F483213

General Info

Members Datasets Scaffolds Average Seq Length
844 533 566 480

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10107624|Ga0316576_101076242
Length 543
Sequence MDTTTRRPPAASNRSGARRLPRQHARGDFDSKTSTYVVAKGDDLTHIAERFELSVEALKAHNTLSSDKIGGGDELTIAGGDAIHTAEQADKSAGVPAPSIEETKAIAEEGFIYGLPIVMNYAVMQEFAVDKNSGQFKAPFNAIFNDAHVFTYKDTAVVTPNSDTPYSMVWLDLRAEPMVISVPAVPKERYYSVQLIDGNTYNYGYIGTRATGAEAGDYLVVGPDWKGEKPAGIKDVFTSTTPFSLAIFRTQLFNADDMPNVVKVQAGYKARPPSAFLNQPAPAAAPKIDFLPATTKGIKDNFFAYLDAALEFVPVTPETDALRGRLASIGIGPGKPFDFKELSLEHKAAVLLAMKAGDDKIDTFLNTAQKDVDGWKIGSLFGDSQFIDGNWLMRAAAAKAGVYGNDSIEATYPMTRVDADGDALDGSKHNYSLTFAAGQTPPVNAFWSVTMYDGKTQLLIENPINRYLINSPMLPELKKGEDGSLTLYIQKDNPGADKESNWLPAPDGPIYLVMRLYWPKTEPPSILPAGSGTWSPPGVVKAN

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231020 Pseudomonas sp. GM74 Isolate Nodule
9 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
10 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
19 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
20 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
21 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
22 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
23 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
24 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
25 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
28 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
29 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
30 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
31 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
32 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
33 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
34 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
35 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
36 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
37 2643221557 Ensifer sp. Root558 Isolate Unclassified
38 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
39 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
40 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
41 2643221618 Ensifer sp. Root231 Isolate Unclassified
42 2643221626 Ensifer sp. Root31 Isolate Unclassified
43 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
44 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
45 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
46 2643221655 Ensifer sp. Root1252 Isolate Unclassified
47 2643221659 Ensifer sp. Root127 Isolate Unclassified
48 2643221668 Ensifer sp. Root423 Isolate Unclassified
49 2643221688 Rhizobium sp. Root482 Isolate Unclassified
50 2643221698 Ensifer sp. Root142 Isolate Unclassified
51 2643221712 Ensifer sp. Root258 Isolate Unclassified
52 2643221723 Ensifer sp. Root278 Isolate Unclassified
53 2643221736 Bosea sp. Root483D1 Isolate Unclassified
54 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
55 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
56 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
57 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
58 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
59 2738543024 Aminobacter sp. AP02 Isolate Unclassified
60 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
61 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
62 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
63 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
64 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
65 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
66 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
67 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
68 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
69 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
70 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
71 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
72 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
73 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
74 2844163670 Ensifer sp. 1H6 Isolate Unclassified
75 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
76 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
77 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
78 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
79 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
80 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
81 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
82 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
83 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
84 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
85 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
86 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
87 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
88 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
89 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
90 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
91 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
92 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
93 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
94 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
95 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
96 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
97 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
98 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
99 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
100 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
101 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
102 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
103 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
104 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
105 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
106 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
107 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
108 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
109 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
110 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
111 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
112 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
113 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
114 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
115 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
116 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
117 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
118 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
119 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
120 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
121 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
122 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
123 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
124 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
125 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
126 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
127 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
128 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
129 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
130 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
131 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
132 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
133 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
134 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
135 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
136 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
137 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
138 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
139 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
140 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
141 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
142 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
143 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
144 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
145 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
146 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
147 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
148 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
149 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
150 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
151 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
152 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
153 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
154 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
155 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
156 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
157 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
158 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
159 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
160 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
161 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
162 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
163 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
164 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
165 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
166 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
167 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
168 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
169 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
170 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
171 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
172 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
173 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
174 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
175 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
176 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
177 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
178 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
179 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
180 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
181 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
182 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
183 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
184 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
185 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
186 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
187 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
188 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
189 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
190 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
191 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
192 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
193 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
194 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
195 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
196 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
197 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
198 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
199 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
200 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
201 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
202 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
203 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
204 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
205 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
206 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
207 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
208 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
209 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
210 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
211 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
212 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
213 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
214 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
215 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
216 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
217 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
218 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
219 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
220 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
221 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
222 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
223 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
224 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
225 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
226 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
227 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
228 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
229 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
230 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
231 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
232 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
233 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
234 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
235 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
236 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
237 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
238 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
239 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
240 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
241 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
242 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
243 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
244 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
245 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
246 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
247 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
248 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
249 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
250 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
251 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
252 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
253 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
254 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
255 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
256 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
257 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
258 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
259 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
260 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
261 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
262 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
263 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
264 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
265 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
266 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
267 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
268 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
269 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
270 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
271 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
272 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
273 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
274 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
275 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
276 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
277 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
278 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
279 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
280 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
281 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
282 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
283 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
284 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
285 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
286 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
287 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
289 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
290 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
291 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
292 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
293 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
294 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
295 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
296 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
297 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
298 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
299 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
300 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
301 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
302 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
303 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
304 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
305 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
306 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
307 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
308 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
309 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
310 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
311 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
312 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
313 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
314 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
315 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
316 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
318 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
319 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
320 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
321 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
322 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
323 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
364 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
365 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
366 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
369 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
370 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
371 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
372 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
373 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
374 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
375 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
376 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
377 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
378 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
379 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
380 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
381 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
382 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
383 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
385 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
386 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
388 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
389 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
390 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
391 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
392 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
393 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
394 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
395 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
396 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
397 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
398 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
399 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
400 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
401 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
402 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
403 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
404 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
405 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
406 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
407 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
408 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
409 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
410 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
411 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
412 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
413 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
414 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
415 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
416 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
417 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
418 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
419 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
420 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
421 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
422 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
423 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
424 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
425 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
426 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
427 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
428 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
429 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
430 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
431 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
432 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
433 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
434 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
435 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
436 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
437 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
438 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
439 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
440 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
441 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
442 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
443 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
444 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
445 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
446 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
447 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
448 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
449 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
450 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
451 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
452 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
453 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
454 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
455 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
456 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
457 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
458 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
459 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
460 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
461 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
462 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
463 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
464 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
465 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
466 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
467 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
468 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
469 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
470 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
471 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
472 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
473 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
474 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
475 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
476 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
477 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
478 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
479 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
480 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
481 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
482 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
483 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
484 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
485 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
486 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
487 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
488 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
489 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
490 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
491 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
492 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
493 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
494 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
495 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
496 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
497 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
498 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
499 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
500 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
501 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
504 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
505 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
506 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
507 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
508 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
509 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
510 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
511 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
512 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
513 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
514 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
515 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
516 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
517 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
518 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
519 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
520 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
521 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
522 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
523 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
524 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
525 8005321885 Rhizobium sp. R72 Isolate Nodule
526 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
527 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
528 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
529 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
530 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
531 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
532 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
533 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.3
Metatranscriptomes 0.36
Isolates 32.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 27.96
Rhizoplane 1.54
Rhizosphere 60.19
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000003 3300002987 Bacteria 274069
2 JGI25151J46595_10018005 3300003187 Bacteria 3047
3 JGI25153J46596_10003083 3300003215 Bacteria 9402
4 JGI25160J50197_1000003 3300003354 Bacteria 482719
5 JGI25161J50226_1000373 3300003374 Bacteria 22529
6 Ga0055526_1002068 3300003771 Bacteria 13783
7 Ga0055524_1030471 3300003775 Bacteria 1572
8 JGI25405J52794_10000694 3300003911 Bacteria 5110
9 Ga0055543_1000203 3300004625 Bacteria 48554
10 Ga0065165_1000084 3300005262 Bacteria 154822
11 Ga0065714_10016073 3300005288 Bacteria 3242
12 Ga0065714_10064708 3300005288 Bacteria 22114
13 Ga0065714_10089636 3300005288 Bacteria 1972
14 Ga0065704_10022662 3300005289 Bacteria 1819
15 Ga0070676_10000904 3300005328 Bacteria 14682
16 Ga0070670_100136242 3300005331 Bacteria 2122
17 Ga0070677_10003064 3300005333 Bacteria 5370
18 Ga0070666_10001014 3300005335 Bacteria 17213
19 Ga0070666_10004020 3300005335 Bacteria 8928
20 Ga0070689_100065820 3300005340 Bacteria 2823
21 Ga0070668_100014033 3300005347 Bacteria 5991
22 Ga0070668_100016536 3300005347 Bacteria 5515
23 Ga0070669_100092257 3300005353 Bacteria 2273
24 Ga0070675_100003604 3300005354 Bacteria 11779
25 Ga0070675_100031808 3300005354 Bacteria 4267
26 Ga0070675_100045147 3300005354 Bacteria 3605
27 Ga0070675_100076079 3300005354 Bacteria 2791
28 Ga0070671_100112165 3300005355 Bacteria 2290
29 Ga0070674_100001604 3300005356 Bacteria 12136
30 Ga0070673_100035602 3300005364 Bacteria 3776
31 Ga0070667_100020128 3300005367 Bacteria 5540
32 Ga0070667_100024728 3300005367 Bacteria 4990
33 Ga0070667_100148506 3300005367 Bacteria 2057
34 Ga0070709_10061353 3300005434 Bacteria 2393
35 Ga0070713_100057088 3300005436 Bacteria 3248
36 Ga0070710_10025309 3300005437 Bacteria 3142
37 Ga0070711_100026793 3300005439 Bacteria 3780
38 Ga0070694_100015060 3300005444 Bacteria 4847
39 Ga0070663_100063934 3300005455 Bacteria 2658
40 Ga0070678_100000405 3300005456 Bacteria 20366
41 Ga0070678_100006469 3300005456 Bacteria 6880
42 Ga0070678_100114537 3300005456 Bacteria 2115
43 Ga0070662_100057499 3300005457 Bacteria 2826
44 Ga0068867_100040060 3300005459 Bacteria 3417
45 Ga0068867_100042435 3300005459 Bacteria 3328
46 Ga0070685_10009082 3300005466 Bacteria 5130
47 Ga0070679_100146748 3300005530 Bacteria 2336
48 Ga0068853_100091295 3300005539 Bacteria 2678
49 Ga0070672_100001549 3300005543 Bacteria 14234
50 Ga0070672_100092468 3300005543 Bacteria 2442
51 Ga0070695_100003489 3300005545 Bacteria 9182
52 Ga0070696_100068650 3300005546 Bacteria 2489
53 Ga0070665_100003169 3300005548 Bacteria 17699
54 Ga0070665_100006331 3300005548 Bacteria 12078
55 Ga0070665_100018677 3300005548 Bacteria 6950
56 Ga0070665_100036309 3300005548 Bacteria 4957
57 Ga0070704_100043577 3300005549 Bacteria 3112
58 Ga0068852_100017853 3300005616 Bacteria 5578
59 Ga0068852_100034910 3300005616 Bacteria 4189
60 Ga0068864_100067919 3300005618 Bacteria 3096
61 Ga0068861_100048010 3300005719 Bacteria 3225
62 Ga0068851_10002660 3300005834 Bacteria 7872
63 Ga0068870_10001420 3300005840 Bacteria 9687
64 Ga0068863_100039874 3300005841 Bacteria 4466
65 Ga0068862_100016358 3300005844 Bacteria 6173
66 Ga0068862_100136004 3300005844 Bacteria 2178
67 Ga0081455_10012180 3300005937 Bacteria 8590
68 Ga0081455_10014532 3300005937 Bacteria 7709
69 Ga0075363_100009224 3300006048 Bacteria 4635
70 Ga0075432_10004750 3300006058 Bacteria 4624
71 Ga0075432_10005105 3300006058 Bacteria 4472
72 Ga0075369_10011884 3300006186 Bacteria 3431
73 Ga0097621_100022234 3300006237 Bacteria 4921
74 Ga0097621_100038227 3300006237 Bacteria 3851
75 Ga0068871_100016950 3300006358 Bacteria 5501
76 Ga0068871_100020842 3300006358 Bacteria 5028
77 Ga0075428_100065792 3300006844 Bacteria 3969
78 Ga0075430_100000496 3300006846 Bacteria 29607
79 Ga0075430_100045636 3300006846 Bacteria 3701
80 Ga0075431_100047446 3300006847 Bacteria 4428
81 Ga0068865_100032046 3300006881 Bacteria 3508
82 Ga0068865_100166334 3300006881 Bacteria 1687
83 Ga0079104_1000141 3300006946 Bacteria 102054
84 Ga0079104_1002621 3300006946 Bacteria 9410
85 Ga0105244_10027675 3300009036 Bacteria 3053
86 Ga0111539_10012513 3300009094 Bacteria 10633
87 Ga0111539_10049248 3300009094 Bacteria 5025
88 Ga0111539_10076343 3300009094 Bacteria 3945
89 Ga0111539_10176452 3300009094 Bacteria 2496
90 Ga0111539_10184888 3300009094 Bacteria 2434
91 Ga0114129_10050166 3300009147 Bacteria 5862
92 Ga0114129_10167222 3300009147 Bacteria 3000
93 Ga0114129_10311506 3300009147 Bacteria 2095
94 Ga0105243_10169835 3300009148 Bacteria 1888
95 Ga0105241_10038236 3300009174 Bacteria 3617
96 Ga0105242_10008285 3300009176 Bacteria 7988
97 Ga0105242_10045147 3300009176 Bacteria 3570
98 Ga0105248_10046402 3300009177 Bacteria 4869
99 Ga0105248_10349607 3300009177 Bacteria 1664
100 Ga0105248_10355683 3300009177 Bacteria 1649
101 Ga0123341_1029041 3300009765 Bacteria 4248
102 Ga0123342_1007700 3300009766 Bacteria 14073
103 Ga0105239_10125523 3300010375 Bacteria 2852
104 Ga0157370_10000874 3300013104 Bacteria 38194
105 Ga0157370_10011163 3300013104 Bacteria 9416
106 Ga0157370_10091703 3300013104 Bacteria 2852
107 Ga0157374_10042294 3300013296 Bacteria 4203
108 Ga0157374_10083881 3300013296 Bacteria 3028
109 Ga0157378_10002100 3300013297 Bacteria 17766
110 Ga0157378_10068141 3300013297 Bacteria 3190
111 Ga0163162_10000430 3300013306 Bacteria 38735
112 Ga0163162_10049337 3300013306 Bacteria 4218
113 Ga0163162_10061624 3300013306 Bacteria 3789
114 Ga0163162_10166769 3300013306 Bacteria 2326
115 Ga0163162_10217165 3300013306 Bacteria 2042
116 Ga0157375_10005698 3300013308 Bacteria 10838
117 Ga0157375_10032963 3300013308 Bacteria 4917
118 Ga0157375_10175723 3300013308 Bacteria 2291
119 Ga0163163_10162365 3300014325 Bacteria 2280
120 Ga0157376_10125786 3300014969 Bacteria 2280
121 Ga0157376_10141867 3300014969 Bacteria 2156
122 Ga0182005_1009417 3300015265 Bacteria 2841
123 Ga0182005_1015399 3300015265 Bacteria 2133
124 Ga0163161_10000683 3300017792 Bacteria 27101
125 Ga0163161_10014053 3300017792 Bacteria 5575
126 Ga0163161_10128586 3300017792 Bacteria 1909
127 Ga0213871_10004105 3300021441 Bacteria 2881
128 Ga0228710_1003508 3300022740 Bacteria 24931
129 Ga0209436_100487 3300025208 Bacteria 17545
130 Ga0209563_101298 3300025230 Bacteria 6824
131 Ga0209130_1000005 3300025284 Bacteria 599620
132 Ga0209025_1000479 3300025294 Bacteria 77489
133 Ga0209564_1000093 3300025295 Bacteria 245793
134 Ga0209758_1000165 3300025297 Bacteria 151122
135 Ga0209256_1001179 3300025299 Bacteria 29395
136 Ga0207426_1000015 3300025302 Bacteria 599316
137 Ga0209051_1004038 3300025303 Bacteria 9273
138 Ga0209257_1002436 3300025304 Bacteria 18504
139 Ga0207697_10015766 3300025315 Bacteria 3118
140 Ga0207655_1023771 3300025728 Bacteria 3026
141 Ga0207682_10002716 3300025893 Bacteria 7853
142 Ga0207692_10029184 3300025898 Bacteria 2619
143 Ga0207680_10013508 3300025903 Bacteria 4198
144 Ga0207680_10019812 3300025903 Bacteria 3606
145 Ga0207680_10023088 3300025903 Bacteria 3392
146 Ga0207699_10093883 3300025906 Bacteria 1889
147 Ga0207645_10000350 3300025907 Bacteria 38438
148 Ga0207643_10004244 3300025908 Bacteria 7715
149 Ga0207654_10021840 3300025911 Bacteria 3409
150 Ga0207707_10000754 3300025912 Bacteria 31878
151 Ga0207693_10020774 3300025915 Bacteria 5222
152 Ga0207660_10189526 3300025917 Bacteria 1601
153 Ga0207652_10061836 3300025921 Bacteria 3234
154 Ga0207681_10033592 3300025923 Bacteria 3365
155 Ga0207650_10074240 3300025925 Bacteria 2563
156 Ga0207659_10037386 3300025926 Bacteria 3370
157 Ga0207659_10052369 3300025926 Bacteria 2907
158 Ga0207659_10094474 3300025926 Bacteria 2240
159 Ga0207659_10105089 3300025926 Bacteria 2136
160 Ga0207700_10050694 3300025928 Bacteria 3094
161 Ga0207664_10096226 3300025929 Bacteria 2436
162 Ga0207644_10015383 3300025931 Bacteria 5134
163 Ga0207644_10023407 3300025931 Bacteria 4230
164 Ga0207644_10094539 3300025931 Bacteria 2233
165 Ga0207706_10136705 3300025933 Bacteria 2156
166 Ga0207686_10006304 3300025934 Bacteria 6380
167 Ga0207670_10024379 3300025936 Bacteria 3781
168 Ga0207669_10049423 3300025937 Bacteria 2506
169 Ga0207704_10038401 3300025938 Bacteria 2777
170 Ga0207665_10028023 3300025939 Bacteria 3721
171 Ga0207691_10000332 3300025940 Bacteria 47224
172 Ga0207691_10018383 3300025940 Bacteria 6623
173 Ga0207691_10019378 3300025940 Bacteria 6438
174 Ga0207691_10052727 3300025940 Bacteria 3715
175 Ga0207711_10098623 3300025941 Bacteria 2582
176 Ga0207651_10026881 3300025960 Bacteria 3604
177 Ga0207668_10026179 3300025972 Bacteria 3784
178 Ga0207668_10031898 3300025972 Bacteria 3475
179 Ga0207668_10097117 3300025972 Bacteria 2179
180 Ga0207658_10016768 3300025986 Bacteria 5041
181 Ga0207658_10034304 3300025986 Bacteria 3626
182 Ga0207677_10004794 3300026023 Bacteria 7298
183 Ga0207639_10144583 3300026041 Bacteria 1985
184 Ga0207648_10002865 3300026089 Bacteria 18249
185 Ga0207648_10022669 3300026089 Bacteria 5637
186 Ga0207676_10041168 3300026095 Bacteria 3544
187 Ga0207676_10178601 3300026095 Bacteria 1857
188 Ga0207674_10028917 3300026116 Bacteria 5842
189 Ga0207675_100070958 3300026118 Bacteria 3256
190 Ga0207683_10002772 3300026121 Bacteria 15316
191 Ga0207683_10010836 3300026121 Bacteria 7775
192 Ga0207683_10018564 3300026121 Bacteria 5935
193 Ga0207683_10020424 3300026121 Bacteria 5666
194 Ga0207683_10062273 3300026121 Bacteria 3286
195 Ga0207698_10156816 3300026142 Bacteria 1985
196 Ga0209281_1000258 3300027111 Bacteria 102068
197 Ga0209281_1001527 3300027111 Bacteria 12998
198 Ga0209282_1000158 3300027666 Bacteria 39360
199 Ga0207428_10002707 3300027907 Bacteria 17662
200 Ga0207428_10029455 3300027907 Bacteria 4551
201 Ga0207428_10062745 3300027907 Bacteria 2938
202 Ga0207428_10073091 3300027907 Bacteria 2691
203 Ga0268266_10002913 3300028379 Bacteria 17710
204 Ga0268266_10037599 3300028379 Bacteria 4122
205 Ga0268266_10044074 3300028379 Bacteria 3812
206 Ga0268265_10011885 3300028380 Bacteria 5887
207 Ga0268265_10193407 3300028380 Bacteria 1759
208 Ga0265327_10001113 3300031251 Bacteria 37190
209 Ga0316579_10011911 3300031691 Bacteria 3710
210 Ga0316579_10024085 3300031691 Bacteria 2738
211 Ga0316576_10002334 3300031727 Bacteria 10771
212 Ga0316576_10082834 3300031727 Bacteria 2382
213 Ga0316576_10107624 3300031727 Bacteria 2088
214 Ga0316578_10037777 3300031728 Bacteria 2782
215 Ga0307405_10051810 3300031731 Bacteria 2549
216 Ga0316577_10000152 3300031733 Bacteria 21331
217 Ga0316577_10059644 3300031733 Bacteria 2130
218 Ga0307406_10164165 3300031901 Bacteria 1600
219 Ga0307412_10019671 3300031911 Bacteria 4095
220 Ga0307412_10024325 3300031911 Bacteria 3738
221 Ga0315914_1001030 3300031967 Bacteria 39792
222 Ga0307409_100003279 3300031995 Bacteria 8740
223 Ga0307409_100025378 3300031995 Bacteria 4156
224 Ga0307414_10000215 3300032004 Bacteria 38077
225 Ga0307415_100031011 3300032126 Bacteria 3439
226 Ga0316583_10005584 3300032133 Bacteria 4516
227 Ga0316583_10014939 3300032133 Bacteria 2795
228 Ga0316585_10000183 3300032137 Bacteria 12834
229 Ga0316580_10000832 3300032139 Bacteria 7573
230 Ga0316593_10002559 3300032168 Bacteria 4345
231 Ga0316593_10006226 3300032168 Bacteria 3208
232 Ga0315911_1000015 3300033442 Bacteria 185247
233 Ga0315915_1000531 3300033464 Bacteria 39979
234 Ga0316596_1009190 3300033541 Bacteria 2369
235 Ga0373934_0006254 3300035086 Bacteria 4414
236 Ga0316574_0005769 3300035398 Bacteria 6638
237 Ga0316574_0044073 3300035398 Bacteria 2759
238 Ga0316574_0059525 3300035398 Bacteria 2396
239 Ga0316574_0079599 3300035398 Bacteria 2078
240 Ga0373927_0028975 3300035695 Bacteria 3609
241 Ga0373937_0003549 3300036401 Bacteria 13139
242 Ga0373937_0019887 3300036401 Bacteria 6014
243 Ga0316582_0000007 3300036647 Bacteria 45992
244 Ga0316582_0034513 3300036647 Bacteria 3117
245 Ga0316582_0084230 3300036647 Bacteria 2081
246 Ga0316584_0053395 3300036712 Bacteria 3024
247 Ga0316584_0084557 3300036712 Bacteria 2376
248 Ga0316584_0104913 3300036712 Bacteria 2115
249 Ga0316584_0120932 3300036712 Bacteria 1957
250 Ga0316581_0000422 3300037588 Bacteria 7981
251 Ga0316581_0024186 3300037588 Bacteria 1800
252 Ga0436360_0178824 3300039438 Bacteria 3965
253 Ga0439436_0000889 3300041404 Bacteria 8179
254 Ga0439438_011444 3300041405 Bacteria 2762
255 Ga0439447_010361 3300041407 Bacteria 2769
256 Ga0439466_0015652 3300041411 Bacteria 2754
257 Ga0439466_0020186 3300041411 Bacteria 2378
258 Ga0451807_0853366 3300041486 Bacteria 1484
259 Ga0451833_0392287 3300041491 Bacteria 4529
260 Ga0451837_0889142 3300041494 Bacteria 1505
261 Ga0451837_1096565 3300041494 Bacteria 1784
262 Ga0451845_0583219 3300041501 Bacteria 1437
263 Ga0451849_0546217 3300041505 Bacteria 8150
264 Ga0451849_0645052 3300041505 Bacteria 3090
265 Ga0451851_0808350 3300041507 Bacteria 3764
266 Ga0451851_0821168 3300041507 Bacteria 3528
267 Ga0451843_0006633 3300041509 Bacteria 3106
268 Ga0451843_0720882 3300041509 Bacteria 1793
269 Ga0451855_0067003 3300041511 Bacteria 2356
270 Ga0451853_0132233 3300041512 Bacteria 1438
271 Ga0451853_0136319 3300041512 Bacteria 2639
272 Ga0439452_000408 3300042010 Bacteria 25266
273 Ga0439452_003588 3300042010 Bacteria 5406
274 Ga0450903_005560 3300042138 Bacteria 2106
275 Ga0439446_0002978 3300042156 Bacteria 4145
276 Ga0439434_0004294 3300042435 Bacteria 4164
277 Ga0439460_0000588 3300042461 Bacteria 7991
278 Ga0451577_0073875 3300042876 Bacteria 3042
279 Ga0453684_0152038 3300044712 Bacteria 2749
280 Ga0453684_0325526 3300044712 Bacteria 1739
281 Ga0495617_002685 3300046452 Bacteria 6913
282 Ga0495617_002834 3300046452 Bacteria 6679
283 Ga0495627_001025 3300046453 Bacteria 18683
284 Ga0495627_008261 3300046453 Bacteria 3917
285 Ga0495592_0030897 3300046454 Bacteria 4052
286 Ga0495603_0000989 3300046455 Bacteria 16384
287 Ga0495590_0000662 3300046457 Bacteria 15926
288 Ga0495590_0023743 3300046457 Bacteria 2163
289 Ga0495590_0029827 3300046457 Bacteria 1911
290 Ga0495591_000515 3300046458 Bacteria 30401
291 Ga0495591_001137 3300046458 Bacteria 17502
292 Ga0495591_001161 3300046458 Bacteria 17257
293 Ga0495591_002530 3300046458 Bacteria 10081
294 Ga0495591_016512 3300046458 Bacteria 2567
295 Ga0495629_0138440 3300046459 Bacteria 1694
296 Ga0495638_0002626 3300046460 Bacteria 14467
297 Ga0495638_0002650 3300046460 Bacteria 14397
298 Ga0495638_0002876 3300046460 Bacteria 13787
299 Ga0495638_0021901 3300046460 Bacteria 4201
300 Ga0495638_0022320 3300046460 Bacteria 4156
301 Ga0495638_0027288 3300046460 Bacteria 3697
302 Ga0495638_0063882 3300046460 Bacteria 2268
303 Ga0495638_0075092 3300046460 Bacteria 2060
304 Ga0495638_0083942 3300046460 Bacteria 1928
305 Ga0495638_0109603 3300046460 Bacteria 1641
306 Ga0495651_0096201 3300046462 Bacteria 2213
307 Ga0495653_0001914 3300046463 Bacteria 16410
308 Ga0495653_0027770 3300046463 Bacteria 4529
309 Ga0495650_0000531 3300046471 Bacteria 55413
310 Ga0495650_0006607 3300046471 Bacteria 7198
311 Ga0495650_0011712 3300046471 Bacteria 4775
312 Ga0495650_0013104 3300046471 Bacteria 4409
313 Ga0495580_0006250 3300046472 Bacteria 9737
314 Ga0495580_0015143 3300046472 Bacteria 5835
315 Ga0495582_0004511 3300046473 Bacteria 7828
316 Ga0495582_0093890 3300046473 Bacteria 1674
317 Ga0495582_0095633 3300046473 Bacteria 1659
318 Ga0495605_0000456 3300046474 Bacteria 36701
319 Ga0495605_0001623 3300046474 Bacteria 14521
320 Ga0495605_0002147 3300046474 Bacteria 12330
321 Ga0495605_0014130 3300046474 Bacteria 4379
322 Ga0495639_0003927 3300046475 Bacteria 6387
323 Ga0495639_0028195 3300046475 Bacteria 2487
324 Ga0495584_0000015 3300046491 Bacteria 169335
325 Ga0495584_0001264 3300046491 Bacteria 15387
326 Ga0495584_0003796 3300046491 Bacteria 8224
327 Ga0495584_0004060 3300046491 Bacteria 7903
328 Ga0495584_0019314 3300046491 Bacteria 3461
329 Ga0495584_0051275 3300046491 Bacteria 2078
330 Ga0495585_0000047 3300046492 Bacteria 120650
331 Ga0495585_0000120 3300046492 Bacteria 85123
332 Ga0495585_0000202 3300046492 Bacteria 62078
333 Ga0495585_0002873 3300046492 Bacteria 11975
334 Ga0495594_0002066 3300046499 Bacteria 10454
335 Ga0495596_0002326 3300046500 Bacteria 10315
336 Ga0495607_0006199 3300046501 Bacteria 8444
337 Ga0495607_0006324 3300046501 Bacteria 8347
338 Ga0495607_0035906 3300046501 Bacteria 2993
339 Ga0495607_0038696 3300046501 Bacteria 2855
340 Ga0495607_0044072 3300046501 Bacteria 2632
341 Ga0495583_0000125 3300046506 Bacteria 129291
342 Ga0495583_0000875 3300046506 Bacteria 36501
343 Ga0495583_0000921 3300046506 Bacteria 34568
344 Ga0495583_0007522 3300046506 Bacteria 6818
345 Ga0495606_0001401 3300046507 Bacteria 32482
346 Ga0495606_0003486 3300046507 Bacteria 16663
347 Ga0495606_0019973 3300046507 Bacteria 4958
348 Ga0495606_0047244 3300046507 Bacteria 2838
349 Ga0495606_0079439 3300046507 Bacteria 2043
350 Ga0495610_0000693 3300046512 Bacteria 32441
351 Ga0495610_0000767 3300046512 Bacteria 30291
352 Ga0495610_0001187 3300046512 Bacteria 23547
353 Ga0495610_0003745 3300046512 Bacteria 11637
354 Ga0495610_0007589 3300046512 Bacteria 7183
355 Ga0495610_0012164 3300046512 Bacteria 5201
356 Ga0495616_0001121 3300046513 Bacteria 18981
357 Ga0495616_0010358 3300046513 Bacteria 5400
358 Ga0495616_0040938 3300046513 Bacteria 2365
359 Ga0495618_0049397 3300046514 Bacteria 2657
360 Ga0495620_0000308 3300046515 Bacteria 34889
361 Ga0495620_0006465 3300046515 Bacteria 6436
362 Ga0495620_0007459 3300046515 Bacteria 5933
363 Ga0495628_0065483 3300046516 Bacteria 2842
364 Ga0495630_0002240 3300046517 Bacteria 13460
365 Ga0495630_0049876 3300046517 Bacteria 3132
366 Ga0495631_0000099 3300046518 Bacteria 58174
367 Ga0495631_0011877 3300046518 Bacteria 4269
368 Ga0495632_0000166 3300046519 Bacteria 68543
369 Ga0495632_0003412 3300046519 Bacteria 11301
370 Ga0495632_0013353 3300046519 Bacteria 4691
371 Ga0495632_0015956 3300046519 Bacteria 4192
372 Ga0495632_0026066 3300046519 Bacteria 3082
373 Ga0495632_0046854 3300046519 Bacteria 2146
374 Ga0495632_0050976 3300046519 Bacteria 2039
375 Ga0495632_0050986 3300046519 Bacteria 2038
376 Ga0495637_0002954 3300046520 Bacteria 9159
377 Ga0495637_0008277 3300046520 Bacteria 5113
378 Ga0495637_0014958 3300046520 Bacteria 3650
379 Ga0495637_0016792 3300046520 Bacteria 3419
380 Ga0495637_0018688 3300046520 Bacteria 3211
381 Ga0495637_0028058 3300046520 Bacteria 2515
382 Ga0495643_0013458 3300046522 Bacteria 4893
383 Ga0495643_0018519 3300046522 Bacteria 4045
384 Ga0495643_0020576 3300046522 Bacteria 3801
385 Ga0495643_0021062 3300046522 Bacteria 3747
386 Ga0495643_0030869 3300046522 Bacteria 2988
387 Ga0495644_0000319 3300046523 Bacteria 22183
388 Ga0495644_0001550 3300046523 Bacteria 9374
389 Ga0495648_0001115 3300046524 Bacteria 27217
390 Ga0495648_0012805 3300046524 Bacteria 6228
391 Ga0495648_0029425 3300046524 Bacteria 3646
392 Ga0495648_0045640 3300046524 Bacteria 2723
393 Ga0495648_0074125 3300046524 Bacteria 1962
394 Ga0495642_0000008 3300046528 Bacteria 162190
395 Ga0495642_0000016 3300046528 Bacteria 114282
396 Ga0495642_0001136 3300046528 Bacteria 12234
397 Ga0495654_0000492 3300046530 Bacteria 32517
398 Ga0495654_0000821 3300046530 Bacteria 23623
399 Ga0495654_0001280 3300046530 Bacteria 17635
400 Ga0495654_0004513 3300046530 Bacteria 8241
401 Ga0495654_0012933 3300046530 Bacteria 4476
402 Ga0495654_0029954 3300046530 Bacteria 2772
403 Ga0495587_0002937 3300046536 Bacteria 11403
404 Ga0495609_0000186 3300046538 Bacteria 62251
405 Ga0495609_0021733 3300046538 Bacteria 2960
406 Ga0495609_0040826 3300046538 Bacteria 2087
407 Ga0495609_0046377 3300046538 Bacteria 1946
408 Ga0495597_0001230 3300046542 Bacteria 19070
409 Ga0495597_0003213 3300046542 Bacteria 9727
410 Ga0495597_0026234 3300046542 Bacteria 2677
411 Ga0495645_0018675 3300046543 Bacteria 4984
412 Ga0495645_0112694 3300046543 Bacteria 1923
413 Ga0495622_0001931 3300046557 Bacteria 10187
414 Ga0495633_0000512 3300046558 Bacteria 38948
415 Ga0495633_0062334 3300046558 Bacteria 1746
416 Ga0495656_0000867 3300046615 Bacteria 9772
417 Ga0495656_0005499 3300046615 Bacteria 4375
418 Ga0495668_0003153 3300046616 Bacteria 12717
419 Ga0495668_0004105 3300046616 Bacteria 10550
420 Ga0495668_0014873 3300046616 Bacteria 4554
421 Ga0495611_0005606 3300046648 Bacteria 5355
422 Ga0495611_0081804 3300046648 Bacteria 1486
423 Ga0495625_0008015 3300046660 Bacteria 9069
424 Ga0495625_0011000 3300046660 Bacteria 7424
425 Ga0495625_0047297 3300046660 Bacteria 3102
426 Ga0495635_0000634 3300046663 Bacteria 22580
427 Ga0495635_0024592 3300046663 Bacteria 4197
428 Ga0495659_0000444 3300046664 Bacteria 15459
429 Ga0495661_0001658 3300046665 Bacteria 18146
430 Ga0495661_0018013 3300046665 Bacteria 4652
431 Ga0495661_0038871 3300046665 Bacteria 2960
432 Ga0495661_0065164 3300046665 Bacteria 2147
433 Ga0495588_0019801 3300046674 Bacteria 3301
434 Ga0495588_0053660 3300046674 Bacteria 2079
435 Ga0495588_0070515 3300046674 Bacteria 1816
436 Ga0495646_0000741 3300046680 Bacteria 18144
437 Ga0495646_0004015 3300046680 Bacteria 9220
438 Ga0495646_0027685 3300046680 Bacteria 3554
439 Ga0495669_0008977 3300046684 Bacteria 4212
440 Ga0495669_0015454 3300046684 Bacteria 3269
441 Ga0495613_0024530 3300046689 Bacteria 4493
442 Ga0495613_0066753 3300046689 Bacteria 2626
443 Ga0495670_0000311 3300046691 Bacteria 23109
444 Ga0495670_0001408 3300046691 Bacteria 11787
445 Ga0495670_0002425 3300046691 Bacteria 9209
446 Ga0495670_0003694 3300046691 Bacteria 7522
447 Ga0495671_0004669 3300046692 Bacteria 8116
448 Ga0495671_0024740 3300046692 Bacteria 3124
449 Ga0495671_0026699 3300046692 Bacteria 2990
450 Ga0495671_0062173 3300046692 Bacteria 1840
451 Ga0495649_0002980 3300046694 Bacteria 11658
452 Ga0495649_0017843 3300046694 Bacteria 4001
453 Ga0495649_0025017 3300046694 Bacteria 3326
454 Ga0495649_0031242 3300046694 Bacteria 2937
455 Ga0495649_0035651 3300046694 Bacteria 2736
456 Ga0495589_0000583 3300046794 Bacteria 25061
457 Ga0495589_0005361 3300046794 Bacteria 6767
458 Ga0495589_0011953 3300046794 Bacteria 4500
459 Ga0495589_0016258 3300046794 Bacteria 3823
460 Ga0495589_0025932 3300046794 Bacteria 2971
461 Ga0495600_0017483 3300046809 Bacteria 4562
462 Ga0495600_0097181 3300046809 Bacteria 1920
463 Ga0495660_0006587 3300046810 Bacteria 6862
464 Ga0495660_0007200 3300046810 Bacteria 6551
465 Ga0495660_0022533 3300046810 Bacteria 3595
466 Ga0495660_0037237 3300046810 Bacteria 2710
467 Ga0495660_0048088 3300046810 Bacteria 2333
468 Ga0495604_0007777 3300047317 Bacteria 8487
469 Ga0495674_0021510 3300047319 Bacteria 5966
470 Ga0495674_0023204 3300047319 Bacteria 5720
471 Ga0495674_0098808 3300047319 Bacteria 2485
472 Ga0495672_0001530 3300047320 Bacteria 22644
473 Ga0495672_0001610 3300047320 Bacteria 22034
474 Ga0495672_0002226 3300047320 Bacteria 18032
475 Ga0495672_0004132 3300047320 Bacteria 12065
476 Ga0495672_0015868 3300047320 Bacteria 5099
477 Ga0495672_0076264 3300047320 Bacteria 1883
478 Ga0495680_0003591 3300047322 Bacteria 15190
479 Ga0495680_0004374 3300047322 Bacteria 13533
480 Ga0495680_0007407 3300047322 Bacteria 10065
481 Ga0495680_0048748 3300047322 Bacteria 3324
482 Ga0495680_0084574 3300047322 Bacteria 2390
483 Ga0495683_0000116 3300047323 Bacteria 80411
484 Ga0495683_0001326 3300047323 Bacteria 16596
485 Ga0495687_000399 3300047443 Bacteria 54034
486 Ga0495687_002509 3300047443 Bacteria 14588
487 Ga0495687_006344 3300047443 Bacteria 7273
488 Ga0495675_0001057 3300047444 Bacteria 16728
489 Ga0495675_0002759 3300047444 Bacteria 10526
490 Ga0495675_0044675 3300047444 Bacteria 2822
491 Ga0495677_0000488 3300047445 Bacteria 16816
492 Ga0495685_000735 3300047447 Bacteria 10014
493 Ga0495673_0000242 3300047469 Bacteria 77375
494 Ga0495673_0000354 3300047469 Bacteria 57082
495 Ga0495673_0000629 3300047469 Bacteria 34725
496 Ga0495673_0000968 3300047469 Bacteria 25866
497 Ga0495673_0001334 3300047469 Bacteria 20025
498 Ga0495673_0002118 3300047469 Bacteria 14422
499 Ga0495673_0006829 3300047469 Bacteria 6658
500 Ga0495673_0007765 3300047469 Bacteria 6119
501 Ga0495673_0015703 3300047469 Bacteria 3895
502 Ga0495673_0019049 3300047469 Bacteria 3445
503 Ga0495681_0002126 3300047470 Bacteria 14393
504 Ga0495681_0003451 3300047470 Bacteria 10995
505 Ga0495681_0005314 3300047470 Bacteria 8641
506 Ga0495681_0008198 3300047470 Bacteria 6571
507 Ga0495681_0009319 3300047470 Bacteria 6062
508 Ga0495681_0010787 3300047470 Bacteria 5502
509 Ga0495681_0033207 3300047470 Bacteria 2588
510 Ga0495681_0044702 3300047470 Bacteria 2125
511 Ga0495684_0016846 3300047471 Bacteria 5631
512 Ga0495684_0054849 3300047471 Bacteria 3039
513 Ga0495686_0001441 3300047472 Bacteria 25958
514 Ga0495686_0005533 3300047472 Bacteria 9939
515 Ga0495686_0013556 3300047472 Bacteria 5652
516 Ga0495686_0056004 3300047472 Bacteria 2464
517 Ga0495593_0007519 3300047673 Bacteria 6369
518 Ga0495626_0000557 3300048091 Bacteria 36990
519 Ga0495626_0001118 3300048091 Bacteria 22562
520 Ga0495626_0001839 3300048091 Bacteria 15949
521 Ga0495626_0002483 3300048091 Bacteria 12759
522 Ga0495626_0015123 3300048091 Bacteria 3955
523 Ga0496100_0009386 3300048903 Bacteria 5499
524 Ga0496101_0024370 3300048904 Bacteria 4187
525 Ga0496102_0028759 3300048905 Bacteria 4968
526 Ga0496104_0028711 3300048907 Bacteria 5156
527 Ga0496104_0042013 3300048907 Bacteria 4288
528 Ga0496105_0009768 3300048908 Bacteria 7516
529 Ga0496105_0045916 3300048908 Bacteria 3604
530 Ga0496106_0039617 3300048909 Bacteria 3529
531 Ga0496107_0139003 3300048910 Bacteria 1795
532 Ga0496113_0072576 3300048916 Bacteria 2620
533 Ga0496125_0008254 3300048928 Bacteria 10937
534 Ga0496125_0011131 3300048928 Bacteria 9022
535 Ga0496125_0022451 3300048928 Bacteria 5861
536 Ga0496125_0026783 3300048928 Bacteria 5239
537 Ga0496126_0000439 3300048929 Bacteria 82909
538 Ga0495678_011525 3300049459 Bacteria 4227
539 Ga0495678_014235 3300049459 Bacteria 3705
540 Ga0495682_0002569 3300049460 Bacteria 8532
541 Ga0495682_0003475 3300049460 Bacteria 7004
542 Ga0495682_0020715 3300049460 Bacteria 2467
543 Ga0501042_0035339 3300049578 Bacteria 3545
544 Ga0501048_0074955 3300049582 Bacteria 2387
545 Ga0501071_0004124 3300049587 Bacteria 9182
546 Ga0501075_0001565 3300049591 Bacteria 14939
547 Ga0501077_0008357 3300049593 Bacteria 6408
548 Ga0501081_0005287 3300049743 Bacteria 8325
549 nmdc:mga03683_1713_c1 3300050489 Bacteria 6188
550 nmdc:mga00v17_116400_c1 3300050491 Bacteria 1699
551 nmdc:mga05p37_31112_c1 3300050507 Bacteria 5580
552 nmdc:mga0qj67_55_c1 3300050509 Bacteria 83015
553 nmdc:mga0qj67_79095_c1 3300050509 Bacteria 2632
554 nmdc:mga06r32_27219_c1 3300050510 Bacteria 5339
555 nmdc:mga08y16_79604_c1 3300050511 Bacteria 3415
556 nmdc:mga08y16_95204_c1 3300050511 Bacteria 3101
557 nmdc:mga0sz30_3371_c1 3300050516 Bacteria 5743
558 Ga0500643_000068 3300053087 Bacteria 117369
559 Ga0500556_0015749 3300053104 Bacteria 2339
560 Ga0500557_027571 3300053105 Bacteria 1689
561 Ga0500594_0001175 3300053118 Bacteria 5653
562 Ga0500568_0000168 3300053139 Bacteria 56752
563 Ga0500616_0000225 3300053153 Bacteria 88286
564 Ga0500616_0001366 3300053153 Bacteria 23717
565 Ga0501082_0009068 3300060353 Bacteria 8580
566 Ga0530510_0070937 3300061734 Bacteria 2528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0065483 Ga0495628_0065483_26_1156 353
2 3300046680 Ga0495646_0004015 Ga0495646_0004015_51_1181 353
3 3300046515 Ga0495620_0007459 Ga0495620_0007459_4650_5921 422
4 3300025915 Ga0207693_10020774 Ga0207693_100207746 433
5 3300046457 Ga0495590_0000662 Ga0495590_0000662_7512_8831 438
6 3300046474 Ga0495605_0002147 Ga0495605_0002147_7344_8663 438
7 3300046674 Ga0495588_0019801 Ga0495588_0019801_684_2003 438
8 3300046694 Ga0495649_0025017 Ga0495649_0025017_1838_3157 438
9 3300046810 Ga0495660_0048088 Ga0495660_0048088_73_1392 438
10 3300047320 Ga0495672_0004132 Ga0495672_0004132_2757_4076 438
11 3300047469 Ga0495673_0007765 Ga0495673_0007765_2858_4177 438
12 3300046459 Ga0495629_0138440 Ga0495629_0138440_214_1602 439
13 3300046463 Ga0495653_0027770 Ga0495653_0027770_187_1575 439
14 3300046473 Ga0495582_0004511 Ga0495582_0004511_5728_7116 439
15 3300046517 Ga0495630_0002240 Ga0495630_0002240_207_1595 439
16 3300046663 Ga0495635_0024592 Ga0495635_0024592_1927_3315 439
17 3300046689 Ga0495613_0024530 Ga0495613_0024530_750_2138 439
18 3300047317 Ga0495604_0007777 Ga0495604_0007777_656_2044 439
19 3300047322 Ga0495680_0084574 Ga0495680_0084574_788_2176 439
20 3300047444 Ga0495675_0001057 Ga0495675_0001057_9214_10602 439
21 3300005548 Ga0070665_100036309 Ga0070665_1000363099 441
22 iso_pu_bacteria 8005460587 8005463180 442
23 3300036712 Ga0316584_0120932 Ga0316584_0120932_204_1628 444
24 3300046472 Ga0495580_0006250 Ga0495580_0006250_423_1877 445
25 3300046520 Ga0495637_0002954 Ga0495637_0002954_22_1440 445
26 3300046512 Ga0495610_0000693 Ga0495610_0000693_16420_17766 447
27 iso_pu_bacteria 2916021584 2916026960 447
28 iso_pu_bacteria 2921296804 2921299701 447
29 3300046491 Ga0495584_0019314 Ga0495584_0019314_1286_2647 449
30 3300046512 Ga0495610_0012164 Ga0495610_0012164_3708_5141 449
31 3300046519 Ga0495632_0026066 Ga0495632_0026066_731_2092 449
32 3300046520 Ga0495637_0028058 Ga0495637_0028058_744_2105 449
33 3300046648 Ga0495611_0081804 Ga0495611_0081804_17_1378 449
34 3300046694 Ga0495649_0035651 Ga0495649_0035651_995_2356 449
35 3300005288 Ga0065714_10064708 Ga0065714_1006470818 450
36 3300017792 Ga0163161_10000683 Ga0163161_1000068311 450
37 3300041512 Ga0451853_0132233 Ga0451853_0132233_24_1379 450
38 3300046455 Ga0495603_0000989 Ga0495603_0000989_9218_10651 450
39 3300046506 Ga0495583_0007522 Ga0495583_0007522_1911_3284 450
40 3300046522 Ga0495643_0030869 Ga0495643_0030869_479_1852 450
41 3300053153 Ga0500616_0001366 Ga0500616_0001366_18991_20364 450
42 3300003775 Ga0055524_1030471 Ga0055524_10304711 451
43 3300009094 Ga0111539_10012513 Ga0111539_100125138 451
44 3300009174 Ga0105241_10038236 Ga0105241_100382362 451
45 3300010375 Ga0105239_10125523 Ga0105239_101255234 451
46 3300041501 Ga0451845_0583219 Ga0451845_0583219_52_1407 451
47 3300041505 Ga0451849_0546217 Ga0451849_0546217_6765_8120 451
48 3300050511 nmdc:mga08y16_79604_c1 nmdc:mga08y16_79604_c1_276_1649 451
49 3300009094 Ga0111539_10076343 Ga0111539_100763433 452
50 3300006058 Ga0075432_10005105 Ga0075432_100051055 453
51 3300047320 Ga0495672_0001530 Ga0495672_0001530_5897_7306 453
52 3300047470 Ga0495681_0009319 Ga0495681_0009319_821_2257 453
53 3300006844 Ga0075428_100065792 Ga0075428_1000657923 458
54 3300006846 Ga0075430_100045636 Ga0075430_1000456363 458
55 3300006847 Ga0075431_100047446 Ga0075431_1000474463 458
56 3300009147 Ga0114129_10311506 Ga0114129_103115062 458
57 3300013296 Ga0157374_10083881 Ga0157374_100838812 458
58 3300013308 Ga0157375_10175723 Ga0157375_101757232 458
59 3300014969 Ga0157376_10125786 Ga0157376_101257862 458
60 3300050507 nmdc:mga05p37_31112_c1 nmdc:mga05p37_31112_c1_3779_5158 458
61 3300050509 nmdc:mga0qj67_79095_c1 nmdc:mga0qj67_79095_c1_494_1873 458
62 3300050510 nmdc:mga06r32_27219_c1 nmdc:mga06r32_27219_c1_3930_5309 458
63 iso_pu_bacteria 2643221736 2644746591 458
64 3300009036 Ga0105244_10027675 Ga0105244_100276753 459
65 3300009766 Ga0123342_1007700 Ga0123342_100770016 459
66 3300046453 Ga0495627_001025 Ga0495627_001025_642_2024 459
67 3300046458 Ga0495591_002530 Ga0495591_002530_2150_3532 459
68 3300046460 Ga0495638_0027288 Ga0495638_0027288_325_1707 459
69 3300046460 Ga0495638_0063882 Ga0495638_0063882_728_2110 459
70 3300046471 Ga0495650_0011712 Ga0495650_0011712_460_1842 459
71 3300046471 Ga0495650_0013104 Ga0495650_0013104_1419_2801 459
72 3300046474 Ga0495605_0014130 Ga0495605_0014130_2271_3653 459
73 3300046491 Ga0495584_0001264 Ga0495584_0001264_13865_15247 459
74 3300046491 Ga0495584_0003796 Ga0495584_0003796_1955_3337 459
75 3300046491 Ga0495584_0004060 Ga0495584_0004060_6029_7411 459
76 3300046501 Ga0495607_0006324 Ga0495607_0006324_1190_2572 459
77 3300046507 Ga0495606_0001401 Ga0495606_0001401_3215_4597 459
78 3300046507 Ga0495606_0047244 Ga0495606_0047244_987_2369 459
79 3300046512 Ga0495610_0007589 Ga0495610_0007589_4914_6296 459
80 3300046513 Ga0495616_0001121 Ga0495616_0001121_5403_6785 459
81 3300046515 Ga0495620_0000308 Ga0495620_0000308_31557_32939 459
82 3300046518 Ga0495631_0000099 Ga0495631_0000099_31387_32769 459
83 3300046520 Ga0495637_0008277 Ga0495637_0008277_2008_3390 459
84 3300046520 Ga0495637_0014958 Ga0495637_0014958_1524_2906 459
85 3300046522 Ga0495643_0018519 Ga0495643_0018519_2430_3812 459
86 3300046524 Ga0495648_0045640 Ga0495648_0045640_19_1401 459
87 3300046530 Ga0495654_0029954 Ga0495654_0029954_402_1784 459
88 3300046542 Ga0495597_0001230 Ga0495597_0001230_16703_18085 459
89 3300046558 Ga0495633_0000512 Ga0495633_0000512_25715_27097 459
90 3300046660 Ga0495625_0011000 Ga0495625_0011000_1320_2702 459
91 3300046665 Ga0495661_0018013 Ga0495661_0018013_2125_3507 459
92 3300046692 Ga0495671_0024740 Ga0495671_0024740_731_2113 459
93 3300046694 Ga0495649_0017843 Ga0495649_0017843_1935_3317 459
94 3300046694 Ga0495649_0031242 Ga0495649_0031242_233_1615 459
95 3300046794 Ga0495589_0000583 Ga0495589_0000583_4961_6343 459
96 3300046794 Ga0495589_0011953 Ga0495589_0011953_1323_2705 459
97 3300047320 Ga0495672_0076264 Ga0495672_0076264_71_1453 459
98 3300047322 Ga0495680_0007407 Ga0495680_0007407_4205_5587 459
99 3300047323 Ga0495683_0000116 Ga0495683_0000116_49873_51255 459
100 3300047323 Ga0495683_0001326 Ga0495683_0001326_1323_2705 459
101 3300047469 Ga0495673_0000242 Ga0495673_0000242_14824_16206 459
102 3300047469 Ga0495673_0000629 Ga0495673_0000629_5440_6822 459
103 3300047470 Ga0495681_0002126 Ga0495681_0002126_6619_8001 459
104 3300047472 Ga0495686_0005533 Ga0495686_0005533_5417_6799 459
105 3300047673 Ga0495593_0007519 Ga0495593_0007519_260_1642 459
106 3300048091 Ga0495626_0000557 Ga0495626_0000557_34327_35709 459
107 3300048928 Ga0496125_0022451 Ga0496125_0022451_4363_5745 459
108 3300049460 Ga0495682_0002569 Ga0495682_0002569_6768_8150 459
109 3300035398 Ga0316574_0044073 Ga0316574_0044073_241_1674 460
110 3300035398 Ga0316574_0079599 Ga0316574_0079599_640_2064 460
111 3300036712 Ga0316584_0053395 Ga0316584_0053395_484_1908 460
112 3300003911 JGI25405J52794_10000694 JGI25405J52794_100006942 461
113 3300005937 Ga0081455_10014532 Ga0081455_100145326 461
114 3300036401 Ga0373937_0019887 Ga0373937_0019887_1587_3062 461
115 3300046460 Ga0495638_0002626 Ga0495638_0002626_11651_13081 461
116 3300046460 Ga0495638_0002650 Ga0495638_0002650_5373_6761 461
117 3300046475 Ga0495639_0003927 Ga0495639_0003927_3648_5036 461
118 3300046492 Ga0495585_0000202 Ga0495585_0000202_34262_35692 461
119 3300046499 Ga0495594_0002066 Ga0495594_0002066_8494_9882 461
120 3300046501 Ga0495607_0006199 Ga0495607_0006199_1296_2684 461
121 3300046507 Ga0495606_0079439 Ga0495606_0079439_630_2018 461
122 3300046538 Ga0495609_0021733 Ga0495609_0021733_1314_2702 461
123 3300046615 Ga0495656_0000867 Ga0495656_0000867_550_1938 461
124 3300046691 Ga0495670_0000311 Ga0495670_0000311_8887_10275 461
125 3300046691 Ga0495670_0002425 Ga0495670_0002425_5470_6858 461
126 3300047443 Ga0495687_006344 Ga0495687_006344_3532_4920 461
127 3300047469 Ga0495673_0006829 Ga0495673_0006829_2189_3577 461
128 3300047470 Ga0495681_0003451 Ga0495681_0003451_2703_4091 461
129 3300047472 Ga0495686_0001441 Ga0495686_0001441_1479_2909 461
130 3300050516 nmdc:mga0sz30_3371_c1 nmdc:mga0sz30_3371_c1_1792_3180 461
131 3300005530 Ga0070679_100146748 Ga0070679_1001467481 463
132 3300009094 Ga0111539_10049248 Ga0111539_100492482 463
133 3300025911 Ga0207654_10021840 Ga0207654_100218404 463
134 3300025912 Ga0207707_10000754 Ga0207707_100007548 463
135 3300025921 Ga0207652_10061836 Ga0207652_100618361 463
136 3300035086 Ga0373934_0006254 Ga0373934_0006254_2465_3901 463
137 3300036401 Ga0373937_0003549 Ga0373937_0003549_10202_11638 463
138 3300046809 Ga0495600_0097181 Ga0495600_0097181_34_1473 463
139 3300047471 Ga0495684_0016846 Ga0495684_0016846_117_1553 463
140 3300048929 Ga0496126_0000439 Ga0496126_0000439_35278_36723 463
141 iso_pu_bacteria 2511231008 2511279281 464
142 3300009765 Ga0123341_1029041 Ga0123341_10290413 465
143 iso_pu_bacteria 2738543024 2739310482 465
144 3300003215 JGI25153J46596_10003083 JGI25153J46596_100030832 466
145 3300009094 Ga0111539_10176452 Ga0111539_101764521 466
146 3300025230 Ga0209563_101298 Ga0209563_1012983 466
147 3300025297 Ga0209758_1000165 Ga0209758_10001659 466
148 3300028380 Ga0268265_10193407 Ga0268265_101934072 466
149 3300046460 Ga0495638_0021901 Ga0495638_0021901_289_1722 466
150 iso_pu_bacteria 2511231020 2511348753 466
151 iso_pu_bacteria 2643221589 2643953482 466
152 iso_pu_bacteria 2643221602 2644021224 466
153 iso_pu_bacteria 2738543004 2739199581 466
154 iso_pu_bacteria 2857537821 2857541634 466
155 3300005331 Ga0070670_100136242 Ga0070670_1001362421 467
156 3300005367 Ga0070667_100148506 Ga0070667_1001485062 467
157 3300006048 Ga0075363_100009224 Ga0075363_1000092243 467
158 3300021441 Ga0213871_10004105 Ga0213871_100041052 467
159 3300022740 Ga0228710_1003508 Ga0228710_10035083 467
160 3300025940 Ga0207691_10019378 Ga0207691_100193783 467
161 3300027666 Ga0209282_1000158 Ga0209282_10001584 467
162 3300031251 Ga0265327_10001113 Ga0265327_1000111338 467
163 3300031967 Ga0315914_1001030 Ga0315914_100103038 467
164 3300033464 Ga0315915_1000531 Ga0315915_10005313 467
165 3300036647 Ga0316582_0034513 Ga0316582_0034513_1105_2565 467
166 3300036647 Ga0316582_0084230 Ga0316582_0084230_517_1977 467
167 3300036712 Ga0316584_0084557 Ga0316584_0084557_618_2078 467
168 3300039438 Ga0436360_0178824 Ga0436360_0178824_120_1556 467
169 3300047470 Ga0495681_0008198 Ga0495681_0008198_4396_5844 467
170 iso_pu_bacteria 2718218269 2720773042 467
171 iso_pu_bacteria 2721755819 2724093071 467
172 iso_pu_bacteria 2791355259 2793316705 467
173 iso_pu_bacteria 2888388044 2888388913 467
174 iso_pu_bacteria 8019555841 8019555848 467
175 iso_pu_bacteria 8019565922 8019569468 467
176 3300005288 Ga0065714_10016073 Ga0065714_100160733 468
177 3300005328 Ga0070676_10000904 Ga0070676_100009045 468
178 3300005333 Ga0070677_10003064 Ga0070677_100030645 468
179 3300005335 Ga0070666_10001014 Ga0070666_100010146 468
180 3300005347 Ga0070668_100016536 Ga0070668_1000165364 468
181 3300005354 Ga0070675_100003604 Ga0070675_1000036042 468
182 3300005356 Ga0070674_100001604 Ga0070674_1000016044 468
183 3300005364 Ga0070673_100035602 Ga0070673_1000356023 468
184 3300005367 Ga0070667_100020128 Ga0070667_1000201284 468
185 3300005455 Ga0070663_100063934 Ga0070663_1000639341 468
186 3300005456 Ga0070678_100000405 Ga0070678_10000040518 468
187 3300005456 Ga0070678_100006469 Ga0070678_1000064693 468
188 3300005459 Ga0068867_100040060 Ga0068867_1000400601 468
189 3300005466 Ga0070685_10009082 Ga0070685_100090825 468
190 3300005539 Ga0068853_100091295 Ga0068853_1000912952 468
191 3300005543 Ga0070672_100001549 Ga0070672_1000015496 468
192 3300005548 Ga0070665_100018677 Ga0070665_1000186775 468
193 3300005616 Ga0068852_100017853 Ga0068852_1000178534 468
194 3300005616 Ga0068852_100034910 Ga0068852_1000349103 468
195 3300005719 Ga0068861_100048010 Ga0068861_1000480102 468
196 3300005834 Ga0068851_10002660 Ga0068851_100026606 468
197 3300005840 Ga0068870_10001420 Ga0068870_100014207 468
198 3300005841 Ga0068863_100039874 Ga0068863_1000398742 468
199 3300006237 Ga0097621_100022234 Ga0097621_1000222345 468
200 3300006358 Ga0068871_100020842 Ga0068871_1000208426 468
201 3300006881 Ga0068865_100032046 Ga0068865_1000320464 468
202 3300009176 Ga0105242_10008285 Ga0105242_100082855 468
203 3300009177 Ga0105248_10046402 Ga0105248_100464022 468
204 3300009177 Ga0105248_10349607 Ga0105248_103496071 468
205 3300009177 Ga0105248_10355683 Ga0105248_103556832 468
206 3300013297 Ga0157378_10068141 Ga0157378_100681412 468
207 3300013306 Ga0163162_10049337 Ga0163162_100493373 468
208 3300013306 Ga0163162_10217165 Ga0163162_102171651 468
209 3300013308 Ga0157375_10005698 Ga0157375_100056985 468
210 3300014969 Ga0157376_10141867 Ga0157376_101418672 468
211 3300025728 Ga0207655_1023771 Ga0207655_10237712 468
212 3300025893 Ga0207682_10002716 Ga0207682_100027164 468
213 3300025903 Ga0207680_10019812 Ga0207680_100198122 468
214 3300025907 Ga0207645_10000350 Ga0207645_1000035013 468
215 3300025908 Ga0207643_10004244 Ga0207643_100042445 468
216 3300025926 Ga0207659_10105089 Ga0207659_101050892 468
217 3300025931 Ga0207644_10015383 Ga0207644_100153834 468
218 3300025934 Ga0207686_10006304 Ga0207686_100063045 468
219 3300025937 Ga0207669_10049423 Ga0207669_100494232 468
220 3300025940 Ga0207691_10000332 Ga0207691_1000033211 468
221 3300025941 Ga0207711_10098623 Ga0207711_100986231 468
222 3300025960 Ga0207651_10026881 Ga0207651_100268814 468
223 3300025972 Ga0207668_10097117 Ga0207668_100971172 468
224 3300025986 Ga0207658_10034304 Ga0207658_100343042 468
225 3300026023 Ga0207677_10004794 Ga0207677_100047946 468
226 3300026041 Ga0207639_10144583 Ga0207639_101445832 468
227 3300026089 Ga0207648_10022669 Ga0207648_100226696 468
228 3300026095 Ga0207676_10178601 Ga0207676_101786011 468
229 3300026118 Ga0207675_100070958 Ga0207675_1000709583 468
230 3300026121 Ga0207683_10002772 Ga0207683_1000277213 468
231 3300026121 Ga0207683_10018564 Ga0207683_100185644 468
232 3300026142 Ga0207698_10156816 Ga0207698_101568161 468
233 3300028379 Ga0268266_10037599 Ga0268266_100375994 468
234 3300041404 Ga0439436_0000889 Ga0439436_0000889_5823_7301 468
235 3300041405 Ga0439438_011444 Ga0439438_011444_169_1647 468
236 3300041407 Ga0439447_010361 Ga0439447_010361_985_2463 468
237 3300041411 Ga0439466_0015652 Ga0439466_0015652_817_2268 468
238 3300041411 Ga0439466_0020186 Ga0439466_0020186_281_1759 468
239 3300042010 Ga0439452_003588 Ga0439452_003588_638_2116 468
240 3300042138 Ga0450903_005560 Ga0450903_005560_149_1600 468
241 3300042156 Ga0439446_0002978 Ga0439446_0002978_316_1794 468
242 3300042435 Ga0439434_0004294 Ga0439434_0004294_1867_3345 468
243 3300046452 Ga0495617_002685 Ga0495617_002685_3700_5151 468
244 3300046457 Ga0495590_0023743 Ga0495590_0023743_118_1569 468
245 3300046457 Ga0495590_0029827 Ga0495590_0029827_448_1899 468
246 3300046458 Ga0495591_000515 Ga0495591_000515_21842_23293 468
247 3300046458 Ga0495591_001161 Ga0495591_001161_3556_5007 468
248 3300046458 Ga0495591_016512 Ga0495591_016512_987_2420 468
249 3300046460 Ga0495638_0075092 Ga0495638_0075092_448_1899 468
250 3300046460 Ga0495638_0083942 Ga0495638_0083942_45_1496 468
251 3300046460 Ga0495638_0109603 Ga0495638_0109603_60_1511 468
252 3300046463 Ga0495653_0001914 Ga0495653_0001914_3519_4970 468
253 3300046471 Ga0495650_0006607 Ga0495650_0006607_5231_6682 468
254 3300046473 Ga0495582_0093890 Ga0495582_0093890_196_1647 468
255 3300046474 Ga0495605_0000456 Ga0495605_0000456_13914_15365 468
256 3300046491 Ga0495584_0051275 Ga0495584_0051275_51_1502 468
257 3300046500 Ga0495596_0002326 Ga0495596_0002326_7085_8536 468
258 3300046501 Ga0495607_0035906 Ga0495607_0035906_1425_2876 468
259 3300046501 Ga0495607_0038696 Ga0495607_0038696_381_1832 468
260 3300046501 Ga0495607_0044072 Ga0495607_0044072_518_1969 468
261 3300046506 Ga0495583_0000125 Ga0495583_0000125_60567_62018 468
262 3300046506 Ga0495583_0000875 Ga0495583_0000875_1626_3077 468
263 3300046507 Ga0495606_0003486 Ga0495606_0003486_6872_8323 468
264 3300046507 Ga0495606_0019973 Ga0495606_0019973_1521_2972 468
265 3300046512 Ga0495610_0000767 Ga0495610_0000767_25206_26657 468
266 3300046512 Ga0495610_0001187 Ga0495610_0001187_21390_22841 468
267 3300046513 Ga0495616_0040938 Ga0495616_0040938_853_2304 468
268 3300046515 Ga0495620_0006465 Ga0495620_0006465_3147_4598 468
269 3300046518 Ga0495631_0011877 Ga0495631_0011877_1850_3301 468
270 3300046519 Ga0495632_0015956 Ga0495632_0015956_1778_3229 468
271 3300046519 Ga0495632_0046854 Ga0495632_0046854_191_1642 468
272 3300046520 Ga0495637_0016792 Ga0495637_0016792_1206_2657 468
273 3300046522 Ga0495643_0020576 Ga0495643_0020576_2116_3567 468
274 3300046522 Ga0495643_0021062 Ga0495643_0021062_610_2061 468
275 3300046523 Ga0495644_0000319 Ga0495644_0000319_15162_16613 468
276 3300046524 Ga0495648_0001115 Ga0495648_0001115_20537_21970 468
277 3300046524 Ga0495648_0074125 Ga0495648_0074125_475_1926 468
278 3300046528 Ga0495642_0001136 Ga0495642_0001136_7885_9309 468
279 3300046530 Ga0495654_0000492 Ga0495654_0000492_14268_15686 468
280 3300046530 Ga0495654_0000821 Ga0495654_0000821_20588_22039 468
281 3300046530 Ga0495654_0001280 Ga0495654_0001280_4728_6179 468
282 3300046530 Ga0495654_0004513 Ga0495654_0004513_2455_3906 468
283 3300046530 Ga0495654_0012933 Ga0495654_0012933_1505_2956 468
284 3300046536 Ga0495587_0002937 Ga0495587_0002937_9329_10780 468
285 3300046542 Ga0495597_0026234 Ga0495597_0026234_513_1964 468
286 3300046543 Ga0495645_0112694 Ga0495645_0112694_408_1859 468
287 3300046557 Ga0495622_0001931 Ga0495622_0001931_243_1694 468
288 3300046615 Ga0495656_0000867 Ga0495656_0000867_6698_8149 468
289 3300046615 Ga0495656_0005499 Ga0495656_0005499_2178_3629 468
290 3300046616 Ga0495668_0004105 Ga0495668_0004105_7056_8507 468
291 3300046660 Ga0495625_0008015 Ga0495625_0008015_5603_7054 468
292 3300046663 Ga0495635_0000634 Ga0495635_0000634_9691_11142 468
293 3300046665 Ga0495661_0001658 Ga0495661_0001658_4690_6108 468
294 3300046665 Ga0495661_0065164 Ga0495661_0065164_403_1854 468
295 3300046674 Ga0495588_0070515 Ga0495588_0070515_108_1559 468
296 3300046680 Ga0495646_0027685 Ga0495646_0027685_539_1990 468
297 3300046692 Ga0495671_0062173 Ga0495671_0062173_220_1671 468
298 3300046694 Ga0495649_0002980 Ga0495649_0002980_4146_5597 468
299 3300046794 Ga0495589_0025932 Ga0495589_0025932_674_2125 468
300 3300046809 Ga0495600_0017483 Ga0495600_0017483_2404_3855 468
301 3300046810 Ga0495660_0006587 Ga0495660_0006587_2242_3660 468
302 3300046810 Ga0495660_0037237 Ga0495660_0037237_862_2313 468
303 3300047320 Ga0495672_0002226 Ga0495672_0002226_13654_15105 468
304 3300047322 Ga0495680_0003591 Ga0495680_0003591_9532_10983 468
305 3300047322 Ga0495680_0004374 Ga0495680_0004374_9534_10985 468
306 3300047444 Ga0495675_0044675 Ga0495675_0044675_289_1740 468
307 3300047469 Ga0495673_0000354 Ga0495673_0000354_45145_46563 468
308 3300047469 Ga0495673_0000968 Ga0495673_0000968_12202_13653 468
309 3300047469 Ga0495673_0001334 Ga0495673_0001334_16263_17714 468
310 3300047470 Ga0495681_0010787 Ga0495681_0010787_3740_5191 468
311 3300047470 Ga0495681_0044702 Ga0495681_0044702_484_1935 468
312 3300047472 Ga0495686_0013556 Ga0495686_0013556_3634_5085 468
313 3300047472 Ga0495686_0056004 Ga0495686_0056004_722_2173 468
314 3300048091 Ga0495626_0001118 Ga0495626_0001118_17534_18985 468
315 3300048091 Ga0495626_0001839 Ga0495626_0001839_1986_3437 468
316 3300049459 Ga0495678_011525 Ga0495678_011525_1455_2906 468
317 3300049459 Ga0495678_014235 Ga0495678_014235_1276_2727 468
318 iso_pu_bacteria 2513237096 2513659641 468
319 iso_pu_bacteria 2513237145 2513921639 468
320 iso_pu_bacteria 2786546548 2787508342 468
321 iso_pu_bacteria 2939669807 2939672722 468
322 iso_pu_bacteria 8006933436 8006936287 468
323 iso_pu_bacteria 8006973647 8006976256 468
324 3300005289 Ga0065704_10022662 Ga0065704_100226622 469
325 3300005354 Ga0070675_100076079 Ga0070675_1000760792 469
326 3300005355 Ga0070671_100112165 Ga0070671_1001121652 469
327 3300005434 Ga0070709_10061353 Ga0070709_100613532 469
328 3300005436 Ga0070713_100057088 Ga0070713_1000570882 469
329 3300005437 Ga0070710_10025309 Ga0070710_100253091 469
330 3300005543 Ga0070672_100092468 Ga0070672_1000924683 469
331 3300005618 Ga0068864_100067919 Ga0068864_1000679192 469
332 3300006237 Ga0097621_100038227 Ga0097621_1000382273 469
333 3300006358 Ga0068871_100016950 Ga0068871_1000169502 469
334 3300006846 Ga0075430_100000496 Ga0075430_10000049616 469
335 3300013297 Ga0157378_10002100 Ga0157378_1000210015 469
336 3300025898 Ga0207692_10029184 Ga0207692_100291841 469
337 3300025906 Ga0207699_10093883 Ga0207699_100938831 469
338 3300025917 Ga0207660_10189526 Ga0207660_101895261 469
339 3300025925 Ga0207650_10074240 Ga0207650_100742402 469
340 3300025926 Ga0207659_10037386 Ga0207659_100373863 469
341 3300025928 Ga0207700_10050694 Ga0207700_100506941 469
342 3300025929 Ga0207664_10096226 Ga0207664_100962261 469
343 3300025931 Ga0207644_10094539 Ga0207644_100945392 469
344 3300025939 Ga0207665_10028023 Ga0207665_100280234 469
345 3300025940 Ga0207691_10052727 Ga0207691_100527273 469
346 3300026095 Ga0207676_10041168 Ga0207676_100411684 469
347 3300027907 Ga0207428_10073091 Ga0207428_100730913 469
348 3300031911 Ga0307412_10019671 Ga0307412_100196713 469
349 3300046471 Ga0495650_0000531 Ga0495650_0000531_3372_4826 469
350 3300046491 Ga0495584_0000015 Ga0495584_0000015_164313_165770 469
351 3300046492 Ga0495585_0002873 Ga0495585_0002873_2309_3763 469
352 3300046513 Ga0495616_0010358 Ga0495616_0010358_3399_4853 469
353 3300046519 Ga0495632_0000166 Ga0495632_0000166_11654_13108 469
354 3300046520 Ga0495637_0018688 Ga0495637_0018688_1698_3152 469
355 3300046684 Ga0495669_0008977 Ga0495669_0008977_1349_2803 469
356 3300046794 Ga0495589_0016258 Ga0495589_0016258_1120_2574 469
357 3300047445 Ga0495677_0000488 Ga0495677_0000488_3700_5154 469
358 3300048928 Ga0496125_0026783 Ga0496125_0026783_2817_4238 469
359 3300050509 nmdc:mga0qj67_55_c1 nmdc:mga0qj67_55_c1_13723_15153 469
360 iso_pu_bacteria 2929150217 2929154151 469
361 3300005335 Ga0070666_10004020 Ga0070666_100040202 470
362 3300005354 Ga0070675_100045147 Ga0070675_1000451472 470
363 3300005367 Ga0070667_100024728 Ga0070667_1000247283 470
364 3300005548 Ga0070665_100003169 Ga0070665_1000031692 470
365 3300005548 Ga0070665_100006331 Ga0070665_10000633111 470
366 3300006058 Ga0075432_10004750 Ga0075432_100047509 470
367 3300006186 Ga0075369_10011884 Ga0075369_100118841 470
368 3300006946 Ga0079104_1000141 Ga0079104_100014111 470
369 3300009176 Ga0105242_10045147 Ga0105242_100451473 470
370 3300013104 Ga0157370_10011163 Ga0157370_100111636 470
371 3300013308 Ga0157375_10032963 Ga0157375_100329634 470
372 3300025903 Ga0207680_10023088 Ga0207680_100230882 470
373 3300025926 Ga0207659_10052369 Ga0207659_100523692 470
374 3300027111 Ga0209281_1000258 Ga0209281_100025897 470
375 3300028379 Ga0268266_10002913 Ga0268266_100029132 470
376 3300028379 Ga0268266_10044074 Ga0268266_100440743 470
377 3300046452 Ga0495617_002834 Ga0495617_002834_2398_3822 470
378 3300046454 Ga0495592_0030897 Ga0495592_0030897_1060_2475 470
379 3300046492 Ga0495585_0000120 Ga0495585_0000120_76072_77496 470
380 3300046512 Ga0495610_0003745 Ga0495610_0003745_7564_8988 470
381 3300046519 Ga0495632_0003412 Ga0495632_0003412_1263_2687 470
382 3300046538 Ga0495609_0046377 Ga0495609_0046377_463_1893 470
383 3300047319 Ga0495674_0023204 Ga0495674_0023204_2899_4314 470
384 3300047320 Ga0495672_0015868 Ga0495672_0015868_731_2161 470
385 3300047443 Ga0495687_002509 Ga0495687_002509_11366_12796 470
386 3300049460 Ga0495682_0020715 Ga0495682_0020715_567_1997 470
387 3300050489 nmdc:mga03683_1713_c1 nmdc:mga03683_1713_c1_3879_5309 470
388 3300053104 Ga0500556_0015749 Ga0500556_0015749_564_2006 470
389 iso_pu_bacteria 2643221589 2643953478 470
390 iso_pu_bacteria 2643221602 2644021220 470
391 iso_pu_bacteria 2841957949 2841962824 470
392 iso_pu_bacteria 2904550169 2904554564 470
393 iso_pu_bacteria 2935630451 2935634679 470
394 iso_pu_bacteria 2941507105 2941509165 470
395 iso_pu_bacteria 2941515067 2941516994 470
396 iso_pu_bacteria 2941523033 2941524911 470
397 3300005288 Ga0065714_10089636 Ga0065714_100896362 471
398 3300005340 Ga0070689_100065820 Ga0070689_1000658201 471
399 3300005459 Ga0068867_100042435 Ga0068867_1000424352 471
400 3300005937 Ga0081455_10012180 Ga0081455_100121803 471
401 3300025926 Ga0207659_10094474 Ga0207659_100944742 471
402 3300025936 Ga0207670_10024379 Ga0207670_100243793 471
403 3300025938 Ga0207704_10038401 Ga0207704_100384011 471
404 3300025940 Ga0207691_10018383 Ga0207691_100183835 471
405 3300026089 Ga0207648_10002865 Ga0207648_100028659 471
406 3300032004 Ga0307414_10000215 Ga0307414_1000021542 471
407 3300046519 Ga0495632_0050986 Ga0495632_0050986_239_1711 471
408 3300047470 Ga0495681_0033207 Ga0495681_0033207_62_1534 471
409 3300050511 nmdc:mga08y16_95204_c1 nmdc:mga08y16_95204_c1_1533_3002 471
410 3300053153 Ga0500616_0000225 Ga0500616_0000225_32218_33657 471
411 iso_pu_bacteria 2508501009 2508539825 471
412 iso_pu_bacteria 2511231014 2511313017 471
413 iso_pu_bacteria 2511231015 2511321498 471
414 iso_pu_bacteria 2513237084 2513567601 471
415 iso_pu_bacteria 2643221565 2643845760 471
416 iso_pu_bacteria 2643221589 2643956741 471
417 iso_pu_bacteria 2643221602 2644021964 471
418 iso_pu_bacteria 2643221633 2644187003 471
419 iso_pu_bacteria 2738543004 2739198304 471
420 iso_pu_bacteria 2738543004 2739199578 471
421 iso_pu_bacteria 2738543004 2739199599 471
422 iso_pu_bacteria 2738543015 2739260153 471
423 iso_pu_bacteria 2876808645 2876815545 471
424 iso_pu_bacteria 2879110137 2879115599 471
425 iso_pu_bacteria 2935630451 2935634890 471
426 iso_pu_bacteria 2935675223 2935684916 471
427 iso_pu_bacteria 2941507105 2941511779 471
428 iso_pu_bacteria 2941515067 2941519481 471
429 iso_pu_bacteria 2941523033 2941527826 471
430 iso_pu_bacteria 2957388812 2957392546 471
431 iso_pu_bacteria 8019648815 8019654652 471
432 iso_pu_bacteria 8056177738 8056177759 471
433 3300005439 Ga0070711_100026793 Ga0070711_1000267934 472
434 3300005444 Ga0070694_100015060 Ga0070694_1000150602 472
435 3300005545 Ga0070695_100003489 Ga0070695_1000034899 472
436 3300005546 Ga0070696_100068650 Ga0070696_1000686502 472
437 3300005549 Ga0070704_100043577 Ga0070704_1000435774 472
438 3300009147 Ga0114129_10050166 Ga0114129_100501665 472
439 3300013306 Ga0163162_10166769 Ga0163162_101667692 472
440 3300015265 Ga0182005_1015399 Ga0182005_10153991 472
441 3300017792 Ga0163161_10128586 Ga0163161_101285861 472
442 3300031691 Ga0316579_10011911 Ga0316579_100119112 472
443 3300031691 Ga0316579_10024085 Ga0316579_100240851 472
444 3300031727 Ga0316576_10002334 Ga0316576_100023346 472
445 3300031727 Ga0316576_10082834 Ga0316576_100828342 472
446 3300031728 Ga0316578_10037777 Ga0316578_100377771 472
447 3300031733 Ga0316577_10000152 Ga0316577_1000015217 472
448 3300031733 Ga0316577_10059644 Ga0316577_100596442 472
449 3300032133 Ga0316583_10005584 Ga0316583_100055844 472
450 3300032133 Ga0316583_10014939 Ga0316583_100149391 472
451 3300032137 Ga0316585_10000183 Ga0316585_100001835 472
452 3300032139 Ga0316580_10000832 Ga0316580_100008326 472
453 3300032168 Ga0316593_10006226 Ga0316593_100062261 472
454 3300033541 Ga0316596_1009190 Ga0316596_10091901 472
455 3300035398 Ga0316574_0005769 Ga0316574_0005769_1298_2806 472
456 3300035398 Ga0316574_0059525 Ga0316574_0059525_195_1685 472
457 3300035695 Ga0373927_0028975 Ga0373927_0028975_989_2437 472
458 3300036647 Ga0316582_0000007 Ga0316582_0000007_39516_41024 472
459 3300036712 Ga0316584_0104913 Ga0316584_0104913_106_1584 472
460 3300037588 Ga0316581_0024186 Ga0316581_0024186_175_1683 472
461 3300042461 Ga0439460_0000588 Ga0439460_0000588_3144_4619 472
462 3300046462 Ga0495651_0096201 Ga0495651_0096201_624_2102 472
463 3300046514 Ga0495618_0049397 Ga0495618_0049397_792_2270 472
464 3300046517 Ga0495630_0049876 Ga0495630_0049876_168_1646 472
465 3300047319 Ga0495674_0021510 Ga0495674_0021510_1039_2487 472
466 3300047319 Ga0495674_0098808 Ga0495674_0098808_42_1520 472
467 3300047322 Ga0495680_0048748 Ga0495680_0048748_372_1850 472
468 3300047471 Ga0495684_0054849 Ga0495684_0054849_1172_2650 472
469 3300050491 nmdc:mga00v17_116400_c1 nmdc:mga00v17_116400_c1_117_1595 472
470 iso_pu_bacteria 2510065019 2510133530 472
471 iso_pu_bacteria 2510065057 2510305650 472
472 iso_pu_bacteria 2510065057 2510307412 472
473 iso_pu_bacteria 2510461076 2510899747 472
474 iso_pu_bacteria 2510461076 2510900343 472
475 iso_pu_bacteria 2512875026 2512969345 472
476 iso_pu_bacteria 2513237089 2513606602 472
477 iso_pu_bacteria 2513237091 2513620224 472
478 iso_pu_bacteria 2513237156 2513986926 472
479 iso_pu_bacteria 2513237160 2514008305 472
480 iso_pu_bacteria 2515075009 2515112506 472
481 iso_pu_bacteria 2515154116 2515659915 472
482 iso_pu_bacteria 2516653046 2516897940 472
483 iso_pu_bacteria 2517093000 2517098806 472
484 iso_pu_bacteria 2517287029 2517411364 472
485 iso_pu_bacteria 2517487022 2517565925 472
486 iso_pu_bacteria 2551306086 2551695822 472
487 iso_pu_bacteria 2551306089 2551711219 472
488 iso_pu_bacteria 2551306090 2551717490 472
489 iso_pu_bacteria 2551306091 2551726840 472
490 iso_pu_bacteria 2551306092 2551738275 472
491 iso_pu_bacteria 2582581283 2585167244 472
492 iso_pu_bacteria 2582581306 2585270181 472
493 iso_pu_bacteria 2643221557 2643809580 472
494 iso_pu_bacteria 2643221636 2644200364 472
495 iso_pu_bacteria 2643221668 2644375923 472
496 iso_pu_bacteria 2643221688 2644492895 472
497 iso_pu_bacteria 2724679232 2725946514 472
498 iso_pu_bacteria 2758568016 2758639741 472
499 iso_pu_bacteria 2765235802 2765466259 472
500 iso_pu_bacteria 2775506901 2776260940 472
501 iso_pu_bacteria 2802428858 2802721614 472
502 iso_pu_bacteria 2802428859 2802726763 472
503 iso_pu_bacteria 2802428860 2802732826 472
504 iso_pu_bacteria 2802428861 2802741054 472
505 iso_pu_bacteria 2802428862 2802747259 472
506 iso_pu_bacteria 2802428863 2802752590 472
507 iso_pu_bacteria 2841734538 2841737611 472
508 iso_pu_bacteria 2849076700 2849079944 472
509 iso_pu_bacteria 2855825444 2855831186 472
510 iso_pu_bacteria 2855839649 2855845200 472
511 iso_pu_bacteria 2857516855 2857522631 472
512 iso_pu_bacteria 2871474448 2871481221 472
513 iso_pu_bacteria 2874590934 2874596608 472
514 iso_pu_bacteria 2874645413 2874653159 472
515 iso_pu_bacteria 2876771140 2876777096 472
516 iso_pu_bacteria 2876818435 2876825154 472
517 iso_pu_bacteria 2879074833 2879081233 472
518 iso_pu_bacteria 2879127579 2879131918 472
519 iso_pu_bacteria 2879142872 2879148952 472
520 iso_pu_bacteria 2894232714 2894233331 472
521 iso_pu_bacteria 2894232714 2894235105 472
522 iso_pu_bacteria 2915980308 2915984809 472
523 iso_pu_bacteria 2915993759 2915999871 472
524 iso_pu_bacteria 2916000859 2916007042 472
525 iso_pu_bacteria 2916007675 2916013177 472
526 iso_pu_bacteria 2916014648 2916021400 472
527 iso_pu_bacteria 2916021584 2916027532 472
528 iso_pu_bacteria 2916035215 2916035395 472
529 iso_pu_bacteria 2916035215 2916035732 472
530 iso_pu_bacteria 2916041962 2916042571 472
531 iso_pu_bacteria 2916041962 2916046854 472
532 iso_pu_bacteria 2916048683 2916049310 472
533 iso_pu_bacteria 2916048683 2916054017 472
534 iso_pu_bacteria 2916061851 2916062510 472
535 iso_pu_bacteria 2916076590 2916078108 472
536 iso_pu_bacteria 2916076590 2916082500 472
537 iso_pu_bacteria 2917699015 2917704144 472
538 iso_pu_bacteria 2921201388 2921206550 472
539 iso_pu_bacteria 2921208531 2921208810 472
540 iso_pu_bacteria 2921237296 2921241773 472
541 iso_pu_bacteria 2921257292 2921262979 472
542 iso_pu_bacteria 2924150972 2924153931 472
543 iso_pu_bacteria 2924158325 2924161282 472
544 iso_pu_bacteria 2924179722 2924186228 472
545 iso_pu_bacteria 2924193448 2924195483 472
546 iso_pu_bacteria 2924207177 2924213290 472
547 iso_pu_bacteria 2924214083 2924217052 472
548 iso_pu_bacteria 2924228884 2924230198 472
549 iso_pu_bacteria 2933016740 2933019836 472
550 iso_pu_bacteria 2935616580 2935624627 472
551 iso_pu_bacteria 2935684952 2935690835 472
552 iso_pu_bacteria 2935694250 2935702527 472
553 iso_pu_bacteria 2935713505 2935718216 472
554 iso_pu_bacteria 2935722832 2935727803 472
555 iso_pu_bacteria 2935732158 2935736507 472
556 iso_pu_bacteria 2935741537 2935745886 472
557 iso_pu_bacteria 2935750917 2935756267 472
558 iso_pu_bacteria 2935819856 2935825778 472
559 iso_pu_bacteria 2935855204 2935863257 472
560 iso_pu_bacteria 2935864058 2935872208 472
561 iso_pu_bacteria 2935873716 2935882323 472
562 iso_pu_bacteria 2935901341 2935905216 472
563 iso_pu_bacteria 2937002841 2937008993 472
564 iso_pu_bacteria 2937009748 2937011900 472
565 iso_pu_bacteria 2937016420 2937019654 472
566 iso_pu_bacteria 2937023124 2937028185 472
567 iso_pu_bacteria 2937036028 2937040396 472
568 iso_pu_bacteria 2937049772 2937051368 472
569 iso_pu_bacteria 2937063883 2937067134 472
570 iso_pu_bacteria 2937078374 2937083657 472
571 iso_pu_bacteria 2937084907 2937087783 472
572 iso_pu_bacteria 2937091812 2937094158 472
573 iso_pu_bacteria 2937098957 2937104034 472
574 iso_pu_bacteria 2937106411 2937113162 472
575 iso_pu_bacteria 2937119839 2937122162 472
576 iso_pu_bacteria 2937836603 2937840155 472
577 iso_pu_bacteria 2940556831 2940561758 472
578 iso_pu_bacteria 2957382221 2957383630 472
579 iso_pu_bacteria 2957395598 2957401208 472
580 iso_pu_bacteria 2957402308 2957403601 472
581 iso_pu_bacteria 2957408893 2957412259 472
582 iso_pu_bacteria 2957430029 2957435207 472
583 iso_pu_bacteria 2957437181 2957439375 472
584 iso_pu_bacteria 2957450854 2957456689 472
585 iso_pu_bacteria 2957457609 2957463869 472
586 iso_pu_bacteria 2957471148 2957477550 472
587 iso_pu_bacteria 2957484790 2957489852 472
588 iso_pu_bacteria 2957491536 2957494673 472
589 iso_pu_bacteria 2957498199 2957505048 472
590 iso_pu_bacteria 2958071322 2958072785 472
591 iso_pu_bacteria 2960591022 2960595305 472
592 iso_pu_bacteria 2960603979 2960610352 472
593 iso_pu_bacteria 2960610863 2960613990 472
594 iso_pu_bacteria 2960610863 2960617179 472
595 iso_pu_bacteria 2960624210 2960630599 472
596 iso_pu_bacteria 2960637947 2960639913 472
597 iso_pu_bacteria 2960667422 2960670320 472
598 iso_pu_bacteria 2960674078 2960674517 472
599 iso_pu_bacteria 2960680706 2960687010 472
600 iso_pu_bacteria 2960687367 2960691711 472
601 iso_pu_bacteria 2964615318 2964620129 472
602 iso_pu_bacteria 2964628898 2964634571 472
603 iso_pu_bacteria 2964636051 2964639922 472
604 iso_pu_bacteria 2964649959 2964650504 472
605 iso_pu_bacteria 2964656573 2964658720 472
606 iso_pu_bacteria 2964663802 2964668529 472
607 iso_pu_bacteria 2964670856 2964674503 472
608 iso_pu_bacteria 2964678106 2964683468 472
609 iso_pu_bacteria 2964691889 2964698233 472
610 iso_pu_bacteria 2964698721 2964699281 472
611 iso_pu_bacteria 2964712639 2964717332 472
612 iso_pu_bacteria 2964719344 2964725367 472
613 iso_pu_bacteria 2967664464 2967667988 472
614 iso_pu_bacteria 2967671571 2967674679 472
615 iso_pu_bacteria 2967678726 2967683970 472
616 iso_pu_bacteria 2967686174 2967691794 472
617 iso_pu_bacteria 2967693043 2967697420 472
618 iso_pu_bacteria 2967699805 2967705850 472
619 iso_pu_bacteria 2967714385 2967716077 472
620 iso_pu_bacteria 2967721400 2967727478 472
621 iso_pu_bacteria 2967728569 2967732943 472
622 iso_pu_bacteria 2967755722 2967760183 472
623 iso_pu_bacteria 2967762386 2967768062 472
624 iso_pu_bacteria 2970019648 2970024732 472
625 iso_pu_bacteria 2970026789 2970031371 472
626 iso_pu_bacteria 2970033650 2970038886 472
627 iso_pu_bacteria 2970040964 2970042802 472
628 iso_pu_bacteria 2970047711 2970050755 472
629 iso_pu_bacteria 2970054988 2970060768 472
630 iso_pu_bacteria 2970061556 2970067599 472
631 iso_pu_bacteria 2970068827 2970075046 472
632 iso_pu_bacteria 2970076120 2970080069 472
633 iso_pu_bacteria 2970088815 2970089089 472
634 iso_pu_bacteria 2970095765 2970102174 472
635 iso_pu_bacteria 2970102677 2970106699 472
636 iso_pu_bacteria 2970109326 2970113092 472
637 iso_pu_bacteria 2970116247 2970118332 472
638 iso_pu_bacteria 2970129317 2970133743 472
639 iso_pu_bacteria 2970143518 2970146987 472
640 iso_pu_bacteria 2970149975 2970156273 472
641 iso_pu_bacteria 2970164137 2970168727 472
642 iso_pu_bacteria 2970170962 2970176444 472
643 iso_pu_bacteria 2970177841 2970182008 472
644 iso_pu_bacteria 2970177841 2970183818 472
645 iso_pu_bacteria 2970184632 2970188083 472
646 iso_pu_bacteria 2977516862 2977519219 472
647 iso_pu_bacteria 2977516862 2977521594 472
648 iso_pu_bacteria 2977537788 2977541371 472
649 iso_pu_bacteria 2977544691 2977547604 472
650 iso_pu_bacteria 2977551784 2977556729 472
651 iso_pu_bacteria 2977565890 2977569338 472
652 iso_pu_bacteria 2977572785 2977578880 472
653 iso_pu_bacteria 2977579622 2977582439 472
654 iso_pu_bacteria 2989771324 2989772434 472
655 iso_pu_bacteria 648276728 648741298 472
656 iso_pu_bacteria 8003992118 8003997816 472
657 iso_pu_bacteria 8003999396 8004004369 472
658 iso_pu_bacteria 8005321885 8005322115 472
659 3300005353 Ga0070669_100092257 Ga0070669_1000922572 473
660 3300005354 Ga0070675_100031808 Ga0070675_1000318081 473
661 3300005844 Ga0068862_100136004 Ga0068862_1001360042 473
662 3300006881 Ga0068865_100166334 Ga0068865_1001663341 473
663 3300006946 Ga0079104_1000141 Ga0079104_10001416 473
664 3300013296 Ga0157374_10042294 Ga0157374_100422943 473
665 3300014325 Ga0163163_10162365 Ga0163163_101623652 473
666 3300017792 Ga0163161_10014053 Ga0163161_100140533 473
667 3300025315 Ga0207697_10015766 Ga0207697_100157663 473
668 3300025923 Ga0207681_10033592 Ga0207681_100335922 473
669 3300025972 Ga0207668_10026179 Ga0207668_100261793 473
670 3300026121 Ga0207683_10020424 Ga0207683_100204242 473
671 3300027111 Ga0209281_1000258 Ga0209281_1000258101 473
672 3300042010 Ga0439452_000408 Ga0439452_000408_714_2192 473
673 3300046460 Ga0495638_0002876 Ga0495638_0002876_9355_10833 473
674 3300046474 Ga0495605_0001623 Ga0495605_0001623_1249_2727 473
675 3300046506 Ga0495583_0000921 Ga0495583_0000921_18307_19785 473
676 3300046522 Ga0495643_0013458 Ga0495643_0013458_1125_2603 473
677 3300046528 Ga0495642_0000016 Ga0495642_0000016_101174_102652 473
678 3300046538 Ga0495609_0000186 Ga0495609_0000186_8428_9906 473
679 3300046616 Ga0495668_0014873 Ga0495668_0014873_2461_3939 473
680 3300046648 Ga0495611_0005606 Ga0495611_0005606_2299_3777 473
681 3300046664 Ga0495659_0000444 Ga0495659_0000444_11064_12542 473
682 3300046665 Ga0495661_0038871 Ga0495661_0038871_1295_2773 473
683 3300046674 Ga0495588_0053660 Ga0495588_0053660_199_1677 473
684 3300047447 Ga0495685_000735 Ga0495685_000735_2296_3774 473
685 3300047469 Ga0495673_0019049 Ga0495673_0019049_1599_3077 473
686 3300048091 Ga0495626_0002483 Ga0495626_0002483_5355_6833 473
687 3300049460 Ga0495682_0003475 Ga0495682_0003475_1509_2987 473
688 iso_pu_bacteria 2513237103 2513709680 473
689 iso_pu_bacteria 2513237138 2513867874 473
690 iso_pu_bacteria 2513237162 2514018670 473
691 iso_pu_bacteria 2515075009 2515115492 473
692 iso_pu_bacteria 2515154113 2515636579 473
693 iso_pu_bacteria 2515154114 2515642369 473
694 iso_pu_bacteria 2516653077 2517042083 473
695 iso_pu_bacteria 2643221618 2644106170 473
696 iso_pu_bacteria 2643221626 2644146865 473
697 iso_pu_bacteria 2643221634 2644193909 473
698 iso_pu_bacteria 2643221655 2644310781 473
699 iso_pu_bacteria 2643221659 2644334432 473
700 iso_pu_bacteria 2643221698 2644545371 473
701 iso_pu_bacteria 2643221712 2644616615 473
702 iso_pu_bacteria 2643221723 2644671772 473
703 iso_pu_bacteria 2767802442 2770199555 473
704 iso_pu_bacteria 2844163670 2844165883 473
705 iso_pu_bacteria 8005460587 8005466714 473
706 iso_pu_bacteria 8057874678 8057880688 473
707 3300005457 Ga0070662_100057499 Ga0070662_1000574993 474
708 3300013104 Ga0157370_10091703 Ga0157370_100917032 474
709 3300015265 Ga0182005_1009417 Ga0182005_10094172 474
710 3300032168 Ga0316593_10002559 Ga0316593_100025592 474
711 3300037588 Ga0316581_0000422 Ga0316581_0000422_3757_5193 474
712 3300044712 Ga0453684_0325526 Ga0453684_0325526_191_1663 474
713 3300046472 Ga0495580_0015143 Ga0495580_0015143_720_2195 474
714 3300047320 Ga0495672_0001610 Ga0495672_0001610_881_2362 474
715 3300005347 Ga0070668_100014033 Ga0070668_1000140333 475
716 3300005456 Ga0070678_100114537 Ga0070678_1001145371 475
717 3300005844 Ga0068862_100016358 Ga0068862_1000163587 475
718 3300009094 Ga0111539_10184888 Ga0111539_101848882 475
719 3300009148 Ga0105243_10169835 Ga0105243_101698352 475
720 3300013104 Ga0157370_10000874 Ga0157370_100008744 475
721 3300013306 Ga0163162_10000430 Ga0163162_1000043032 475
722 3300013306 Ga0163162_10061624 Ga0163162_100616243 475
723 3300025933 Ga0207706_10136705 Ga0207706_101367052 475
724 3300025972 Ga0207668_10031898 Ga0207668_100318983 475
725 3300025986 Ga0207658_10016768 Ga0207658_100167682 475
726 3300026121 Ga0207683_10010836 Ga0207683_100108367 475
727 3300026121 Ga0207683_10062273 Ga0207683_100622733 475
728 3300028380 Ga0268265_10011885 Ga0268265_100118856 475
729 3300033442 Ga0315911_1000015 Ga0315911_100001599 475
730 3300046519 Ga0495632_0013353 Ga0495632_0013353_1010_2533 475
731 3300046558 Ga0495633_0062334 Ga0495633_0062334_87_1571 475
732 3300046691 Ga0495670_0000311 Ga0495670_0000311_4245_5774 475
733 3300046691 Ga0495670_0001408 Ga0495670_0001408_3987_5510 475
734 3300046692 Ga0495671_0026699 Ga0495671_0026699_1156_2679 475
735 3300046810 Ga0495660_0007200 Ga0495660_0007200_1654_3177 475
736 3300047469 Ga0495673_0002118 Ga0495673_0002118_2410_3933 475
737 3300047470 Ga0495681_0003451 Ga0495681_0003451_6389_7912 475
738 3300048903 Ga0496100_0009386 Ga0496100_0009386_1843_3327 475
739 3300048904 Ga0496101_0024370 Ga0496101_0024370_1505_2989 475
740 3300048905 Ga0496102_0028759 Ga0496102_0028759_1381_2865 475
741 3300048907 Ga0496104_0028711 Ga0496104_0028711_2133_3617 475
742 3300048908 Ga0496105_0009768 Ga0496105_0009768_4042_5526 475
743 3300048909 Ga0496106_0039617 Ga0496106_0039617_1862_3346 475
744 3300048910 Ga0496107_0139003 Ga0496107_0139003_247_1731 475
745 3300048916 Ga0496113_0072576 Ga0496113_0072576_822_2306 475
746 3300048928 Ga0496125_0008254 Ga0496125_0008254_3305_4834 475
747 iso_pu_bacteria 2939669807 2939674549 475
748 3300006946 Ga0079104_1002621 Ga0079104_10026216 476
749 3300009147 Ga0114129_10167222 Ga0114129_101672222 476
750 3300025903 Ga0207680_10013508 Ga0207680_100135083 476
751 3300025931 Ga0207644_10023407 Ga0207644_100234072 476
752 3300026116 Ga0207674_10028917 Ga0207674_100289173 476
753 3300027111 Ga0209281_1001527 Ga0209281_10015279 476
754 3300027907 Ga0207428_10002707 Ga0207428_100027077 476
755 3300027907 Ga0207428_10029455 Ga0207428_100294554 476
756 3300027907 Ga0207428_10062745 Ga0207428_100627452 476
757 3300031727 Ga0316576_10107624 Ga0316576_101076242 476
758 3300031731 Ga0307405_10051810 Ga0307405_100518102 476
759 3300031901 Ga0307406_10164165 Ga0307406_101641651 476
760 3300031911 Ga0307412_10024325 Ga0307412_100243253 476
761 3300031995 Ga0307409_100003279 Ga0307409_1000032798 476
762 3300031995 Ga0307409_100025378 Ga0307409_1000253783 476
763 3300032126 Ga0307415_100031011 Ga0307415_1000310111 476
764 3300041486 Ga0451807_0853366 Ga0451807_0853366_29_1462 476
765 3300041491 Ga0451833_0392287 Ga0451833_0392287_449_1891 476
766 3300041494 Ga0451837_1096565 Ga0451837_1096565_295_1728 476
767 3300041505 Ga0451849_0645052 Ga0451849_0645052_1085_2527 476
768 3300041507 Ga0451851_0808350 Ga0451851_0808350_1817_3250 476
769 3300041507 Ga0451851_0821168 Ga0451851_0821168_1560_3002 476
770 3300041509 Ga0451843_0006633 Ga0451843_0006633_1102_2544 476
771 3300041509 Ga0451843_0720882 Ga0451843_0720882_30_1463 476
772 3300041512 Ga0451853_0136319 Ga0451853_0136319_697_2139 476
773 3300042876 Ga0451577_0073875 Ga0451577_0073875_48_1517 476
774 3300044712 Ga0453684_0152038 Ga0453684_0152038_1016_2485 476
775 3300046453 Ga0495627_008261 Ga0495627_008261_1503_3062 476
776 3300046458 Ga0495591_001137 Ga0495591_001137_6776_8302 476
777 3300046460 Ga0495638_0022320 Ga0495638_0022320_2306_3832 476
778 3300046473 Ga0495582_0095633 Ga0495582_0095633_41_1567 476
779 3300046475 Ga0495639_0028195 Ga0495639_0028195_663_2189 476
780 3300046492 Ga0495585_0000047 Ga0495585_0000047_65804_67330 476
781 3300046519 Ga0495632_0050976 Ga0495632_0050976_72_1565 476
782 3300046523 Ga0495644_0001550 Ga0495644_0001550_1517_3076 476
783 3300046524 Ga0495648_0012805 Ga0495648_0012805_4451_6040 476
784 3300046524 Ga0495648_0029425 Ga0495648_0029425_587_2146 476
785 3300046528 Ga0495642_0000008 Ga0495642_0000008_99972_101498 476
786 3300046538 Ga0495609_0040826 Ga0495609_0040826_274_1863 476
787 3300046542 Ga0495597_0003213 Ga0495597_0003213_1767_3326 476
788 3300046543 Ga0495645_0018675 Ga0495645_0018675_472_1998 476
789 3300046616 Ga0495668_0003153 Ga0495668_0003153_7009_8535 476
790 3300046660 Ga0495625_0047297 Ga0495625_0047297_1505_3064 476
791 3300046680 Ga0495646_0000741 Ga0495646_0000741_709_2235 476
792 3300046684 Ga0495669_0015454 Ga0495669_0015454_393_1919 476
793 3300046689 Ga0495613_0066753 Ga0495613_0066753_839_2365 476
794 3300046691 Ga0495670_0003694 Ga0495670_0003694_1789_3348 476
795 3300046692 Ga0495671_0004669 Ga0495671_0004669_5957_7516 476
796 3300046794 Ga0495589_0005361 Ga0495589_0005361_4390_5916 476
797 3300046810 Ga0495660_0022533 Ga0495660_0022533_338_1864 476
798 3300047443 Ga0495687_000399 Ga0495687_000399_48570_50159 476
799 3300047444 Ga0495675_0002759 Ga0495675_0002759_8021_9547 476
800 3300047469 Ga0495673_0015703 Ga0495673_0015703_1975_3564 476
801 3300047470 Ga0495681_0005314 Ga0495681_0005314_5290_6849 476
802 3300048091 Ga0495626_0015123 Ga0495626_0015123_901_2427 476
803 3300048907 Ga0496104_0042013 Ga0496104_0042013_2350_3792 476
804 3300048908 Ga0496105_0045916 Ga0496105_0045916_516_1958 476
805 3300048928 Ga0496125_0011131 Ga0496125_0011131_2848_4374 476
806 3300049578 Ga0501042_0035339 Ga0501042_0035339_1089_2573 476
807 3300049582 Ga0501048_0074955 Ga0501048_0074955_23_1507 476
808 3300049587 Ga0501071_0004124 Ga0501071_0004124_4507_5991 476
809 3300049591 Ga0501075_0001565 Ga0501075_0001565_9773_11257 476
810 3300049593 Ga0501077_0008357 Ga0501077_0008357_2068_3552 476
811 3300049743 Ga0501081_0005287 Ga0501081_0005287_5074_6558 476
812 3300053087 Ga0500643_000068 Ga0500643_000068_78290_79735 476
813 3300053105 Ga0500557_027571 Ga0500557_027571_153_1646 476
814 3300053118 Ga0500594_0001175 Ga0500594_0001175_692_2185 476
815 3300053139 Ga0500568_0000168 Ga0500568_0000168_2728_4221 476
816 3300060353 Ga0501082_0009068 Ga0501082_0009068_3833_5317 476
817 3300061734 Ga0530510_0070937 Ga0530510_0070937_520_2004 476
818 iso_pu_bacteria 2582581299 2585233923 476
819 iso_pu_bacteria 2921250672 2921255495 476
820 iso_pu_bacteria 2937029754 2937034079 476
821 iso_pu_bacteria 2937836603 2937837575 476
822 iso_pu_bacteria 2957375807 2957379657 476
823 iso_pu_bacteria 2960631154 2960637877 476
824 iso_pu_bacteria 2960693952 2960698940 476
825 iso_pu_bacteria 2970122695 2970127374 476
826 iso_pu_bacteria 2970143518 2970148322 476
827 iso_pu_bacteria 2977530762 2977535646 476
828 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003154 477
829 3300003187 JGI25151J46595_10018005 JGI25151J46595_100180052 477
830 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003335 477
831 3300003374 JGI25161J50226_1000373 JGI25161J50226_10003737 477
832 3300003771 Ga0055526_1002068 Ga0055526_10020685 477
833 3300004625 Ga0055543_1000203 Ga0055543_100020316 477
834 3300005262 Ga0065165_1000084 Ga0065165_100008411 477
835 3300025208 Ga0209436_100487 Ga0209436_10048716 477
836 3300025284 Ga0209130_1000005 Ga0209130_1000005143 477
837 3300025294 Ga0209025_1000479 Ga0209025_100047974 477
838 3300025295 Ga0209564_1000093 Ga0209564_1000093146 477
839 3300025299 Ga0209256_1001179 Ga0209256_10011797 477
840 3300025302 Ga0207426_1000015 Ga0207426_1000015456 477
841 3300025303 Ga0209051_1004038 Ga0209051_10040381 477
842 3300025304 Ga0209257_1002436 Ga0209257_100243613 477
843 3300041494 Ga0451837_0889142 Ga0451837_0889142_16_1449 477
844 3300041511 Ga0451855_0067003 Ga0451855_0067003_879_2312 477

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06742

DUF1214

Protein of unknown function (DUF1214)

409

521

0.98

PF01476

LysM

LysM domain

36

78

0.96

PF06863

DUF1254

Protein of unknown function (DUF1254)

140

272

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u07-assembly2.cif.gz_B crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.7933 37 477
3u07-assembly2.cif.gz_B crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.7899 37 477
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.7771 37 477
3vb9-assembly2.cif.gz_D crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 0.7767 35 476
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.7737 37 477
ID Description Score Start End Superfamily
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8721 346 477 2.60.120.1600
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8583 346 477 2.60.120.1600
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.8581 344 476 2.60.120.600
2p3yA02 Mainly Alpha;Orthogonal Bundle;VPA0735-like fold;VPA0735-like domain 0.7275 236 301 1.10.3360.10
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.6093 344 476 2.60.120.600
ID Description Score Start End GO Terms
AF-A0A3S3M672-F1-model_v4 DUF1214 domain-containing protein 0.9861 367 454
AF-S3IAL2-F1-model_v4 DUF1254 domain-containing protein 0.9846 113 198
AF-A0A3N6RAW6-F1-model_v4 DUF1254 domain-containing protein 0.9831 100 206
AF-A0A6P0DQY6-F1-model_v4 DUF1254 domain-containing protein 0.9727 114 276
AF-A0A434CKC3-F1-model_v4 DUF1254 domain-containing protein 0.9682 35 283

Feature Viewer

pLDDT pTM Quality
89.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map