 Ga0055528_1017754
912 Ga0055530_10037531
913 Ga0055540_1000111
914 Ga0055540_1008488
915 Ga0055540_1008672
916 Ga0055540_1017841
917 Ga0055540_1021187
918 Ga0055540_1024277
919 Ga0055531_10009694
920 Ga0055531_10012435
921 Ga0055531_10014881
922 Ga0055543_1000208
923 Ga0055543_1000402
924 Ga0055543_1000637
925 Ga0055543_1003374
926 Ga0055543_1006055
927 Ga0065165_1000389
928 Ga0065165_1000468
929 Ga0065165_1000693
930 Ga0065165_1003090
931 Ga0065165_1008980
932 Ga0065165_1010930
933 Ga0065165_1028682
934 Ga0070670_100000173
935 Ga0070666_10107996
936 Ga0070682_100181413
937 Ga0070668_100093172
938 Ga0070669_100624789
939 Ga0070671_100012822
940 Ga0070671_100357284
941 Ga0070667_100146697
942 Ga0070663_100067648
943 Ga0068853_100255608
944 Ga0070665_100018373
945 Ga0070665_100060832
946 Ga0068855_100345760
947 Ga0068856_100083561
948 Ga0068856_100135663
949 Ga0068852_100080225
950 Ga0068863_100510787
951 Ga0075365_10009533
952 Ga0075365_10012660
953 Ga0075365_10033219
954 Ga0075365_10273664
955 Ga0075363_100286759
956 Ga0075364_10000875
957 Ga0075362_10068711
958 Ga0075369_10002530
959 Ga0075369_10009993
960 Ga0075366_10011977
961 Ga0075366_10432235
962 Ga0075370_10021085
963 Ga0075370_10023191
964 Ga0079104_1000069
965 Ga0105251_10010923
966 Ga0105250_10030703
967 Ga0105240_10006772
968 Ga0105247_10206393
969 Ga0105243_10044233
970 Ga0105243_10162016
971 Ga0105248_10005517
972 Ga0105237_10010394
973 Ga0105237_10283757
974 Ga0123340_1057202
975 Ga0123341_1000452
976 Ga0123341_1082950
977 Ga0123341_1083348
978 Ga0123342_1014969
979 Ga0123342_1029957
980 Ga0105239_10012926
981 Ga0157322_1003048
982 Ga0157314_1004303
983 Ga0157373_10017343
984 Ga0157373_10087897
985 Ga0157370_10003911
986 Ga0157369_10127636
987 Ga0157369_10137547
988 Ga0171463_1008
989 Ga0163162_10400123
990 Ga0163163_10401145
991 Ga0157379_10457298
992 Ga0182005_1003486
993 Ga0183363_1335
994 Ga0209435_100011
995 Ga0209436_100077
996 Ga0209436_100305
997 Ga0209437_100036
998 Ga0209437_100086
999 Ga0207425_1000012
1000 Ga0207425_1008931
1001 Ga0207425_1010568
1002 Ga0207425_1017543
1003 Ga0209646_1000024
1004 Ga0209646_1006810
1005 Ga0209646_1009330
1006 Ga0209026_1000030
1007 Ga0209677_100267
1008 Ga0209759_1000011
1009 Ga0209759_1025982
1010 Ga0209129_1000086
1011 Ga0209129_1000123
1012 Ga0209129_1000316
1013 Ga0209129_1000472
1014 Ga0209129_1000633
1015 Ga0209129_1000710
1016 Ga0209129_1006698
1017 Ga0209233_1000110
1018 Ga0209233_1000166
1019 Ga0209233_1000350
1020 Ga0209565_1031971
1021 Ga0209455_1008242
1022 Ga0209673_1000015
1023 Ga0209673_1000091
1024 Ga0209673_1000919
1025 Ga0209673_1002462
1026 Ga0209673_1002974
1027 Ga0209673_1004455
1028 Ga0209130_1000015
1029 Ga0209130_1000182
1030 Ga0209130_1000185
1031 Ga0209130_1000312
1032 Ga0209675_1030297
1033 Ga0209676_1008100
1034 Ga0209676_1009574
1035 Ga0209676_1010076
1036 Ga0209676_1012133
1037 Ga0209676_1028044
1038 Ga0209676_1031387
1039 Ga0209676_1037030
1040 Ga0209025_1000024
1041 Ga0209025_1000033
1042 Ga0209025_1000407
1043 Ga0209025_1001232
1044 Ga0209025_1002342
1045 Ga0209025_1010470
1046 Ga0209025_1014042
1047 Ga0209025_1015556
1048 Ga0209025_1018388
1049 Ga0209025_1035721
1050 Ga0209025_1050259
1051 Ga0209564_1000152
1052 Ga0209564_1000845
1053 Ga0209564_1001802
1054 Ga0209564_1002399
1055 Ga0209564_1009840
1056 Ga0209564_1013227
1057 Ga0209564_1030461
1058 Ga0209758_1000046
1059 Ga0209758_1000336
1060 Ga0209758_1000602
1061 Ga0209758_1000877
1062 Ga0209758_1004509
1063 Ga0209758_1013040
1064 Ga0209758_1019376
1065 Ga0209758_1023591
1066 Ga0209758_1060159
1067 Ga0209050_1004756
1068 Ga0209050_1009663
1069 Ga0209050_1016427
1070 Ga0209256_1000188
1071 Ga0209256_1000218
1072 Ga0209256_1000531
1073 Ga0209256_1000759
1074 Ga0209256_1002589
1075 Ga0209256_1004329
1076 Ga0209256_1006233
1077 Ga0209256_1016158
1078 Ga0207426_1000012
1079 Ga0207426_1000063
1080 Ga0207426_1000144
1081 Ga0207426_1000340
1082 Ga0207426_1004140
1083 Ga0207426_1023549
1084 Ga0209051_1000084
1085 Ga0209051_1001336
1086 Ga0209051_1004188
1087 Ga0209051_1005881
1088 Ga0209051_1009489
1089 Ga0209051_1016530
1090 Ga0209051_1055965
1091 Ga0209257_1009030
1092 Ga0209257_1009036
1093 Ga0209257_1009123
1094 Ga0209257_1015380
1095 Ga0209257_1036948
1096 Ga0209257_1044544
1097 Ga0207713_1032483
1098 Ga0207695_10005499
1099 Ga0207671_10000176
1100 Ga0207681_10196225
1101 Ga0207681_10358434
1102 Ga0207650_10016150
1103 Ga0207709_10173314
1104 Ga0207711_10199320
1105 Ga0207667_10278046
1106 Ga0207668_10086867
1107 Ga0207640_10083001
1108 Ga0207639_10267885
1109 Ga0207678_10045153
1110 Ga0207702_10331923
1111 Ga0207702_10869565
1112 Ga0207698_10067092
1113 Ga0207698_10689472
1114 Ga0209281_1000192
1115 Ga0209371_1002637
1116 Ga0268266_10059328
1117 Ga0268266_10081975
1118 Ga0307515_10077394
1119 Ga0268256_1002270
1120 Ga0307513_10106022
1121 Ga0307513_10167532
1122 Ga0307405_10002585
1123 Ga0307413_10482056
1124 Ga0307406_10001781
1125 Ga0307406_10207269
1126 Ga0307412_10001828
1127 Ga0237816_01952
1128 Ga0436360_1375654
1129 Ga0436361_0616510
1130 Ga0436363_0887411
1131 Ga0439436_0039178
1132 Ga0439438_042655
1133 Ga0439465_0034291
1134 Ga0439465_0039202
1135 Ga0451787_682831
1136 Ga0451833_1012096
1137 Ga0451837_0259953
1138 Ga0451841_1019185
1139 Ga0451845_0396315
1140 Ga0451847_0124849
1141 Ga0451849_0241149
1142 Ga0451855_0112266
1143 Ga0451855_1309579
1144 Ga0439449_0015161
1145 Ga0466965_0082582
1146 Ga0466966_0021690
1147 Ga0466966_0082022
1148 Ga0466970_0003121
1149 Ga0466957_0064581
1150 Ga0466958_0020796
1151 Ga0495617_014356
1152 Ga0495592_0050931
1153 Ga0495629_0391167
1154 Ga0495638_0000299
1155 Ga0495638_0127301
1156 Ga0495605_0003759
1157 Ga0495605_0050626
1158 Ga0495605_0109147
1159 Ga0495662_0027480
1160 Ga0495584_0125661
1161 Ga0495585_0023818
1162 Ga0495585_0095321
1163 Ga0495607_0027801
1164 Ga0495607_0103965
1165 Ga0495583_0001834
1166 Ga0495583_0028985
1167 Ga0495606_0004205
1168 Ga0495606_0061334
1169 Ga0495606_0070080
1170 Ga0495606_0133784
1171 Ga0495610_0003518
1172 Ga0495610_0108342
1173 Ga0495610_0137584
1174 Ga0495616_0014369
1175 Ga0495616_0082853
1176 Ga0495620_0026849
1177 Ga0495620_0041911
1178 Ga0495620_0052126
1179 Ga0495628_0225948
1180 Ga0495631_0003621
1181 Ga0495631_0090134
1182 Ga0495631_0138793
1183 Ga0495632_0001582
1184 Ga0495632_0035888
1185 Ga0495637_0098017
1186 Ga0495637_0180455
1187 Ga0495643_0036604
1188 Ga0495643_0075030
1189 Ga0495643_0081163
1190 Ga0495648_0204325
1191 Ga0495654_0002878
1192 Ga0495609_0010561
1193 Ga0495609_0022699
1194 Ga0495597_0024726
1195 Ga0495633_0045729
1196 Ga0495633_0214659
1197 Ga0495656_0019612
1198 Ga0495668_0007244
1199 Ga0495634_0077167
1200 Ga0495611_0015546
1201 Ga0495625_0004364
1202 Ga0495625_0044036
1203 Ga0495625_0205281
1204 Ga0495625_0409653
1205 Ga0495661_0142024
1206 Ga0495588_0100587
1207 Ga0495624_0081841
1208 Ga0495671_0139155
1209 Ga0495649_0025304
1210 Ga0495649_0157157
1211 Ga0495600_0070820
1212 Ga0495660_0028650
1213 Ga0495604_0020147
1214 Ga0495636_0010645
1215 Ga0495672_0015932
1216 Ga0495683_0017508
1217 Ga0495687_057508
1218 Ga0495687_125710
1219 Ga0495685_052846
1220 Ga0495681_0092572
1221 Ga0495686_0000688
1222 Ga0495686_0007326
1223 Ga0495686_0019662
1224 Ga0495686_0066988
1225 Ga0495686_0231443
1226 Ga0495686_0289687
1227 Ga0495686_0341145
1228 Ga0495615_0006719
1229 Ga0496101_0166779
1230 Ga0496102_0006951
1231 Ga0496103_0006250
1232 Ga0496106_0007956
1233 Ga0496106_0073382
1234 Ga0496110_0170901
1235 Ga0496111_0003317
1236 Ga0496113_0047872
1237 Ga0496113_0379103
1238 Ga0496116_0019214
1239 Ga0496116_0026581
1240 Ga0496116_0042281
1241 Ga0496116_0074978
1242 Ga0496116_0081922
1243 Ga0496116_0176274
1244 Ga0496117_0004211
1245 Ga0496117_0007443
1246 Ga0496117_0019788
1247 Ga0496117_0039979
1248 Ga0496117_0101682
1249 Ga0496117_0160544
1250 Ga0496118_0008854
1251 Ga0496118_0009023
1252 Ga0496118_0016254
1253 Ga0496118_0022988
1254 Ga0496119_0011852
1255 Ga0496119_0016635
1256 Ga0496120_0003587
1257 Ga0496120_0108845
1258 Ga0496121_0000581
1259 Ga0496121_0005515
1260 Ga0496121_0006088
1261 Ga0496121_0009856
1262 Ga0496121_0035493
1263 Ga0496121_0048431
1264 Ga0496121_0053577
1265 Ga0496121_0072341
1266 Ga0496121_0126312
1267 Ga0496121_0213114
1268 Ga0496121_0300078
1269 Ga0496122_0000009
1270 Ga0496122_0010110
1271 Ga0496122_0018408
1272 Ga0496122_0021974
1273 Ga0496122_0026276
1274 Ga0496122_0033043
1275 Ga0496122_0039858
1276 Ga0496122_0041423
1277 Ga0496122_0049563
1278 Ga0496122_0073942
1279 Ga0496123_0000020
1280 Ga0496123_0005995
1281 Ga0496123_0007612
1282 Ga0496123_0013530
1283 Ga0496123_0025599
1284 Ga0496123_0026213
1285 Ga0496123_0042850
1286 Ga0496123_0081438
1287 Ga0496123_0164043
1288 Ga0496123_0182720
1289 Ga0496124_0004941
1290 Ga0496124_0015396
1291 Ga0496124_0035902
1292 Ga0496124_0038092
1293 Ga0496124_0047300
1294 Ga0496124_0050244
1295 Ga0496124_0062089
1296 Ga0496124_0068333
1297 Ga0496124_0174779
1298 Ga0496124_0257429
1299 Ga0496125_0002192
1300 Ga0496125_0009453
1301 Ga0496126_0017025
1302 Ga0496126_0104013
1303 Ga0496126_0176292
1304 Ga0496126_0222981
1305 Ga0495678_008193
1306 Ga0495678_008483
1307 Ga0495678_070657
1308 Ga0495682_0051415
1309 Ga0501031_0029846
1310 Ga0501032_0082367
1311 Ga0501032_0098084
1312 Ga0501033_0000986
1313 Ga0501034_0009938
1314 Ga0501034_0033123
1315 Ga0501034_0108890
1316 Ga0501034_0365055
1317 Ga0501036_0086253
1318 Ga0501038_0311247
1319 Ga0501039_0102104
1320 Ga0501043_0295347
1321 Ga0501046_0206111
1322 Ga0501047_0204311
1323 Ga0501048_0194381
1324 Ga0501067_0000688
1325 Ga0501067_0056919
1326 Ga0501068_0079644
1327 Ga0501073_0012900
1328 Ga0501073_0028289
1329 Ga0501073_0228449
1330 Ga0501073_0279246
1331 Ga0501080_0013741
1332 Ga0501080_0098860
1333 Ga0501083_0004419
1334 Ga0501083_0007506
1335 Ga0501280_001569
1336 Ga0501035_0001767
1337 Ga0501035_0203277
1338 Ga0501044_0074123
1339 nmdc:mga03683_59285_c1
1340 nmdc:mga00v17_133_c2
1341 nmdc:mga00v17_227463_c1
1342 nmdc:mga0yw44_12807_c1
1343 nmdc:mga0yw44_38792_c1
1344 nmdc:mga0k408_54169_c1
1345 nmdc:mga06z11_64413_c1
1346 nmdc:mga07m45_131759_c1
1347 nmdc:mga0sz30_68451_c1
1348 Ga0500610_0051524
1349 Ga0500578_0108565
1350 Ga0500646_0060954
1351 Ga0500650_0049985
1352 Ga0500556_0051888
1353 Ga0500557_019144
1354 Ga0500569_003997
1355 Ga0500594_0001496
1356 Ga0500594_0016853
1357 Ga0500607_163219
1358 Ga0500618_000046
1359 Ga0500618_007646
1360 Ga0500618_013097
1361 Ga0500618_013268
1362 Ga0500618_017561
1363 Ga0500658_0000767
1364 Ga0500658_0038470
1365 Ga0500568_0000108
1366 Ga0500568_0002150
1367 Ga0500568_0014071
1368 Ga0500573_0001555
1369 Ga0500577_0066311
1370 Ga0500577_0166121
1371 Ga0500590_000222
1372 Ga0500616_0001019
1373 Ga0500616_0009546
1374 Ga0500616_0155131
1375 Ga0500622_0000653
1376 Ga0500622_0066099
1377 Ga0500633_0018749
1378 Ga0500633_0054053
1379 Ga0501084_0010280
1380 Ga0501082_0004072
1381 Ga0501082_0040155
1382 Ga0466962_0161745
1383 2509388340
1384 2509443904
1385 2510131549
1386 2510843118
1387 2510897855
1388 2511136218
1389 2511175364
1390 2511185619
1391 2511194414
1392 2511390098
1393 2513571139
1394 2513579316
1395 2513596791
1396 2513632232
1397 2513713282
1398 2513870285
1399 2513910431
1400 2513928383
1401 2514020939
1402 2515110482
1403 2515636916
1404 2515647121
1405 2515659533
1406 2515743006
1407 2517039183
1408 2517079429
1409 2517093373
1410 2517409599
1411 2520380020
1412 2524457583
1413 2530647724
1414 2535515163
1415 2561467365
1416 2585203741
1417 2585227530
1418 2585229055
1419 2585259509
1420 2585275381
1421 2585283442
1422 2585325913
1423 2585330084
1424 2585398482
1425 2585528386
1426 2585536382
1427 2585539777
1428 2585550963
1429 2585556947
1430 2585560176
1431 2585819371
1432 2585837760
1433 2585844586
1434 2585901554
1435 2585905642
1436 2585994506
1437 2585998953
1438 2587979242
1439 2599419103
1440 2599719492
1441 2600192490
1442 2600374781
1443 2616295748
1444 2616306257
1445 2616553479
1446 2617386652
1447 2643808651
1448 2643810481
1449 2644007417
1450 2644066327
1451 2644109354
1452 2644149957
1453 2644190668
1454 2644241476
1455 2644297495
1456 2644307619
1457 2644332394
1458 2644377879
1459 2644415460
1460 2644450138
1461 2644544128
1462 2644613708
1463 2644655748
1464 2644678067
1465 2644687695
1466 2644733656
1467 2644742118
1468 2671112433
1469 2719179647
1470 2719384259
1471 2719663993
1472 2719730317
1473 2720490412
1474 2720611790
1475 2720618647
1476 2720630046
1477 2720773741
1478 2721145740
1479 2721157272
1480 2721162619
1481 2721397973
1482 2722838789
1483 2723025411
1484 2723558994
1485 2723565601
1486 2724036783
1487 2724043073
1488 2724088348
1489 2724102866
1490 2724108733
1491 2725950167
1492 2730106347
1493 2730162884
1494 2730296904
1495 2738803768
1496 2738945652
1497 2739034636
1498 2757570762
1499 2766065619
1500 2776270476
1501 2776281605
1502 2776912216
1503 2778174238
1504 2793295137
1505 2793315346
1506 2793320207
1507 2793326073
1508 2793332509
1509 2793343253
1510 2793351046
1511 2793353302
1512 2793362685
1513 2793364756
1514 2805927507
1515 2805932291
1516 2806043933
1517 2806052249
1518 2806058550
1519 2806067046
1520 2806074791
1521 2819243155
1522 2819608340
1523 2819643396
1524 2819684636
1525 2819717078
1526 2821123703
1527 2837653283
1528 2838022154
1529 2838024567
1530 2838029229
1531 2838037210
1532 2838044338
1533 2838051397
1534 2838066658
1535 2838073711
1536 2838663602
1537 2838673140
1538 2838680673
1539 2838692667
1540 2838695294
1541 2838703942
1542 2838708670
1543 2838732739
1544 2838739266
1545 2838745634
1546 2839997451
1547 2840768923
1548 2841763533
1549 2841843164
1550 2841855278
1551 2841866730
1552 2842080095
1553 2842112288
1554 2842120715
1555 2842142946
1556 2842148266
1557 2842161692
1558 2842170095
1559 2842185309
1560 2842192980
1561 2842200328
1562 2842206851
1563 2842218711
1564 2842233247
1565 2842238082
1566 2842248749
1567 2842253331
1568 2842261892
1569 2842267363
1570 2842277044
1571 2842280456
1572 2842289403
1573 2842293755
1574 2842300803
1575 2842306401
1576 2842312545
1577 2842322577
1578 2842342993
1579 2842358078
1580 2842367283
1581 2842371136
1582 2842380152
1583 2842387223
1584 2842401247
1585 2842406751
1586 2842413753
1587 2842420285
1588 2842427159
1589 2842431385
1590 2842437720
1591 2842444535
1592 2842450282
1593 2842465637
1594 2842472447
1595 2842476341
1596 2842482417
1597 2842492381
1598 2842501940
1599 2842502757
1600 2842509275
1601 2842872088
1602 2844109563
1603 2844167239
1604 2844455893
1605 2851182780
1606 2851251670
1607 2852388561
1608 2854898356
1609 2854919069
1610 2857522171
1611 2857531265
1612 2889794269
1613 2889916772
1614 2894821591
1615 2899804420
1616 2913310669
1617 2917554680
1618 2917701427
1619 2919101268
1620 2919171998
1621 2919408867
1622 2920824404
1623 2923557265
1624 2928524026
1625 2933019475
1626 2933573470
1627 2933587617
1628 2933604139
1629 2935895817
1630 2935907734
1631 2936368835
1632 2936377085
1633 2936388338
1634 2941505088
1635 2954012971
1636 2989777586
1637 2996892112
1638 2996893535
1639 3002144913
1640 3005411297
1641 3005422745
1642 3005446251
1643 3005452904
1644 639646754
1645 8005247249
1646 8005263561
1647 8005278973
1648 8005283659
1649 8005291003
1650 8005303927
1651 8005308747
1652 8005321719
1653 8005326639
1654 8005377341
1655 8005387212
1656 8005401971
1657 8005433011
1658 8005461121
1659 8005486075
1660 8005498735
1661 8005543839
1662 8005560721
1663 8005569703
1664 8005577012
1665 8005619930
1666 8005628527
1667 8005650213
1668 8005661833
1669 8005670146
1670 8005685051
1671 8005690354
1672 8005700295
1673 8018133210
1674 8018151980
1675 8018167809
1676 8018180234
1677 8023684131
1678 8024480378
1679 8024491360
1680 8024503599
1681 8045867261
1682 8046771101
1683 8056375713
1684 8056386034
1685 8056879205
1686 8057534542
1687 8057579869
1688 8057881009

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

6

183

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pke-assembly1.cif.gz_A crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9449 1 233
3ddh-assembly1.cif.gz_A the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9201 5 230
2pke-assembly1.cif.gz_B crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9145 4 233
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9121 1 234
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9082 1 234
ID Description Score Start End Superfamily
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9597 22 100 1.10.150.240
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9363 22 100 1.10.150.240
2pkeB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8908 98 233 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8599 105 199 3.40.50.1000
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8592 3 234 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A527HAS5-F1-model_v4 HAD family hydrolase 0.9925 145 233 GO:0016787
AF-A0A2N2XIM3-F1-model_v4 deleted 0.9913 6 149
AF-A0A1I0C3C8-F1-model_v4 Putative hydrolase of the HAD superfamily 0.9909 11 97 GO:0016787
AF-A0A259DCA7-F1-model_v4 HAD family hydrolase 0.9883 6 129 GO:0016787
AF-A0A3M2DJN1-F1-model_v4 HAD family hydrolase 0.9864 3 192 GO:0016787

Map