F483237
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 845 | 288 | 845 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10102203|Ga0070658_101022034 |
| Length | 146 |
| Sequence | MAMNVGTADGDDDEVMSTINTTPLVDVMLVLLXXFLITVPVVRNSIPVELPKERNEIRESKPENIVISVDAQDHIYWNDLRMASTQALVDRLKKISVLSPQPEVQIRGDGRGNYEGVGRVVYACQRAGISKVSFITEPPPRAAAAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 107 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 108 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 226 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 229 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 230 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 231 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 283 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 286 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 287 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.47 |
| Nodule | 0 |
| Rhizoplane | 3.91 |
| Rhizosphere | 94.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1010643 | 3300001976 | Bacteria | 1200 |
| 2 | JGI24748J21848_1011999 | 3300002074 | Bacteria | 1021 |
| 3 | JGI24738J21930_10018936 | 3300002075 | Bacteria | 1438 |
| 4 | JGI24749J21850_1019575 | 3300002076 | Bacteria | 956 |
| 5 | JGI24033J26618_1007210 | 3300002155 | Bacteria | 1259 |
| 6 | JGI24034J26672_10010575 | 3300002239 | Bacteria | 1373 |
| 7 | JGI24034J26672_10073748 | 3300002239 | Bacteria | 614 |
| 8 | JGI24751J29686_10044553 | 3300002459 | Bacteria | 917 |
| 9 | rootL2_10104466 | 3300003322 | Bacteria | 2144 |
| 10 | Ga0065714_10344125 | 3300005288 | Bacteria | 642 |
| 11 | Ga0065712_10129191 | 3300005290 | Bacteria | 1570 |
| 12 | Ga0065715_10105326 | 3300005293 | Bacteria | 2900 |
| 13 | Ga0065715_10150410 | 3300005293 | Bacteria | 1736 |
| 14 | Ga0070658_10102203 | 3300005327 | Bacteria | 2370 |
| 15 | Ga0070658_10325556 | 3300005327 | Bacteria | 1313 |
| 16 | Ga0070676_10001268 | 3300005328 | Bacteria | 12689 |
| 17 | Ga0070676_10022429 | 3300005328 | Bacteria | 3539 |
| 18 | Ga0070676_10040257 | 3300005328 | Bacteria | 2706 |
| 19 | Ga0070676_10051342 | 3300005328 | Bacteria | 2421 |
| 20 | Ga0070676_10321970 | 3300005328 | Bacteria | 1055 |
| 21 | Ga0070683_100004758 | 3300005329 | Bacteria | 11234 |
| 22 | Ga0070683_100049601 | 3300005329 | Bacteria | 3883 |
| 23 | Ga0070683_100052029 | 3300005329 | Bacteria | 3794 |
| 24 | Ga0070690_100019262 | 3300005330 | Bacteria | 4138 |
| 25 | Ga0070690_100212354 | 3300005330 | Bacteria | 1352 |
| 26 | Ga0070670_100006317 | 3300005331 | Bacteria | 10030 |
| 27 | Ga0070670_100006809 | 3300005331 | Bacteria | 9676 |
| 28 | Ga0070670_100076130 | 3300005331 | Bacteria | 2883 |
| 29 | Ga0070670_100082257 | 3300005331 | Bacteria | 2767 |
| 30 | Ga0070670_100444170 | 3300005331 | Bacteria | 1149 |
| 31 | Ga0070670_100471761 | 3300005331 | Bacteria | 1114 |
| 32 | Ga0070670_100522873 | 3300005331 | Bacteria | 1057 |
| 33 | Ga0070677_10003225 | 3300005333 | Bacteria | 5250 |
| 34 | Ga0070677_10014052 | 3300005333 | Bacteria | 2811 |
| 35 | Ga0070677_10082214 | 3300005333 | Bacteria | 1381 |
| 36 | Ga0068869_100003638 | 3300005334 | Bacteria | 9461 |
| 37 | Ga0068869_100008402 | 3300005334 | Bacteria | 6656 |
| 38 | Ga0068869_100047854 | 3300005334 | Bacteria | 3090 |
| 39 | Ga0068869_100051214 | 3300005334 | Bacteria | 2995 |
| 40 | Ga0070666_10001424 | 3300005335 | Bacteria | 14500 |
| 41 | Ga0070666_10013532 | 3300005335 | Bacteria | 5179 |
| 42 | Ga0070666_10076897 | 3300005335 | Bacteria | 2278 |
| 43 | Ga0070666_10232927 | 3300005335 | Bacteria | 1301 |
| 44 | Ga0070666_10251072 | 3300005335 | Bacteria | 1252 |
| 45 | Ga0070680_100302817 | 3300005336 | Bacteria | 1356 |
| 46 | Ga0070680_101012233 | 3300005336 | Bacteria | 718 |
| 47 | Ga0070682_100055241 | 3300005337 | Bacteria | 2494 |
| 48 | Ga0068868_100002750 | 3300005338 | Bacteria | 12180 |
| 49 | Ga0068868_100006774 | 3300005338 | Bacteria | 8140 |
| 50 | Ga0068868_100011037 | 3300005338 | Bacteria | 6567 |
| 51 | Ga0068868_100040170 | 3300005338 | Bacteria | 3640 |
| 52 | Ga0068868_101164502 | 3300005338 | Bacteria | 712 |
| 53 | Ga0070660_100000551 | 3300005339 | Bacteria | 25098 |
| 54 | Ga0070660_100048969 | 3300005339 | Bacteria | 3247 |
| 55 | Ga0070660_100113162 | 3300005339 | Bacteria | 2161 |
| 56 | Ga0070660_100256552 | 3300005339 | Bacteria | 1427 |
| 57 | Ga0070660_100387922 | 3300005339 | Bacteria | 1153 |
| 58 | Ga0070660_101015659 | 3300005339 | Bacteria | 701 |
| 59 | Ga0070689_100079378 | 3300005340 | Bacteria | 2574 |
| 60 | Ga0070689_100279327 | 3300005340 | Bacteria | 1385 |
| 61 | Ga0070661_100007142 | 3300005344 | Bacteria | 7701 |
| 62 | Ga0070661_100013445 | 3300005344 | Bacteria | 5744 |
| 63 | Ga0070661_100035823 | 3300005344 | Bacteria | 3606 |
| 64 | Ga0070661_100041563 | 3300005344 | Bacteria | 3355 |
| 65 | Ga0070661_100092316 | 3300005344 | Bacteria | 2243 |
| 66 | Ga0070661_100238474 | 3300005344 | Bacteria | 1400 |
| 67 | Ga0070661_101827089 | 3300005344 | Bacteria | 516 |
| 68 | Ga0070668_100001406 | 3300005347 | Bacteria | 17305 |
| 69 | Ga0070668_100003165 | 3300005347 | Bacteria | 12129 |
| 70 | Ga0070668_100044359 | 3300005347 | Bacteria | 3412 |
| 71 | Ga0070668_100047261 | 3300005347 | Bacteria | 3308 |
| 72 | Ga0070668_100301473 | 3300005347 | Bacteria | 1344 |
| 73 | Ga0070668_100317601 | 3300005347 | Bacteria | 1310 |
| 74 | Ga0070668_100383260 | 3300005347 | Bacteria | 1197 |
| 75 | Ga0070668_100914659 | 3300005347 | Bacteria | 785 |
| 76 | Ga0070669_100002287 | 3300005353 | Bacteria | 13893 |
| 77 | Ga0070669_100042357 | 3300005353 | Bacteria | 3313 |
| 78 | Ga0070669_100377471 | 3300005353 | Bacteria | 1156 |
| 79 | Ga0070675_100002082 | 3300005354 | Bacteria | 14809 |
| 80 | Ga0070675_100021055 | 3300005354 | Bacteria | 5207 |
| 81 | Ga0070675_100022596 | 3300005354 | Bacteria | 5025 |
| 82 | Ga0070675_100032188 | 3300005354 | Bacteria | 4242 |
| 83 | Ga0070675_100748439 | 3300005354 | Bacteria | 892 |
| 84 | Ga0070675_101085289 | 3300005354 | Bacteria | 736 |
| 85 | Ga0070671_100005547 | 3300005355 | Bacteria | 10050 |
| 86 | Ga0070671_100013130 | 3300005355 | Bacteria | 6674 |
| 87 | Ga0070671_100020178 | 3300005355 | Bacteria | 5432 |
| 88 | Ga0070671_100058212 | 3300005355 | Bacteria | 3217 |
| 89 | Ga0070671_100194496 | 3300005355 | Bacteria | 1719 |
| 90 | Ga0070671_100336695 | 3300005355 | Bacteria | 1287 |
| 91 | Ga0070671_100695773 | 3300005355 | Bacteria | 881 |
| 92 | Ga0070671_101033111 | 3300005355 | Bacteria | 721 |
| 93 | Ga0070671_101221548 | 3300005355 | Bacteria | 662 |
| 94 | Ga0070674_100000659 | 3300005356 | Bacteria | 17432 |
| 95 | Ga0070674_100013733 | 3300005356 | Bacteria | 5013 |
| 96 | Ga0070674_100099090 | 3300005356 | Bacteria | 2119 |
| 97 | Ga0070673_100001356 | 3300005364 | Bacteria | 14306 |
| 98 | Ga0070673_100007946 | 3300005364 | Bacteria | 7029 |
| 99 | Ga0070673_100011832 | 3300005364 | Bacteria | 5972 |
| 100 | Ga0070673_100647597 | 3300005364 | Bacteria | 967 |
| 101 | Ga0070673_100738552 | 3300005364 | Bacteria | 906 |
| 102 | Ga0070673_100957650 | 3300005364 | Bacteria | 795 |
| 103 | Ga0070673_101692088 | 3300005364 | Bacteria | 599 |
| 104 | Ga0070688_100013445 | 3300005365 | Bacteria | 4615 |
| 105 | Ga0070688_100837337 | 3300005365 | Bacteria | 722 |
| 106 | Ga0070688_101105635 | 3300005365 | Bacteria | 634 |
| 107 | Ga0070659_100000779 | 3300005366 | Bacteria | 23129 |
| 108 | Ga0070659_100018637 | 3300005366 | Bacteria | 5239 |
| 109 | Ga0070659_100023800 | 3300005366 | Bacteria | 4689 |
| 110 | Ga0070659_100275134 | 3300005366 | Bacteria | 1400 |
| 111 | Ga0070659_100343555 | 3300005366 | Bacteria | 1251 |
| 112 | Ga0070659_100482661 | 3300005366 | Bacteria | 1055 |
| 113 | Ga0070659_100815926 | 3300005366 | Bacteria | 812 |
| 114 | Ga0070667_100000406 | 3300005367 | Bacteria | 46071 |
| 115 | Ga0070667_100003532 | 3300005367 | Bacteria | 13319 |
| 116 | Ga0070667_100053943 | 3300005367 | Bacteria | 3394 |
| 117 | Ga0070667_100059940 | 3300005367 | Bacteria | 3221 |
| 118 | Ga0070667_100080136 | 3300005367 | Bacteria | 2792 |
| 119 | Ga0070667_100087714 | 3300005367 | Bacteria | 2671 |
| 120 | Ga0070667_100387313 | 3300005367 | Bacteria | 1271 |
| 121 | Ga0070709_10032539 | 3300005434 | Bacteria | 3145 |
| 122 | Ga0070709_10328334 | 3300005434 | Bacteria | 1125 |
| 123 | Ga0070714_100005077 | 3300005435 | Bacteria | 10014 |
| 124 | Ga0070714_100115806 | 3300005435 | Bacteria | 2379 |
| 125 | Ga0070714_100512886 | 3300005435 | Bacteria | 1144 |
| 126 | Ga0070713_100000130 | 3300005436 | Bacteria | 49533 |
| 127 | Ga0070713_100140230 | 3300005436 | Bacteria | 2141 |
| 128 | Ga0070711_100056778 | 3300005439 | Bacteria | 2709 |
| 129 | Ga0070711_101417065 | 3300005439 | Bacteria | 605 |
| 130 | Ga0070705_100195599 | 3300005440 | Bacteria | 1382 |
| 131 | Ga0070700_100336905 | 3300005441 | Bacteria | 1114 |
| 132 | Ga0070700_101278560 | 3300005441 | Bacteria | 616 |
| 133 | Ga0070708_100997082 | 3300005445 | Bacteria | 785 |
| 134 | Ga0070708_101302424 | 3300005445 | Bacteria | 679 |
| 135 | Ga0070663_100016715 | 3300005455 | Bacteria | 4774 |
| 136 | Ga0070663_100053096 | 3300005455 | Bacteria | 2892 |
| 137 | Ga0070663_100077225 | 3300005455 | Bacteria | 2437 |
| 138 | Ga0070663_100183221 | 3300005455 | Bacteria | 1626 |
| 139 | Ga0070663_100545131 | 3300005455 | Bacteria | 969 |
| 140 | Ga0070663_101422153 | 3300005455 | Bacteria | 615 |
| 141 | Ga0070678_100001796 | 3300005456 | Bacteria | 11558 |
| 142 | Ga0070678_100009966 | 3300005456 | Bacteria | 5781 |
| 143 | Ga0070678_100021157 | 3300005456 | Bacteria | 4284 |
| 144 | Ga0070678_101611830 | 3300005456 | Bacteria | 609 |
| 145 | Ga0070662_100000211 | 3300005457 | Bacteria | 34047 |
| 146 | Ga0070662_100027596 | 3300005457 | Bacteria | 3943 |
| 147 | Ga0070662_100074089 | 3300005457 | Bacteria | 2517 |
| 148 | Ga0070662_101103762 | 3300005457 | Bacteria | 681 |
| 149 | Ga0070662_101473745 | 3300005457 | Bacteria | 587 |
| 150 | Ga0070681_10002421 | 3300005458 | Bacteria | 17061 |
| 151 | Ga0070681_10153827 | 3300005458 | Bacteria | 2226 |
| 152 | Ga0070681_10171072 | 3300005458 | Bacteria | 2094 |
| 153 | Ga0070681_10188673 | 3300005458 | Bacteria | 1981 |
| 154 | Ga0068867_100002050 | 3300005459 | Bacteria | 14116 |
| 155 | Ga0068867_100002361 | 3300005459 | Bacteria | 13277 |
| 156 | Ga0068867_100009099 | 3300005459 | Bacteria | 7008 |
| 157 | Ga0068867_100075232 | 3300005459 | Bacteria | 2533 |
| 158 | Ga0068867_100278648 | 3300005459 | Bacteria | 1370 |
| 159 | Ga0068867_100309215 | 3300005459 | Bacteria | 1305 |
| 160 | Ga0068867_100417426 | 3300005459 | Bacteria | 1136 |
| 161 | Ga0070685_10011328 | 3300005466 | Bacteria | 4670 |
| 162 | Ga0070707_100705744 | 3300005468 | Bacteria | 972 |
| 163 | Ga0070699_100038292 | 3300005518 | Bacteria | 4151 |
| 164 | Ga0070679_100006694 | 3300005530 | Bacteria | 10750 |
| 165 | Ga0070679_100143875 | 3300005530 | Bacteria | 2363 |
| 166 | Ga0070679_100338254 | 3300005530 | Bacteria | 1453 |
| 167 | Ga0070679_100780669 | 3300005530 | Bacteria | 898 |
| 168 | Ga0070684_100003917 | 3300005535 | Bacteria | 11278 |
| 169 | Ga0070697_100333228 | 3300005536 | Bacteria | 1308 |
| 170 | Ga0068853_100006893 | 3300005539 | Bacteria | 9070 |
| 171 | Ga0068853_100035421 | 3300005539 | Bacteria | 4240 |
| 172 | Ga0068853_100051166 | 3300005539 | Bacteria | 3555 |
| 173 | Ga0068853_100095578 | 3300005539 | Bacteria | 2620 |
| 174 | Ga0068853_100377690 | 3300005539 | Bacteria | 1323 |
| 175 | Ga0068853_101066876 | 3300005539 | Bacteria | 779 |
| 176 | Ga0070672_100003099 | 3300005543 | Bacteria | 10725 |
| 177 | Ga0070672_100008014 | 3300005543 | Bacteria | 7216 |
| 178 | Ga0070672_100062486 | 3300005543 | Bacteria | 2939 |
| 179 | Ga0070672_100066179 | 3300005543 | Bacteria | 2861 |
| 180 | Ga0070672_100067020 | 3300005543 | Bacteria | 2844 |
| 181 | Ga0070672_100416921 | 3300005543 | Bacteria | 1153 |
| 182 | Ga0070672_100511109 | 3300005543 | Bacteria | 1040 |
| 183 | Ga0070672_100803947 | 3300005543 | Bacteria | 827 |
| 184 | Ga0070686_100322126 | 3300005544 | Bacteria | 1153 |
| 185 | Ga0070695_101221839 | 3300005545 | Bacteria | 619 |
| 186 | Ga0070695_101246514 | 3300005545 | Bacteria | 613 |
| 187 | Ga0070696_100017284 | 3300005546 | Bacteria | 4868 |
| 188 | Ga0070693_100108418 | 3300005547 | Bacteria | 1704 |
| 189 | Ga0070693_100248777 | 3300005547 | Bacteria | 1177 |
| 190 | Ga0070665_100004484 | 3300005548 | Bacteria | 14665 |
| 191 | Ga0070665_100006553 | 3300005548 | Bacteria | 11833 |
| 192 | Ga0070665_100009685 | 3300005548 | Bacteria | 9735 |
| 193 | Ga0070665_100028552 | 3300005548 | Bacteria | 5619 |
| 194 | Ga0070665_100077530 | 3300005548 | Bacteria | 3330 |
| 195 | Ga0070665_100201390 | 3300005548 | Bacteria | 1991 |
| 196 | Ga0068855_100010927 | 3300005563 | Bacteria | 10957 |
| 197 | Ga0068855_100052511 | 3300005563 | Bacteria | 4799 |
| 198 | Ga0068855_100092805 | 3300005563 | Bacteria | 3481 |
| 199 | Ga0068855_100148581 | 3300005563 | Bacteria | 2666 |
| 200 | Ga0068855_100274735 | 3300005563 | Bacteria | 1873 |
| 201 | Ga0068855_100418212 | 3300005563 | Bacteria | 1466 |
| 202 | Ga0068855_100431680 | 3300005563 | Bacteria | 1440 |
| 203 | Ga0068855_100505548 | 3300005563 | Bacteria | 1313 |
| 204 | Ga0070664_100017006 | 3300005564 | Bacteria | 5970 |
| 205 | Ga0070664_100033691 | 3300005564 | Bacteria | 4293 |
| 206 | Ga0070664_100034982 | 3300005564 | Bacteria | 4216 |
| 207 | Ga0070664_101297291 | 3300005564 | Bacteria | 688 |
| 208 | Ga0068857_100069369 | 3300005577 | Bacteria | 3139 |
| 209 | Ga0068857_100071664 | 3300005577 | Bacteria | 3087 |
| 210 | Ga0068857_101300655 | 3300005577 | Bacteria | 706 |
| 211 | Ga0068857_101616329 | 3300005577 | Bacteria | 633 |
| 212 | Ga0068854_100048212 | 3300005578 | Bacteria | 3039 |
| 213 | Ga0068854_100253011 | 3300005578 | Bacteria | 1407 |
| 214 | Ga0068854_101062186 | 3300005578 | Bacteria | 720 |
| 215 | Ga0068856_100004235 | 3300005614 | Bacteria | 14328 |
| 216 | Ga0068856_100010690 | 3300005614 | Bacteria | 8917 |
| 217 | Ga0068856_100193547 | 3300005614 | Bacteria | 2047 |
| 218 | Ga0068856_100391308 | 3300005614 | Bacteria | 1410 |
| 219 | Ga0070702_100301479 | 3300005615 | Bacteria | 1109 |
| 220 | Ga0068852_100003693 | 3300005616 | Bacteria | 10727 |
| 221 | Ga0068852_100010012 | 3300005616 | Bacteria | 7055 |
| 222 | Ga0068852_100014944 | 3300005616 | Bacteria | 6000 |
| 223 | Ga0068852_100063346 | 3300005616 | Bacteria | 3219 |
| 224 | Ga0068852_101167920 | 3300005616 | Bacteria | 791 |
| 225 | Ga0068852_101277301 | 3300005616 | Bacteria | 756 |
| 226 | Ga0068859_100000527 | 3300005617 | Bacteria | 37976 |
| 227 | Ga0068859_100006056 | 3300005617 | Bacteria | 12280 |
| 228 | Ga0068859_100015175 | 3300005617 | Bacteria | 7733 |
| 229 | Ga0068859_101363790 | 3300005617 | Bacteria | 782 |
| 230 | Ga0068864_100003597 | 3300005618 | Bacteria | 12816 |
| 231 | Ga0068864_100005302 | 3300005618 | Bacteria | 10552 |
| 232 | Ga0068864_100030005 | 3300005618 | Bacteria | 4609 |
| 233 | Ga0068864_100238796 | 3300005618 | Bacteria | 1683 |
| 234 | Ga0068864_100384001 | 3300005618 | Bacteria | 1332 |
| 235 | Ga0068861_100019824 | 3300005719 | Bacteria | 4807 |
| 236 | Ga0068861_100034998 | 3300005719 | Bacteria | 3717 |
| 237 | Ga0068861_100036344 | 3300005719 | Bacteria | 3654 |
| 238 | Ga0068861_100047556 | 3300005719 | Bacteria | 3239 |
| 239 | Ga0068861_100934040 | 3300005719 | Bacteria | 824 |
| 240 | Ga0068851_10001801 | 3300005834 | Bacteria | 9384 |
| 241 | Ga0068851_10009400 | 3300005834 | Bacteria | 4544 |
| 242 | Ga0068851_10009599 | 3300005834 | Bacteria | 4505 |
| 243 | Ga0068851_10553019 | 3300005834 | Bacteria | 696 |
| 244 | Ga0068870_10038529 | 3300005840 | Bacteria | 2469 |
| 245 | Ga0068870_10095920 | 3300005840 | Bacteria | 1667 |
| 246 | Ga0068870_10198353 | 3300005840 | Bacteria | 1215 |
| 247 | Ga0068863_100003159 | 3300005841 | Bacteria | 16274 |
| 248 | Ga0068863_100013286 | 3300005841 | Bacteria | 7946 |
| 249 | Ga0068863_100059591 | 3300005841 | Bacteria | 3611 |
| 250 | Ga0068863_100190937 | 3300005841 | Bacteria | 1968 |
| 251 | Ga0068863_100747347 | 3300005841 | Bacteria | 974 |
| 252 | Ga0068858_100003264 | 3300005842 | Bacteria | 16167 |
| 253 | Ga0068858_100005279 | 3300005842 | Bacteria | 12662 |
| 254 | Ga0068858_100057003 | 3300005842 | Bacteria | 3610 |
| 255 | Ga0068858_100303808 | 3300005842 | Bacteria | 1523 |
| 256 | Ga0068858_100573120 | 3300005842 | Bacteria | 1094 |
| 257 | Ga0068860_100000976 | 3300005843 | Bacteria | 31714 |
| 258 | Ga0068860_100001042 | 3300005843 | Bacteria | 30514 |
| 259 | Ga0068860_100034620 | 3300005843 | Bacteria | 4846 |
| 260 | Ga0068860_100057406 | 3300005843 | Bacteria | 3700 |
| 261 | Ga0068860_100445682 | 3300005843 | Bacteria | 1287 |
| 262 | Ga0068860_100752028 | 3300005843 | Bacteria | 986 |
| 263 | Ga0068860_101989050 | 3300005843 | Bacteria | 603 |
| 264 | Ga0068860_102089951 | 3300005843 | Bacteria | 588 |
| 265 | Ga0068862_100002697 | 3300005844 | Bacteria | 15601 |
| 266 | Ga0081455_10111676 | 3300005937 | Bacteria | 2171 |
| 267 | Ga0081539_10009998 | 3300005985 | Bacteria | 7813 |
| 268 | Ga0070715_10494719 | 3300006163 | Bacteria | 699 |
| 269 | Ga0070716_100351355 | 3300006173 | Bacteria | 1044 |
| 270 | Ga0070716_101039098 | 3300006173 | Bacteria | 650 |
| 271 | Ga0070712_100398064 | 3300006175 | Bacteria | 1137 |
| 272 | Ga0070712_100936133 | 3300006175 | Bacteria | 748 |
| 273 | Ga0075369_10390072 | 3300006186 | Bacteria | 656 |
| 274 | Ga0097621_100018761 | 3300006237 | Bacteria | 5293 |
| 275 | Ga0097621_100333714 | 3300006237 | Bacteria | 1345 |
| 276 | Ga0097621_100804923 | 3300006237 | Bacteria | 871 |
| 277 | Ga0068871_100001817 | 3300006358 | Bacteria | 14403 |
| 278 | Ga0068871_100007616 | 3300006358 | Bacteria | 7744 |
| 279 | Ga0068871_100152018 | 3300006358 | Bacteria | 1974 |
| 280 | Ga0068871_100249240 | 3300006358 | Bacteria | 1546 |
| 281 | Ga0068871_100363345 | 3300006358 | Bacteria | 1283 |
| 282 | Ga0068871_100627234 | 3300006358 | Bacteria | 979 |
| 283 | Ga0068871_100888331 | 3300006358 | Bacteria | 825 |
| 284 | Ga0075428_100332244 | 3300006844 | Bacteria | 1633 |
| 285 | Ga0075430_100319170 | 3300006846 | Bacteria | 1284 |
| 286 | Ga0075433_10285057 | 3300006852 | Bacteria | 1463 |
| 287 | Ga0075433_11686874 | 3300006852 | Bacteria | 546 |
| 288 | Ga0075434_100017475 | 3300006871 | Bacteria | 6913 |
| 289 | Ga0075434_100553720 | 3300006871 | Bacteria | 1170 |
| 290 | Ga0075434_100750620 | 3300006871 | Bacteria | 993 |
| 291 | Ga0075429_100769971 | 3300006880 | Bacteria | 843 |
| 292 | Ga0068865_100017413 | 3300006881 | Bacteria | 4621 |
| 293 | Ga0068865_100035685 | 3300006881 | Bacteria | 3347 |
| 294 | Ga0068865_100069512 | 3300006881 | Bacteria | 2492 |
| 295 | Ga0068865_100462689 | 3300006881 | Bacteria | 1051 |
| 296 | Ga0068865_100497947 | 3300006881 | Bacteria | 1015 |
| 297 | Ga0068865_100612271 | 3300006881 | Bacteria | 922 |
| 298 | Ga0068865_100847818 | 3300006881 | Bacteria | 791 |
| 299 | Ga0075436_100025545 | 3300006914 | Bacteria | 4066 |
| 300 | Ga0075436_100166189 | 3300006914 | Bacteria | 1557 |
| 301 | Ga0097620_100000527 | 3300006931 | Bacteria | 37976 |
| 302 | Ga0097620_100006056 | 3300006931 | Bacteria | 12280 |
| 303 | Ga0097620_100015174 | 3300006931 | Bacteria | 7733 |
| 304 | Ga0097620_101364163 | 3300006931 | Bacteria | 782 |
| 305 | Ga0075435_100015592 | 3300007076 | Bacteria | 5717 |
| 306 | Ga0075435_100209964 | 3300007076 | Bacteria | 1651 |
| 307 | Ga0075435_100278836 | 3300007076 | Bacteria | 1427 |
| 308 | Ga0075435_100563646 | 3300007076 | Bacteria | 987 |
| 309 | Ga0075435_100644198 | 3300007076 | Bacteria | 920 |
| 310 | Ga0105240_10008953 | 3300009093 | Bacteria | 14232 |
| 311 | Ga0105240_10022687 | 3300009093 | Bacteria | 8317 |
| 312 | Ga0105240_10495028 | 3300009093 | Bacteria | 1360 |
| 313 | Ga0111539_11996554 | 3300009094 | Bacteria | 673 |
| 314 | Ga0105245_10721422 | 3300009098 | Bacteria | 1031 |
| 315 | Ga0105245_12481724 | 3300009098 | Bacteria | 572 |
| 316 | Ga0105247_11080124 | 3300009101 | Bacteria | 632 |
| 317 | Ga0114129_10682258 | 3300009147 | Bacteria | 1322 |
| 318 | Ga0114129_13292340 | 3300009147 | Bacteria | 523 |
| 319 | Ga0105243_10077773 | 3300009148 | Bacteria | 2699 |
| 320 | Ga0105241_10015461 | 3300009174 | Bacteria | 5590 |
| 321 | Ga0105241_10656610 | 3300009174 | Bacteria | 953 |
| 322 | Ga0105248_10002431 | 3300009177 | Bacteria | 20666 |
| 323 | Ga0105248_10007721 | 3300009177 | Bacteria | 11816 |
| 324 | Ga0105248_10019006 | 3300009177 | Bacteria | 7597 |
| 325 | Ga0105248_10033264 | 3300009177 | Bacteria | 5759 |
| 326 | Ga0105248_10111081 | 3300009177 | Bacteria | 3091 |
| 327 | Ga0105248_10277003 | 3300009177 | Bacteria | 1889 |
| 328 | Ga0105248_10525587 | 3300009177 | Bacteria | 1334 |
| 329 | Ga0105237_10368335 | 3300009545 | Bacteria | 1441 |
| 330 | Ga0105237_11501209 | 3300009545 | Bacteria | 680 |
| 331 | Ga0105237_11688791 | 3300009545 | Bacteria | 640 |
| 332 | Ga0105238_10034778 | 3300009551 | Bacteria | 5125 |
| 333 | Ga0105238_10549397 | 3300009551 | Bacteria | 1159 |
| 334 | Ga0105249_10222105 | 3300009553 | Bacteria | 1859 |
| 335 | Ga0105249_11300621 | 3300009553 | Bacteria | 799 |
| 336 | Ga0105239_10057486 | 3300010375 | Bacteria | 4267 |
| 337 | Ga0105246_10085830 | 3300011119 | Bacteria | 2255 |
| 338 | Ga0105246_10240505 | 3300011119 | Bacteria | 1431 |
| 339 | Ga0105246_10372905 | 3300011119 | Bacteria | 1177 |
| 340 | Ga0157325_1023402 | 3300012485 | Bacteria | 569 |
| 341 | Ga0157343_1003807 | 3300012488 | Bacteria | 905 |
| 342 | Ga0157326_1003717 | 3300012513 | Bacteria | 1600 |
| 343 | Ga0157373_10003956 | 3300013100 | Bacteria | 11193 |
| 344 | Ga0157373_10004136 | 3300013100 | Bacteria | 10944 |
| 345 | Ga0157373_10080217 | 3300013100 | Bacteria | 2301 |
| 346 | Ga0157373_10270501 | 3300013100 | Bacteria | 1203 |
| 347 | Ga0157373_11226372 | 3300013100 | Bacteria | 566 |
| 348 | Ga0157371_10000446 | 3300013102 | Bacteria | 50636 |
| 349 | Ga0157371_10179093 | 3300013102 | Bacteria | 1516 |
| 350 | Ga0157371_10515985 | 3300013102 | Bacteria | 884 |
| 351 | Ga0157371_10566585 | 3300013102 | Bacteria | 843 |
| 352 | Ga0157370_10012128 | 3300013104 | Bacteria | 8964 |
| 353 | Ga0157370_10093865 | 3300013104 | Bacteria | 2816 |
| 354 | Ga0157370_10098205 | 3300013104 | Bacteria | 2747 |
| 355 | Ga0157370_10192267 | 3300013104 | Bacteria | 1894 |
| 356 | Ga0157370_10208493 | 3300013104 | Bacteria | 1811 |
| 357 | Ga0157370_10347864 | 3300013104 | Bacteria | 1366 |
| 358 | Ga0157370_11624898 | 3300013104 | Bacteria | 580 |
| 359 | Ga0157369_10012261 | 3300013105 | Bacteria | 9734 |
| 360 | Ga0157369_10408681 | 3300013105 | Bacteria | 1408 |
| 361 | Ga0157369_10589982 | 3300013105 | Bacteria | 1147 |
| 362 | Ga0157369_10666255 | 3300013105 | Bacteria | 1072 |
| 363 | Ga0157369_10726265 | 3300013105 | Bacteria | 1022 |
| 364 | Ga0157374_10009504 | 3300013296 | Bacteria | 8352 |
| 365 | Ga0157374_10084887 | 3300013296 | Bacteria | 3010 |
| 366 | Ga0157374_10246103 | 3300013296 | Bacteria | 1759 |
| 367 | Ga0157374_10539888 | 3300013296 | Bacteria | 1173 |
| 368 | Ga0157378_10014139 | 3300013297 | Bacteria | 6984 |
| 369 | Ga0157378_10046393 | 3300013297 | Bacteria | 3863 |
| 370 | Ga0157378_10372394 | 3300013297 | Bacteria | 1400 |
| 371 | Ga0157378_11575904 | 3300013297 | Bacteria | 702 |
| 372 | Ga0163162_10006529 | 3300013306 | Bacteria | 11298 |
| 373 | Ga0163162_10043422 | 3300013306 | Bacteria | 4501 |
| 374 | Ga0163162_10138414 | 3300013306 | Bacteria | 2546 |
| 375 | Ga0163162_10299866 | 3300013306 | Bacteria | 1739 |
| 376 | Ga0163162_10303148 | 3300013306 | Bacteria | 1730 |
| 377 | Ga0163162_10314425 | 3300013306 | Bacteria | 1699 |
| 378 | Ga0163162_10515419 | 3300013306 | Bacteria | 1326 |
| 379 | Ga0163162_10585285 | 3300013306 | Bacteria | 1243 |
| 380 | Ga0163162_10769356 | 3300013306 | Bacteria | 1081 |
| 381 | Ga0157372_10000523 | 3300013307 | Bacteria | 42408 |
| 382 | Ga0157372_10030913 | 3300013307 | Bacteria | 5860 |
| 383 | Ga0157372_10092901 | 3300013307 | Bacteria | 3433 |
| 384 | Ga0157372_10131156 | 3300013307 | Bacteria | 2884 |
| 385 | Ga0157372_10300882 | 3300013307 | Bacteria | 1866 |
| 386 | Ga0157372_10305617 | 3300013307 | Bacteria | 1851 |
| 387 | Ga0157372_10517195 | 3300013307 | Bacteria | 1391 |
| 388 | Ga0157372_10590193 | 3300013307 | Bacteria | 1295 |
| 389 | Ga0157372_11428204 | 3300013307 | Bacteria | 798 |
| 390 | Ga0157372_11548556 | 3300013307 | Bacteria | 763 |
| 391 | Ga0157375_10002572 | 3300013308 | Bacteria | 15765 |
| 392 | Ga0157375_10055728 | 3300013308 | Bacteria | 3899 |
| 393 | Ga0157375_10123821 | 3300013308 | Bacteria | 2698 |
| 394 | Ga0157375_11177958 | 3300013308 | Bacteria | 898 |
| 395 | Ga0157375_11387302 | 3300013308 | Bacteria | 828 |
| 396 | Ga0157375_11415592 | 3300013308 | Bacteria | 819 |
| 397 | Ga0157375_11438786 | 3300013308 | Bacteria | 812 |
| 398 | Ga0163163_10010153 | 3300014325 | Bacteria | 8449 |
| 399 | Ga0163163_10162204 | 3300014325 | Bacteria | 2281 |
| 400 | Ga0163163_10986437 | 3300014325 | Bacteria | 906 |
| 401 | Ga0163163_13134558 | 3300014325 | Bacteria | 516 |
| 402 | Ga0157380_10580775 | 3300014326 | Bacteria | 1105 |
| 403 | Ga0157380_11847194 | 3300014326 | Bacteria | 664 |
| 404 | Ga0182008_10000107 | 3300014497 | Bacteria | 64378 |
| 405 | Ga0182008_10117288 | 3300014497 | Bacteria | 1321 |
| 406 | Ga0157379_10002763 | 3300014968 | Bacteria | 14802 |
| 407 | Ga0157379_10013355 | 3300014968 | Bacteria | 7192 |
| 408 | Ga0157379_10020291 | 3300014968 | Bacteria | 5875 |
| 409 | Ga0157379_10092851 | 3300014968 | Bacteria | 2707 |
| 410 | Ga0157379_10366482 | 3300014968 | Bacteria | 1321 |
| 411 | Ga0157379_12583399 | 3300014968 | Bacteria | 508 |
| 412 | Ga0157376_10003007 | 3300014969 | Bacteria | 11569 |
| 413 | Ga0157376_10045182 | 3300014969 | Bacteria | 3625 |
| 414 | Ga0157376_10182942 | 3300014969 | Bacteria | 1917 |
| 415 | Ga0157376_11075366 | 3300014969 | Bacteria | 829 |
| 416 | Ga0157376_11084092 | 3300014969 | Bacteria | 826 |
| 417 | Ga0163161_10015702 | 3300017792 | Bacteria | 5281 |
| 418 | Ga0163161_10042182 | 3300017792 | Bacteria | 3281 |
| 419 | Ga0163161_10650561 | 3300017792 | Bacteria | 873 |
| 420 | Ga0206356_10546372 | 3300020070 | Bacteria | 1320 |
| 421 | Ga0207697_10001270 | 3300025315 | Bacteria | 13847 |
| 422 | Ga0207697_10004477 | 3300025315 | Bacteria | 6669 |
| 423 | Ga0207697_10048895 | 3300025315 | Bacteria | 1745 |
| 424 | Ga0207656_10002941 | 3300025321 | Bacteria | 5811 |
| 425 | Ga0207656_10008891 | 3300025321 | Bacteria | 3718 |
| 426 | Ga0207656_10014121 | 3300025321 | Bacteria | 3069 |
| 427 | Ga0207656_10056353 | 3300025321 | Bacteria | 1713 |
| 428 | Ga0207656_10308718 | 3300025321 | Bacteria | 784 |
| 429 | Ga0207682_10001158 | 3300025893 | Bacteria | 12235 |
| 430 | Ga0207682_10004140 | 3300025893 | Bacteria | 6142 |
| 431 | Ga0207682_10265217 | 3300025893 | Bacteria | 801 |
| 432 | Ga0207692_11040042 | 3300025898 | Bacteria | 541 |
| 433 | Ga0207642_10490922 | 3300025899 | Bacteria | 750 |
| 434 | Ga0207688_10139443 | 3300025901 | Bacteria | 1426 |
| 435 | Ga0207688_10232069 | 3300025901 | Bacteria | 1114 |
| 436 | Ga0207688_10272526 | 3300025901 | Bacteria | 1030 |
| 437 | Ga0207688_10485466 | 3300025901 | Bacteria | 773 |
| 438 | Ga0207680_10001915 | 3300025903 | Bacteria | 9760 |
| 439 | Ga0207680_10010912 | 3300025903 | Bacteria | 4567 |
| 440 | Ga0207680_10015863 | 3300025903 | Bacteria | 3942 |
| 441 | Ga0207680_10056147 | 3300025903 | Bacteria | 2377 |
| 442 | Ga0207680_10185588 | 3300025903 | Bacteria | 1409 |
| 443 | Ga0207647_10158855 | 3300025904 | Bacteria | 1319 |
| 444 | Ga0207699_10015910 | 3300025906 | Bacteria | 3922 |
| 445 | Ga0207699_10145403 | 3300025906 | Bacteria | 1562 |
| 446 | Ga0207699_10698316 | 3300025906 | Bacteria | 742 |
| 447 | Ga0207645_10000519 | 3300025907 | Bacteria | 31964 |
| 448 | Ga0207645_10008023 | 3300025907 | Bacteria | 7406 |
| 449 | Ga0207645_10015925 | 3300025907 | Bacteria | 4983 |
| 450 | Ga0207645_10021957 | 3300025907 | Bacteria | 4157 |
| 451 | Ga0207645_10036864 | 3300025907 | Bacteria | 3140 |
| 452 | Ga0207645_10146439 | 3300025907 | Bacteria | 1540 |
| 453 | Ga0207645_10211813 | 3300025907 | Bacteria | 1276 |
| 454 | Ga0207643_10102350 | 3300025908 | Bacteria | 1680 |
| 455 | Ga0207705_10052596 | 3300025909 | Bacteria | 2932 |
| 456 | Ga0207654_10210518 | 3300025911 | Bacteria | 1285 |
| 457 | Ga0207707_10005207 | 3300025912 | Bacteria | 11396 |
| 458 | Ga0207707_10016135 | 3300025912 | Bacteria | 6514 |
| 459 | Ga0207707_10215310 | 3300025912 | Bacteria | 1672 |
| 460 | Ga0207707_10234129 | 3300025912 | Bacteria | 1598 |
| 461 | Ga0207707_10328500 | 3300025912 | Bacteria | 1320 |
| 462 | Ga0207695_10007532 | 3300025913 | Bacteria | 13801 |
| 463 | Ga0207695_10208220 | 3300025913 | Bacteria | 1868 |
| 464 | Ga0207695_10270035 | 3300025913 | Bacteria | 1596 |
| 465 | Ga0207671_11129402 | 3300025914 | Bacteria | 615 |
| 466 | Ga0207693_10160135 | 3300025915 | Bacteria | 1770 |
| 467 | Ga0207693_10486203 | 3300025915 | Bacteria | 964 |
| 468 | Ga0207663_10028111 | 3300025916 | Bacteria | 3287 |
| 469 | Ga0207663_10047577 | 3300025916 | Bacteria | 2649 |
| 470 | Ga0207663_10701999 | 3300025916 | Bacteria | 801 |
| 471 | Ga0207660_10012654 | 3300025917 | Bacteria | 5526 |
| 472 | Ga0207660_10133674 | 3300025917 | Bacteria | 1891 |
| 473 | Ga0207662_10026822 | 3300025918 | Bacteria | 3325 |
| 474 | Ga0207657_10000229 | 3300025919 | Bacteria | 58709 |
| 475 | Ga0207657_10008077 | 3300025919 | Bacteria | 10730 |
| 476 | Ga0207657_10024320 | 3300025919 | Bacteria | 5614 |
| 477 | Ga0207657_10059551 | 3300025919 | Bacteria | 3280 |
| 478 | Ga0207657_10257408 | 3300025919 | Bacteria | 1390 |
| 479 | Ga0207657_10305144 | 3300025919 | Bacteria | 1261 |
| 480 | Ga0207657_10417554 | 3300025919 | Bacteria | 1055 |
| 481 | Ga0207649_10002277 | 3300025920 | Bacteria | 10798 |
| 482 | Ga0207649_10056653 | 3300025920 | Bacteria | 2448 |
| 483 | Ga0207649_10222134 | 3300025920 | Bacteria | 1346 |
| 484 | Ga0207649_10285769 | 3300025920 | Bacteria | 1201 |
| 485 | Ga0207649_10384117 | 3300025920 | Bacteria | 1047 |
| 486 | Ga0207649_11567963 | 3300025920 | Bacteria | 521 |
| 487 | Ga0207652_10003991 | 3300025921 | Bacteria | 12060 |
| 488 | Ga0207652_10007247 | 3300025921 | Bacteria | 8934 |
| 489 | Ga0207652_10124648 | 3300025921 | Bacteria | 2294 |
| 490 | Ga0207652_10131443 | 3300025921 | Bacteria | 2233 |
| 491 | Ga0207652_10399812 | 3300025921 | Bacteria | 1240 |
| 492 | Ga0207681_10002527 | 3300025923 | Bacteria | 11626 |
| 493 | Ga0207681_10356964 | 3300025923 | Bacteria | 1171 |
| 494 | Ga0207681_10460754 | 3300025923 | Bacteria | 1035 |
| 495 | Ga0207681_10492627 | 3300025923 | Bacteria | 1002 |
| 496 | Ga0207681_10698231 | 3300025923 | Bacteria | 843 |
| 497 | Ga0207694_10028324 | 3300025924 | Bacteria | 4270 |
| 498 | Ga0207694_10579037 | 3300025924 | Bacteria | 943 |
| 499 | Ga0207650_10002190 | 3300025925 | Bacteria | 13657 |
| 500 | Ga0207650_10016761 | 3300025925 | Bacteria | 5124 |
| 501 | Ga0207650_10026509 | 3300025925 | Bacteria | 4135 |
| 502 | Ga0207650_10213979 | 3300025925 | Bacteria | 1549 |
| 503 | Ga0207650_10386519 | 3300025925 | Bacteria | 1156 |
| 504 | Ga0207650_10432081 | 3300025925 | Bacteria | 1094 |
| 505 | Ga0207659_10002335 | 3300025926 | Bacteria | 11288 |
| 506 | Ga0207659_10002707 | 3300025926 | Bacteria | 10560 |
| 507 | Ga0207659_10007428 | 3300025926 | Bacteria | 6736 |
| 508 | Ga0207659_10109419 | 3300025926 | Bacteria | 2098 |
| 509 | Ga0207659_10666030 | 3300025926 | Bacteria | 890 |
| 510 | Ga0207659_10802356 | 3300025926 | Bacteria | 809 |
| 511 | Ga0207659_11149511 | 3300025926 | Bacteria | 668 |
| 512 | Ga0207687_10602065 | 3300025927 | Bacteria | 926 |
| 513 | Ga0207700_10000536 | 3300025928 | Bacteria | 22231 |
| 514 | Ga0207700_10222032 | 3300025928 | Bacteria | 1602 |
| 515 | Ga0207664_10006738 | 3300025929 | Bacteria | 7934 |
| 516 | Ga0207664_10071003 | 3300025929 | Bacteria | 2804 |
| 517 | Ga0207644_10000405 | 3300025931 | Bacteria | 28099 |
| 518 | Ga0207644_10054422 | 3300025931 | Bacteria | 2882 |
| 519 | Ga0207644_10116881 | 3300025931 | Bacteria | 2024 |
| 520 | Ga0207644_10266450 | 3300025931 | Bacteria | 1371 |
| 521 | Ga0207644_10858433 | 3300025931 | Bacteria | 760 |
| 522 | Ga0207644_10908943 | 3300025931 | Bacteria | 738 |
| 523 | Ga0207644_10952388 | 3300025931 | Bacteria | 720 |
| 524 | Ga0207644_11557781 | 3300025931 | Bacteria | 554 |
| 525 | Ga0207690_10000348 | 3300025932 | Bacteria | 30788 |
| 526 | Ga0207690_10006051 | 3300025932 | Bacteria | 7165 |
| 527 | Ga0207690_10035029 | 3300025932 | Bacteria | 3238 |
| 528 | Ga0207690_10220567 | 3300025932 | Bacteria | 1451 |
| 529 | Ga0207690_10346607 | 3300025932 | Bacteria | 1173 |
| 530 | Ga0207690_10821926 | 3300025932 | Bacteria | 768 |
| 531 | Ga0207706_10000045 | 3300025933 | Bacteria | 120758 |
| 532 | Ga0207706_10023713 | 3300025933 | Bacteria | 5507 |
| 533 | Ga0207706_10064814 | 3300025933 | Bacteria | 3217 |
| 534 | Ga0207706_10223524 | 3300025933 | Bacteria | 1648 |
| 535 | Ga0207709_10000130 | 3300025935 | Bacteria | 110843 |
| 536 | Ga0207709_10227944 | 3300025935 | Bacteria | 1348 |
| 537 | Ga0207709_10507096 | 3300025935 | Bacteria | 942 |
| 538 | Ga0207670_10250880 | 3300025936 | Bacteria | 1368 |
| 539 | Ga0207669_10010494 | 3300025937 | Bacteria | 4463 |
| 540 | Ga0207669_10010707 | 3300025937 | Bacteria | 4427 |
| 541 | Ga0207669_10791340 | 3300025937 | Bacteria | 786 |
| 542 | Ga0207704_10226291 | 3300025938 | Bacteria | 1388 |
| 543 | Ga0207665_10009812 | 3300025939 | Bacteria | 6286 |
| 544 | Ga0207665_10739723 | 3300025939 | Bacteria | 775 |
| 545 | Ga0207691_10000310 | 3300025940 | Bacteria | 48478 |
| 546 | Ga0207691_10000629 | 3300025940 | Bacteria | 34886 |
| 547 | Ga0207691_10036678 | 3300025940 | Bacteria | 4543 |
| 548 | Ga0207691_10050344 | 3300025940 | Bacteria | 3814 |
| 549 | Ga0207691_10075011 | 3300025940 | Bacteria | 3050 |
| 550 | Ga0207691_10085085 | 3300025940 | Bacteria | 2838 |
| 551 | Ga0207691_10147467 | 3300025940 | Bacteria | 2070 |
| 552 | Ga0207691_10358075 | 3300025940 | Bacteria | 1248 |
| 553 | Ga0207711_10011574 | 3300025941 | Bacteria | 7334 |
| 554 | Ga0207711_10162511 | 3300025941 | Bacteria | 2022 |
| 555 | Ga0207711_10174265 | 3300025941 | Bacteria | 1953 |
| 556 | Ga0207711_10181192 | 3300025941 | Bacteria | 1916 |
| 557 | Ga0207711_10279790 | 3300025941 | Bacteria | 1536 |
| 558 | Ga0207711_10322829 | 3300025941 | Bacteria | 1427 |
| 559 | Ga0207689_10004985 | 3300025942 | Bacteria | 11959 |
| 560 | Ga0207689_10005921 | 3300025942 | Bacteria | 10828 |
| 561 | Ga0207689_10013147 | 3300025942 | Bacteria | 7063 |
| 562 | Ga0207689_10067966 | 3300025942 | Bacteria | 2928 |
| 563 | Ga0207661_10074070 | 3300025944 | Bacteria | 2790 |
| 564 | Ga0207661_10172727 | 3300025944 | Bacteria | 1882 |
| 565 | Ga0207661_10502796 | 3300025944 | Bacteria | 1107 |
| 566 | Ga0207661_11639973 | 3300025944 | Bacteria | 588 |
| 567 | Ga0207679_10003526 | 3300025945 | Bacteria | 9684 |
| 568 | Ga0207679_10011829 | 3300025945 | Bacteria | 5671 |
| 569 | Ga0207679_10024632 | 3300025945 | Bacteria | 4128 |
| 570 | Ga0207679_10049245 | 3300025945 | Bacteria | 3073 |
| 571 | Ga0207679_10051924 | 3300025945 | Bacteria | 3004 |
| 572 | Ga0207679_10154259 | 3300025945 | Bacteria | 1873 |
| 573 | Ga0207679_10781540 | 3300025945 | Bacteria | 870 |
| 574 | Ga0207679_10859607 | 3300025945 | Bacteria | 829 |
| 575 | Ga0207667_10002826 | 3300025949 | Bacteria | 21544 |
| 576 | Ga0207667_10003469 | 3300025949 | Bacteria | 19459 |
| 577 | Ga0207667_10033290 | 3300025949 | Bacteria | 5543 |
| 578 | Ga0207667_10046141 | 3300025949 | Bacteria | 4614 |
| 579 | Ga0207667_10105193 | 3300025949 | Bacteria | 2912 |
| 580 | Ga0207667_10113256 | 3300025949 | Bacteria | 2797 |
| 581 | Ga0207667_10172367 | 3300025949 | Bacteria | 2224 |
| 582 | Ga0207667_10435293 | 3300025949 | Bacteria | 1334 |
| 583 | Ga0207667_11254987 | 3300025949 | Bacteria | 719 |
| 584 | Ga0207667_11710818 | 3300025949 | Bacteria | 595 |
| 585 | Ga0207651_10001764 | 3300025960 | Bacteria | 10031 |
| 586 | Ga0207651_10005532 | 3300025960 | Bacteria | 6501 |
| 587 | Ga0207651_10017237 | 3300025960 | Bacteria | 4261 |
| 588 | Ga0207651_10053586 | 3300025960 | Bacteria | 2758 |
| 589 | Ga0207651_10091138 | 3300025960 | Bacteria | 2231 |
| 590 | Ga0207651_10150139 | 3300025960 | Bacteria | 1812 |
| 591 | Ga0207651_10176290 | 3300025960 | Bacteria | 1691 |
| 592 | Ga0207712_10151247 | 3300025961 | Bacteria | 1793 |
| 593 | Ga0207712_10201372 | 3300025961 | Bacteria | 1579 |
| 594 | Ga0207668_10003264 | 3300025972 | Bacteria | 9507 |
| 595 | Ga0207668_10005981 | 3300025972 | Bacteria | 7173 |
| 596 | Ga0207668_10013879 | 3300025972 | Bacteria | 4974 |
| 597 | Ga0207668_10077542 | 3300025972 | Bacteria | 2396 |
| 598 | Ga0207668_10186950 | 3300025972 | Bacteria | 1638 |
| 599 | Ga0207668_10221403 | 3300025972 | Bacteria | 1520 |
| 600 | Ga0207668_10258794 | 3300025972 | Bacteria | 1417 |
| 601 | Ga0207668_10327768 | 3300025972 | Bacteria | 1273 |
| 602 | Ga0207668_10683607 | 3300025972 | Bacteria | 901 |
| 603 | Ga0207640_10019747 | 3300025981 | Bacteria | 3987 |
| 604 | Ga0207640_10056577 | 3300025981 | Bacteria | 2576 |
| 605 | Ga0207640_10063512 | 3300025981 | Bacteria | 2454 |
| 606 | Ga0207640_10266043 | 3300025981 | Bacteria | 1339 |
| 607 | Ga0207640_10458887 | 3300025981 | Bacteria | 1052 |
| 608 | Ga0207640_10890569 | 3300025981 | Bacteria | 777 |
| 609 | Ga0207658_10008951 | 3300025986 | Bacteria | 6790 |
| 610 | Ga0207658_10024238 | 3300025986 | Bacteria | 4243 |
| 611 | Ga0207658_10035070 | 3300025986 | Bacteria | 3591 |
| 612 | Ga0207658_10052049 | 3300025986 | Bacteria | 3020 |
| 613 | Ga0207658_10104528 | 3300025986 | Bacteria | 2226 |
| 614 | Ga0207658_10323597 | 3300025986 | Bacteria | 1335 |
| 615 | Ga0207658_10336284 | 3300025986 | Bacteria | 1311 |
| 616 | Ga0207677_10005183 | 3300026023 | Bacteria | 7053 |
| 617 | Ga0207677_10011855 | 3300026023 | Bacteria | 4988 |
| 618 | Ga0207677_10017625 | 3300026023 | Bacteria | 4264 |
| 619 | Ga0207677_10622437 | 3300026023 | Bacteria | 949 |
| 620 | Ga0207677_10784901 | 3300026023 | Bacteria | 852 |
| 621 | Ga0207703_10002568 | 3300026035 | Bacteria | 15692 |
| 622 | Ga0207703_10005921 | 3300026035 | Bacteria | 9800 |
| 623 | Ga0207703_10007291 | 3300026035 | Bacteria | 8791 |
| 624 | Ga0207703_10515556 | 3300026035 | Bacteria | 1124 |
| 625 | Ga0207639_10008842 | 3300026041 | Bacteria | 6925 |
| 626 | Ga0207639_10018465 | 3300026041 | Bacteria | 4956 |
| 627 | Ga0207639_10030631 | 3300026041 | Bacteria | 3947 |
| 628 | Ga0207639_10066846 | 3300026041 | Bacteria | 2796 |
| 629 | Ga0207639_10316610 | 3300026041 | Bacteria | 1384 |
| 630 | Ga0207639_10655600 | 3300026041 | Bacteria | 971 |
| 631 | Ga0207639_10991470 | 3300026041 | Bacteria | 787 |
| 632 | Ga0207639_12189938 | 3300026041 | Bacteria | 514 |
| 633 | Ga0207678_10001996 | 3300026067 | Bacteria | 18581 |
| 634 | Ga0207678_10010760 | 3300026067 | Bacteria | 8038 |
| 635 | Ga0207678_10028712 | 3300026067 | Bacteria | 4856 |
| 636 | Ga0207678_10032115 | 3300026067 | Bacteria | 4577 |
| 637 | Ga0207678_10104144 | 3300026067 | Bacteria | 2421 |
| 638 | Ga0207678_10934802 | 3300026067 | Bacteria | 767 |
| 639 | Ga0207708_10304201 | 3300026075 | Bacteria | 1298 |
| 640 | Ga0207708_10575052 | 3300026075 | Bacteria | 952 |
| 641 | Ga0207702_10000715 | 3300026078 | Bacteria | 35679 |
| 642 | Ga0207702_10027561 | 3300026078 | Bacteria | 4718 |
| 643 | Ga0207702_10056652 | 3300026078 | Bacteria | 3328 |
| 644 | Ga0207702_10192135 | 3300026078 | Bacteria | 1887 |
| 645 | Ga0207702_10423446 | 3300026078 | Bacteria | 1288 |
| 646 | Ga0207702_10815600 | 3300026078 | Bacteria | 923 |
| 647 | Ga0207702_11361539 | 3300026078 | Bacteria | 704 |
| 648 | Ga0207641_10001932 | 3300026088 | Bacteria | 19887 |
| 649 | Ga0207641_10036346 | 3300026088 | Bacteria | 4111 |
| 650 | Ga0207641_10056891 | 3300026088 | Bacteria | 3325 |
| 651 | Ga0207641_10084073 | 3300026088 | Bacteria | 2770 |
| 652 | Ga0207641_10101932 | 3300026088 | Bacteria | 2530 |
| 653 | Ga0207641_10512363 | 3300026088 | Bacteria | 1166 |
| 654 | Ga0207641_10731971 | 3300026088 | Bacteria | 975 |
| 655 | Ga0207648_10000364 | 3300026089 | Bacteria | 49697 |
| 656 | Ga0207648_10002230 | 3300026089 | Bacteria | 20980 |
| 657 | Ga0207648_10003344 | 3300026089 | Bacteria | 16855 |
| 658 | Ga0207648_10083123 | 3300026089 | Bacteria | 2792 |
| 659 | Ga0207648_10484980 | 3300026089 | Bacteria | 1129 |
| 660 | Ga0207676_10003751 | 3300026095 | Bacteria | 10735 |
| 661 | Ga0207676_10007800 | 3300026095 | Bacteria | 7613 |
| 662 | Ga0207676_10014659 | 3300026095 | Bacteria | 5645 |
| 663 | Ga0207676_10093737 | 3300026095 | Bacteria | 2472 |
| 664 | Ga0207674_10000225 | 3300026116 | Bacteria | 70648 |
| 665 | Ga0207674_10015172 | 3300026116 | Bacteria | 8478 |
| 666 | Ga0207674_10030050 | 3300026116 | Bacteria | 5716 |
| 667 | Ga0207674_10400935 | 3300026116 | Bacteria | 1326 |
| 668 | Ga0207675_100018204 | 3300026118 | Bacteria | 6549 |
| 669 | Ga0207675_100025976 | 3300026118 | Bacteria | 5450 |
| 670 | Ga0207675_100040300 | 3300026118 | Bacteria | 4361 |
| 671 | Ga0207675_100863415 | 3300026118 | Bacteria | 920 |
| 672 | Ga0207675_101071826 | 3300026118 | Bacteria | 825 |
| 673 | Ga0207675_101135948 | 3300026118 | Bacteria | 801 |
| 674 | Ga0207683_10000076 | 3300026121 | Bacteria | 77762 |
| 675 | Ga0207683_10000121 | 3300026121 | Bacteria | 64376 |
| 676 | Ga0207683_10005699 | 3300026121 | Bacteria | 10686 |
| 677 | Ga0207683_10016965 | 3300026121 | Bacteria | 6198 |
| 678 | Ga0207698_10004376 | 3300026142 | Bacteria | 8601 |
| 679 | Ga0207698_10007522 | 3300026142 | Bacteria | 6827 |
| 680 | Ga0207698_10015072 | 3300026142 | Bacteria | 5165 |
| 681 | Ga0207698_10105034 | 3300026142 | Bacteria | 2352 |
| 682 | Ga0207698_10587420 | 3300026142 | Bacteria | 1096 |
| 683 | Ga0210002_1019853 | 3300027617 | Bacteria | 1080 |
| 684 | Ga0209974_10072542 | 3300027876 | Bacteria | 1176 |
| 685 | Ga0268266_10028455 | 3300028379 | Bacteria | 4750 |
| 686 | Ga0268266_10040095 | 3300028379 | Bacteria | 3990 |
| 687 | Ga0268266_10072189 | 3300028379 | Bacteria | 2992 |
| 688 | Ga0268266_10516993 | 3300028379 | Bacteria | 1141 |
| 689 | Ga0268265_10181670 | 3300028380 | Bacteria | 1808 |
| 690 | Ga0268265_10692258 | 3300028380 | Bacteria | 984 |
| 691 | Ga0268265_11012437 | 3300028380 | Bacteria | 821 |
| 692 | Ga0268264_10000967 | 3300028381 | Bacteria | 29459 |
| 693 | Ga0268264_10007545 | 3300028381 | Bacteria | 9076 |
| 694 | Ga0268264_10065017 | 3300028381 | Bacteria | 3071 |
| 695 | Ga0268264_10256884 | 3300028381 | Bacteria | 1626 |
| 696 | Ga0268264_10621648 | 3300028381 | Bacteria | 1067 |
| 697 | Ga0268264_10678333 | 3300028381 | Bacteria | 1022 |
| 698 | Ga0307509_10282087 | 3300031507 | Bacteria | 1422 |
| 699 | Ga0307509_10430403 | 3300031507 | Bacteria | 1018 |
| 700 | Ga0307408_100064934 | 3300031548 | Bacteria | 2675 |
| 701 | Ga0307516_10000138 | 3300031730 | Bacteria | 87604 |
| 702 | Ga0307405_10058582 | 3300031731 | Bacteria | 2424 |
| 703 | Ga0307405_11366801 | 3300031731 | Bacteria | 618 |
| 704 | Ga0307410_10039366 | 3300031852 | Bacteria | 3103 |
| 705 | Ga0307406_10127050 | 3300031901 | Bacteria | 1783 |
| 706 | Ga0307406_10966201 | 3300031901 | Bacteria | 729 |
| 707 | Ga0307412_10045789 | 3300031911 | Bacteria | 2862 |
| 708 | Ga0307409_100006788 | 3300031995 | Bacteria | 6771 |
| 709 | Ga0307416_100245809 | 3300032002 | Bacteria | 1737 |
| 710 | Ga0307416_100343170 | 3300032002 | Bacteria | 1507 |
| 711 | Ga0307414_10205034 | 3300032004 | Bacteria | 1607 |
| 712 | Ga0307411_10019396 | 3300032005 | Bacteria | 3928 |
| 713 | Ga0307415_100007976 | 3300032126 | Bacteria | 5836 |
| 714 | Ga0373948_0049468 | 3300034817 | Bacteria | 900 |
| 715 | Ga0373958_0077024 | 3300034819 | Bacteria | 749 |
| 716 | Ga0373926_0181431 | 3300035083 | Bacteria | 807 |
| 717 | Ga0373945_0224210 | 3300035116 | Bacteria | 787 |
| 718 | Ga0373954_0174717 | 3300035118 | Bacteria | 1053 |
| 719 | Ga0373957_0195685 | 3300035120 | Bacteria | 841 |
| 720 | Ga0373943_0169166 | 3300035170 | Bacteria | 1195 |
| 721 | Ga0373946_0080264 | 3300035171 | Bacteria | 1427 |
| 722 | Ga0373961_0116190 | 3300035241 | Bacteria | 882 |
| 723 | Ga0373931_0148638 | 3300035691 | Bacteria | 1364 |
| 724 | Ga0373931_0596967 | 3300035691 | Bacteria | 721 |
| 725 | Ga0373935_0058920 | 3300035692 | Bacteria | 2453 |
| 726 | Ga0373935_0889885 | 3300035692 | Bacteria | 659 |
| 727 | Ga0373927_0001525 | 3300035695 | Bacteria | 17425 |
| 728 | Ga0373927_0256857 | 3300035695 | Bacteria | 1149 |
| 729 | Ga0373933_0599995 | 3300035724 | Bacteria | 723 |
| 730 | Ga0373947_0401072 | 3300035725 | Bacteria | 925 |
| 731 | Ga0373947_1167743 | 3300035725 | Bacteria | 524 |
| 732 | Ga0373937_0165958 | 3300036401 | Bacteria | 2071 |
| 733 | Ga0373937_0692006 | 3300036401 | Bacteria | 966 |
| 734 | Ga0373937_1879298 | 3300036401 | Bacteria | 545 |
| 735 | Ga0373925_0022631 | 3300037068 | Bacteria | 4586 |
| 736 | Ga0373925_0023008 | 3300037068 | Bacteria | 4548 |
| 737 | Ga0373925_0034090 | 3300037068 | Bacteria | 3752 |
| 738 | Ga0373925_0049574 | 3300037068 | Bacteria | 3130 |
| 739 | Ga0373925_0236453 | 3300037068 | Bacteria | 1462 |
| 740 | Ga0395899_0275335 | 3300037312 | Bacteria | 1147 |
| 741 | Ga0395900_0035910 | 3300037418 | Bacteria | 5107 |
| 742 | Ga0395900_0542778 | 3300037418 | Bacteria | 1108 |
| 743 | Ga0395898_0058539 | 3300037466 | Bacteria | 3751 |
| 744 | Ga0395898_1433034 | 3300037466 | Bacteria | 618 |
| 745 | Ga0395905_0020317 | 3300037471 | Bacteria | 6291 |
| 746 | Ga0395905_0958466 | 3300037471 | Bacteria | 758 |
| 747 | Ga0395901_0254916 | 3300038443 | Bacteria | 1827 |
| 748 | Ga0395901_0401510 | 3300038443 | Bacteria | 1408 |
| 749 | Ga0242420_065050 | 3300038996 | Bacteria | 733 |
| 750 | Ga0451798_1003561 | 3300041458 | Bacteria | 598 |
| 751 | Ga0451802_0595318 | 3300041460 | Bacteria | 878 |
| 752 | Ga0451835_0250944 | 3300041492 | Bacteria | 605 |
| 753 | Ga0451849_0660544 | 3300041505 | Bacteria | 654 |
| 754 | Ga0451849_0959626 | 3300041505 | Bacteria | 736 |
| 755 | Ga0451853_1750809 | 3300041512 | Bacteria | 810 |
| 756 | Ga0451853_3081903 | 3300041512 | Bacteria | 725 |
| 757 | Ga0439458_0059704 | 3300042157 | Bacteria | 951 |
| 758 | Ga0466963_0767749 | 3300044694 | Bacteria | 680 |
| 759 | Ga0453684_0238511 | 3300044712 | Bacteria | 2095 |
| 760 | Ga0453684_1072153 | 3300044712 | Bacteria | 853 |
| 761 | Ga0466968_0010602 | 3300044735 | Bacteria | 3577 |
| 762 | Ga0466957_0757849 | 3300044842 | Bacteria | 688 |
| 763 | Ga0451576_1087686 | 3300045051 | Bacteria | 837 |
| 764 | Ga0466958_0241512 | 3300045836 | Bacteria | 1154 |
| 765 | Ga0466967_2261541 | 3300045976 | Bacteria | 539 |
| 766 | Ga0495629_0302645 | 3300046459 | Bacteria | 1095 |
| 767 | Ga0495580_0092998 | 3300046472 | Bacteria | 2099 |
| 768 | Ga0495580_0540959 | 3300046472 | Bacteria | 774 |
| 769 | Ga0495588_0192217 | 3300046674 | Bacteria | 1078 |
| 770 | Ga0495647_0441462 | 3300046681 | Bacteria | 601 |
| 771 | Ga0495658_0384686 | 3300046683 | Bacteria | 894 |
| 772 | Ga0496100_0159488 | 3300048903 | Bacteria | 1616 |
| 773 | Ga0496100_0551114 | 3300048903 | Bacteria | 892 |
| 774 | Ga0496101_0082914 | 3300048904 | Bacteria | 2373 |
| 775 | Ga0496101_0269512 | 3300048904 | Bacteria | 1329 |
| 776 | Ga0496101_0379714 | 3300048904 | Bacteria | 1112 |
| 777 | Ga0496101_0455942 | 3300048904 | Bacteria | 1009 |
| 778 | Ga0496102_0062700 | 3300048905 | Bacteria | 3404 |
| 779 | Ga0496102_0078545 | 3300048905 | Bacteria | 3038 |
| 780 | Ga0496102_0179141 | 3300048905 | Bacteria | 1996 |
| 781 | Ga0496103_0035997 | 3300048906 | Bacteria | 3031 |
| 782 | Ga0496103_0043380 | 3300048906 | Bacteria | 2769 |
| 783 | Ga0496104_0006095 | 3300048907 | Bacteria | 10582 |
| 784 | Ga0496104_0797096 | 3300048907 | Bacteria | 851 |
| 785 | Ga0496105_0573641 | 3300048908 | Bacteria | 878 |
| 786 | Ga0496106_0000931 | 3300048909 | Bacteria | 21318 |
| 787 | Ga0496106_0098618 | 3300048909 | Bacteria | 2264 |
| 788 | Ga0496106_0460274 | 3300048909 | Bacteria | 1022 |
| 789 | Ga0496107_0139594 | 3300048910 | Bacteria | 1791 |
| 790 | Ga0496107_0312216 | 3300048910 | Bacteria | 1170 |
| 791 | Ga0496107_0570980 | 3300048910 | Bacteria | 837 |
| 792 | Ga0496108_0009652 | 3300048911 | Bacteria | 7823 |
| 793 | Ga0496108_0093485 | 3300048911 | Bacteria | 2558 |
| 794 | Ga0496108_0312849 | 3300048911 | Bacteria | 1368 |
| 795 | Ga0496108_0686565 | 3300048911 | Bacteria | 888 |
| 796 | Ga0496109_0028312 | 3300048912 | Bacteria | 5010 |
| 797 | Ga0496109_0229782 | 3300048912 | Bacteria | 1745 |
| 798 | Ga0496110_0005169 | 3300048913 | Bacteria | 10205 |
| 799 | Ga0496110_0330460 | 3300048913 | Bacteria | 1389 |
| 800 | Ga0496111_0092906 | 3300048914 | Bacteria | 2212 |
| 801 | Ga0496111_0133240 | 3300048914 | Bacteria | 1840 |
| 802 | Ga0496113_0136992 | 3300048916 | Bacteria | 1924 |
| 803 | Ga0496121_0822578 | 3300048924 | Bacteria | 543 |
| 804 | Ga0496124_0002098 | 3300048927 | Bacteria | 26914 |
| 805 | Ga0496125_0019440 | 3300048928 | Bacteria | 6405 |
| 806 | Ga0501034_0164865 | 3300049571 | Bacteria | 2185 |
| 807 | Ga0501042_0820392 | 3300049578 | Bacteria | 677 |
| 808 | Ga0501047_0098402 | 3300049581 | Bacteria | 2804 |
| 809 | Ga0501067_0045931 | 3300049583 | Bacteria | 2424 |
| 810 | Ga0501067_0339975 | 3300049583 | Bacteria | 836 |
| 811 | Ga0501069_0179365 | 3300049585 | Bacteria | 1224 |
| 812 | Ga0501070_0021038 | 3300049586 | Bacteria | 5473 |
| 813 | Ga0501072_0009398 | 3300049588 | Bacteria | 7435 |
| 814 | Ga0501073_0079480 | 3300049589 | Bacteria | 2282 |
| 815 | Ga0501074_0006516 | 3300049590 | Bacteria | 8429 |
| 816 | Ga0501080_0003414 | 3300049742 | Bacteria | 14003 |
| 817 | Ga0501083_0026063 | 3300049744 | Bacteria | 4044 |
| 818 | Ga0501035_0303704 | 3300049822 | Bacteria | 1344 |
| 819 | Ga0501044_0168927 | 3300049823 | Bacteria | 2160 |
| 820 | nmdc:mga03683_268756_c1 | 3300050489 | Bacteria | 795 |
| 821 | nmdc:mga05p37_246019_c1 | 3300050507 | Bacteria | 2147 |
| 822 | nmdc:mga08y16_1377663_c1 | 3300050511 | Bacteria | 669 |
| 823 | nmdc:mga08y16_1669785_c1 | 3300050511 | Bacteria | 593 |
| 824 | nmdc:mga0n895_2239954_c1 | 3300050512 | Bacteria | 501 |
| 825 | nmdc:mga0n895_352208_c1 | 3300050512 | Bacteria | 1491 |
| 826 | nmdc:mga0n895_362172_c1 | 3300050512 | Bacteria | 1468 |
| 827 | nmdc:mga0n895_8616_c1 | 3300050512 | Bacteria | 8847 |
| 828 | nmdc:mga0rr50_283924_c1 | 3300050513 | Bacteria | 1382 |
| 829 | nmdc:mga0rr50_630279_c1 | 3300050513 | Bacteria | 914 |
| 830 | nmdc:mga0rr50_65083_c1 | 3300050513 | Bacteria | 2760 |
| 831 | nmdc:mga08x19_24644_c1 | 3300050514 | Bacteria | 3742 |
| 832 | nmdc:mga08x19_367453_c1 | 3300050514 | Bacteria | 1006 |
| 833 | nmdc:mga08x19_81935_c1 | 3300050514 | Bacteria | 2119 |
| 834 | nmdc:mga0a205_1260788_c1 | 3300050515 | Bacteria | 587 |
| 835 | nmdc:mga0a205_13153_c1 | 3300050515 | Bacteria | 7687 |
| 836 | nmdc:mga0a205_419155_c1 | 3300050515 | Bacteria | 1201 |
| 837 | Ga0495601_0361601 | 3300053077 | Bacteria | 943 |
| 838 | Ga0495612_0576059 | 3300053078 | Bacteria | 519 |
| 839 | Ga0500561_0012267 | 3300053137 | Bacteria | 1824 |
| 840 | Ga0500627_0146474 | 3300053158 | Bacteria | 1067 |
| 841 | Ga0501084_0247834 | 3300054114 | Bacteria | 1504 |
| 842 | Ga0590071_011345 | 3300059421 | Bacteria | 2085 |
| 843 | Ga0590075_059976 | 3300059424 | Bacteria | 980 |
| 844 | Ga0587067_026936 | 3300059640 | Bacteria | 1033 |
| 845 | Ga0587071_052560 | 3300060344 | Bacteria | 846 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035120 | Ga0373957_0195685 | Ga0373957_0195685_10_366 | 103 |
| 2 | 3300035170 | Ga0373943_0169166 | Ga0373943_0169166_11_367 | 103 |
| 3 | 3300037068 | Ga0373925_0022631 | Ga0373925_0022631_11_367 | 103 |
| 4 | 3300053078 | Ga0495612_0576059 | Ga0495612_0576059_13_369 | 103 |
| 5 | 3300041505 | Ga0451849_0959626 | Ga0451849_0959626_11_394 | 112 |
| 6 | 3300013100 | Ga0157373_11226372 | Ga0157373_112263721 | 113 |
| 7 | 3300013105 | Ga0157369_10589982 | Ga0157369_105899823 | 118 |
| 8 | 3300035116 | Ga0373945_0224210 | Ga0373945_0224210_58_483 | 119 |
| 9 | 3300035171 | Ga0373946_0080264 | Ga0373946_0080264_155_580 | 119 |
| 10 | 3300035692 | Ga0373935_0058920 | Ga0373935_0058920_52_477 | 119 |
| 11 | 3300036401 | Ga0373937_0165958 | Ga0373937_0165958_1353_1778 | 119 |
| 12 | 3300037068 | Ga0373925_0049574 | Ga0373925_0049574_134_559 | 119 |
| 13 | 3300041505 | Ga0451849_0660544 | Ga0451849_0660544_118_546 | 120 |
| 14 | 3300005336 | Ga0070680_101012233 | Ga0070680_1010122331 | 121 |
| 15 | 3300005435 | Ga0070714_100512886 | Ga0070714_1005128862 | 121 |
| 16 | 3300005543 | Ga0070672_100416921 | Ga0070672_1004169212 | 121 |
| 17 | 3300005563 | Ga0068855_100092805 | Ga0068855_1000928052 | 121 |
| 18 | 3300005563 | Ga0068855_100148581 | Ga0068855_1001485812 | 121 |
| 19 | 3300005614 | Ga0068856_100193547 | Ga0068856_1001935472 | 121 |
| 20 | 3300006173 | Ga0070716_101039098 | Ga0070716_1010390982 | 121 |
| 21 | 3300006914 | Ga0075436_100166189 | Ga0075436_1001661892 | 121 |
| 22 | 3300007076 | Ga0075435_100563646 | Ga0075435_1005636462 | 121 |
| 23 | 3300009093 | Ga0105240_10495028 | Ga0105240_104950283 | 121 |
| 24 | 3300013105 | Ga0157369_10666255 | Ga0157369_106662552 | 121 |
| 25 | 3300013307 | Ga0157372_11428204 | Ga0157372_114282042 | 121 |
| 26 | 3300013308 | Ga0157375_11438786 | Ga0157375_114387862 | 121 |
| 27 | 3300025906 | Ga0207699_10145403 | Ga0207699_101454032 | 121 |
| 28 | 3300025913 | Ga0207695_10270035 | Ga0207695_102700352 | 121 |
| 29 | 3300025929 | Ga0207664_10071003 | Ga0207664_100710034 | 121 |
| 30 | 3300025939 | Ga0207665_10739723 | Ga0207665_107397232 | 121 |
| 31 | 3300025940 | Ga0207691_10358075 | Ga0207691_103580752 | 121 |
| 32 | 3300025949 | Ga0207667_10033290 | Ga0207667_100332905 | 121 |
| 33 | 3300025981 | Ga0207640_10458887 | Ga0207640_104588872 | 121 |
| 34 | 3300026078 | Ga0207702_10192135 | Ga0207702_101921353 | 121 |
| 35 | 3300028381 | Ga0268264_10621648 | Ga0268264_106216482 | 121 |
| 36 | 3300035241 | Ga0373961_0116190 | Ga0373961_0116190_196_639 | 121 |
| 37 | 3300049822 | Ga0501035_0303704 | Ga0501035_0303704_441_854 | 121 |
| 38 | 3300050512 | nmdc:mga0n895_2239954_c1 | nmdc:mga0n895_2239954_c1_21_449 | 121 |
| 39 | 3300050514 | nmdc:mga08x19_81935_c1 | nmdc:mga08x19_81935_c1_339_767 | 121 |
| 40 | 3300049578 | Ga0501042_0820392 | Ga0501042_0820392_101_532 | 122 |
| 41 | 3300005445 | Ga0070708_101302424 | Ga0070708_1013024242 | 123 |
| 42 | 3300005459 | Ga0068867_100417426 | Ga0068867_1004174262 | 123 |
| 43 | 3300006358 | Ga0068871_100152018 | Ga0068871_1001520183 | 123 |
| 44 | 3300041512 | Ga0451853_1750809 | Ga0451853_1750809_114_542 | 123 |
| 45 | 3300005339 | Ga0070660_100048969 | Ga0070660_1000489694 | 124 |
| 46 | 3300005366 | Ga0070659_100815926 | Ga0070659_1008159261 | 124 |
| 47 | 3300012488 | Ga0157343_1003807 | Ga0157343_10038072 | 124 |
| 48 | 3300013105 | Ga0157369_10408681 | Ga0157369_104086812 | 124 |
| 49 | 3300013307 | Ga0157372_10300882 | Ga0157372_103008822 | 124 |
| 50 | 3300025919 | Ga0207657_10059551 | Ga0207657_100595514 | 124 |
| 51 | 3300025920 | Ga0207649_10285769 | Ga0207649_102857692 | 124 |
| 52 | 3300025932 | Ga0207690_10821926 | Ga0207690_108219261 | 124 |
| 53 | 3300031507 | Ga0307509_10430403 | Ga0307509_104304032 | 124 |
| 54 | 3300036401 | Ga0373937_1879298 | Ga0373937_1879298_39_473 | 124 |
| 55 | 3300048910 | Ga0496107_0570980 | Ga0496107_0570980_164_595 | 124 |
| 56 | 3300053137 | Ga0500561_0012267 | Ga0500561_0012267_1242_1664 | 124 |
| 57 | 3300005328 | Ga0070676_10051342 | Ga0070676_100513423 | 125 |
| 58 | 3300005331 | Ga0070670_100006317 | Ga0070670_1000063178 | 125 |
| 59 | 3300005331 | Ga0070670_100471761 | Ga0070670_1004717612 | 125 |
| 60 | 3300005334 | Ga0068869_100047854 | Ga0068869_1000478542 | 125 |
| 61 | 3300005338 | Ga0068868_101164502 | Ga0068868_1011645022 | 125 |
| 62 | 3300005344 | Ga0070661_101827089 | Ga0070661_1018270891 | 125 |
| 63 | 3300005354 | Ga0070675_100021055 | Ga0070675_1000210556 | 125 |
| 64 | 3300005355 | Ga0070671_100336695 | Ga0070671_1003366952 | 125 |
| 65 | 3300005364 | Ga0070673_101692088 | Ga0070673_1016920881 | 125 |
| 66 | 3300005445 | Ga0070708_100997082 | Ga0070708_1009970822 | 125 |
| 67 | 3300005457 | Ga0070662_101473745 | Ga0070662_1014737451 | 125 |
| 68 | 3300005459 | Ga0068867_100075232 | Ga0068867_1000752322 | 125 |
| 69 | 3300005536 | Ga0070697_100333228 | Ga0070697_1003332281 | 125 |
| 70 | 3300005543 | Ga0070672_100067020 | Ga0070672_1000670202 | 125 |
| 71 | 3300005563 | Ga0068855_100052511 | Ga0068855_1000525114 | 125 |
| 72 | 3300005577 | Ga0068857_101616329 | Ga0068857_1016163292 | 125 |
| 73 | 3300006852 | Ga0075433_11686874 | Ga0075433_116868741 | 125 |
| 74 | 3300006871 | Ga0075434_100017475 | Ga0075434_1000174753 | 125 |
| 75 | 3300006914 | Ga0075436_100025545 | Ga0075436_1000255455 | 125 |
| 76 | 3300007076 | Ga0075435_100015592 | Ga0075435_1000155925 | 125 |
| 77 | 3300009147 | Ga0114129_10682258 | Ga0114129_106822582 | 125 |
| 78 | 3300009148 | Ga0105243_10077773 | Ga0105243_100777735 | 125 |
| 79 | 3300009551 | Ga0105238_10549397 | Ga0105238_105493972 | 125 |
| 80 | 3300011119 | Ga0105246_10372905 | Ga0105246_103729053 | 125 |
| 81 | 3300014968 | Ga0157379_12583399 | Ga0157379_125833991 | 125 |
| 82 | 3300025907 | Ga0207645_10146439 | Ga0207645_101464392 | 125 |
| 83 | 3300025919 | Ga0207657_10257408 | Ga0207657_102574082 | 125 |
| 84 | 3300025925 | Ga0207650_10016761 | Ga0207650_100167612 | 125 |
| 85 | 3300025925 | Ga0207650_10432081 | Ga0207650_104320812 | 125 |
| 86 | 3300025926 | Ga0207659_10109419 | Ga0207659_101094193 | 125 |
| 87 | 3300025931 | Ga0207644_10952388 | Ga0207644_109523882 | 125 |
| 88 | 3300025935 | Ga0207709_10227944 | Ga0207709_102279443 | 125 |
| 89 | 3300025939 | Ga0207665_10009812 | Ga0207665_100098127 | 125 |
| 90 | 3300025940 | Ga0207691_10036678 | Ga0207691_100366783 | 125 |
| 91 | 3300025942 | Ga0207689_10067966 | Ga0207689_100679664 | 125 |
| 92 | 3300025949 | Ga0207667_10046141 | Ga0207667_100461414 | 125 |
| 93 | 3300025960 | Ga0207651_10091138 | Ga0207651_100911382 | 125 |
| 94 | 3300026023 | Ga0207677_10622437 | Ga0207677_106224372 | 125 |
| 95 | 3300026089 | Ga0207648_10484980 | Ga0207648_104849802 | 125 |
| 96 | 3300026116 | Ga0207674_10400935 | Ga0207674_104009352 | 125 |
| 97 | 3300026142 | Ga0207698_10105034 | Ga0207698_101050341 | 125 |
| 98 | 3300041458 | Ga0451798_1003561 | Ga0451798_1003561_51_482 | 125 |
| 99 | 3300041460 | Ga0451802_0595318 | Ga0451802_0595318_423_854 | 125 |
| 100 | 3300046472 | Ga0495580_0540959 | Ga0495580_0540959_328_756 | 125 |
| 101 | 3300048927 | Ga0496124_0002098 | Ga0496124_0002098_1904_2329 | 125 |
| 102 | 3300048928 | Ga0496125_0019440 | Ga0496125_0019440_3364_3789 | 125 |
| 103 | 3300050507 | nmdc:mga05p37_246019_c1 | nmdc:mga05p37_246019_c1_361_789 | 125 |
| 104 | 3300050511 | nmdc:mga08y16_1377663_c1 | nmdc:mga08y16_1377663_c1_109_543 | 125 |
| 105 | 3300050512 | nmdc:mga0n895_8616_c1 | nmdc:mga0n895_8616_c1_2790_3218 | 125 |
| 106 | 3300050513 | nmdc:mga0rr50_65083_c1 | nmdc:mga0rr50_65083_c1_802_1230 | 125 |
| 107 | 3300050514 | nmdc:mga08x19_24644_c1 | nmdc:mga08x19_24644_c1_1498_1926 | 125 |
| 108 | 3300050515 | nmdc:mga0a205_1260788_c1 | nmdc:mga0a205_1260788_c1_76_510 | 125 |
| 109 | 3300050515 | nmdc:mga0a205_13153_c1 | nmdc:mga0a205_13153_c1_4211_4639 | 125 |
| 110 | 3300053158 | Ga0500627_0146474 | Ga0500627_0146474_597_1022 | 125 |
| 111 | 3300059424 | Ga0590075_059976 | Ga0590075_059976_539_964 | 125 |
| 112 | 3300002239 | JGI24034J26672_10073748 | JGI24034J26672_100737481 | 126 |
| 113 | 3300003322 | rootL2_10104466 | rootL2_101044663 | 126 |
| 114 | 3300005288 | Ga0065714_10344125 | Ga0065714_103441251 | 126 |
| 115 | 3300005328 | Ga0070676_10001268 | Ga0070676_100012686 | 126 |
| 116 | 3300005328 | Ga0070676_10022429 | Ga0070676_100224295 | 126 |
| 117 | 3300005331 | Ga0070670_100444170 | Ga0070670_1004441702 | 126 |
| 118 | 3300005331 | Ga0070670_100522873 | Ga0070670_1005228732 | 126 |
| 119 | 3300005333 | Ga0070677_10014052 | Ga0070677_100140523 | 126 |
| 120 | 3300005334 | Ga0068869_100008402 | Ga0068869_1000084025 | 126 |
| 121 | 3300005335 | Ga0070666_10001424 | Ga0070666_100014248 | 126 |
| 122 | 3300005335 | Ga0070666_10013532 | Ga0070666_100135323 | 126 |
| 123 | 3300005336 | Ga0070680_100302817 | Ga0070680_1003028172 | 126 |
| 124 | 3300005338 | Ga0068868_100002750 | Ga0068868_10000275012 | 126 |
| 125 | 3300005338 | Ga0068868_100006774 | Ga0068868_1000067742 | 126 |
| 126 | 3300005344 | Ga0070661_100092316 | Ga0070661_1000923165 | 126 |
| 127 | 3300005347 | Ga0070668_100001406 | Ga0070668_1000014069 | 126 |
| 128 | 3300005347 | Ga0070668_100003165 | Ga0070668_10000316510 | 126 |
| 129 | 3300005353 | Ga0070669_100002287 | Ga0070669_1000022878 | 126 |
| 130 | 3300005353 | Ga0070669_100377471 | Ga0070669_1003774712 | 126 |
| 131 | 3300005354 | Ga0070675_100002082 | Ga0070675_10000208214 | 126 |
| 132 | 3300005354 | Ga0070675_100022596 | Ga0070675_1000225965 | 126 |
| 133 | 3300005355 | Ga0070671_100005547 | Ga0070671_1000055478 | 126 |
| 134 | 3300005355 | Ga0070671_100013130 | Ga0070671_1000131304 | 126 |
| 135 | 3300005356 | Ga0070674_100000659 | Ga0070674_10000065915 | 126 |
| 136 | 3300005356 | Ga0070674_100013733 | Ga0070674_1000137336 | 126 |
| 137 | 3300005364 | Ga0070673_100001356 | Ga0070673_10000135614 | 126 |
| 138 | 3300005364 | Ga0070673_100007946 | Ga0070673_1000079462 | 126 |
| 139 | 3300005365 | Ga0070688_101105635 | Ga0070688_1011056351 | 126 |
| 140 | 3300005367 | Ga0070667_100003532 | Ga0070667_1000035328 | 126 |
| 141 | 3300005367 | Ga0070667_100080136 | Ga0070667_1000801364 | 126 |
| 142 | 3300005367 | Ga0070667_100387313 | Ga0070667_1003873131 | 126 |
| 143 | 3300005436 | Ga0070713_100000130 | Ga0070713_1000001305 | 126 |
| 144 | 3300005439 | Ga0070711_101417065 | Ga0070711_1014170651 | 126 |
| 145 | 3300005455 | Ga0070663_100183221 | Ga0070663_1001832212 | 126 |
| 146 | 3300005456 | Ga0070678_100001796 | Ga0070678_1000017967 | 126 |
| 147 | 3300005456 | Ga0070678_100009966 | Ga0070678_1000099663 | 126 |
| 148 | 3300005458 | Ga0070681_10002421 | Ga0070681_100024216 | 126 |
| 149 | 3300005458 | Ga0070681_10171072 | Ga0070681_101710724 | 126 |
| 150 | 3300005459 | Ga0068867_100002050 | Ga0068867_1000020509 | 126 |
| 151 | 3300005459 | Ga0068867_100002361 | Ga0068867_1000023618 | 126 |
| 152 | 3300005530 | Ga0070679_100006694 | Ga0070679_1000066948 | 126 |
| 153 | 3300005530 | Ga0070679_100338254 | Ga0070679_1003382542 | 126 |
| 154 | 3300005539 | Ga0068853_100035421 | Ga0068853_1000354216 | 126 |
| 155 | 3300005539 | Ga0068853_100095578 | Ga0068853_1000955782 | 126 |
| 156 | 3300005543 | Ga0070672_100003099 | Ga0070672_1000030996 | 126 |
| 157 | 3300005543 | Ga0070672_100008014 | Ga0070672_1000080147 | 126 |
| 158 | 3300005548 | Ga0070665_100006553 | Ga0070665_1000065537 | 126 |
| 159 | 3300005548 | Ga0070665_100028552 | Ga0070665_1000285526 | 126 |
| 160 | 3300005563 | Ga0068855_100274735 | Ga0068855_1002747352 | 126 |
| 161 | 3300005577 | Ga0068857_101300655 | Ga0068857_1013006552 | 126 |
| 162 | 3300005578 | Ga0068854_101062186 | Ga0068854_1010621862 | 126 |
| 163 | 3300005614 | Ga0068856_100391308 | Ga0068856_1003913082 | 126 |
| 164 | 3300005616 | Ga0068852_100063346 | Ga0068852_1000633462 | 126 |
| 165 | 3300005616 | Ga0068852_101277301 | Ga0068852_1012773012 | 126 |
| 166 | 3300005617 | Ga0068859_100006056 | Ga0068859_1000060567 | 126 |
| 167 | 3300005618 | Ga0068864_100003597 | Ga0068864_1000035979 | 126 |
| 168 | 3300005618 | Ga0068864_100030005 | Ga0068864_1000300056 | 126 |
| 169 | 3300005719 | Ga0068861_100047556 | Ga0068861_1000475564 | 126 |
| 170 | 3300005834 | Ga0068851_10009599 | Ga0068851_100095992 | 126 |
| 171 | 3300005840 | Ga0068870_10038529 | Ga0068870_100385292 | 126 |
| 172 | 3300005841 | Ga0068863_100013286 | Ga0068863_1000132866 | 126 |
| 173 | 3300005841 | Ga0068863_100059591 | Ga0068863_1000595913 | 126 |
| 174 | 3300005842 | Ga0068858_100003264 | Ga0068858_1000032648 | 126 |
| 175 | 3300005842 | Ga0068858_100303808 | Ga0068858_1003038082 | 126 |
| 176 | 3300005843 | Ga0068860_100001042 | Ga0068860_10000104225 | 126 |
| 177 | 3300005843 | Ga0068860_100034620 | Ga0068860_1000346205 | 126 |
| 178 | 3300005985 | Ga0081539_10009998 | Ga0081539_100099986 | 126 |
| 179 | 3300006186 | Ga0075369_10390072 | Ga0075369_103900721 | 126 |
| 180 | 3300006237 | Ga0097621_100018761 | Ga0097621_1000187616 | 126 |
| 181 | 3300006237 | Ga0097621_100333714 | Ga0097621_1003337143 | 126 |
| 182 | 3300006358 | Ga0068871_100001817 | Ga0068871_1000018179 | 126 |
| 183 | 3300006358 | Ga0068871_100007616 | Ga0068871_1000076164 | 126 |
| 184 | 3300006881 | Ga0068865_100017413 | Ga0068865_1000174134 | 126 |
| 185 | 3300006881 | Ga0068865_100069512 | Ga0068865_1000695122 | 126 |
| 186 | 3300006931 | Ga0097620_100006056 | Ga0097620_1000060567 | 126 |
| 187 | 3300009147 | Ga0114129_13292340 | Ga0114129_132923401 | 126 |
| 188 | 3300009174 | Ga0105241_10656610 | Ga0105241_106566102 | 126 |
| 189 | 3300009177 | Ga0105248_10002431 | Ga0105248_100024318 | 126 |
| 190 | 3300009177 | Ga0105248_10111081 | Ga0105248_101110814 | 126 |
| 191 | 3300009553 | Ga0105249_10222105 | Ga0105249_102221052 | 126 |
| 192 | 3300011119 | Ga0105246_10240505 | Ga0105246_102405053 | 126 |
| 193 | 3300013100 | Ga0157373_10004136 | Ga0157373_100041369 | 126 |
| 194 | 3300013104 | Ga0157370_10098205 | Ga0157370_100982052 | 126 |
| 195 | 3300013104 | Ga0157370_10208493 | Ga0157370_102084932 | 126 |
| 196 | 3300013104 | Ga0157370_10347864 | Ga0157370_103478642 | 126 |
| 197 | 3300013296 | Ga0157374_10009504 | Ga0157374_100095048 | 126 |
| 198 | 3300013297 | Ga0157378_11575904 | Ga0157378_115759042 | 126 |
| 199 | 3300013306 | Ga0163162_10006529 | Ga0163162_100065298 | 126 |
| 200 | 3300013306 | Ga0163162_10043422 | Ga0163162_100434222 | 126 |
| 201 | 3300013306 | Ga0163162_10769356 | Ga0163162_107693562 | 126 |
| 202 | 3300013307 | Ga0157372_10030913 | Ga0157372_100309136 | 126 |
| 203 | 3300013308 | Ga0157375_10002572 | Ga0157375_100025728 | 126 |
| 204 | 3300014497 | Ga0182008_10000107 | Ga0182008_1000010742 | 126 |
| 205 | 3300014968 | Ga0157379_10020291 | Ga0157379_100202917 | 126 |
| 206 | 3300014969 | Ga0157376_10003007 | Ga0157376_100030078 | 126 |
| 207 | 3300014969 | Ga0157376_10045182 | Ga0157376_100451826 | 126 |
| 208 | 3300017792 | Ga0163161_10015702 | Ga0163161_100157027 | 126 |
| 209 | 3300017792 | Ga0163161_10042182 | Ga0163161_100421826 | 126 |
| 210 | 3300025315 | Ga0207697_10004477 | Ga0207697_100044772 | 126 |
| 211 | 3300025315 | Ga0207697_10048895 | Ga0207697_100488952 | 126 |
| 212 | 3300025321 | Ga0207656_10056353 | Ga0207656_100563533 | 126 |
| 213 | 3300025893 | Ga0207682_10001158 | Ga0207682_100011583 | 126 |
| 214 | 3300025899 | Ga0207642_10490922 | Ga0207642_104909222 | 126 |
| 215 | 3300025903 | Ga0207680_10001915 | Ga0207680_100019155 | 126 |
| 216 | 3300025903 | Ga0207680_10010912 | Ga0207680_100109127 | 126 |
| 217 | 3300025907 | Ga0207645_10000519 | Ga0207645_1000051921 | 126 |
| 218 | 3300025907 | Ga0207645_10008023 | Ga0207645_100080236 | 126 |
| 219 | 3300025912 | Ga0207707_10016135 | Ga0207707_100161356 | 126 |
| 220 | 3300025912 | Ga0207707_10215310 | Ga0207707_102153102 | 126 |
| 221 | 3300025916 | Ga0207663_10701999 | Ga0207663_107019992 | 126 |
| 222 | 3300025917 | Ga0207660_10133674 | Ga0207660_101336743 | 126 |
| 223 | 3300025919 | Ga0207657_10417554 | Ga0207657_104175542 | 126 |
| 224 | 3300025920 | Ga0207649_10384117 | Ga0207649_103841172 | 126 |
| 225 | 3300025921 | Ga0207652_10007247 | Ga0207652_100072477 | 126 |
| 226 | 3300025921 | Ga0207652_10124648 | Ga0207652_101246483 | 126 |
| 227 | 3300025921 | Ga0207652_10399812 | Ga0207652_103998123 | 126 |
| 228 | 3300025923 | Ga0207681_10002527 | Ga0207681_100025276 | 126 |
| 229 | 3300025923 | Ga0207681_10698231 | Ga0207681_106982312 | 126 |
| 230 | 3300025924 | Ga0207694_10579037 | Ga0207694_105790371 | 126 |
| 231 | 3300025925 | Ga0207650_10213979 | Ga0207650_102139792 | 126 |
| 232 | 3300025925 | Ga0207650_10386519 | Ga0207650_103865192 | 126 |
| 233 | 3300025926 | Ga0207659_10002707 | Ga0207659_100027078 | 126 |
| 234 | 3300025926 | Ga0207659_10007428 | Ga0207659_100074285 | 126 |
| 235 | 3300025928 | Ga0207700_10000536 | Ga0207700_100005366 | 126 |
| 236 | 3300025935 | Ga0207709_10000130 | Ga0207709_1000013030 | 126 |
| 237 | 3300025937 | Ga0207669_10010494 | Ga0207669_100104943 | 126 |
| 238 | 3300025937 | Ga0207669_10010707 | Ga0207669_100107076 | 126 |
| 239 | 3300025940 | Ga0207691_10000310 | Ga0207691_100003106 | 126 |
| 240 | 3300025940 | Ga0207691_10000629 | Ga0207691_1000062928 | 126 |
| 241 | 3300025941 | Ga0207711_10162511 | Ga0207711_101625112 | 126 |
| 242 | 3300025941 | Ga0207711_10322829 | Ga0207711_103228292 | 126 |
| 243 | 3300025942 | Ga0207689_10005921 | Ga0207689_100059218 | 126 |
| 244 | 3300025944 | Ga0207661_11639973 | Ga0207661_116399732 | 126 |
| 245 | 3300025949 | Ga0207667_10113256 | Ga0207667_101132562 | 126 |
| 246 | 3300025960 | Ga0207651_10001764 | Ga0207651_100017644 | 126 |
| 247 | 3300025960 | Ga0207651_10053586 | Ga0207651_100535864 | 126 |
| 248 | 3300025961 | Ga0207712_10151247 | Ga0207712_101512473 | 126 |
| 249 | 3300025972 | Ga0207668_10003264 | Ga0207668_100032646 | 126 |
| 250 | 3300025972 | Ga0207668_10005981 | Ga0207668_100059812 | 126 |
| 251 | 3300025981 | Ga0207640_10266043 | Ga0207640_102660431 | 126 |
| 252 | 3300025986 | Ga0207658_10008951 | Ga0207658_100089512 | 126 |
| 253 | 3300025986 | Ga0207658_10052049 | Ga0207658_100520495 | 126 |
| 254 | 3300025986 | Ga0207658_10323597 | Ga0207658_103235972 | 126 |
| 255 | 3300026023 | Ga0207677_10005183 | Ga0207677_100051836 | 126 |
| 256 | 3300026023 | Ga0207677_10011855 | Ga0207677_100118553 | 126 |
| 257 | 3300026035 | Ga0207703_10007291 | Ga0207703_100072916 | 126 |
| 258 | 3300026035 | Ga0207703_10515556 | Ga0207703_105155562 | 126 |
| 259 | 3300026041 | Ga0207639_10030631 | Ga0207639_100306312 | 126 |
| 260 | 3300026041 | Ga0207639_10066846 | Ga0207639_100668465 | 126 |
| 261 | 3300026067 | Ga0207678_10010760 | Ga0207678_100107603 | 126 |
| 262 | 3300026078 | Ga0207702_10423446 | Ga0207702_104234462 | 126 |
| 263 | 3300026078 | Ga0207702_11361539 | Ga0207702_113615391 | 126 |
| 264 | 3300026088 | Ga0207641_10001932 | Ga0207641_100019328 | 126 |
| 265 | 3300026089 | Ga0207648_10000364 | Ga0207648_100003648 | 126 |
| 266 | 3300026089 | Ga0207648_10003344 | Ga0207648_100033446 | 126 |
| 267 | 3300026095 | Ga0207676_10003751 | Ga0207676_100037517 | 126 |
| 268 | 3300026095 | Ga0207676_10014659 | Ga0207676_100146594 | 126 |
| 269 | 3300026116 | Ga0207674_10030050 | Ga0207674_100300507 | 126 |
| 270 | 3300026118 | Ga0207675_100040300 | Ga0207675_1000403004 | 126 |
| 271 | 3300026118 | Ga0207675_101135948 | Ga0207675_1011359482 | 126 |
| 272 | 3300026121 | Ga0207683_10000076 | Ga0207683_1000007676 | 126 |
| 273 | 3300026121 | Ga0207683_10000121 | Ga0207683_1000012154 | 126 |
| 274 | 3300026142 | Ga0207698_10015072 | Ga0207698_100150724 | 126 |
| 275 | 3300028379 | Ga0268266_10028455 | Ga0268266_100284556 | 126 |
| 276 | 3300028379 | Ga0268266_10072189 | Ga0268266_100721892 | 126 |
| 277 | 3300028381 | Ga0268264_10007545 | Ga0268264_100075456 | 126 |
| 278 | 3300031507 | Ga0307509_10282087 | Ga0307509_102820873 | 126 |
| 279 | 3300031730 | Ga0307516_10000138 | Ga0307516_1000013841 | 126 |
| 280 | 3300031731 | Ga0307405_11366801 | Ga0307405_113668012 | 126 |
| 281 | 3300032002 | Ga0307416_100343170 | Ga0307416_1003431702 | 126 |
| 282 | 3300035691 | Ga0373931_0596967 | Ga0373931_0596967_84_515 | 126 |
| 283 | 3300037068 | Ga0373925_0034090 | Ga0373925_0034090_2651_3079 | 126 |
| 284 | 3300037466 | Ga0395898_1433034 | Ga0395898_1433034_22_450 | 126 |
| 285 | 3300037471 | Ga0395905_0020317 | Ga0395905_0020317_5192_5620 | 126 |
| 286 | 3300044694 | Ga0466963_0767749 | Ga0466963_0767749_235_663 | 126 |
| 287 | 3300044735 | Ga0466968_0010602 | Ga0466968_0010602_1308_1736 | 126 |
| 288 | 3300046674 | Ga0495588_0192217 | Ga0495588_0192217_54_482 | 126 |
| 289 | 3300048904 | Ga0496101_0379714 | Ga0496101_0379714_85_516 | 126 |
| 290 | 3300048908 | Ga0496105_0573641 | Ga0496105_0573641_276_707 | 126 |
| 291 | 3300048910 | Ga0496107_0312216 | Ga0496107_0312216_581_1012 | 126 |
| 292 | 3300048911 | Ga0496108_0093485 | Ga0496108_0093485_1665_2096 | 126 |
| 293 | 3300048924 | Ga0496121_0822578 | Ga0496121_0822578_76_504 | 126 |
| 294 | 3300050489 | nmdc:mga03683_268756_c1 | nmdc:mga03683_268756_c1_344_772 | 126 |
| 295 | 3300053077 | Ga0495601_0361601 | Ga0495601_0361601_78_506 | 126 |
| 296 | 3300059421 | Ga0590071_011345 | Ga0590071_011345_1297_1725 | 126 |
| 297 | 3300005333 | Ga0070677_10082214 | Ga0070677_100822141 | 127 |
| 298 | 3300005335 | Ga0070666_10232927 | Ga0070666_102329273 | 127 |
| 299 | 3300005344 | Ga0070661_100035823 | Ga0070661_1000358233 | 127 |
| 300 | 3300005347 | Ga0070668_100047261 | Ga0070668_1000472613 | 127 |
| 301 | 3300005347 | Ga0070668_100383260 | Ga0070668_1003832602 | 127 |
| 302 | 3300005355 | Ga0070671_100695773 | Ga0070671_1006957732 | 127 |
| 303 | 3300005356 | Ga0070674_100099090 | Ga0070674_1000990901 | 127 |
| 304 | 3300005364 | Ga0070673_100738552 | Ga0070673_1007385522 | 127 |
| 305 | 3300005366 | Ga0070659_100275134 | Ga0070659_1002751341 | 127 |
| 306 | 3300005366 | Ga0070659_100482661 | Ga0070659_1004826611 | 127 |
| 307 | 3300005367 | Ga0070667_100059940 | Ga0070667_1000599404 | 127 |
| 308 | 3300005434 | Ga0070709_10032539 | Ga0070709_100325392 | 127 |
| 309 | 3300005434 | Ga0070709_10328334 | Ga0070709_103283341 | 127 |
| 310 | 3300005435 | Ga0070714_100115806 | Ga0070714_1001158063 | 127 |
| 311 | 3300005436 | Ga0070713_100140230 | Ga0070713_1001402302 | 127 |
| 312 | 3300005439 | Ga0070711_100056778 | Ga0070711_1000567783 | 127 |
| 313 | 3300005456 | Ga0070678_100021157 | Ga0070678_1000211574 | 127 |
| 314 | 3300005457 | Ga0070662_101103762 | Ga0070662_1011037621 | 127 |
| 315 | 3300005458 | Ga0070681_10153827 | Ga0070681_101538273 | 127 |
| 316 | 3300005518 | Ga0070699_100038292 | Ga0070699_1000382923 | 127 |
| 317 | 3300005530 | Ga0070679_100143875 | Ga0070679_1001438753 | 127 |
| 318 | 3300005530 | Ga0070679_100780669 | Ga0070679_1007806692 | 127 |
| 319 | 3300005543 | Ga0070672_100066179 | Ga0070672_1000661792 | 127 |
| 320 | 3300005546 | Ga0070696_100017284 | Ga0070696_1000172845 | 127 |
| 321 | 3300005548 | Ga0070665_100004484 | Ga0070665_10000448417 | 127 |
| 322 | 3300005564 | Ga0070664_100033691 | Ga0070664_1000336915 | 127 |
| 323 | 3300005618 | Ga0068864_100384001 | Ga0068864_1003840012 | 127 |
| 324 | 3300005719 | Ga0068861_100036344 | Ga0068861_1000363442 | 127 |
| 325 | 3300005841 | Ga0068863_100747347 | Ga0068863_1007473472 | 127 |
| 326 | 3300005842 | Ga0068858_100057003 | Ga0068858_1000570033 | 127 |
| 327 | 3300005843 | Ga0068860_100445682 | Ga0068860_1004456822 | 127 |
| 328 | 3300005843 | Ga0068860_102089951 | Ga0068860_1020899511 | 127 |
| 329 | 3300005937 | Ga0081455_10111676 | Ga0081455_101116763 | 127 |
| 330 | 3300006175 | Ga0070712_100936133 | Ga0070712_1009361331 | 127 |
| 331 | 3300006358 | Ga0068871_100363345 | Ga0068871_1003633453 | 127 |
| 332 | 3300006358 | Ga0068871_100627234 | Ga0068871_1006272342 | 127 |
| 333 | 3300006844 | Ga0075428_100332244 | Ga0075428_1003322442 | 127 |
| 334 | 3300006846 | Ga0075430_100319170 | Ga0075430_1003191701 | 127 |
| 335 | 3300006880 | Ga0075429_100769971 | Ga0075429_1007699712 | 127 |
| 336 | 3300007076 | Ga0075435_100209964 | Ga0075435_1002099641 | 127 |
| 337 | 3300007076 | Ga0075435_100278836 | Ga0075435_1002788362 | 127 |
| 338 | 3300009093 | Ga0105240_10008953 | Ga0105240_100089539 | 127 |
| 339 | 3300009545 | Ga0105237_11501209 | Ga0105237_115012091 | 127 |
| 340 | 3300009545 | Ga0105237_11688791 | Ga0105237_116887912 | 127 |
| 341 | 3300013100 | Ga0157373_10080217 | Ga0157373_100802172 | 127 |
| 342 | 3300013104 | Ga0157370_10192267 | Ga0157370_101922672 | 127 |
| 343 | 3300013296 | Ga0157374_10539888 | Ga0157374_105398883 | 127 |
| 344 | 3300013297 | Ga0157378_10372394 | Ga0157378_103723942 | 127 |
| 345 | 3300013306 | Ga0163162_10314425 | Ga0163162_103144253 | 127 |
| 346 | 3300013307 | Ga0157372_10517195 | Ga0157372_105171952 | 127 |
| 347 | 3300013308 | Ga0157375_11177958 | Ga0157375_111779582 | 127 |
| 348 | 3300013308 | Ga0157375_11387302 | Ga0157375_113873022 | 127 |
| 349 | 3300013308 | Ga0157375_11415592 | Ga0157375_114155922 | 127 |
| 350 | 3300014325 | Ga0163163_13134558 | Ga0163163_131345581 | 127 |
| 351 | 3300014968 | Ga0157379_10013355 | Ga0157379_100133553 | 127 |
| 352 | 3300017792 | Ga0163161_10650561 | Ga0163161_106505612 | 127 |
| 353 | 3300025893 | Ga0207682_10265217 | Ga0207682_102652171 | 127 |
| 354 | 3300025901 | Ga0207688_10232069 | Ga0207688_102320692 | 127 |
| 355 | 3300025903 | Ga0207680_10185588 | Ga0207680_101855883 | 127 |
| 356 | 3300025906 | Ga0207699_10015910 | Ga0207699_100159102 | 127 |
| 357 | 3300025906 | Ga0207699_10698316 | Ga0207699_106983162 | 127 |
| 358 | 3300025907 | Ga0207645_10211813 | Ga0207645_102118132 | 127 |
| 359 | 3300025912 | Ga0207707_10234129 | Ga0207707_102341292 | 127 |
| 360 | 3300025913 | Ga0207695_10208220 | Ga0207695_102082203 | 127 |
| 361 | 3300025914 | Ga0207671_11129402 | Ga0207671_111294022 | 127 |
| 362 | 3300025915 | Ga0207693_10486203 | Ga0207693_104862032 | 127 |
| 363 | 3300025916 | Ga0207663_10028111 | Ga0207663_100281113 | 127 |
| 364 | 3300025920 | Ga0207649_10222134 | Ga0207649_102221342 | 127 |
| 365 | 3300025921 | Ga0207652_10131443 | Ga0207652_101314432 | 127 |
| 366 | 3300025923 | Ga0207681_10356964 | Ga0207681_103569642 | 127 |
| 367 | 3300025926 | Ga0207659_10802356 | Ga0207659_108023562 | 127 |
| 368 | 3300025928 | Ga0207700_10222032 | Ga0207700_102220322 | 127 |
| 369 | 3300025931 | Ga0207644_10858433 | Ga0207644_108584331 | 127 |
| 370 | 3300025931 | Ga0207644_10908943 | Ga0207644_109089431 | 127 |
| 371 | 3300025933 | Ga0207706_10023713 | Ga0207706_100237132 | 127 |
| 372 | 3300025940 | Ga0207691_10075011 | Ga0207691_100750113 | 127 |
| 373 | 3300025940 | Ga0207691_10147467 | Ga0207691_101474674 | 127 |
| 374 | 3300025941 | Ga0207711_10181192 | Ga0207711_101811922 | 127 |
| 375 | 3300025945 | Ga0207679_10024632 | Ga0207679_100246323 | 127 |
| 376 | 3300025945 | Ga0207679_10154259 | Ga0207679_101542592 | 127 |
| 377 | 3300025949 | Ga0207667_11254987 | Ga0207667_112549871 | 127 |
| 378 | 3300025972 | Ga0207668_10013879 | Ga0207668_100138796 | 127 |
| 379 | 3300025972 | Ga0207668_10186950 | Ga0207668_101869502 | 127 |
| 380 | 3300025981 | Ga0207640_10890569 | Ga0207640_108905692 | 127 |
| 381 | 3300025986 | Ga0207658_10035070 | Ga0207658_100350702 | 127 |
| 382 | 3300025986 | Ga0207658_10104528 | Ga0207658_101045282 | 127 |
| 383 | 3300026035 | Ga0207703_10005921 | Ga0207703_100059212 | 127 |
| 384 | 3300026041 | Ga0207639_10655600 | Ga0207639_106556001 | 127 |
| 385 | 3300026067 | Ga0207678_10028712 | Ga0207678_100287126 | 127 |
| 386 | 3300026078 | Ga0207702_10027561 | Ga0207702_100275612 | 127 |
| 387 | 3300026088 | Ga0207641_10084073 | Ga0207641_100840733 | 127 |
| 388 | 3300026088 | Ga0207641_10731971 | Ga0207641_107319712 | 127 |
| 389 | 3300026118 | Ga0207675_100025976 | Ga0207675_1000259765 | 127 |
| 390 | 3300026118 | Ga0207675_101071826 | Ga0207675_1010718262 | 127 |
| 391 | 3300026121 | Ga0207683_10005699 | Ga0207683_100056996 | 127 |
| 392 | 3300028379 | Ga0268266_10040095 | Ga0268266_100400955 | 127 |
| 393 | 3300028380 | Ga0268265_10692258 | Ga0268265_106922582 | 127 |
| 394 | 3300028381 | Ga0268264_10256884 | Ga0268264_102568841 | 127 |
| 395 | 3300028381 | Ga0268264_10678333 | Ga0268264_106783332 | 127 |
| 396 | 3300035691 | Ga0373931_0148638 | Ga0373931_0148638_28_468 | 127 |
| 397 | 3300035692 | Ga0373935_0889885 | Ga0373935_0889885_80_511 | 127 |
| 398 | 3300041512 | Ga0451853_3081903 | Ga0451853_3081903_222_653 | 127 |
| 399 | 3300045976 | Ga0466967_2261541 | Ga0466967_2261541_29_466 | 127 |
| 400 | 3300048904 | Ga0496101_0455942 | Ga0496101_0455942_459_893 | 127 |
| 401 | 3300048905 | Ga0496102_0179141 | Ga0496102_0179141_208_639 | 127 |
| 402 | 3300048911 | Ga0496108_0686565 | Ga0496108_0686565_69_500 | 127 |
| 403 | 3300048914 | Ga0496111_0092906 | Ga0496111_0092906_501_932 | 127 |
| 404 | 3300048916 | Ga0496113_0136992 | Ga0496113_0136992_268_699 | 127 |
| 405 | 3300049571 | Ga0501034_0164865 | Ga0501034_0164865_248_679 | 127 |
| 406 | 3300049581 | Ga0501047_0098402 | Ga0501047_0098402_1115_1546 | 127 |
| 407 | 3300049583 | Ga0501067_0045931 | Ga0501067_0045931_1959_2390 | 127 |
| 408 | 3300049585 | Ga0501069_0179365 | Ga0501069_0179365_130_561 | 127 |
| 409 | 3300049586 | Ga0501070_0021038 | Ga0501070_0021038_4937_5368 | 127 |
| 410 | 3300049588 | Ga0501072_0009398 | Ga0501072_0009398_3095_3526 | 127 |
| 411 | 3300049589 | Ga0501073_0079480 | Ga0501073_0079480_672_1103 | 127 |
| 412 | 3300049590 | Ga0501074_0006516 | Ga0501074_0006516_4163_4594 | 127 |
| 413 | 3300049742 | Ga0501080_0003414 | Ga0501080_0003414_5565_5996 | 127 |
| 414 | 3300049744 | Ga0501083_0026063 | Ga0501083_0026063_1737_2168 | 127 |
| 415 | 3300049823 | Ga0501044_0168927 | Ga0501044_0168927_1446_1877 | 127 |
| 416 | 3300050512 | nmdc:mga0n895_352208_c1 | nmdc:mga0n895_352208_c1_552_983 | 127 |
| 417 | 3300050513 | nmdc:mga0rr50_283924_c1 | nmdc:mga0rr50_283924_c1_97_528 | 127 |
| 418 | 3300050514 | nmdc:mga08x19_367453_c1 | nmdc:mga08x19_367453_c1_415_846 | 127 |
| 419 | 3300054114 | Ga0501084_0247834 | Ga0501084_0247834_58_489 | 127 |
| 420 | 3300005328 | Ga0070676_10321970 | Ga0070676_103219702 | 128 |
| 421 | 3300005330 | Ga0070690_100212354 | Ga0070690_1002123541 | 128 |
| 422 | 3300005331 | Ga0070670_100006809 | Ga0070670_1000068092 | 128 |
| 423 | 3300005334 | Ga0068869_100003638 | Ga0068869_1000036382 | 128 |
| 424 | 3300005335 | Ga0070666_10076897 | Ga0070666_100768973 | 128 |
| 425 | 3300005338 | Ga0068868_100011037 | Ga0068868_1000110376 | 128 |
| 426 | 3300005339 | Ga0070660_101015659 | Ga0070660_1010156592 | 128 |
| 427 | 3300005340 | Ga0070689_100279327 | Ga0070689_1002793272 | 128 |
| 428 | 3300005347 | Ga0070668_100044359 | Ga0070668_1000443594 | 128 |
| 429 | 3300005347 | Ga0070668_100914659 | Ga0070668_1009146592 | 128 |
| 430 | 3300005355 | Ga0070671_101221548 | Ga0070671_1012215482 | 128 |
| 431 | 3300005364 | Ga0070673_100011832 | Ga0070673_1000118325 | 128 |
| 432 | 3300005365 | Ga0070688_100837337 | Ga0070688_1008373371 | 128 |
| 433 | 3300005367 | Ga0070667_100000406 | Ga0070667_1000004065 | 128 |
| 434 | 3300005440 | Ga0070705_100195599 | Ga0070705_1001955993 | 128 |
| 435 | 3300005441 | Ga0070700_101278560 | Ga0070700_1012785601 | 128 |
| 436 | 3300005455 | Ga0070663_100545131 | Ga0070663_1005451312 | 128 |
| 437 | 3300005457 | Ga0070662_100027596 | Ga0070662_1000275963 | 128 |
| 438 | 3300005459 | Ga0068867_100009099 | Ga0068867_1000090996 | 128 |
| 439 | 3300005468 | Ga0070707_100705744 | Ga0070707_1007057442 | 128 |
| 440 | 3300005539 | Ga0068853_100377690 | Ga0068853_1003776903 | 128 |
| 441 | 3300005543 | Ga0070672_100062486 | Ga0070672_1000624863 | 128 |
| 442 | 3300005563 | Ga0068855_100431680 | Ga0068855_1004316802 | 128 |
| 443 | 3300005617 | Ga0068859_100000527 | Ga0068859_10000052736 | 128 |
| 444 | 3300005618 | Ga0068864_100005302 | Ga0068864_1000053028 | 128 |
| 445 | 3300005719 | Ga0068861_100019824 | Ga0068861_1000198244 | 128 |
| 446 | 3300005840 | Ga0068870_10095920 | Ga0068870_100959202 | 128 |
| 447 | 3300005841 | Ga0068863_100003159 | Ga0068863_10000315912 | 128 |
| 448 | 3300005842 | Ga0068858_100005279 | Ga0068858_1000052792 | 128 |
| 449 | 3300005843 | Ga0068860_100000976 | Ga0068860_10000097626 | 128 |
| 450 | 3300005843 | Ga0068860_101989050 | Ga0068860_1019890501 | 128 |
| 451 | 3300005844 | Ga0068862_100002697 | Ga0068862_1000026975 | 128 |
| 452 | 3300006237 | Ga0097621_100804923 | Ga0097621_1008049232 | 128 |
| 453 | 3300006852 | Ga0075433_10285057 | Ga0075433_102850573 | 128 |
| 454 | 3300006871 | Ga0075434_100750620 | Ga0075434_1007506202 | 128 |
| 455 | 3300006881 | Ga0068865_100035685 | Ga0068865_1000356856 | 128 |
| 456 | 3300006931 | Ga0097620_100000527 | Ga0097620_10000052736 | 128 |
| 457 | 3300009177 | Ga0105248_10007721 | Ga0105248_100077212 | 128 |
| 458 | 3300009553 | Ga0105249_11300621 | Ga0105249_113006212 | 128 |
| 459 | 3300013104 | Ga0157370_10012128 | Ga0157370_100121282 | 128 |
| 460 | 3300013297 | Ga0157378_10046393 | Ga0157378_100463932 | 128 |
| 461 | 3300013306 | Ga0163162_10515419 | Ga0163162_105154193 | 128 |
| 462 | 3300013308 | Ga0157375_10123821 | Ga0157375_101238214 | 128 |
| 463 | 3300014325 | Ga0163163_10010153 | Ga0163163_100101535 | 128 |
| 464 | 3300014326 | Ga0157380_10580775 | Ga0157380_105807752 | 128 |
| 465 | 3300014968 | Ga0157379_10002763 | Ga0157379_1000276312 | 128 |
| 466 | 3300025901 | Ga0207688_10485466 | Ga0207688_104854661 | 128 |
| 467 | 3300025907 | Ga0207645_10021957 | Ga0207645_100219572 | 128 |
| 468 | 3300025925 | Ga0207650_10002190 | Ga0207650_1000219012 | 128 |
| 469 | 3300025931 | Ga0207644_11557781 | Ga0207644_115577811 | 128 |
| 470 | 3300025933 | Ga0207706_10223524 | Ga0207706_102235242 | 128 |
| 471 | 3300025936 | Ga0207670_10250880 | Ga0207670_102508802 | 128 |
| 472 | 3300025938 | Ga0207704_10226291 | Ga0207704_102262912 | 128 |
| 473 | 3300025941 | Ga0207711_10279790 | Ga0207711_102797902 | 128 |
| 474 | 3300025942 | Ga0207689_10004985 | Ga0207689_100049858 | 128 |
| 475 | 3300025949 | Ga0207667_10172367 | Ga0207667_101723672 | 128 |
| 476 | 3300025960 | Ga0207651_10017237 | Ga0207651_100172373 | 128 |
| 477 | 3300025972 | Ga0207668_10077542 | Ga0207668_100775424 | 128 |
| 478 | 3300025972 | Ga0207668_10683607 | Ga0207668_106836072 | 128 |
| 479 | 3300025986 | Ga0207658_10024238 | Ga0207658_100242385 | 128 |
| 480 | 3300026023 | Ga0207677_10017625 | Ga0207677_100176254 | 128 |
| 481 | 3300026035 | Ga0207703_10002568 | Ga0207703_1000256810 | 128 |
| 482 | 3300026041 | Ga0207639_10316610 | Ga0207639_103166103 | 128 |
| 483 | 3300026075 | Ga0207708_10575052 | Ga0207708_105750522 | 128 |
| 484 | 3300026078 | Ga0207702_10815600 | Ga0207702_108156002 | 128 |
| 485 | 3300026088 | Ga0207641_10036346 | Ga0207641_100363465 | 128 |
| 486 | 3300026089 | Ga0207648_10002230 | Ga0207648_1000223018 | 128 |
| 487 | 3300026095 | Ga0207676_10007800 | Ga0207676_100078004 | 128 |
| 488 | 3300026118 | Ga0207675_100018204 | Ga0207675_1000182044 | 128 |
| 489 | 3300028381 | Ga0268264_10000967 | Ga0268264_1000096724 | 128 |
| 490 | 3300035695 | Ga0373927_0001525 | Ga0373927_0001525_15810_16244 | 128 |
| 491 | 3300035725 | Ga0373947_1167743 | Ga0373947_1167743_63_497 | 128 |
| 492 | 3300036401 | Ga0373937_0692006 | Ga0373937_0692006_166_600 | 128 |
| 493 | 3300037068 | Ga0373925_0023008 | Ga0373925_0023008_3806_4240 | 128 |
| 494 | 3300037068 | Ga0373925_0236453 | Ga0373925_0236453_549_983 | 128 |
| 495 | 3300041492 | Ga0451835_0250944 | Ga0451835_0250944_128_565 | 128 |
| 496 | 3300044842 | Ga0466957_0757849 | Ga0466957_0757849_52_492 | 128 |
| 497 | 3300045836 | Ga0466958_0241512 | Ga0466958_0241512_26_466 | 128 |
| 498 | 3300048905 | Ga0496102_0078545 | Ga0496102_0078545_2155_2589 | 128 |
| 499 | 3300048906 | Ga0496103_0043380 | Ga0496103_0043380_1084_1518 | 128 |
| 500 | 3300048909 | Ga0496106_0098618 | Ga0496106_0098618_719_1153 | 128 |
| 501 | 3300048911 | Ga0496108_0312849 | Ga0496108_0312849_224_658 | 128 |
| 502 | 3300048912 | Ga0496109_0229782 | Ga0496109_0229782_573_1007 | 128 |
| 503 | 3300050512 | nmdc:mga0n895_362172_c1 | nmdc:mga0n895_362172_c1_297_734 | 128 |
| 504 | 3300050515 | nmdc:mga0a205_419155_c1 | nmdc:mga0a205_419155_c1_110_544 | 128 |
| 505 | 3300001976 | JGI24752J21851_1010643 | JGI24752J21851_10106433 | 129 |
| 506 | 3300002074 | JGI24748J21848_1011999 | JGI24748J21848_10119992 | 129 |
| 507 | 3300002075 | JGI24738J21930_10018936 | JGI24738J21930_100189362 | 129 |
| 508 | 3300002076 | JGI24749J21850_1019575 | JGI24749J21850_10195752 | 129 |
| 509 | 3300002155 | JGI24033J26618_1007210 | JGI24033J26618_10072102 | 129 |
| 510 | 3300002239 | JGI24034J26672_10010575 | JGI24034J26672_100105752 | 129 |
| 511 | 3300002459 | JGI24751J29686_10044553 | JGI24751J29686_100445532 | 129 |
| 512 | 3300005290 | Ga0065712_10129191 | Ga0065712_101291912 | 129 |
| 513 | 3300005293 | Ga0065715_10105326 | Ga0065715_101053265 | 129 |
| 514 | 3300005293 | Ga0065715_10150410 | Ga0065715_101504102 | 129 |
| 515 | 3300005327 | Ga0070658_10102203 | Ga0070658_101022034 | 129 |
| 516 | 3300005327 | Ga0070658_10325556 | Ga0070658_103255561 | 129 |
| 517 | 3300005328 | Ga0070676_10040257 | Ga0070676_100402573 | 129 |
| 518 | 3300005329 | Ga0070683_100004758 | Ga0070683_1000047588 | 129 |
| 519 | 3300005329 | Ga0070683_100049601 | Ga0070683_1000496016 | 129 |
| 520 | 3300005329 | Ga0070683_100052029 | Ga0070683_1000520293 | 129 |
| 521 | 3300005330 | Ga0070690_100019262 | Ga0070690_1000192626 | 129 |
| 522 | 3300005331 | Ga0070670_100076130 | Ga0070670_1000761302 | 129 |
| 523 | 3300005331 | Ga0070670_100082257 | Ga0070670_1000822575 | 129 |
| 524 | 3300005333 | Ga0070677_10003225 | Ga0070677_100032252 | 129 |
| 525 | 3300005334 | Ga0068869_100051214 | Ga0068869_1000512143 | 129 |
| 526 | 3300005335 | Ga0070666_10251072 | Ga0070666_102510722 | 129 |
| 527 | 3300005337 | Ga0070682_100055241 | Ga0070682_1000552413 | 129 |
| 528 | 3300005338 | Ga0068868_100040170 | Ga0068868_1000401706 | 129 |
| 529 | 3300005339 | Ga0070660_100000551 | Ga0070660_10000055117 | 129 |
| 530 | 3300005339 | Ga0070660_100113162 | Ga0070660_1001131622 | 129 |
| 531 | 3300005339 | Ga0070660_100256552 | Ga0070660_1002565522 | 129 |
| 532 | 3300005339 | Ga0070660_100387922 | Ga0070660_1003879221 | 129 |
| 533 | 3300005340 | Ga0070689_100079378 | Ga0070689_1000793784 | 129 |
| 534 | 3300005344 | Ga0070661_100007142 | Ga0070661_1000071427 | 129 |
| 535 | 3300005344 | Ga0070661_100013445 | Ga0070661_1000134453 | 129 |
| 536 | 3300005344 | Ga0070661_100041563 | Ga0070661_1000415636 | 129 |
| 537 | 3300005344 | Ga0070661_100238474 | Ga0070661_1002384742 | 129 |
| 538 | 3300005347 | Ga0070668_100301473 | Ga0070668_1003014733 | 129 |
| 539 | 3300005347 | Ga0070668_100317601 | Ga0070668_1003176012 | 129 |
| 540 | 3300005353 | Ga0070669_100042357 | Ga0070669_1000423575 | 129 |
| 541 | 3300005354 | Ga0070675_100032188 | Ga0070675_1000321886 | 129 |
| 542 | 3300005354 | Ga0070675_100748439 | Ga0070675_1007484392 | 129 |
| 543 | 3300005354 | Ga0070675_101085289 | Ga0070675_1010852892 | 129 |
| 544 | 3300005355 | Ga0070671_100020178 | Ga0070671_1000201783 | 129 |
| 545 | 3300005355 | Ga0070671_100058212 | Ga0070671_1000582124 | 129 |
| 546 | 3300005355 | Ga0070671_100194496 | Ga0070671_1001944962 | 129 |
| 547 | 3300005355 | Ga0070671_101033111 | Ga0070671_1010331111 | 129 |
| 548 | 3300005364 | Ga0070673_100647597 | Ga0070673_1006475972 | 129 |
| 549 | 3300005364 | Ga0070673_100957650 | Ga0070673_1009576502 | 129 |
| 550 | 3300005365 | Ga0070688_100013445 | Ga0070688_1000134453 | 129 |
| 551 | 3300005366 | Ga0070659_100000779 | Ga0070659_1000007797 | 129 |
| 552 | 3300005366 | Ga0070659_100018637 | Ga0070659_1000186376 | 129 |
| 553 | 3300005366 | Ga0070659_100023800 | Ga0070659_1000238004 | 129 |
| 554 | 3300005366 | Ga0070659_100343555 | Ga0070659_1003435553 | 129 |
| 555 | 3300005367 | Ga0070667_100053943 | Ga0070667_1000539435 | 129 |
| 556 | 3300005367 | Ga0070667_100087714 | Ga0070667_1000877142 | 129 |
| 557 | 3300005435 | Ga0070714_100005077 | Ga0070714_1000050773 | 129 |
| 558 | 3300005441 | Ga0070700_100336905 | Ga0070700_1003369052 | 129 |
| 559 | 3300005455 | Ga0070663_100016715 | Ga0070663_1000167155 | 129 |
| 560 | 3300005455 | Ga0070663_100053096 | Ga0070663_1000530961 | 129 |
| 561 | 3300005455 | Ga0070663_100077225 | Ga0070663_1000772251 | 129 |
| 562 | 3300005455 | Ga0070663_101422153 | Ga0070663_1014221531 | 129 |
| 563 | 3300005456 | Ga0070678_101611830 | Ga0070678_1016118302 | 129 |
| 564 | 3300005457 | Ga0070662_100000211 | Ga0070662_1000002119 | 129 |
| 565 | 3300005457 | Ga0070662_100074089 | Ga0070662_1000740892 | 129 |
| 566 | 3300005458 | Ga0070681_10188673 | Ga0070681_101886733 | 129 |
| 567 | 3300005459 | Ga0068867_100278648 | Ga0068867_1002786482 | 129 |
| 568 | 3300005459 | Ga0068867_100309215 | Ga0068867_1003092152 | 129 |
| 569 | 3300005466 | Ga0070685_10011328 | Ga0070685_100113282 | 129 |
| 570 | 3300005535 | Ga0070684_100003917 | Ga0070684_1000039178 | 129 |
| 571 | 3300005539 | Ga0068853_100006893 | Ga0068853_1000068935 | 129 |
| 572 | 3300005539 | Ga0068853_100051166 | Ga0068853_1000511662 | 129 |
| 573 | 3300005539 | Ga0068853_101066876 | Ga0068853_1010668761 | 129 |
| 574 | 3300005543 | Ga0070672_100511109 | Ga0070672_1005111092 | 129 |
| 575 | 3300005543 | Ga0070672_100803947 | Ga0070672_1008039471 | 129 |
| 576 | 3300005544 | Ga0070686_100322126 | Ga0070686_1003221262 | 129 |
| 577 | 3300005545 | Ga0070695_101221839 | Ga0070695_1012218391 | 129 |
| 578 | 3300005545 | Ga0070695_101246514 | Ga0070695_1012465141 | 129 |
| 579 | 3300005547 | Ga0070693_100108418 | Ga0070693_1001084183 | 129 |
| 580 | 3300005547 | Ga0070693_100248777 | Ga0070693_1002487772 | 129 |
| 581 | 3300005548 | Ga0070665_100009685 | Ga0070665_1000096855 | 129 |
| 582 | 3300005548 | Ga0070665_100077530 | Ga0070665_1000775302 | 129 |
| 583 | 3300005548 | Ga0070665_100201390 | Ga0070665_1002013902 | 129 |
| 584 | 3300005563 | Ga0068855_100010927 | Ga0068855_1000109275 | 129 |
| 585 | 3300005563 | Ga0068855_100418212 | Ga0068855_1004182122 | 129 |
| 586 | 3300005563 | Ga0068855_100505548 | Ga0068855_1005055482 | 129 |
| 587 | 3300005564 | Ga0070664_100017006 | Ga0070664_1000170067 | 129 |
| 588 | 3300005564 | Ga0070664_100034982 | Ga0070664_1000349824 | 129 |
| 589 | 3300005564 | Ga0070664_101297291 | Ga0070664_1012972912 | 129 |
| 590 | 3300005577 | Ga0068857_100069369 | Ga0068857_1000693696 | 129 |
| 591 | 3300005577 | Ga0068857_100071664 | Ga0068857_1000716645 | 129 |
| 592 | 3300005578 | Ga0068854_100048212 | Ga0068854_1000482122 | 129 |
| 593 | 3300005578 | Ga0068854_100253011 | Ga0068854_1002530112 | 129 |
| 594 | 3300005614 | Ga0068856_100004235 | Ga0068856_1000042358 | 129 |
| 595 | 3300005614 | Ga0068856_100010690 | Ga0068856_1000106905 | 129 |
| 596 | 3300005615 | Ga0070702_100301479 | Ga0070702_1003014792 | 129 |
| 597 | 3300005616 | Ga0068852_100003693 | Ga0068852_1000036936 | 129 |
| 598 | 3300005616 | Ga0068852_100010012 | Ga0068852_1000100125 | 129 |
| 599 | 3300005616 | Ga0068852_100014944 | Ga0068852_1000149442 | 129 |
| 600 | 3300005616 | Ga0068852_101167920 | Ga0068852_1011679202 | 129 |
| 601 | 3300005617 | Ga0068859_100015175 | Ga0068859_1000151757 | 129 |
| 602 | 3300005617 | Ga0068859_101363790 | Ga0068859_1013637902 | 129 |
| 603 | 3300005618 | Ga0068864_100238796 | Ga0068864_1002387962 | 129 |
| 604 | 3300005719 | Ga0068861_100034998 | Ga0068861_1000349986 | 129 |
| 605 | 3300005719 | Ga0068861_100934040 | Ga0068861_1009340402 | 129 |
| 606 | 3300005834 | Ga0068851_10001801 | Ga0068851_100018019 | 129 |
| 607 | 3300005834 | Ga0068851_10009400 | Ga0068851_100094004 | 129 |
| 608 | 3300005834 | Ga0068851_10553019 | Ga0068851_105530191 | 129 |
| 609 | 3300005840 | Ga0068870_10198353 | Ga0068870_101983532 | 129 |
| 610 | 3300005841 | Ga0068863_100190937 | Ga0068863_1001909373 | 129 |
| 611 | 3300005842 | Ga0068858_100573120 | Ga0068858_1005731202 | 129 |
| 612 | 3300005843 | Ga0068860_100057406 | Ga0068860_1000574063 | 129 |
| 613 | 3300005843 | Ga0068860_100752028 | Ga0068860_1007520282 | 129 |
| 614 | 3300006163 | Ga0070715_10494719 | Ga0070715_104947192 | 129 |
| 615 | 3300006173 | Ga0070716_100351355 | Ga0070716_1003513552 | 129 |
| 616 | 3300006175 | Ga0070712_100398064 | Ga0070712_1003980642 | 129 |
| 617 | 3300006358 | Ga0068871_100249240 | Ga0068871_1002492403 | 129 |
| 618 | 3300006358 | Ga0068871_100888331 | Ga0068871_1008883312 | 129 |
| 619 | 3300006871 | Ga0075434_100553720 | Ga0075434_1005537203 | 129 |
| 620 | 3300006881 | Ga0068865_100462689 | Ga0068865_1004626892 | 129 |
| 621 | 3300006881 | Ga0068865_100497947 | Ga0068865_1004979472 | 129 |
| 622 | 3300006881 | Ga0068865_100612271 | Ga0068865_1006122712 | 129 |
| 623 | 3300006881 | Ga0068865_100847818 | Ga0068865_1008478182 | 129 |
| 624 | 3300006931 | Ga0097620_100015174 | Ga0097620_1000151747 | 129 |
| 625 | 3300006931 | Ga0097620_101364163 | Ga0097620_1013641632 | 129 |
| 626 | 3300007076 | Ga0075435_100644198 | Ga0075435_1006441982 | 129 |
| 627 | 3300009093 | Ga0105240_10022687 | Ga0105240_100226877 | 129 |
| 628 | 3300009094 | Ga0111539_11996554 | Ga0111539_119965542 | 129 |
| 629 | 3300009098 | Ga0105245_10721422 | Ga0105245_107214222 | 129 |
| 630 | 3300009098 | Ga0105245_12481724 | Ga0105245_124817242 | 129 |
| 631 | 3300009101 | Ga0105247_11080124 | Ga0105247_110801241 | 129 |
| 632 | 3300009174 | Ga0105241_10015461 | Ga0105241_100154617 | 129 |
| 633 | 3300009177 | Ga0105248_10019006 | Ga0105248_100190067 | 129 |
| 634 | 3300009177 | Ga0105248_10033264 | Ga0105248_100332647 | 129 |
| 635 | 3300009177 | Ga0105248_10277003 | Ga0105248_102770032 | 129 |
| 636 | 3300009177 | Ga0105248_10525587 | Ga0105248_105255872 | 129 |
| 637 | 3300009545 | Ga0105237_10368335 | Ga0105237_103683351 | 129 |
| 638 | 3300009551 | Ga0105238_10034778 | Ga0105238_100347785 | 129 |
| 639 | 3300010375 | Ga0105239_10057486 | Ga0105239_100574865 | 129 |
| 640 | 3300011119 | Ga0105246_10085830 | Ga0105246_100858301 | 129 |
| 641 | 3300012485 | Ga0157325_1023402 | Ga0157325_10234021 | 129 |
| 642 | 3300012513 | Ga0157326_1003717 | Ga0157326_10037172 | 129 |
| 643 | 3300013100 | Ga0157373_10003956 | Ga0157373_100039564 | 129 |
| 644 | 3300013100 | Ga0157373_10270501 | Ga0157373_102705012 | 129 |
| 645 | 3300013102 | Ga0157371_10000446 | Ga0157371_1000044625 | 129 |
| 646 | 3300013102 | Ga0157371_10179093 | Ga0157371_101790932 | 129 |
| 647 | 3300013102 | Ga0157371_10515985 | Ga0157371_105159852 | 129 |
| 648 | 3300013102 | Ga0157371_10566585 | Ga0157371_105665852 | 129 |
| 649 | 3300013104 | Ga0157370_10093865 | Ga0157370_100938655 | 129 |
| 650 | 3300013104 | Ga0157370_11624898 | Ga0157370_116248981 | 129 |
| 651 | 3300013105 | Ga0157369_10012261 | Ga0157369_100122612 | 129 |
| 652 | 3300013105 | Ga0157369_10726265 | Ga0157369_107262652 | 129 |
| 653 | 3300013296 | Ga0157374_10084887 | Ga0157374_100848873 | 129 |
| 654 | 3300013296 | Ga0157374_10246103 | Ga0157374_102461032 | 129 |
| 655 | 3300013297 | Ga0157378_10014139 | Ga0157378_100141398 | 129 |
| 656 | 3300013306 | Ga0163162_10138414 | Ga0163162_101384143 | 129 |
| 657 | 3300013306 | Ga0163162_10299866 | Ga0163162_102998662 | 129 |
| 658 | 3300013306 | Ga0163162_10303148 | Ga0163162_103031483 | 129 |
| 659 | 3300013306 | Ga0163162_10585285 | Ga0163162_105852853 | 129 |
| 660 | 3300013307 | Ga0157372_10000523 | Ga0157372_1000052325 | 129 |
| 661 | 3300013307 | Ga0157372_10092901 | Ga0157372_100929014 | 129 |
| 662 | 3300013307 | Ga0157372_10131156 | Ga0157372_101311562 | 129 |
| 663 | 3300013307 | Ga0157372_10305617 | Ga0157372_103056172 | 129 |
| 664 | 3300013307 | Ga0157372_10590193 | Ga0157372_105901932 | 129 |
| 665 | 3300013307 | Ga0157372_11548556 | Ga0157372_115485561 | 129 |
| 666 | 3300013308 | Ga0157375_10055728 | Ga0157375_100557281 | 129 |
| 667 | 3300014325 | Ga0163163_10162204 | Ga0163163_101622041 | 129 |
| 668 | 3300014325 | Ga0163163_10986437 | Ga0163163_109864371 | 129 |
| 669 | 3300014326 | Ga0157380_11847194 | Ga0157380_118471941 | 129 |
| 670 | 3300014497 | Ga0182008_10117288 | Ga0182008_101172882 | 129 |
| 671 | 3300014968 | Ga0157379_10092851 | Ga0157379_100928512 | 129 |
| 672 | 3300014968 | Ga0157379_10366482 | Ga0157379_103664823 | 129 |
| 673 | 3300014969 | Ga0157376_10182942 | Ga0157376_101829422 | 129 |
| 674 | 3300014969 | Ga0157376_11075366 | Ga0157376_110753661 | 129 |
| 675 | 3300014969 | Ga0157376_11084092 | Ga0157376_110840921 | 129 |
| 676 | 3300020070 | Ga0206356_10546372 | Ga0206356_105463722 | 129 |
| 677 | 3300025315 | Ga0207697_10001270 | Ga0207697_100012705 | 129 |
| 678 | 3300025321 | Ga0207656_10002941 | Ga0207656_100029411 | 129 |
| 679 | 3300025321 | Ga0207656_10008891 | Ga0207656_100088913 | 129 |
| 680 | 3300025321 | Ga0207656_10014121 | Ga0207656_100141212 | 129 |
| 681 | 3300025321 | Ga0207656_10308718 | Ga0207656_103087182 | 129 |
| 682 | 3300025893 | Ga0207682_10004140 | Ga0207682_100041406 | 129 |
| 683 | 3300025898 | Ga0207692_11040042 | Ga0207692_110400421 | 129 |
| 684 | 3300025901 | Ga0207688_10139443 | Ga0207688_101394432 | 129 |
| 685 | 3300025901 | Ga0207688_10272526 | Ga0207688_102725262 | 129 |
| 686 | 3300025903 | Ga0207680_10015863 | Ga0207680_100158633 | 129 |
| 687 | 3300025903 | Ga0207680_10056147 | Ga0207680_100561474 | 129 |
| 688 | 3300025904 | Ga0207647_10158855 | Ga0207647_101588552 | 129 |
| 689 | 3300025907 | Ga0207645_10015925 | Ga0207645_100159257 | 129 |
| 690 | 3300025907 | Ga0207645_10036864 | Ga0207645_100368643 | 129 |
| 691 | 3300025908 | Ga0207643_10102350 | Ga0207643_101023502 | 129 |
| 692 | 3300025909 | Ga0207705_10052596 | Ga0207705_100525962 | 129 |
| 693 | 3300025911 | Ga0207654_10210518 | Ga0207654_102105182 | 129 |
| 694 | 3300025912 | Ga0207707_10005207 | Ga0207707_1000520713 | 129 |
| 695 | 3300025912 | Ga0207707_10328500 | Ga0207707_103285001 | 129 |
| 696 | 3300025913 | Ga0207695_10007532 | Ga0207695_100075325 | 129 |
| 697 | 3300025915 | Ga0207693_10160135 | Ga0207693_101601353 | 129 |
| 698 | 3300025916 | Ga0207663_10047577 | Ga0207663_100475773 | 129 |
| 699 | 3300025917 | Ga0207660_10012654 | Ga0207660_100126544 | 129 |
| 700 | 3300025918 | Ga0207662_10026822 | Ga0207662_100268222 | 129 |
| 701 | 3300025919 | Ga0207657_10000229 | Ga0207657_1000022926 | 129 |
| 702 | 3300025919 | Ga0207657_10008077 | Ga0207657_100080775 | 129 |
| 703 | 3300025919 | Ga0207657_10024320 | Ga0207657_100243202 | 129 |
| 704 | 3300025919 | Ga0207657_10305144 | Ga0207657_103051442 | 129 |
| 705 | 3300025920 | Ga0207649_10002277 | Ga0207649_100022775 | 129 |
| 706 | 3300025920 | Ga0207649_10056653 | Ga0207649_100566532 | 129 |
| 707 | 3300025920 | Ga0207649_11567963 | Ga0207649_115679631 | 129 |
| 708 | 3300025921 | Ga0207652_10003991 | Ga0207652_100039914 | 129 |
| 709 | 3300025923 | Ga0207681_10460754 | Ga0207681_104607541 | 129 |
| 710 | 3300025923 | Ga0207681_10492627 | Ga0207681_104926271 | 129 |
| 711 | 3300025924 | Ga0207694_10028324 | Ga0207694_100283245 | 129 |
| 712 | 3300025925 | Ga0207650_10026509 | Ga0207650_100265095 | 129 |
| 713 | 3300025926 | Ga0207659_10002335 | Ga0207659_100023357 | 129 |
| 714 | 3300025926 | Ga0207659_10666030 | Ga0207659_106660302 | 129 |
| 715 | 3300025926 | Ga0207659_11149511 | Ga0207659_111495112 | 129 |
| 716 | 3300025927 | Ga0207687_10602065 | Ga0207687_106020652 | 129 |
| 717 | 3300025929 | Ga0207664_10006738 | Ga0207664_100067385 | 129 |
| 718 | 3300025931 | Ga0207644_10000405 | Ga0207644_100004058 | 129 |
| 719 | 3300025931 | Ga0207644_10054422 | Ga0207644_100544223 | 129 |
| 720 | 3300025931 | Ga0207644_10116881 | Ga0207644_101168813 | 129 |
| 721 | 3300025931 | Ga0207644_10266450 | Ga0207644_102664503 | 129 |
| 722 | 3300025932 | Ga0207690_10000348 | Ga0207690_1000034822 | 129 |
| 723 | 3300025932 | Ga0207690_10006051 | Ga0207690_100060514 | 129 |
| 724 | 3300025932 | Ga0207690_10035029 | Ga0207690_100350296 | 129 |
| 725 | 3300025932 | Ga0207690_10220567 | Ga0207690_102205672 | 129 |
| 726 | 3300025932 | Ga0207690_10346607 | Ga0207690_103466071 | 129 |
| 727 | 3300025933 | Ga0207706_10000045 | Ga0207706_1000004572 | 129 |
| 728 | 3300025933 | Ga0207706_10064814 | Ga0207706_100648145 | 129 |
| 729 | 3300025935 | Ga0207709_10507096 | Ga0207709_105070962 | 129 |
| 730 | 3300025937 | Ga0207669_10791340 | Ga0207669_107913402 | 129 |
| 731 | 3300025940 | Ga0207691_10050344 | Ga0207691_100503445 | 129 |
| 732 | 3300025940 | Ga0207691_10085085 | Ga0207691_100850854 | 129 |
| 733 | 3300025941 | Ga0207711_10011574 | Ga0207711_100115744 | 129 |
| 734 | 3300025941 | Ga0207711_10174265 | Ga0207711_101742652 | 129 |
| 735 | 3300025942 | Ga0207689_10013147 | Ga0207689_100131472 | 129 |
| 736 | 3300025944 | Ga0207661_10074070 | Ga0207661_100740705 | 129 |
| 737 | 3300025944 | Ga0207661_10172727 | Ga0207661_101727272 | 129 |
| 738 | 3300025944 | Ga0207661_10502796 | Ga0207661_105027962 | 129 |
| 739 | 3300025945 | Ga0207679_10003526 | Ga0207679_100035264 | 129 |
| 740 | 3300025945 | Ga0207679_10011829 | Ga0207679_100118295 | 129 |
| 741 | 3300025945 | Ga0207679_10049245 | Ga0207679_100492453 | 129 |
| 742 | 3300025945 | Ga0207679_10051924 | Ga0207679_100519244 | 129 |
| 743 | 3300025945 | Ga0207679_10781540 | Ga0207679_107815401 | 129 |
| 744 | 3300025945 | Ga0207679_10859607 | Ga0207679_108596071 | 129 |
| 745 | 3300025949 | Ga0207667_10002826 | Ga0207667_100028265 | 129 |
| 746 | 3300025949 | Ga0207667_10003469 | Ga0207667_1000346914 | 129 |
| 747 | 3300025949 | Ga0207667_10105193 | Ga0207667_101051933 | 129 |
| 748 | 3300025949 | Ga0207667_10435293 | Ga0207667_104352932 | 129 |
| 749 | 3300025949 | Ga0207667_11710818 | Ga0207667_117108182 | 129 |
| 750 | 3300025960 | Ga0207651_10005532 | Ga0207651_100055323 | 129 |
| 751 | 3300025960 | Ga0207651_10150139 | Ga0207651_101501392 | 129 |
| 752 | 3300025960 | Ga0207651_10176290 | Ga0207651_101762902 | 129 |
| 753 | 3300025961 | Ga0207712_10201372 | Ga0207712_102013723 | 129 |
| 754 | 3300025972 | Ga0207668_10221403 | Ga0207668_102214032 | 129 |
| 755 | 3300025972 | Ga0207668_10258794 | Ga0207668_102587943 | 129 |
| 756 | 3300025972 | Ga0207668_10327768 | Ga0207668_103277682 | 129 |
| 757 | 3300025981 | Ga0207640_10019747 | Ga0207640_100197475 | 129 |
| 758 | 3300025981 | Ga0207640_10056577 | Ga0207640_100565772 | 129 |
| 759 | 3300025981 | Ga0207640_10063512 | Ga0207640_100635124 | 129 |
| 760 | 3300025986 | Ga0207658_10336284 | Ga0207658_103362842 | 129 |
| 761 | 3300026023 | Ga0207677_10784901 | Ga0207677_107849011 | 129 |
| 762 | 3300026041 | Ga0207639_10008842 | Ga0207639_100088428 | 129 |
| 763 | 3300026041 | Ga0207639_10018465 | Ga0207639_100184655 | 129 |
| 764 | 3300026041 | Ga0207639_10991470 | Ga0207639_109914702 | 129 |
| 765 | 3300026041 | Ga0207639_12189938 | Ga0207639_121899381 | 129 |
| 766 | 3300026067 | Ga0207678_10001996 | Ga0207678_1000199616 | 129 |
| 767 | 3300026067 | Ga0207678_10032115 | Ga0207678_100321154 | 129 |
| 768 | 3300026067 | Ga0207678_10104144 | Ga0207678_101041444 | 129 |
| 769 | 3300026067 | Ga0207678_10934802 | Ga0207678_109348022 | 129 |
| 770 | 3300026075 | Ga0207708_10304201 | Ga0207708_103042012 | 129 |
| 771 | 3300026078 | Ga0207702_10000715 | Ga0207702_1000071520 | 129 |
| 772 | 3300026078 | Ga0207702_10056652 | Ga0207702_100566526 | 129 |
| 773 | 3300026088 | Ga0207641_10056891 | Ga0207641_100568915 | 129 |
| 774 | 3300026088 | Ga0207641_10101932 | Ga0207641_101019322 | 129 |
| 775 | 3300026088 | Ga0207641_10512363 | Ga0207641_105123633 | 129 |
| 776 | 3300026089 | Ga0207648_10083123 | Ga0207648_100831232 | 129 |
| 777 | 3300026095 | Ga0207676_10093737 | Ga0207676_100937375 | 129 |
| 778 | 3300026116 | Ga0207674_10000225 | Ga0207674_1000022553 | 129 |
| 779 | 3300026116 | Ga0207674_10015172 | Ga0207674_100151727 | 129 |
| 780 | 3300026118 | Ga0207675_100863415 | Ga0207675_1008634152 | 129 |
| 781 | 3300026121 | Ga0207683_10016965 | Ga0207683_100169657 | 129 |
| 782 | 3300026142 | Ga0207698_10004376 | Ga0207698_100043768 | 129 |
| 783 | 3300026142 | Ga0207698_10007522 | Ga0207698_100075225 | 129 |
| 784 | 3300026142 | Ga0207698_10587420 | Ga0207698_105874202 | 129 |
| 785 | 3300027617 | Ga0210002_1019853 | Ga0210002_10198532 | 129 |
| 786 | 3300027876 | Ga0209974_10072542 | Ga0209974_100725423 | 129 |
| 787 | 3300028379 | Ga0268266_10516993 | Ga0268266_105169932 | 129 |
| 788 | 3300028380 | Ga0268265_10181670 | Ga0268265_101816704 | 129 |
| 789 | 3300028380 | Ga0268265_11012437 | Ga0268265_110124372 | 129 |
| 790 | 3300028381 | Ga0268264_10065017 | Ga0268264_100650173 | 129 |
| 791 | 3300031548 | Ga0307408_100064934 | Ga0307408_1000649343 | 129 |
| 792 | 3300031731 | Ga0307405_10058582 | Ga0307405_100585822 | 129 |
| 793 | 3300031852 | Ga0307410_10039366 | Ga0307410_100393663 | 129 |
| 794 | 3300031901 | Ga0307406_10127050 | Ga0307406_101270502 | 129 |
| 795 | 3300031901 | Ga0307406_10966201 | Ga0307406_109662012 | 129 |
| 796 | 3300031911 | Ga0307412_10045789 | Ga0307412_100457893 | 129 |
| 797 | 3300031995 | Ga0307409_100006788 | Ga0307409_1000067887 | 129 |
| 798 | 3300032002 | Ga0307416_100245809 | Ga0307416_1002458093 | 129 |
| 799 | 3300032004 | Ga0307414_10205034 | Ga0307414_102050342 | 129 |
| 800 | 3300032005 | Ga0307411_10019396 | Ga0307411_100193964 | 129 |
| 801 | 3300032126 | Ga0307415_100007976 | Ga0307415_1000079766 | 129 |
| 802 | 3300034817 | Ga0373948_0049468 | Ga0373948_0049468_126_563 | 129 |
| 803 | 3300034819 | Ga0373958_0077024 | Ga0373958_0077024_139_573 | 129 |
| 804 | 3300035083 | Ga0373926_0181431 | Ga0373926_0181431_37_474 | 129 |
| 805 | 3300035118 | Ga0373954_0174717 | Ga0373954_0174717_80_517 | 129 |
| 806 | 3300035695 | Ga0373927_0256857 | Ga0373927_0256857_88_525 | 129 |
| 807 | 3300035724 | Ga0373933_0599995 | Ga0373933_0599995_134_571 | 129 |
| 808 | 3300035725 | Ga0373947_0401072 | Ga0373947_0401072_195_632 | 129 |
| 809 | 3300037312 | Ga0395899_0275335 | Ga0395899_0275335_268_708 | 129 |
| 810 | 3300037418 | Ga0395900_0035910 | Ga0395900_0035910_2298_2738 | 129 |
| 811 | 3300037418 | Ga0395900_0542778 | Ga0395900_0542778_86_526 | 129 |
| 812 | 3300037466 | Ga0395898_0058539 | Ga0395898_0058539_582_1022 | 129 |
| 813 | 3300037471 | Ga0395905_0958466 | Ga0395905_0958466_163_603 | 129 |
| 814 | 3300038443 | Ga0395901_0254916 | Ga0395901_0254916_1270_1710 | 129 |
| 815 | 3300038443 | Ga0395901_0401510 | Ga0395901_0401510_151_591 | 129 |
| 816 | 3300038996 | Ga0242420_065050 | Ga0242420_065050_206_646 | 129 |
| 817 | 3300042157 | Ga0439458_0059704 | Ga0439458_0059704_468_908 | 129 |
| 818 | 3300044712 | Ga0453684_0238511 | Ga0453684_0238511_491_931 | 129 |
| 819 | 3300044712 | Ga0453684_1072153 | Ga0453684_1072153_80_514 | 129 |
| 820 | 3300045051 | Ga0451576_1087686 | Ga0451576_1087686_254_688 | 129 |
| 821 | 3300046459 | Ga0495629_0302645 | Ga0495629_0302645_179_616 | 129 |
| 822 | 3300046472 | Ga0495580_0092998 | Ga0495580_0092998_543_977 | 129 |
| 823 | 3300046681 | Ga0495647_0441462 | Ga0495647_0441462_148_582 | 129 |
| 824 | 3300046683 | Ga0495658_0384686 | Ga0495658_0384686_230_667 | 129 |
| 825 | 3300048903 | Ga0496100_0159488 | Ga0496100_0159488_558_992 | 129 |
| 826 | 3300048903 | Ga0496100_0551114 | Ga0496100_0551114_417_854 | 129 |
| 827 | 3300048904 | Ga0496101_0082914 | Ga0496101_0082914_752_1186 | 129 |
| 828 | 3300048904 | Ga0496101_0269512 | Ga0496101_0269512_722_1159 | 129 |
| 829 | 3300048905 | Ga0496102_0062700 | Ga0496102_0062700_2525_2962 | 129 |
| 830 | 3300048906 | Ga0496103_0035997 | Ga0496103_0035997_1385_1822 | 129 |
| 831 | 3300048907 | Ga0496104_0006095 | Ga0496104_0006095_3904_4338 | 129 |
| 832 | 3300048907 | Ga0496104_0797096 | Ga0496104_0797096_251_688 | 129 |
| 833 | 3300048909 | Ga0496106_0000931 | Ga0496106_0000931_11321_11758 | 129 |
| 834 | 3300048909 | Ga0496106_0460274 | Ga0496106_0460274_61_501 | 129 |
| 835 | 3300048910 | Ga0496107_0139594 | Ga0496107_0139594_1168_1605 | 129 |
| 836 | 3300048911 | Ga0496108_0009652 | Ga0496108_0009652_5520_5954 | 129 |
| 837 | 3300048912 | Ga0496109_0028312 | Ga0496109_0028312_127_561 | 129 |
| 838 | 3300048913 | Ga0496110_0005169 | Ga0496110_0005169_6570_7004 | 129 |
| 839 | 3300048913 | Ga0496110_0330460 | Ga0496110_0330460_440_880 | 129 |
| 840 | 3300048914 | Ga0496111_0133240 | Ga0496111_0133240_1010_1444 | 129 |
| 841 | 3300049583 | Ga0501067_0339975 | Ga0501067_0339975_155_592 | 129 |
| 842 | 3300050511 | nmdc:mga08y16_1669785_c1 | nmdc:mga08y16_1669785_c1_24_458 | 129 |
| 843 | 3300050513 | nmdc:mga0rr50_630279_c1 | nmdc:mga0rr50_630279_c1_64_504 | 129 |
| 844 | 3300059640 | Ga0587067_026936 | Ga0587067_026936_98_538 | 129 |
| 845 | 3300060344 | Ga0587071_052560 | Ga0587071_052560_250_690 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8205 | 46 | 119 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8011 | 46 | 119 |
| 1vdm-assembly1.cif.gz_I | crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 | 0.7275 | 86 | 118 |
| 6sxa-assembly1.cif.gz_G | xpf-ercc1 cryo-em structure, apo-form | 0.7144 | 72 | 122 |
| 2jwl-assembly1.cif.gz_B | solution structure of periplasmic domain of tolr from h. influenzae with saxs data | 0.7085 | 48 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jwlB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7085 | 48 | 114 | 3.30.420.270 |
| 3f7tA01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain | 0.7076 | 88 | 119 | 3.40.1010.20 |
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7068 | 87 | 119 | 3.40.50.2020 |
| 2vzvA03 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.6897 | 69 | 119 | 3.20.20.80 |
| af_A0A1D6NEB8_5_191_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.6828 | 68 | 120 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ZWN2-F1-model_v4 | Biopolymer transporter ExbD | 0.9438 | 54 | 126 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A5E9Q4F2-F1-model_v4 | deleted | 0.9401 | 46 | 120 |
|
| AF-A0A1I7IB77-F1-model_v4 | Biopolymer transport protein ExbD | 0.9377 | 43 | 119 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A2S9GU90-F1-model_v4 | Biopolymer transport protein ExbD/TolR | 0.9194 | 49 | 120 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A7X8V0M5-F1-model_v4 | deleted | 0.9093 | 45 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar