F483237

General Info

Members Datasets Scaffolds Average Seq Length
845 288 845 133

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10102203|Ga0070658_101022034
Length 146
Sequence MAMNVGTADGDDDEVMSTINTTPLVDVMLVLLXXFLITVPVVRNSIPVELPKERNEIRESKPENIVISVDAQDHIYWNDLRMASTQALVDRLKKISVLSPQPEVQIRGDGRGNYEGVGRVVYACQRAGISKVSFITEPPPRAAAAS

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
107 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
108 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
226 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
229 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 3.91
Rhizosphere 94.2
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1010643 3300001976 Bacteria 1200
2 JGI24748J21848_1011999 3300002074 Bacteria 1021
3 JGI24738J21930_10018936 3300002075 Bacteria 1438
4 JGI24749J21850_1019575 3300002076 Bacteria 956
5 JGI24033J26618_1007210 3300002155 Bacteria 1259
6 JGI24034J26672_10010575 3300002239 Bacteria 1373
7 JGI24034J26672_10073748 3300002239 Bacteria 614
8 JGI24751J29686_10044553 3300002459 Bacteria 917
9 rootL2_10104466 3300003322 Bacteria 2144
10 Ga0065714_10344125 3300005288 Bacteria 642
11 Ga0065712_10129191 3300005290 Bacteria 1570
12 Ga0065715_10105326 3300005293 Bacteria 2900
13 Ga0065715_10150410 3300005293 Bacteria 1736
14 Ga0070658_10102203 3300005327 Bacteria 2370
15 Ga0070658_10325556 3300005327 Bacteria 1313
16 Ga0070676_10001268 3300005328 Bacteria 12689
17 Ga0070676_10022429 3300005328 Bacteria 3539
18 Ga0070676_10040257 3300005328 Bacteria 2706
19 Ga0070676_10051342 3300005328 Bacteria 2421
20 Ga0070676_10321970 3300005328 Bacteria 1055
21 Ga0070683_100004758 3300005329 Bacteria 11234
22 Ga0070683_100049601 3300005329 Bacteria 3883
23 Ga0070683_100052029 3300005329 Bacteria 3794
24 Ga0070690_100019262 3300005330 Bacteria 4138
25 Ga0070690_100212354 3300005330 Bacteria 1352
26 Ga0070670_100006317 3300005331 Bacteria 10030
27 Ga0070670_100006809 3300005331 Bacteria 9676
28 Ga0070670_100076130 3300005331 Bacteria 2883
29 Ga0070670_100082257 3300005331 Bacteria 2767
30 Ga0070670_100444170 3300005331 Bacteria 1149
31 Ga0070670_100471761 3300005331 Bacteria 1114
32 Ga0070670_100522873 3300005331 Bacteria 1057
33 Ga0070677_10003225 3300005333 Bacteria 5250
34 Ga0070677_10014052 3300005333 Bacteria 2811
35 Ga0070677_10082214 3300005333 Bacteria 1381
36 Ga0068869_100003638 3300005334 Bacteria 9461
37 Ga0068869_100008402 3300005334 Bacteria 6656
38 Ga0068869_100047854 3300005334 Bacteria 3090
39 Ga0068869_100051214 3300005334 Bacteria 2995
40 Ga0070666_10001424 3300005335 Bacteria 14500
41 Ga0070666_10013532 3300005335 Bacteria 5179
42 Ga0070666_10076897 3300005335 Bacteria 2278
43 Ga0070666_10232927 3300005335 Bacteria 1301
44 Ga0070666_10251072 3300005335 Bacteria 1252
45 Ga0070680_100302817 3300005336 Bacteria 1356
46 Ga0070680_101012233 3300005336 Bacteria 718
47 Ga0070682_100055241 3300005337 Bacteria 2494
48 Ga0068868_100002750 3300005338 Bacteria 12180
49 Ga0068868_100006774 3300005338 Bacteria 8140
50 Ga0068868_100011037 3300005338 Bacteria 6567
51 Ga0068868_100040170 3300005338 Bacteria 3640
52 Ga0068868_101164502 3300005338 Bacteria 712
53 Ga0070660_100000551 3300005339 Bacteria 25098
54 Ga0070660_100048969 3300005339 Bacteria 3247
55 Ga0070660_100113162 3300005339 Bacteria 2161
56 Ga0070660_100256552 3300005339 Bacteria 1427
57 Ga0070660_100387922 3300005339 Bacteria 1153
58 Ga0070660_101015659 3300005339 Bacteria 701
59 Ga0070689_100079378 3300005340 Bacteria 2574
60 Ga0070689_100279327 3300005340 Bacteria 1385
61 Ga0070661_100007142 3300005344 Bacteria 7701
62 Ga0070661_100013445 3300005344 Bacteria 5744
63 Ga0070661_100035823 3300005344 Bacteria 3606
64 Ga0070661_100041563 3300005344 Bacteria 3355
65 Ga0070661_100092316 3300005344 Bacteria 2243
66 Ga0070661_100238474 3300005344 Bacteria 1400
67 Ga0070661_101827089 3300005344 Bacteria 516
68 Ga0070668_100001406 3300005347 Bacteria 17305
69 Ga0070668_100003165 3300005347 Bacteria 12129
70 Ga0070668_100044359 3300005347 Bacteria 3412
71 Ga0070668_100047261 3300005347 Bacteria 3308
72 Ga0070668_100301473 3300005347 Bacteria 1344
73 Ga0070668_100317601 3300005347 Bacteria 1310
74 Ga0070668_100383260 3300005347 Bacteria 1197
75 Ga0070668_100914659 3300005347 Bacteria 785
76 Ga0070669_100002287 3300005353 Bacteria 13893
77 Ga0070669_100042357 3300005353 Bacteria 3313
78 Ga0070669_100377471 3300005353 Bacteria 1156
79 Ga0070675_100002082 3300005354 Bacteria 14809
80 Ga0070675_100021055 3300005354 Bacteria 5207
81 Ga0070675_100022596 3300005354 Bacteria 5025
82 Ga0070675_100032188 3300005354 Bacteria 4242
83 Ga0070675_100748439 3300005354 Bacteria 892
84 Ga0070675_101085289 3300005354 Bacteria 736
85 Ga0070671_100005547 3300005355 Bacteria 10050
86 Ga0070671_100013130 3300005355 Bacteria 6674
87 Ga0070671_100020178 3300005355 Bacteria 5432
88 Ga0070671_100058212 3300005355 Bacteria 3217
89 Ga0070671_100194496 3300005355 Bacteria 1719
90 Ga0070671_100336695 3300005355 Bacteria 1287
91 Ga0070671_100695773 3300005355 Bacteria 881
92 Ga0070671_101033111 3300005355 Bacteria 721
93 Ga0070671_101221548 3300005355 Bacteria 662
94 Ga0070674_100000659 3300005356 Bacteria 17432
95 Ga0070674_100013733 3300005356 Bacteria 5013
96 Ga0070674_100099090 3300005356 Bacteria 2119
97 Ga0070673_100001356 3300005364 Bacteria 14306
98 Ga0070673_100007946 3300005364 Bacteria 7029
99 Ga0070673_100011832 3300005364 Bacteria 5972
100 Ga0070673_100647597 3300005364 Bacteria 967
101 Ga0070673_100738552 3300005364 Bacteria 906
102 Ga0070673_100957650 3300005364 Bacteria 795
103 Ga0070673_101692088 3300005364 Bacteria 599
104 Ga0070688_100013445 3300005365 Bacteria 4615
105 Ga0070688_100837337 3300005365 Bacteria 722
106 Ga0070688_101105635 3300005365 Bacteria 634
107 Ga0070659_100000779 3300005366 Bacteria 23129
108 Ga0070659_100018637 3300005366 Bacteria 5239
109 Ga0070659_100023800 3300005366 Bacteria 4689
110 Ga0070659_100275134 3300005366 Bacteria 1400
111 Ga0070659_100343555 3300005366 Bacteria 1251
112 Ga0070659_100482661 3300005366 Bacteria 1055
113 Ga0070659_100815926 3300005366 Bacteria 812
114 Ga0070667_100000406 3300005367 Bacteria 46071
115 Ga0070667_100003532 3300005367 Bacteria 13319
116 Ga0070667_100053943 3300005367 Bacteria 3394
117 Ga0070667_100059940 3300005367 Bacteria 3221
118 Ga0070667_100080136 3300005367 Bacteria 2792
119 Ga0070667_100087714 3300005367 Bacteria 2671
120 Ga0070667_100387313 3300005367 Bacteria 1271
121 Ga0070709_10032539 3300005434 Bacteria 3145
122 Ga0070709_10328334 3300005434 Bacteria 1125
123 Ga0070714_100005077 3300005435 Bacteria 10014
124 Ga0070714_100115806 3300005435 Bacteria 2379
125 Ga0070714_100512886 3300005435 Bacteria 1144
126 Ga0070713_100000130 3300005436 Bacteria 49533
127 Ga0070713_100140230 3300005436 Bacteria 2141
128 Ga0070711_100056778 3300005439 Bacteria 2709
129 Ga0070711_101417065 3300005439 Bacteria 605
130 Ga0070705_100195599 3300005440 Bacteria 1382
131 Ga0070700_100336905 3300005441 Bacteria 1114
132 Ga0070700_101278560 3300005441 Bacteria 616
133 Ga0070708_100997082 3300005445 Bacteria 785
134 Ga0070708_101302424 3300005445 Bacteria 679
135 Ga0070663_100016715 3300005455 Bacteria 4774
136 Ga0070663_100053096 3300005455 Bacteria 2892
137 Ga0070663_100077225 3300005455 Bacteria 2437
138 Ga0070663_100183221 3300005455 Bacteria 1626
139 Ga0070663_100545131 3300005455 Bacteria 969
140 Ga0070663_101422153 3300005455 Bacteria 615
141 Ga0070678_100001796 3300005456 Bacteria 11558
142 Ga0070678_100009966 3300005456 Bacteria 5781
143 Ga0070678_100021157 3300005456 Bacteria 4284
144 Ga0070678_101611830 3300005456 Bacteria 609
145 Ga0070662_100000211 3300005457 Bacteria 34047
146 Ga0070662_100027596 3300005457 Bacteria 3943
147 Ga0070662_100074089 3300005457 Bacteria 2517
148 Ga0070662_101103762 3300005457 Bacteria 681
149 Ga0070662_101473745 3300005457 Bacteria 587
150 Ga0070681_10002421 3300005458 Bacteria 17061
151 Ga0070681_10153827 3300005458 Bacteria 2226
152 Ga0070681_10171072 3300005458 Bacteria 2094
153 Ga0070681_10188673 3300005458 Bacteria 1981
154 Ga0068867_100002050 3300005459 Bacteria 14116
155 Ga0068867_100002361 3300005459 Bacteria 13277
156 Ga0068867_100009099 3300005459 Bacteria 7008
157 Ga0068867_100075232 3300005459 Bacteria 2533
158 Ga0068867_100278648 3300005459 Bacteria 1370
159 Ga0068867_100309215 3300005459 Bacteria 1305
160 Ga0068867_100417426 3300005459 Bacteria 1136
161 Ga0070685_10011328 3300005466 Bacteria 4670
162 Ga0070707_100705744 3300005468 Bacteria 972
163 Ga0070699_100038292 3300005518 Bacteria 4151
164 Ga0070679_100006694 3300005530 Bacteria 10750
165 Ga0070679_100143875 3300005530 Bacteria 2363
166 Ga0070679_100338254 3300005530 Bacteria 1453
167 Ga0070679_100780669 3300005530 Bacteria 898
168 Ga0070684_100003917 3300005535 Bacteria 11278
169 Ga0070697_100333228 3300005536 Bacteria 1308
170 Ga0068853_100006893 3300005539 Bacteria 9070
171 Ga0068853_100035421 3300005539 Bacteria 4240
172 Ga0068853_100051166 3300005539 Bacteria 3555
173 Ga0068853_100095578 3300005539 Bacteria 2620
174 Ga0068853_100377690 3300005539 Bacteria 1323
175 Ga0068853_101066876 3300005539 Bacteria 779
176 Ga0070672_100003099 3300005543 Bacteria 10725
177 Ga0070672_100008014 3300005543 Bacteria 7216
178 Ga0070672_100062486 3300005543 Bacteria 2939
179 Ga0070672_100066179 3300005543 Bacteria 2861
180 Ga0070672_100067020 3300005543 Bacteria 2844
181 Ga0070672_100416921 3300005543 Bacteria 1153
182 Ga0070672_100511109 3300005543 Bacteria 1040
183 Ga0070672_100803947 3300005543 Bacteria 827
184 Ga0070686_100322126 3300005544 Bacteria 1153
185 Ga0070695_101221839 3300005545 Bacteria 619
186 Ga0070695_101246514 3300005545 Bacteria 613
187 Ga0070696_100017284 3300005546 Bacteria 4868
188 Ga0070693_100108418 3300005547 Bacteria 1704
189 Ga0070693_100248777 3300005547 Bacteria 1177
190 Ga0070665_100004484 3300005548 Bacteria 14665
191 Ga0070665_100006553 3300005548 Bacteria 11833
192 Ga0070665_100009685 3300005548 Bacteria 9735
193 Ga0070665_100028552 3300005548 Bacteria 5619
194 Ga0070665_100077530 3300005548 Bacteria 3330
195 Ga0070665_100201390 3300005548 Bacteria 1991
196 Ga0068855_100010927 3300005563 Bacteria 10957
197 Ga0068855_100052511 3300005563 Bacteria 4799
198 Ga0068855_100092805 3300005563 Bacteria 3481
199 Ga0068855_100148581 3300005563 Bacteria 2666
200 Ga0068855_100274735 3300005563 Bacteria 1873
201 Ga0068855_100418212 3300005563 Bacteria 1466
202 Ga0068855_100431680 3300005563 Bacteria 1440
203 Ga0068855_100505548 3300005563 Bacteria 1313
204 Ga0070664_100017006 3300005564 Bacteria 5970
205 Ga0070664_100033691 3300005564 Bacteria 4293
206 Ga0070664_100034982 3300005564 Bacteria 4216
207 Ga0070664_101297291 3300005564 Bacteria 688
208 Ga0068857_100069369 3300005577 Bacteria 3139
209 Ga0068857_100071664 3300005577 Bacteria 3087
210 Ga0068857_101300655 3300005577 Bacteria 706
211 Ga0068857_101616329 3300005577 Bacteria 633
212 Ga0068854_100048212 3300005578 Bacteria 3039
213 Ga0068854_100253011 3300005578 Bacteria 1407
214 Ga0068854_101062186 3300005578 Bacteria 720
215 Ga0068856_100004235 3300005614 Bacteria 14328
216 Ga0068856_100010690 3300005614 Bacteria 8917
217 Ga0068856_100193547 3300005614 Bacteria 2047
218 Ga0068856_100391308 3300005614 Bacteria 1410
219 Ga0070702_100301479 3300005615 Bacteria 1109
220 Ga0068852_100003693 3300005616 Bacteria 10727
221 Ga0068852_100010012 3300005616 Bacteria 7055
222 Ga0068852_100014944 3300005616 Bacteria 6000
223 Ga0068852_100063346 3300005616 Bacteria 3219
224 Ga0068852_101167920 3300005616 Bacteria 791
225 Ga0068852_101277301 3300005616 Bacteria 756
226 Ga0068859_100000527 3300005617 Bacteria 37976
227 Ga0068859_100006056 3300005617 Bacteria 12280
228 Ga0068859_100015175 3300005617 Bacteria 7733
229 Ga0068859_101363790 3300005617 Bacteria 782
230 Ga0068864_100003597 3300005618 Bacteria 12816
231 Ga0068864_100005302 3300005618 Bacteria 10552
232 Ga0068864_100030005 3300005618 Bacteria 4609
233 Ga0068864_100238796 3300005618 Bacteria 1683
234 Ga0068864_100384001 3300005618 Bacteria 1332
235 Ga0068861_100019824 3300005719 Bacteria 4807
236 Ga0068861_100034998 3300005719 Bacteria 3717
237 Ga0068861_100036344 3300005719 Bacteria 3654
238 Ga0068861_100047556 3300005719 Bacteria 3239
239 Ga0068861_100934040 3300005719 Bacteria 824
240 Ga0068851_10001801 3300005834 Bacteria 9384
241 Ga0068851_10009400 3300005834 Bacteria 4544
242 Ga0068851_10009599 3300005834 Bacteria 4505
243 Ga0068851_10553019 3300005834 Bacteria 696
244 Ga0068870_10038529 3300005840 Bacteria 2469
245 Ga0068870_10095920 3300005840 Bacteria 1667
246 Ga0068870_10198353 3300005840 Bacteria 1215
247 Ga0068863_100003159 3300005841 Bacteria 16274
248 Ga0068863_100013286 3300005841 Bacteria 7946
249 Ga0068863_100059591 3300005841 Bacteria 3611
250 Ga0068863_100190937 3300005841 Bacteria 1968
251 Ga0068863_100747347 3300005841 Bacteria 974
252 Ga0068858_100003264 3300005842 Bacteria 16167
253 Ga0068858_100005279 3300005842 Bacteria 12662
254 Ga0068858_100057003 3300005842 Bacteria 3610
255 Ga0068858_100303808 3300005842 Bacteria 1523
256 Ga0068858_100573120 3300005842 Bacteria 1094
257 Ga0068860_100000976 3300005843 Bacteria 31714
258 Ga0068860_100001042 3300005843 Bacteria 30514
259 Ga0068860_100034620 3300005843 Bacteria 4846
260 Ga0068860_100057406 3300005843 Bacteria 3700
261 Ga0068860_100445682 3300005843 Bacteria 1287
262 Ga0068860_100752028 3300005843 Bacteria 986
263 Ga0068860_101989050 3300005843 Bacteria 603
264 Ga0068860_102089951 3300005843 Bacteria 588
265 Ga0068862_100002697 3300005844 Bacteria 15601
266 Ga0081455_10111676 3300005937 Bacteria 2171
267 Ga0081539_10009998 3300005985 Bacteria 7813
268 Ga0070715_10494719 3300006163 Bacteria 699
269 Ga0070716_100351355 3300006173 Bacteria 1044
270 Ga0070716_101039098 3300006173 Bacteria 650
271 Ga0070712_100398064 3300006175 Bacteria 1137
272 Ga0070712_100936133 3300006175 Bacteria 748
273 Ga0075369_10390072 3300006186 Bacteria 656
274 Ga0097621_100018761 3300006237 Bacteria 5293
275 Ga0097621_100333714 3300006237 Bacteria 1345
276 Ga0097621_100804923 3300006237 Bacteria 871
277 Ga0068871_100001817 3300006358 Bacteria 14403
278 Ga0068871_100007616 3300006358 Bacteria 7744
279 Ga0068871_100152018 3300006358 Bacteria 1974
280 Ga0068871_100249240 3300006358 Bacteria 1546
281 Ga0068871_100363345 3300006358 Bacteria 1283
282 Ga0068871_100627234 3300006358 Bacteria 979
283 Ga0068871_100888331 3300006358 Bacteria 825
284 Ga0075428_100332244 3300006844 Bacteria 1633
285 Ga0075430_100319170 3300006846 Bacteria 1284
286 Ga0075433_10285057 3300006852 Bacteria 1463
287 Ga0075433_11686874 3300006852 Bacteria 546
288 Ga0075434_100017475 3300006871 Bacteria 6913
289 Ga0075434_100553720 3300006871 Bacteria 1170
290 Ga0075434_100750620 3300006871 Bacteria 993
291 Ga0075429_100769971 3300006880 Bacteria 843
292 Ga0068865_100017413 3300006881 Bacteria 4621
293 Ga0068865_100035685 3300006881 Bacteria 3347
294 Ga0068865_100069512 3300006881 Bacteria 2492
295 Ga0068865_100462689 3300006881 Bacteria 1051
296 Ga0068865_100497947 3300006881 Bacteria 1015
297 Ga0068865_100612271 3300006881 Bacteria 922
298 Ga0068865_100847818 3300006881 Bacteria 791
299 Ga0075436_100025545 3300006914 Bacteria 4066
300 Ga0075436_100166189 3300006914 Bacteria 1557
301 Ga0097620_100000527 3300006931 Bacteria 37976
302 Ga0097620_100006056 3300006931 Bacteria 12280
303 Ga0097620_100015174 3300006931 Bacteria 7733
304 Ga0097620_101364163 3300006931 Bacteria 782
305 Ga0075435_100015592 3300007076 Bacteria 5717
306 Ga0075435_100209964 3300007076 Bacteria 1651
307 Ga0075435_100278836 3300007076 Bacteria 1427
308 Ga0075435_100563646 3300007076 Bacteria 987
309 Ga0075435_100644198 3300007076 Bacteria 920
310 Ga0105240_10008953 3300009093 Bacteria 14232
311 Ga0105240_10022687 3300009093 Bacteria 8317
312 Ga0105240_10495028 3300009093 Bacteria 1360
313 Ga0111539_11996554 3300009094 Bacteria 673
314 Ga0105245_10721422 3300009098 Bacteria 1031
315 Ga0105245_12481724 3300009098 Bacteria 572
316 Ga0105247_11080124 3300009101 Bacteria 632
317 Ga0114129_10682258 3300009147 Bacteria 1322
318 Ga0114129_13292340 3300009147 Bacteria 523
319 Ga0105243_10077773 3300009148 Bacteria 2699
320 Ga0105241_10015461 3300009174 Bacteria 5590
321 Ga0105241_10656610 3300009174 Bacteria 953
322 Ga0105248_10002431 3300009177 Bacteria 20666
323 Ga0105248_10007721 3300009177 Bacteria 11816
324 Ga0105248_10019006 3300009177 Bacteria 7597
325 Ga0105248_10033264 3300009177 Bacteria 5759
326 Ga0105248_10111081 3300009177 Bacteria 3091
327 Ga0105248_10277003 3300009177 Bacteria 1889
328 Ga0105248_10525587 3300009177 Bacteria 1334
329 Ga0105237_10368335 3300009545 Bacteria 1441
330 Ga0105237_11501209 3300009545 Bacteria 680
331 Ga0105237_11688791 3300009545 Bacteria 640
332 Ga0105238_10034778 3300009551 Bacteria 5125
333 Ga0105238_10549397 3300009551 Bacteria 1159
334 Ga0105249_10222105 3300009553 Bacteria 1859
335 Ga0105249_11300621 3300009553 Bacteria 799
336 Ga0105239_10057486 3300010375 Bacteria 4267
337 Ga0105246_10085830 3300011119 Bacteria 2255
338 Ga0105246_10240505 3300011119 Bacteria 1431
339 Ga0105246_10372905 3300011119 Bacteria 1177
340 Ga0157325_1023402 3300012485 Bacteria 569
341 Ga0157343_1003807 3300012488 Bacteria 905
342 Ga0157326_1003717 3300012513 Bacteria 1600
343 Ga0157373_10003956 3300013100 Bacteria 11193
344 Ga0157373_10004136 3300013100 Bacteria 10944
345 Ga0157373_10080217 3300013100 Bacteria 2301
346 Ga0157373_10270501 3300013100 Bacteria 1203
347 Ga0157373_11226372 3300013100 Bacteria 566
348 Ga0157371_10000446 3300013102 Bacteria 50636
349 Ga0157371_10179093 3300013102 Bacteria 1516
350 Ga0157371_10515985 3300013102 Bacteria 884
351 Ga0157371_10566585 3300013102 Bacteria 843
352 Ga0157370_10012128 3300013104 Bacteria 8964
353 Ga0157370_10093865 3300013104 Bacteria 2816
354 Ga0157370_10098205 3300013104 Bacteria 2747
355 Ga0157370_10192267 3300013104 Bacteria 1894
356 Ga0157370_10208493 3300013104 Bacteria 1811
357 Ga0157370_10347864 3300013104 Bacteria 1366
358 Ga0157370_11624898 3300013104 Bacteria 580
359 Ga0157369_10012261 3300013105 Bacteria 9734
360 Ga0157369_10408681 3300013105 Bacteria 1408
361 Ga0157369_10589982 3300013105 Bacteria 1147
362 Ga0157369_10666255 3300013105 Bacteria 1072
363 Ga0157369_10726265 3300013105 Bacteria 1022
364 Ga0157374_10009504 3300013296 Bacteria 8352
365 Ga0157374_10084887 3300013296 Bacteria 3010
366 Ga0157374_10246103 3300013296 Bacteria 1759
367 Ga0157374_10539888 3300013296 Bacteria 1173
368 Ga0157378_10014139 3300013297 Bacteria 6984
369 Ga0157378_10046393 3300013297 Bacteria 3863
370 Ga0157378_10372394 3300013297 Bacteria 1400
371 Ga0157378_11575904 3300013297 Bacteria 702
372 Ga0163162_10006529 3300013306 Bacteria 11298
373 Ga0163162_10043422 3300013306 Bacteria 4501
374 Ga0163162_10138414 3300013306 Bacteria 2546
375 Ga0163162_10299866 3300013306 Bacteria 1739
376 Ga0163162_10303148 3300013306 Bacteria 1730
377 Ga0163162_10314425 3300013306 Bacteria 1699
378 Ga0163162_10515419 3300013306 Bacteria 1326
379 Ga0163162_10585285 3300013306 Bacteria 1243
380 Ga0163162_10769356 3300013306 Bacteria 1081
381 Ga0157372_10000523 3300013307 Bacteria 42408
382 Ga0157372_10030913 3300013307 Bacteria 5860
383 Ga0157372_10092901 3300013307 Bacteria 3433
384 Ga0157372_10131156 3300013307 Bacteria 2884
385 Ga0157372_10300882 3300013307 Bacteria 1866
386 Ga0157372_10305617 3300013307 Bacteria 1851
387 Ga0157372_10517195 3300013307 Bacteria 1391
388 Ga0157372_10590193 3300013307 Bacteria 1295
389 Ga0157372_11428204 3300013307 Bacteria 798
390 Ga0157372_11548556 3300013307 Bacteria 763
391 Ga0157375_10002572 3300013308 Bacteria 15765
392 Ga0157375_10055728 3300013308 Bacteria 3899
393 Ga0157375_10123821 3300013308 Bacteria 2698
394 Ga0157375_11177958 3300013308 Bacteria 898
395 Ga0157375_11387302 3300013308 Bacteria 828
396 Ga0157375_11415592 3300013308 Bacteria 819
397 Ga0157375_11438786 3300013308 Bacteria 812
398 Ga0163163_10010153 3300014325 Bacteria 8449
399 Ga0163163_10162204 3300014325 Bacteria 2281
400 Ga0163163_10986437 3300014325 Bacteria 906
401 Ga0163163_13134558 3300014325 Bacteria 516
402 Ga0157380_10580775 3300014326 Bacteria 1105
403 Ga0157380_11847194 3300014326 Bacteria 664
404 Ga0182008_10000107 3300014497 Bacteria 64378
405 Ga0182008_10117288 3300014497 Bacteria 1321
406 Ga0157379_10002763 3300014968 Bacteria 14802
407 Ga0157379_10013355 3300014968 Bacteria 7192
408 Ga0157379_10020291 3300014968 Bacteria 5875
409 Ga0157379_10092851 3300014968 Bacteria 2707
410 Ga0157379_10366482 3300014968 Bacteria 1321
411 Ga0157379_12583399 3300014968 Bacteria 508
412 Ga0157376_10003007 3300014969 Bacteria 11569
413 Ga0157376_10045182 3300014969 Bacteria 3625
414 Ga0157376_10182942 3300014969 Bacteria 1917
415 Ga0157376_11075366 3300014969 Bacteria 829
416 Ga0157376_11084092 3300014969 Bacteria 826
417 Ga0163161_10015702 3300017792 Bacteria 5281
418 Ga0163161_10042182 3300017792 Bacteria 3281
419 Ga0163161_10650561 3300017792 Bacteria 873
420 Ga0206356_10546372 3300020070 Bacteria 1320
421 Ga0207697_10001270 3300025315 Bacteria 13847
422 Ga0207697_10004477 3300025315 Bacteria 6669
423 Ga0207697_10048895 3300025315 Bacteria 1745
424 Ga0207656_10002941 3300025321 Bacteria 5811
425 Ga0207656_10008891 3300025321 Bacteria 3718
426 Ga0207656_10014121 3300025321 Bacteria 3069
427 Ga0207656_10056353 3300025321 Bacteria 1713
428 Ga0207656_10308718 3300025321 Bacteria 784
429 Ga0207682_10001158 3300025893 Bacteria 12235
430 Ga0207682_10004140 3300025893 Bacteria 6142
431 Ga0207682_10265217 3300025893 Bacteria 801
432 Ga0207692_11040042 3300025898 Bacteria 541
433 Ga0207642_10490922 3300025899 Bacteria 750
434 Ga0207688_10139443 3300025901 Bacteria 1426
435 Ga0207688_10232069 3300025901 Bacteria 1114
436 Ga0207688_10272526 3300025901 Bacteria 1030
437 Ga0207688_10485466 3300025901 Bacteria 773
438 Ga0207680_10001915 3300025903 Bacteria 9760
439 Ga0207680_10010912 3300025903 Bacteria 4567
440 Ga0207680_10015863 3300025903 Bacteria 3942
441 Ga0207680_10056147 3300025903 Bacteria 2377
442 Ga0207680_10185588 3300025903 Bacteria 1409
443 Ga0207647_10158855 3300025904 Bacteria 1319
444 Ga0207699_10015910 3300025906 Bacteria 3922
445 Ga0207699_10145403 3300025906 Bacteria 1562
446 Ga0207699_10698316 3300025906 Bacteria 742
447 Ga0207645_10000519 3300025907 Bacteria 31964
448 Ga0207645_10008023 3300025907 Bacteria 7406
449 Ga0207645_10015925 3300025907 Bacteria 4983
450 Ga0207645_10021957 3300025907 Bacteria 4157
451 Ga0207645_10036864 3300025907 Bacteria 3140
452 Ga0207645_10146439 3300025907 Bacteria 1540
453 Ga0207645_10211813 3300025907 Bacteria 1276
454 Ga0207643_10102350 3300025908 Bacteria 1680
455 Ga0207705_10052596 3300025909 Bacteria 2932
456 Ga0207654_10210518 3300025911 Bacteria 1285
457 Ga0207707_10005207 3300025912 Bacteria 11396
458 Ga0207707_10016135 3300025912 Bacteria 6514
459 Ga0207707_10215310 3300025912 Bacteria 1672
460 Ga0207707_10234129 3300025912 Bacteria 1598
461 Ga0207707_10328500 3300025912 Bacteria 1320
462 Ga0207695_10007532 3300025913 Bacteria 13801
463 Ga0207695_10208220 3300025913 Bacteria 1868
464 Ga0207695_10270035 3300025913 Bacteria 1596
465 Ga0207671_11129402 3300025914 Bacteria 615
466 Ga0207693_10160135 3300025915 Bacteria 1770
467 Ga0207693_10486203 3300025915 Bacteria 964
468 Ga0207663_10028111 3300025916 Bacteria 3287
469 Ga0207663_10047577 3300025916 Bacteria 2649
470 Ga0207663_10701999 3300025916 Bacteria 801
471 Ga0207660_10012654 3300025917 Bacteria 5526
472 Ga0207660_10133674 3300025917 Bacteria 1891
473 Ga0207662_10026822 3300025918 Bacteria 3325
474 Ga0207657_10000229 3300025919 Bacteria 58709
475 Ga0207657_10008077 3300025919 Bacteria 10730
476 Ga0207657_10024320 3300025919 Bacteria 5614
477 Ga0207657_10059551 3300025919 Bacteria 3280
478 Ga0207657_10257408 3300025919 Bacteria 1390
479 Ga0207657_10305144 3300025919 Bacteria 1261
480 Ga0207657_10417554 3300025919 Bacteria 1055
481 Ga0207649_10002277 3300025920 Bacteria 10798
482 Ga0207649_10056653 3300025920 Bacteria 2448
483 Ga0207649_10222134 3300025920 Bacteria 1346
484 Ga0207649_10285769 3300025920 Bacteria 1201
485 Ga0207649_10384117 3300025920 Bacteria 1047
486 Ga0207649_11567963 3300025920 Bacteria 521
487 Ga0207652_10003991 3300025921 Bacteria 12060
488 Ga0207652_10007247 3300025921 Bacteria 8934
489 Ga0207652_10124648 3300025921 Bacteria 2294
490 Ga0207652_10131443 3300025921 Bacteria 2233
491 Ga0207652_10399812 3300025921 Bacteria 1240
492 Ga0207681_10002527 3300025923 Bacteria 11626
493 Ga0207681_10356964 3300025923 Bacteria 1171
494 Ga0207681_10460754 3300025923 Bacteria 1035
495 Ga0207681_10492627 3300025923 Bacteria 1002
496 Ga0207681_10698231 3300025923 Bacteria 843
497 Ga0207694_10028324 3300025924 Bacteria 4270
498 Ga0207694_10579037 3300025924 Bacteria 943
499 Ga0207650_10002190 3300025925 Bacteria 13657
500 Ga0207650_10016761 3300025925 Bacteria 5124
501 Ga0207650_10026509 3300025925 Bacteria 4135
502 Ga0207650_10213979 3300025925 Bacteria 1549
503 Ga0207650_10386519 3300025925 Bacteria 1156
504 Ga0207650_10432081 3300025925 Bacteria 1094
505 Ga0207659_10002335 3300025926 Bacteria 11288
506 Ga0207659_10002707 3300025926 Bacteria 10560
507 Ga0207659_10007428 3300025926 Bacteria 6736
508 Ga0207659_10109419 3300025926 Bacteria 2098
509 Ga0207659_10666030 3300025926 Bacteria 890
510 Ga0207659_10802356 3300025926 Bacteria 809
511 Ga0207659_11149511 3300025926 Bacteria 668
512 Ga0207687_10602065 3300025927 Bacteria 926
513 Ga0207700_10000536 3300025928 Bacteria 22231
514 Ga0207700_10222032 3300025928 Bacteria 1602
515 Ga0207664_10006738 3300025929 Bacteria 7934
516 Ga0207664_10071003 3300025929 Bacteria 2804
517 Ga0207644_10000405 3300025931 Bacteria 28099
518 Ga0207644_10054422 3300025931 Bacteria 2882
519 Ga0207644_10116881 3300025931 Bacteria 2024
520 Ga0207644_10266450 3300025931 Bacteria 1371
521 Ga0207644_10858433 3300025931 Bacteria 760
522 Ga0207644_10908943 3300025931 Bacteria 738
523 Ga0207644_10952388 3300025931 Bacteria 720
524 Ga0207644_11557781 3300025931 Bacteria 554
525 Ga0207690_10000348 3300025932 Bacteria 30788
526 Ga0207690_10006051 3300025932 Bacteria 7165
527 Ga0207690_10035029 3300025932 Bacteria 3238
528 Ga0207690_10220567 3300025932 Bacteria 1451
529 Ga0207690_10346607 3300025932 Bacteria 1173
530 Ga0207690_10821926 3300025932 Bacteria 768
531 Ga0207706_10000045 3300025933 Bacteria 120758
532 Ga0207706_10023713 3300025933 Bacteria 5507
533 Ga0207706_10064814 3300025933 Bacteria 3217
534 Ga0207706_10223524 3300025933 Bacteria 1648
535 Ga0207709_10000130 3300025935 Bacteria 110843
536 Ga0207709_10227944 3300025935 Bacteria 1348
537 Ga0207709_10507096 3300025935 Bacteria 942
538 Ga0207670_10250880 3300025936 Bacteria 1368
539 Ga0207669_10010494 3300025937 Bacteria 4463
540 Ga0207669_10010707 3300025937 Bacteria 4427
541 Ga0207669_10791340 3300025937 Bacteria 786
542 Ga0207704_10226291 3300025938 Bacteria 1388
543 Ga0207665_10009812 3300025939 Bacteria 6286
544 Ga0207665_10739723 3300025939 Bacteria 775
545 Ga0207691_10000310 3300025940 Bacteria 48478
546 Ga0207691_10000629 3300025940 Bacteria 34886
547 Ga0207691_10036678 3300025940 Bacteria 4543
548 Ga0207691_10050344 3300025940 Bacteria 3814
549 Ga0207691_10075011 3300025940 Bacteria 3050
550 Ga0207691_10085085 3300025940 Bacteria 2838
551 Ga0207691_10147467 3300025940 Bacteria 2070
552 Ga0207691_10358075 3300025940 Bacteria 1248
553 Ga0207711_10011574 3300025941 Bacteria 7334
554 Ga0207711_10162511 3300025941 Bacteria 2022
555 Ga0207711_10174265 3300025941 Bacteria 1953
556 Ga0207711_10181192 3300025941 Bacteria 1916
557 Ga0207711_10279790 3300025941 Bacteria 1536
558 Ga0207711_10322829 3300025941 Bacteria 1427
559 Ga0207689_10004985 3300025942 Bacteria 11959
560 Ga0207689_10005921 3300025942 Bacteria 10828
561 Ga0207689_10013147 3300025942 Bacteria 7063
562 Ga0207689_10067966 3300025942 Bacteria 2928
563 Ga0207661_10074070 3300025944 Bacteria 2790
564 Ga0207661_10172727 3300025944 Bacteria 1882
565 Ga0207661_10502796 3300025944 Bacteria 1107
566 Ga0207661_11639973 3300025944 Bacteria 588
567 Ga0207679_10003526 3300025945 Bacteria 9684
568 Ga0207679_10011829 3300025945 Bacteria 5671
569 Ga0207679_10024632 3300025945 Bacteria 4128
570 Ga0207679_10049245 3300025945 Bacteria 3073
571 Ga0207679_10051924 3300025945 Bacteria 3004
572 Ga0207679_10154259 3300025945 Bacteria 1873
573 Ga0207679_10781540 3300025945 Bacteria 870
574 Ga0207679_10859607 3300025945 Bacteria 829
575 Ga0207667_10002826 3300025949 Bacteria 21544
576 Ga0207667_10003469 3300025949 Bacteria 19459
577 Ga0207667_10033290 3300025949 Bacteria 5543
578 Ga0207667_10046141 3300025949 Bacteria 4614
579 Ga0207667_10105193 3300025949 Bacteria 2912
580 Ga0207667_10113256 3300025949 Bacteria 2797
581 Ga0207667_10172367 3300025949 Bacteria 2224
582 Ga0207667_10435293 3300025949 Bacteria 1334
583 Ga0207667_11254987 3300025949 Bacteria 719
584 Ga0207667_11710818 3300025949 Bacteria 595
585 Ga0207651_10001764 3300025960 Bacteria 10031
586 Ga0207651_10005532 3300025960 Bacteria 6501
587 Ga0207651_10017237 3300025960 Bacteria 4261
588 Ga0207651_10053586 3300025960 Bacteria 2758
589 Ga0207651_10091138 3300025960 Bacteria 2231
590 Ga0207651_10150139 3300025960 Bacteria 1812
591 Ga0207651_10176290 3300025960 Bacteria 1691
592 Ga0207712_10151247 3300025961 Bacteria 1793
593 Ga0207712_10201372 3300025961 Bacteria 1579
594 Ga0207668_10003264 3300025972 Bacteria 9507
595 Ga0207668_10005981 3300025972 Bacteria 7173
596 Ga0207668_10013879 3300025972 Bacteria 4974
597 Ga0207668_10077542 3300025972 Bacteria 2396
598 Ga0207668_10186950 3300025972 Bacteria 1638
599 Ga0207668_10221403 3300025972 Bacteria 1520
600 Ga0207668_10258794 3300025972 Bacteria 1417
601 Ga0207668_10327768 3300025972 Bacteria 1273
602 Ga0207668_10683607 3300025972 Bacteria 901
603 Ga0207640_10019747 3300025981 Bacteria 3987
604 Ga0207640_10056577 3300025981 Bacteria 2576
605 Ga0207640_10063512 3300025981 Bacteria 2454
606 Ga0207640_10266043 3300025981 Bacteria 1339
607 Ga0207640_10458887 3300025981 Bacteria 1052
608 Ga0207640_10890569 3300025981 Bacteria 777
609 Ga0207658_10008951 3300025986 Bacteria 6790
610 Ga0207658_10024238 3300025986 Bacteria 4243
611 Ga0207658_10035070 3300025986 Bacteria 3591
612 Ga0207658_10052049 3300025986 Bacteria 3020
613 Ga0207658_10104528 3300025986 Bacteria 2226
614 Ga0207658_10323597 3300025986 Bacteria 1335
615 Ga0207658_10336284 3300025986 Bacteria 1311
616 Ga0207677_10005183 3300026023 Bacteria 7053
617 Ga0207677_10011855 3300026023 Bacteria 4988
618 Ga0207677_10017625 3300026023 Bacteria 4264
619 Ga0207677_10622437 3300026023 Bacteria 949
620 Ga0207677_10784901 3300026023 Bacteria 852
621 Ga0207703_10002568 3300026035 Bacteria 15692
622 Ga0207703_10005921 3300026035 Bacteria 9800
623 Ga0207703_10007291 3300026035 Bacteria 8791
624 Ga0207703_10515556 3300026035 Bacteria 1124
625 Ga0207639_10008842 3300026041 Bacteria 6925
626 Ga0207639_10018465 3300026041 Bacteria 4956
627 Ga0207639_10030631 3300026041 Bacteria 3947
628 Ga0207639_10066846 3300026041 Bacteria 2796
629 Ga0207639_10316610 3300026041 Bacteria 1384
630 Ga0207639_10655600 3300026041 Bacteria 971
631 Ga0207639_10991470 3300026041 Bacteria 787
632 Ga0207639_12189938 3300026041 Bacteria 514
633 Ga0207678_10001996 3300026067 Bacteria 18581
634 Ga0207678_10010760 3300026067 Bacteria 8038
635 Ga0207678_10028712 3300026067 Bacteria 4856
636 Ga0207678_10032115 3300026067 Bacteria 4577
637 Ga0207678_10104144 3300026067 Bacteria 2421
638 Ga0207678_10934802 3300026067 Bacteria 767
639 Ga0207708_10304201 3300026075 Bacteria 1298
640 Ga0207708_10575052 3300026075 Bacteria 952
641 Ga0207702_10000715 3300026078 Bacteria 35679
642 Ga0207702_10027561 3300026078 Bacteria 4718
643 Ga0207702_10056652 3300026078 Bacteria 3328
644 Ga0207702_10192135 3300026078 Bacteria 1887
645 Ga0207702_10423446 3300026078 Bacteria 1288
646 Ga0207702_10815600 3300026078 Bacteria 923
647 Ga0207702_11361539 3300026078 Bacteria 704
648 Ga0207641_10001932 3300026088 Bacteria 19887
649 Ga0207641_10036346 3300026088 Bacteria 4111
650 Ga0207641_10056891 3300026088 Bacteria 3325
651 Ga0207641_10084073 3300026088 Bacteria 2770
652 Ga0207641_10101932 3300026088 Bacteria 2530
653 Ga0207641_10512363 3300026088 Bacteria 1166
654 Ga0207641_10731971 3300026088 Bacteria 975
655 Ga0207648_10000364 3300026089 Bacteria 49697
656 Ga0207648_10002230 3300026089 Bacteria 20980
657 Ga0207648_10003344 3300026089 Bacteria 16855
658 Ga0207648_10083123 3300026089 Bacteria 2792
659 Ga0207648_10484980 3300026089 Bacteria 1129
660 Ga0207676_10003751 3300026095 Bacteria 10735
661 Ga0207676_10007800 3300026095 Bacteria 7613
662 Ga0207676_10014659 3300026095 Bacteria 5645
663 Ga0207676_10093737 3300026095 Bacteria 2472
664 Ga0207674_10000225 3300026116 Bacteria 70648
665 Ga0207674_10015172 3300026116 Bacteria 8478
666 Ga0207674_10030050 3300026116 Bacteria 5716
667 Ga0207674_10400935 3300026116 Bacteria 1326
668 Ga0207675_100018204 3300026118 Bacteria 6549
669 Ga0207675_100025976 3300026118 Bacteria 5450
670 Ga0207675_100040300 3300026118 Bacteria 4361
671 Ga0207675_100863415 3300026118 Bacteria 920
672 Ga0207675_101071826 3300026118 Bacteria 825
673 Ga0207675_101135948 3300026118 Bacteria 801
674 Ga0207683_10000076 3300026121 Bacteria 77762
675 Ga0207683_10000121 3300026121 Bacteria 64376
676 Ga0207683_10005699 3300026121 Bacteria 10686
677 Ga0207683_10016965 3300026121 Bacteria 6198
678 Ga0207698_10004376 3300026142 Bacteria 8601
679 Ga0207698_10007522 3300026142 Bacteria 6827
680 Ga0207698_10015072 3300026142 Bacteria 5165
681 Ga0207698_10105034 3300026142 Bacteria 2352
682 Ga0207698_10587420 3300026142 Bacteria 1096
683 Ga0210002_1019853 3300027617 Bacteria 1080
684 Ga0209974_10072542 3300027876 Bacteria 1176
685 Ga0268266_10028455 3300028379 Bacteria 4750
686 Ga0268266_10040095 3300028379 Bacteria 3990
687 Ga0268266_10072189 3300028379 Bacteria 2992
688 Ga0268266_10516993 3300028379 Bacteria 1141
689 Ga0268265_10181670 3300028380 Bacteria 1808
690 Ga0268265_10692258 3300028380 Bacteria 984
691 Ga0268265_11012437 3300028380 Bacteria 821
692 Ga0268264_10000967 3300028381 Bacteria 29459
693 Ga0268264_10007545 3300028381 Bacteria 9076
694 Ga0268264_10065017 3300028381 Bacteria 3071
695 Ga0268264_10256884 3300028381 Bacteria 1626
696 Ga0268264_10621648 3300028381 Bacteria 1067
697 Ga0268264_10678333 3300028381 Bacteria 1022
698 Ga0307509_10282087 3300031507 Bacteria 1422
699 Ga0307509_10430403 3300031507 Bacteria 1018
700 Ga0307408_100064934 3300031548 Bacteria 2675
701 Ga0307516_10000138 3300031730 Bacteria 87604
702 Ga0307405_10058582 3300031731 Bacteria 2424
703 Ga0307405_11366801 3300031731 Bacteria 618
704 Ga0307410_10039366 3300031852 Bacteria 3103
705 Ga0307406_10127050 3300031901 Bacteria 1783
706 Ga0307406_10966201 3300031901 Bacteria 729
707 Ga0307412_10045789 3300031911 Bacteria 2862
708 Ga0307409_100006788 3300031995 Bacteria 6771
709 Ga0307416_100245809 3300032002 Bacteria 1737
710 Ga0307416_100343170 3300032002 Bacteria 1507
711 Ga0307414_10205034 3300032004 Bacteria 1607
712 Ga0307411_10019396 3300032005 Bacteria 3928
713 Ga0307415_100007976 3300032126 Bacteria 5836
714 Ga0373948_0049468 3300034817 Bacteria 900
715 Ga0373958_0077024 3300034819 Bacteria 749
716 Ga0373926_0181431 3300035083 Bacteria 807
717 Ga0373945_0224210 3300035116 Bacteria 787
718 Ga0373954_0174717 3300035118 Bacteria 1053
719 Ga0373957_0195685 3300035120 Bacteria 841
720 Ga0373943_0169166 3300035170 Bacteria 1195
721 Ga0373946_0080264 3300035171 Bacteria 1427
722 Ga0373961_0116190 3300035241 Bacteria 882
723 Ga0373931_0148638 3300035691 Bacteria 1364
724 Ga0373931_0596967 3300035691 Bacteria 721
725 Ga0373935_0058920 3300035692 Bacteria 2453
726 Ga0373935_0889885 3300035692 Bacteria 659
727 Ga0373927_0001525 3300035695 Bacteria 17425
728 Ga0373927_0256857 3300035695 Bacteria 1149
729 Ga0373933_0599995 3300035724 Bacteria 723
730 Ga0373947_0401072 3300035725 Bacteria 925
731 Ga0373947_1167743 3300035725 Bacteria 524
732 Ga0373937_0165958 3300036401 Bacteria 2071
733 Ga0373937_0692006 3300036401 Bacteria 966
734 Ga0373937_1879298 3300036401 Bacteria 545
735 Ga0373925_0022631 3300037068 Bacteria 4586
736 Ga0373925_0023008 3300037068 Bacteria 4548
737 Ga0373925_0034090 3300037068 Bacteria 3752
738 Ga0373925_0049574 3300037068 Bacteria 3130
739 Ga0373925_0236453 3300037068 Bacteria 1462
740 Ga0395899_0275335 3300037312 Bacteria 1147
741 Ga0395900_0035910 3300037418 Bacteria 5107
742 Ga0395900_0542778 3300037418 Bacteria 1108
743 Ga0395898_0058539 3300037466 Bacteria 3751
744 Ga0395898_1433034 3300037466 Bacteria 618
745 Ga0395905_0020317 3300037471 Bacteria 6291
746 Ga0395905_0958466 3300037471 Bacteria 758
747 Ga0395901_0254916 3300038443 Bacteria 1827
748 Ga0395901_0401510 3300038443 Bacteria 1408
749 Ga0242420_065050 3300038996 Bacteria 733
750 Ga0451798_1003561 3300041458 Bacteria 598
751 Ga0451802_0595318 3300041460 Bacteria 878
752 Ga0451835_0250944 3300041492 Bacteria 605
753 Ga0451849_0660544 3300041505 Bacteria 654
754 Ga0451849_0959626 3300041505 Bacteria 736
755 Ga0451853_1750809 3300041512 Bacteria 810
756 Ga0451853_3081903 3300041512 Bacteria 725
757 Ga0439458_0059704 3300042157 Bacteria 951
758 Ga0466963_0767749 3300044694 Bacteria 680
759 Ga0453684_0238511 3300044712 Bacteria 2095
760 Ga0453684_1072153 3300044712 Bacteria 853
761 Ga0466968_0010602 3300044735 Bacteria 3577
762 Ga0466957_0757849 3300044842 Bacteria 688
763 Ga0451576_1087686 3300045051 Bacteria 837
764 Ga0466958_0241512 3300045836 Bacteria 1154
765 Ga0466967_2261541 3300045976 Bacteria 539
766 Ga0495629_0302645 3300046459 Bacteria 1095
767 Ga0495580_0092998 3300046472 Bacteria 2099
768 Ga0495580_0540959 3300046472 Bacteria 774
769 Ga0495588_0192217 3300046674 Bacteria 1078
770 Ga0495647_0441462 3300046681 Bacteria 601
771 Ga0495658_0384686 3300046683 Bacteria 894
772 Ga0496100_0159488 3300048903 Bacteria 1616
773 Ga0496100_0551114 3300048903 Bacteria 892
774 Ga0496101_0082914 3300048904 Bacteria 2373
775 Ga0496101_0269512 3300048904 Bacteria 1329
776 Ga0496101_0379714 3300048904 Bacteria 1112
777 Ga0496101_0455942 3300048904 Bacteria 1009
778 Ga0496102_0062700 3300048905 Bacteria 3404
779 Ga0496102_0078545 3300048905 Bacteria 3038
780 Ga0496102_0179141 3300048905 Bacteria 1996
781 Ga0496103_0035997 3300048906 Bacteria 3031
782 Ga0496103_0043380 3300048906 Bacteria 2769
783 Ga0496104_0006095 3300048907 Bacteria 10582
784 Ga0496104_0797096 3300048907 Bacteria 851
785 Ga0496105_0573641 3300048908 Bacteria 878
786 Ga0496106_0000931 3300048909 Bacteria 21318
787 Ga0496106_0098618 3300048909 Bacteria 2264
788 Ga0496106_0460274 3300048909 Bacteria 1022
789 Ga0496107_0139594 3300048910 Bacteria 1791
790 Ga0496107_0312216 3300048910 Bacteria 1170
791 Ga0496107_0570980 3300048910 Bacteria 837
792 Ga0496108_0009652 3300048911 Bacteria 7823
793 Ga0496108_0093485 3300048911 Bacteria 2558
794 Ga0496108_0312849 3300048911 Bacteria 1368
795 Ga0496108_0686565 3300048911 Bacteria 888
796 Ga0496109_0028312 3300048912 Bacteria 5010
797 Ga0496109_0229782 3300048912 Bacteria 1745
798 Ga0496110_0005169 3300048913 Bacteria 10205
799 Ga0496110_0330460 3300048913 Bacteria 1389
800 Ga0496111_0092906 3300048914 Bacteria 2212
801 Ga0496111_0133240 3300048914 Bacteria 1840
802 Ga0496113_0136992 3300048916 Bacteria 1924
803 Ga0496121_0822578 3300048924 Bacteria 543
804 Ga0496124_0002098 3300048927 Bacteria 26914
805 Ga0496125_0019440 3300048928 Bacteria 6405
806 Ga0501034_0164865 3300049571 Bacteria 2185
807 Ga0501042_0820392 3300049578 Bacteria 677
808 Ga0501047_0098402 3300049581 Bacteria 2804
809 Ga0501067_0045931 3300049583 Bacteria 2424
810 Ga0501067_0339975 3300049583 Bacteria 836
811 Ga0501069_0179365 3300049585 Bacteria 1224
812 Ga0501070_0021038 3300049586 Bacteria 5473
813 Ga0501072_0009398 3300049588 Bacteria 7435
814 Ga0501073_0079480 3300049589 Bacteria 2282
815 Ga0501074_0006516 3300049590 Bacteria 8429
816 Ga0501080_0003414 3300049742 Bacteria 14003
817 Ga0501083_0026063 3300049744 Bacteria 4044
818 Ga0501035_0303704 3300049822 Bacteria 1344
819 Ga0501044_0168927 3300049823 Bacteria 2160
820 nmdc:mga03683_268756_c1 3300050489 Bacteria 795
821 nmdc:mga05p37_246019_c1 3300050507 Bacteria 2147
822 nmdc:mga08y16_1377663_c1 3300050511 Bacteria 669
823 nmdc:mga08y16_1669785_c1 3300050511 Bacteria 593
824 nmdc:mga0n895_2239954_c1 3300050512 Bacteria 501
825 nmdc:mga0n895_352208_c1 3300050512 Bacteria 1491
826 nmdc:mga0n895_362172_c1 3300050512 Bacteria 1468
827 nmdc:mga0n895_8616_c1 3300050512 Bacteria 8847
828 nmdc:mga0rr50_283924_c1 3300050513 Bacteria 1382
829 nmdc:mga0rr50_630279_c1 3300050513 Bacteria 914
830 nmdc:mga0rr50_65083_c1 3300050513 Bacteria 2760
831 nmdc:mga08x19_24644_c1 3300050514 Bacteria 3742
832 nmdc:mga08x19_367453_c1 3300050514 Bacteria 1006
833 nmdc:mga08x19_81935_c1 3300050514 Bacteria 2119
834 nmdc:mga0a205_1260788_c1 3300050515 Bacteria 587
835 nmdc:mga0a205_13153_c1 3300050515 Bacteria 7687
836 nmdc:mga0a205_419155_c1 3300050515 Bacteria 1201
837 Ga0495601_0361601 3300053077 Bacteria 943
838 Ga0495612_0576059 3300053078 Bacteria 519
839 Ga0500561_0012267 3300053137 Bacteria 1824
840 Ga0500627_0146474 3300053158 Bacteria 1067
841 Ga0501084_0247834 3300054114 Bacteria 1504
842 Ga0590071_011345 3300059421 Bacteria 2085
843 Ga0590075_059976 3300059424 Bacteria 980
844 Ga0587067_026936 3300059640 Bacteria 1033
845 Ga0587071_052560 3300060344 Bacteria 846

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035120 Ga0373957_0195685 Ga0373957_0195685_10_366 103
2 3300035170 Ga0373943_0169166 Ga0373943_0169166_11_367 103
3 3300037068 Ga0373925_0022631 Ga0373925_0022631_11_367 103
4 3300053078 Ga0495612_0576059 Ga0495612_0576059_13_369 103
5 3300041505 Ga0451849_0959626 Ga0451849_0959626_11_394 112
6 3300013100 Ga0157373_11226372 Ga0157373_112263721 113
7 3300013105 Ga0157369_10589982 Ga0157369_105899823 118
8 3300035116 Ga0373945_0224210 Ga0373945_0224210_58_483 119
9 3300035171 Ga0373946_0080264 Ga0373946_0080264_155_580 119
10 3300035692 Ga0373935_0058920 Ga0373935_0058920_52_477 119
11 3300036401 Ga0373937_0165958 Ga0373937_0165958_1353_1778 119
12 3300037068 Ga0373925_0049574 Ga0373925_0049574_134_559 119
13 3300041505 Ga0451849_0660544 Ga0451849_0660544_118_546 120
14 3300005336 Ga0070680_101012233 Ga0070680_1010122331 121
15 3300005435 Ga0070714_100512886 Ga0070714_1005128862 121
16 3300005543 Ga0070672_100416921 Ga0070672_1004169212 121
17 3300005563 Ga0068855_100092805 Ga0068855_1000928052 121
18 3300005563 Ga0068855_100148581 Ga0068855_1001485812 121
19 3300005614 Ga0068856_100193547 Ga0068856_1001935472 121
20 3300006173 Ga0070716_101039098 Ga0070716_1010390982 121
21 3300006914 Ga0075436_100166189 Ga0075436_1001661892 121
22 3300007076 Ga0075435_100563646 Ga0075435_1005636462 121
23 3300009093 Ga0105240_10495028 Ga0105240_104950283 121
24 3300013105 Ga0157369_10666255 Ga0157369_106662552 121
25 3300013307 Ga0157372_11428204 Ga0157372_114282042 121
26 3300013308 Ga0157375_11438786 Ga0157375_114387862 121
27 3300025906 Ga0207699_10145403 Ga0207699_101454032 121
28 3300025913 Ga0207695_10270035 Ga0207695_102700352 121
29 3300025929 Ga0207664_10071003 Ga0207664_100710034 121
30 3300025939 Ga0207665_10739723 Ga0207665_107397232 121
31 3300025940 Ga0207691_10358075 Ga0207691_103580752 121
32 3300025949 Ga0207667_10033290 Ga0207667_100332905 121
33 3300025981 Ga0207640_10458887 Ga0207640_104588872 121
34 3300026078 Ga0207702_10192135 Ga0207702_101921353 121
35 3300028381 Ga0268264_10621648 Ga0268264_106216482 121
36 3300035241 Ga0373961_0116190 Ga0373961_0116190_196_639 121
37 3300049822 Ga0501035_0303704 Ga0501035_0303704_441_854 121
38 3300050512 nmdc:mga0n895_2239954_c1 nmdc:mga0n895_2239954_c1_21_449 121
39 3300050514 nmdc:mga08x19_81935_c1 nmdc:mga08x19_81935_c1_339_767 121
40 3300049578 Ga0501042_0820392 Ga0501042_0820392_101_532 122
41 3300005445 Ga0070708_101302424 Ga0070708_1013024242 123
42 3300005459 Ga0068867_100417426 Ga0068867_1004174262 123
43 3300006358 Ga0068871_100152018 Ga0068871_1001520183 123
44 3300041512 Ga0451853_1750809 Ga0451853_1750809_114_542 123
45 3300005339 Ga0070660_100048969 Ga0070660_1000489694 124
46 3300005366 Ga0070659_100815926 Ga0070659_1008159261 124
47 3300012488 Ga0157343_1003807 Ga0157343_10038072 124
48 3300013105 Ga0157369_10408681 Ga0157369_104086812 124
49 3300013307 Ga0157372_10300882 Ga0157372_103008822 124
50 3300025919 Ga0207657_10059551 Ga0207657_100595514 124
51 3300025920 Ga0207649_10285769 Ga0207649_102857692 124
52 3300025932 Ga0207690_10821926 Ga0207690_108219261 124
53 3300031507 Ga0307509_10430403 Ga0307509_104304032 124
54 3300036401 Ga0373937_1879298 Ga0373937_1879298_39_473 124
55 3300048910 Ga0496107_0570980 Ga0496107_0570980_164_595 124
56 3300053137 Ga0500561_0012267 Ga0500561_0012267_1242_1664 124
57 3300005328 Ga0070676_10051342 Ga0070676_100513423 125
58 3300005331 Ga0070670_100006317 Ga0070670_1000063178 125
59 3300005331 Ga0070670_100471761 Ga0070670_1004717612 125
60 3300005334 Ga0068869_100047854 Ga0068869_1000478542 125
61 3300005338 Ga0068868_101164502 Ga0068868_1011645022 125
62 3300005344 Ga0070661_101827089 Ga0070661_1018270891 125
63 3300005354 Ga0070675_100021055 Ga0070675_1000210556 125
64 3300005355 Ga0070671_100336695 Ga0070671_1003366952 125
65 3300005364 Ga0070673_101692088 Ga0070673_1016920881 125
66 3300005445 Ga0070708_100997082 Ga0070708_1009970822 125
67 3300005457 Ga0070662_101473745 Ga0070662_1014737451 125
68 3300005459 Ga0068867_100075232 Ga0068867_1000752322 125
69 3300005536 Ga0070697_100333228 Ga0070697_1003332281 125
70 3300005543 Ga0070672_100067020 Ga0070672_1000670202 125
71 3300005563 Ga0068855_100052511 Ga0068855_1000525114 125
72 3300005577 Ga0068857_101616329 Ga0068857_1016163292 125
73 3300006852 Ga0075433_11686874 Ga0075433_116868741 125
74 3300006871 Ga0075434_100017475 Ga0075434_1000174753 125
75 3300006914 Ga0075436_100025545 Ga0075436_1000255455 125
76 3300007076 Ga0075435_100015592 Ga0075435_1000155925 125
77 3300009147 Ga0114129_10682258 Ga0114129_106822582 125
78 3300009148 Ga0105243_10077773 Ga0105243_100777735 125
79 3300009551 Ga0105238_10549397 Ga0105238_105493972 125
80 3300011119 Ga0105246_10372905 Ga0105246_103729053 125
81 3300014968 Ga0157379_12583399 Ga0157379_125833991 125
82 3300025907 Ga0207645_10146439 Ga0207645_101464392 125
83 3300025919 Ga0207657_10257408 Ga0207657_102574082 125
84 3300025925 Ga0207650_10016761 Ga0207650_100167612 125
85 3300025925 Ga0207650_10432081 Ga0207650_104320812 125
86 3300025926 Ga0207659_10109419 Ga0207659_101094193 125
87 3300025931 Ga0207644_10952388 Ga0207644_109523882 125
88 3300025935 Ga0207709_10227944 Ga0207709_102279443 125
89 3300025939 Ga0207665_10009812 Ga0207665_100098127 125
90 3300025940 Ga0207691_10036678 Ga0207691_100366783 125
91 3300025942 Ga0207689_10067966 Ga0207689_100679664 125
92 3300025949 Ga0207667_10046141 Ga0207667_100461414 125
93 3300025960 Ga0207651_10091138 Ga0207651_100911382 125
94 3300026023 Ga0207677_10622437 Ga0207677_106224372 125
95 3300026089 Ga0207648_10484980 Ga0207648_104849802 125
96 3300026116 Ga0207674_10400935 Ga0207674_104009352 125
97 3300026142 Ga0207698_10105034 Ga0207698_101050341 125
98 3300041458 Ga0451798_1003561 Ga0451798_1003561_51_482 125
99 3300041460 Ga0451802_0595318 Ga0451802_0595318_423_854 125
100 3300046472 Ga0495580_0540959 Ga0495580_0540959_328_756 125
101 3300048927 Ga0496124_0002098 Ga0496124_0002098_1904_2329 125
102 3300048928 Ga0496125_0019440 Ga0496125_0019440_3364_3789 125
103 3300050507 nmdc:mga05p37_246019_c1 nmdc:mga05p37_246019_c1_361_789 125
104 3300050511 nmdc:mga08y16_1377663_c1 nmdc:mga08y16_1377663_c1_109_543 125
105 3300050512 nmdc:mga0n895_8616_c1 nmdc:mga0n895_8616_c1_2790_3218 125
106 3300050513 nmdc:mga0rr50_65083_c1 nmdc:mga0rr50_65083_c1_802_1230 125
107 3300050514 nmdc:mga08x19_24644_c1 nmdc:mga08x19_24644_c1_1498_1926 125
108 3300050515 nmdc:mga0a205_1260788_c1 nmdc:mga0a205_1260788_c1_76_510 125
109 3300050515 nmdc:mga0a205_13153_c1 nmdc:mga0a205_13153_c1_4211_4639 125
110 3300053158 Ga0500627_0146474 Ga0500627_0146474_597_1022 125
111 3300059424 Ga0590075_059976 Ga0590075_059976_539_964 125
112 3300002239 JGI24034J26672_10073748 JGI24034J26672_100737481 126
113 3300003322 rootL2_10104466 rootL2_101044663 126
114 3300005288 Ga0065714_10344125 Ga0065714_103441251 126
115 3300005328 Ga0070676_10001268 Ga0070676_100012686 126
116 3300005328 Ga0070676_10022429 Ga0070676_100224295 126
117 3300005331 Ga0070670_100444170 Ga0070670_1004441702 126
118 3300005331 Ga0070670_100522873 Ga0070670_1005228732 126
119 3300005333 Ga0070677_10014052 Ga0070677_100140523 126
120 3300005334 Ga0068869_100008402 Ga0068869_1000084025 126
121 3300005335 Ga0070666_10001424 Ga0070666_100014248 126
122 3300005335 Ga0070666_10013532 Ga0070666_100135323 126
123 3300005336 Ga0070680_100302817 Ga0070680_1003028172 126
124 3300005338 Ga0068868_100002750 Ga0068868_10000275012 126
125 3300005338 Ga0068868_100006774 Ga0068868_1000067742 126
126 3300005344 Ga0070661_100092316 Ga0070661_1000923165 126
127 3300005347 Ga0070668_100001406 Ga0070668_1000014069 126
128 3300005347 Ga0070668_100003165 Ga0070668_10000316510 126
129 3300005353 Ga0070669_100002287 Ga0070669_1000022878 126
130 3300005353 Ga0070669_100377471 Ga0070669_1003774712 126
131 3300005354 Ga0070675_100002082 Ga0070675_10000208214 126
132 3300005354 Ga0070675_100022596 Ga0070675_1000225965 126
133 3300005355 Ga0070671_100005547 Ga0070671_1000055478 126
134 3300005355 Ga0070671_100013130 Ga0070671_1000131304 126
135 3300005356 Ga0070674_100000659 Ga0070674_10000065915 126
136 3300005356 Ga0070674_100013733 Ga0070674_1000137336 126
137 3300005364 Ga0070673_100001356 Ga0070673_10000135614 126
138 3300005364 Ga0070673_100007946 Ga0070673_1000079462 126
139 3300005365 Ga0070688_101105635 Ga0070688_1011056351 126
140 3300005367 Ga0070667_100003532 Ga0070667_1000035328 126
141 3300005367 Ga0070667_100080136 Ga0070667_1000801364 126
142 3300005367 Ga0070667_100387313 Ga0070667_1003873131 126
143 3300005436 Ga0070713_100000130 Ga0070713_1000001305 126
144 3300005439 Ga0070711_101417065 Ga0070711_1014170651 126
145 3300005455 Ga0070663_100183221 Ga0070663_1001832212 126
146 3300005456 Ga0070678_100001796 Ga0070678_1000017967 126
147 3300005456 Ga0070678_100009966 Ga0070678_1000099663 126
148 3300005458 Ga0070681_10002421 Ga0070681_100024216 126
149 3300005458 Ga0070681_10171072 Ga0070681_101710724 126
150 3300005459 Ga0068867_100002050 Ga0068867_1000020509 126
151 3300005459 Ga0068867_100002361 Ga0068867_1000023618 126
152 3300005530 Ga0070679_100006694 Ga0070679_1000066948 126
153 3300005530 Ga0070679_100338254 Ga0070679_1003382542 126
154 3300005539 Ga0068853_100035421 Ga0068853_1000354216 126
155 3300005539 Ga0068853_100095578 Ga0068853_1000955782 126
156 3300005543 Ga0070672_100003099 Ga0070672_1000030996 126
157 3300005543 Ga0070672_100008014 Ga0070672_1000080147 126
158 3300005548 Ga0070665_100006553 Ga0070665_1000065537 126
159 3300005548 Ga0070665_100028552 Ga0070665_1000285526 126
160 3300005563 Ga0068855_100274735 Ga0068855_1002747352 126
161 3300005577 Ga0068857_101300655 Ga0068857_1013006552 126
162 3300005578 Ga0068854_101062186 Ga0068854_1010621862 126
163 3300005614 Ga0068856_100391308 Ga0068856_1003913082 126
164 3300005616 Ga0068852_100063346 Ga0068852_1000633462 126
165 3300005616 Ga0068852_101277301 Ga0068852_1012773012 126
166 3300005617 Ga0068859_100006056 Ga0068859_1000060567 126
167 3300005618 Ga0068864_100003597 Ga0068864_1000035979 126
168 3300005618 Ga0068864_100030005 Ga0068864_1000300056 126
169 3300005719 Ga0068861_100047556 Ga0068861_1000475564 126
170 3300005834 Ga0068851_10009599 Ga0068851_100095992 126
171 3300005840 Ga0068870_10038529 Ga0068870_100385292 126
172 3300005841 Ga0068863_100013286 Ga0068863_1000132866 126
173 3300005841 Ga0068863_100059591 Ga0068863_1000595913 126
174 3300005842 Ga0068858_100003264 Ga0068858_1000032648 126
175 3300005842 Ga0068858_100303808 Ga0068858_1003038082 126
176 3300005843 Ga0068860_100001042 Ga0068860_10000104225 126
177 3300005843 Ga0068860_100034620 Ga0068860_1000346205 126
178 3300005985 Ga0081539_10009998 Ga0081539_100099986 126
179 3300006186 Ga0075369_10390072 Ga0075369_103900721 126
180 3300006237 Ga0097621_100018761 Ga0097621_1000187616 126
181 3300006237 Ga0097621_100333714 Ga0097621_1003337143 126
182 3300006358 Ga0068871_100001817 Ga0068871_1000018179 126
183 3300006358 Ga0068871_100007616 Ga0068871_1000076164 126
184 3300006881 Ga0068865_100017413 Ga0068865_1000174134 126
185 3300006881 Ga0068865_100069512 Ga0068865_1000695122 126
186 3300006931 Ga0097620_100006056 Ga0097620_1000060567 126
187 3300009147 Ga0114129_13292340 Ga0114129_132923401 126
188 3300009174 Ga0105241_10656610 Ga0105241_106566102 126
189 3300009177 Ga0105248_10002431 Ga0105248_100024318 126
190 3300009177 Ga0105248_10111081 Ga0105248_101110814 126
191 3300009553 Ga0105249_10222105 Ga0105249_102221052 126
192 3300011119 Ga0105246_10240505 Ga0105246_102405053 126
193 3300013100 Ga0157373_10004136 Ga0157373_100041369 126
194 3300013104 Ga0157370_10098205 Ga0157370_100982052 126
195 3300013104 Ga0157370_10208493 Ga0157370_102084932 126
196 3300013104 Ga0157370_10347864 Ga0157370_103478642 126
197 3300013296 Ga0157374_10009504 Ga0157374_100095048 126
198 3300013297 Ga0157378_11575904 Ga0157378_115759042 126
199 3300013306 Ga0163162_10006529 Ga0163162_100065298 126
200 3300013306 Ga0163162_10043422 Ga0163162_100434222 126
201 3300013306 Ga0163162_10769356 Ga0163162_107693562 126
202 3300013307 Ga0157372_10030913 Ga0157372_100309136 126
203 3300013308 Ga0157375_10002572 Ga0157375_100025728 126
204 3300014497 Ga0182008_10000107 Ga0182008_1000010742 126
205 3300014968 Ga0157379_10020291 Ga0157379_100202917 126
206 3300014969 Ga0157376_10003007 Ga0157376_100030078 126
207 3300014969 Ga0157376_10045182 Ga0157376_100451826 126
208 3300017792 Ga0163161_10015702 Ga0163161_100157027 126
209 3300017792 Ga0163161_10042182 Ga0163161_100421826 126
210 3300025315 Ga0207697_10004477 Ga0207697_100044772 126
211 3300025315 Ga0207697_10048895 Ga0207697_100488952 126
212 3300025321 Ga0207656_10056353 Ga0207656_100563533 126
213 3300025893 Ga0207682_10001158 Ga0207682_100011583 126
214 3300025899 Ga0207642_10490922 Ga0207642_104909222 126
215 3300025903 Ga0207680_10001915 Ga0207680_100019155 126
216 3300025903 Ga0207680_10010912 Ga0207680_100109127 126
217 3300025907 Ga0207645_10000519 Ga0207645_1000051921 126
218 3300025907 Ga0207645_10008023 Ga0207645_100080236 126
219 3300025912 Ga0207707_10016135 Ga0207707_100161356 126
220 3300025912 Ga0207707_10215310 Ga0207707_102153102 126
221 3300025916 Ga0207663_10701999 Ga0207663_107019992 126
222 3300025917 Ga0207660_10133674 Ga0207660_101336743 126
223 3300025919 Ga0207657_10417554 Ga0207657_104175542 126
224 3300025920 Ga0207649_10384117 Ga0207649_103841172 126
225 3300025921 Ga0207652_10007247 Ga0207652_100072477 126
226 3300025921 Ga0207652_10124648 Ga0207652_101246483 126
227 3300025921 Ga0207652_10399812 Ga0207652_103998123 126
228 3300025923 Ga0207681_10002527 Ga0207681_100025276 126
229 3300025923 Ga0207681_10698231 Ga0207681_106982312 126
230 3300025924 Ga0207694_10579037 Ga0207694_105790371 126
231 3300025925 Ga0207650_10213979 Ga0207650_102139792 126
232 3300025925 Ga0207650_10386519 Ga0207650_103865192 126
233 3300025926 Ga0207659_10002707 Ga0207659_100027078 126
234 3300025926 Ga0207659_10007428 Ga0207659_100074285 126
235 3300025928 Ga0207700_10000536 Ga0207700_100005366 126
236 3300025935 Ga0207709_10000130 Ga0207709_1000013030 126
237 3300025937 Ga0207669_10010494 Ga0207669_100104943 126
238 3300025937 Ga0207669_10010707 Ga0207669_100107076 126
239 3300025940 Ga0207691_10000310 Ga0207691_100003106 126
240 3300025940 Ga0207691_10000629 Ga0207691_1000062928 126
241 3300025941 Ga0207711_10162511 Ga0207711_101625112 126
242 3300025941 Ga0207711_10322829 Ga0207711_103228292 126
243 3300025942 Ga0207689_10005921 Ga0207689_100059218 126
244 3300025944 Ga0207661_11639973 Ga0207661_116399732 126
245 3300025949 Ga0207667_10113256 Ga0207667_101132562 126
246 3300025960 Ga0207651_10001764 Ga0207651_100017644 126
247 3300025960 Ga0207651_10053586 Ga0207651_100535864 126
248 3300025961 Ga0207712_10151247 Ga0207712_101512473 126
249 3300025972 Ga0207668_10003264 Ga0207668_100032646 126
250 3300025972 Ga0207668_10005981 Ga0207668_100059812 126
251 3300025981 Ga0207640_10266043 Ga0207640_102660431 126
252 3300025986 Ga0207658_10008951 Ga0207658_100089512 126
253 3300025986 Ga0207658_10052049 Ga0207658_100520495 126
254 3300025986 Ga0207658_10323597 Ga0207658_103235972 126
255 3300026023 Ga0207677_10005183 Ga0207677_100051836 126
256 3300026023 Ga0207677_10011855 Ga0207677_100118553 126
257 3300026035 Ga0207703_10007291 Ga0207703_100072916 126
258 3300026035 Ga0207703_10515556 Ga0207703_105155562 126
259 3300026041 Ga0207639_10030631 Ga0207639_100306312 126
260 3300026041 Ga0207639_10066846 Ga0207639_100668465 126
261 3300026067 Ga0207678_10010760 Ga0207678_100107603 126
262 3300026078 Ga0207702_10423446 Ga0207702_104234462 126
263 3300026078 Ga0207702_11361539 Ga0207702_113615391 126
264 3300026088 Ga0207641_10001932 Ga0207641_100019328 126
265 3300026089 Ga0207648_10000364 Ga0207648_100003648 126
266 3300026089 Ga0207648_10003344 Ga0207648_100033446 126
267 3300026095 Ga0207676_10003751 Ga0207676_100037517 126
268 3300026095 Ga0207676_10014659 Ga0207676_100146594 126
269 3300026116 Ga0207674_10030050 Ga0207674_100300507 126
270 3300026118 Ga0207675_100040300 Ga0207675_1000403004 126
271 3300026118 Ga0207675_101135948 Ga0207675_1011359482 126
272 3300026121 Ga0207683_10000076 Ga0207683_1000007676 126
273 3300026121 Ga0207683_10000121 Ga0207683_1000012154 126
274 3300026142 Ga0207698_10015072 Ga0207698_100150724 126
275 3300028379 Ga0268266_10028455 Ga0268266_100284556 126
276 3300028379 Ga0268266_10072189 Ga0268266_100721892 126
277 3300028381 Ga0268264_10007545 Ga0268264_100075456 126
278 3300031507 Ga0307509_10282087 Ga0307509_102820873 126
279 3300031730 Ga0307516_10000138 Ga0307516_1000013841 126
280 3300031731 Ga0307405_11366801 Ga0307405_113668012 126
281 3300032002 Ga0307416_100343170 Ga0307416_1003431702 126
282 3300035691 Ga0373931_0596967 Ga0373931_0596967_84_515 126
283 3300037068 Ga0373925_0034090 Ga0373925_0034090_2651_3079 126
284 3300037466 Ga0395898_1433034 Ga0395898_1433034_22_450 126
285 3300037471 Ga0395905_0020317 Ga0395905_0020317_5192_5620 126
286 3300044694 Ga0466963_0767749 Ga0466963_0767749_235_663 126
287 3300044735 Ga0466968_0010602 Ga0466968_0010602_1308_1736 126
288 3300046674 Ga0495588_0192217 Ga0495588_0192217_54_482 126
289 3300048904 Ga0496101_0379714 Ga0496101_0379714_85_516 126
290 3300048908 Ga0496105_0573641 Ga0496105_0573641_276_707 126
291 3300048910 Ga0496107_0312216 Ga0496107_0312216_581_1012 126
292 3300048911 Ga0496108_0093485 Ga0496108_0093485_1665_2096 126
293 3300048924 Ga0496121_0822578 Ga0496121_0822578_76_504 126
294 3300050489 nmdc:mga03683_268756_c1 nmdc:mga03683_268756_c1_344_772 126
295 3300053077 Ga0495601_0361601 Ga0495601_0361601_78_506 126
296 3300059421 Ga0590071_011345 Ga0590071_011345_1297_1725 126
297 3300005333 Ga0070677_10082214 Ga0070677_100822141 127
298 3300005335 Ga0070666_10232927 Ga0070666_102329273 127
299 3300005344 Ga0070661_100035823 Ga0070661_1000358233 127
300 3300005347 Ga0070668_100047261 Ga0070668_1000472613 127
301 3300005347 Ga0070668_100383260 Ga0070668_1003832602 127
302 3300005355 Ga0070671_100695773 Ga0070671_1006957732 127
303 3300005356 Ga0070674_100099090 Ga0070674_1000990901 127
304 3300005364 Ga0070673_100738552 Ga0070673_1007385522 127
305 3300005366 Ga0070659_100275134 Ga0070659_1002751341 127
306 3300005366 Ga0070659_100482661 Ga0070659_1004826611 127
307 3300005367 Ga0070667_100059940 Ga0070667_1000599404 127
308 3300005434 Ga0070709_10032539 Ga0070709_100325392 127
309 3300005434 Ga0070709_10328334 Ga0070709_103283341 127
310 3300005435 Ga0070714_100115806 Ga0070714_1001158063 127
311 3300005436 Ga0070713_100140230 Ga0070713_1001402302 127
312 3300005439 Ga0070711_100056778 Ga0070711_1000567783 127
313 3300005456 Ga0070678_100021157 Ga0070678_1000211574 127
314 3300005457 Ga0070662_101103762 Ga0070662_1011037621 127
315 3300005458 Ga0070681_10153827 Ga0070681_101538273 127
316 3300005518 Ga0070699_100038292 Ga0070699_1000382923 127
317 3300005530 Ga0070679_100143875 Ga0070679_1001438753 127
318 3300005530 Ga0070679_100780669 Ga0070679_1007806692 127
319 3300005543 Ga0070672_100066179 Ga0070672_1000661792 127
320 3300005546 Ga0070696_100017284 Ga0070696_1000172845 127
321 3300005548 Ga0070665_100004484 Ga0070665_10000448417 127
322 3300005564 Ga0070664_100033691 Ga0070664_1000336915 127
323 3300005618 Ga0068864_100384001 Ga0068864_1003840012 127
324 3300005719 Ga0068861_100036344 Ga0068861_1000363442 127
325 3300005841 Ga0068863_100747347 Ga0068863_1007473472 127
326 3300005842 Ga0068858_100057003 Ga0068858_1000570033 127
327 3300005843 Ga0068860_100445682 Ga0068860_1004456822 127
328 3300005843 Ga0068860_102089951 Ga0068860_1020899511 127
329 3300005937 Ga0081455_10111676 Ga0081455_101116763 127
330 3300006175 Ga0070712_100936133 Ga0070712_1009361331 127
331 3300006358 Ga0068871_100363345 Ga0068871_1003633453 127
332 3300006358 Ga0068871_100627234 Ga0068871_1006272342 127
333 3300006844 Ga0075428_100332244 Ga0075428_1003322442 127
334 3300006846 Ga0075430_100319170 Ga0075430_1003191701 127
335 3300006880 Ga0075429_100769971 Ga0075429_1007699712 127
336 3300007076 Ga0075435_100209964 Ga0075435_1002099641 127
337 3300007076 Ga0075435_100278836 Ga0075435_1002788362 127
338 3300009093 Ga0105240_10008953 Ga0105240_100089539 127
339 3300009545 Ga0105237_11501209 Ga0105237_115012091 127
340 3300009545 Ga0105237_11688791 Ga0105237_116887912 127
341 3300013100 Ga0157373_10080217 Ga0157373_100802172 127
342 3300013104 Ga0157370_10192267 Ga0157370_101922672 127
343 3300013296 Ga0157374_10539888 Ga0157374_105398883 127
344 3300013297 Ga0157378_10372394 Ga0157378_103723942 127
345 3300013306 Ga0163162_10314425 Ga0163162_103144253 127
346 3300013307 Ga0157372_10517195 Ga0157372_105171952 127
347 3300013308 Ga0157375_11177958 Ga0157375_111779582 127
348 3300013308 Ga0157375_11387302 Ga0157375_113873022 127
349 3300013308 Ga0157375_11415592 Ga0157375_114155922 127
350 3300014325 Ga0163163_13134558 Ga0163163_131345581 127
351 3300014968 Ga0157379_10013355 Ga0157379_100133553 127
352 3300017792 Ga0163161_10650561 Ga0163161_106505612 127
353 3300025893 Ga0207682_10265217 Ga0207682_102652171 127
354 3300025901 Ga0207688_10232069 Ga0207688_102320692 127
355 3300025903 Ga0207680_10185588 Ga0207680_101855883 127
356 3300025906 Ga0207699_10015910 Ga0207699_100159102 127
357 3300025906 Ga0207699_10698316 Ga0207699_106983162 127
358 3300025907 Ga0207645_10211813 Ga0207645_102118132 127
359 3300025912 Ga0207707_10234129 Ga0207707_102341292 127
360 3300025913 Ga0207695_10208220 Ga0207695_102082203 127
361 3300025914 Ga0207671_11129402 Ga0207671_111294022 127
362 3300025915 Ga0207693_10486203 Ga0207693_104862032 127
363 3300025916 Ga0207663_10028111 Ga0207663_100281113 127
364 3300025920 Ga0207649_10222134 Ga0207649_102221342 127
365 3300025921 Ga0207652_10131443 Ga0207652_101314432 127
366 3300025923 Ga0207681_10356964 Ga0207681_103569642 127
367 3300025926 Ga0207659_10802356 Ga0207659_108023562 127
368 3300025928 Ga0207700_10222032 Ga0207700_102220322 127
369 3300025931 Ga0207644_10858433 Ga0207644_108584331 127
370 3300025931 Ga0207644_10908943 Ga0207644_109089431 127
371 3300025933 Ga0207706_10023713 Ga0207706_100237132 127
372 3300025940 Ga0207691_10075011 Ga0207691_100750113 127
373 3300025940 Ga0207691_10147467 Ga0207691_101474674 127
374 3300025941 Ga0207711_10181192 Ga0207711_101811922 127
375 3300025945 Ga0207679_10024632 Ga0207679_100246323 127
376 3300025945 Ga0207679_10154259 Ga0207679_101542592 127
377 3300025949 Ga0207667_11254987 Ga0207667_112549871 127
378 3300025972 Ga0207668_10013879 Ga0207668_100138796 127
379 3300025972 Ga0207668_10186950 Ga0207668_101869502 127
380 3300025981 Ga0207640_10890569 Ga0207640_108905692 127
381 3300025986 Ga0207658_10035070 Ga0207658_100350702 127
382 3300025986 Ga0207658_10104528 Ga0207658_101045282 127
383 3300026035 Ga0207703_10005921 Ga0207703_100059212 127
384 3300026041 Ga0207639_10655600 Ga0207639_106556001 127
385 3300026067 Ga0207678_10028712 Ga0207678_100287126 127
386 3300026078 Ga0207702_10027561 Ga0207702_100275612 127
387 3300026088 Ga0207641_10084073 Ga0207641_100840733 127
388 3300026088 Ga0207641_10731971 Ga0207641_107319712 127
389 3300026118 Ga0207675_100025976 Ga0207675_1000259765 127
390 3300026118 Ga0207675_101071826 Ga0207675_1010718262 127
391 3300026121 Ga0207683_10005699 Ga0207683_100056996 127
392 3300028379 Ga0268266_10040095 Ga0268266_100400955 127
393 3300028380 Ga0268265_10692258 Ga0268265_106922582 127
394 3300028381 Ga0268264_10256884 Ga0268264_102568841 127
395 3300028381 Ga0268264_10678333 Ga0268264_106783332 127
396 3300035691 Ga0373931_0148638 Ga0373931_0148638_28_468 127
397 3300035692 Ga0373935_0889885 Ga0373935_0889885_80_511 127
398 3300041512 Ga0451853_3081903 Ga0451853_3081903_222_653 127
399 3300045976 Ga0466967_2261541 Ga0466967_2261541_29_466 127
400 3300048904 Ga0496101_0455942 Ga0496101_0455942_459_893 127
401 3300048905 Ga0496102_0179141 Ga0496102_0179141_208_639 127
402 3300048911 Ga0496108_0686565 Ga0496108_0686565_69_500 127
403 3300048914 Ga0496111_0092906 Ga0496111_0092906_501_932 127
404 3300048916 Ga0496113_0136992 Ga0496113_0136992_268_699 127
405 3300049571 Ga0501034_0164865 Ga0501034_0164865_248_679 127
406 3300049581 Ga0501047_0098402 Ga0501047_0098402_1115_1546 127
407 3300049583 Ga0501067_0045931 Ga0501067_0045931_1959_2390 127
408 3300049585 Ga0501069_0179365 Ga0501069_0179365_130_561 127
409 3300049586 Ga0501070_0021038 Ga0501070_0021038_4937_5368 127
410 3300049588 Ga0501072_0009398 Ga0501072_0009398_3095_3526 127
411 3300049589 Ga0501073_0079480 Ga0501073_0079480_672_1103 127
412 3300049590 Ga0501074_0006516 Ga0501074_0006516_4163_4594 127
413 3300049742 Ga0501080_0003414 Ga0501080_0003414_5565_5996 127
414 3300049744 Ga0501083_0026063 Ga0501083_0026063_1737_2168 127
415 3300049823 Ga0501044_0168927 Ga0501044_0168927_1446_1877 127
416 3300050512 nmdc:mga0n895_352208_c1 nmdc:mga0n895_352208_c1_552_983 127
417 3300050513 nmdc:mga0rr50_283924_c1 nmdc:mga0rr50_283924_c1_97_528 127
418 3300050514 nmdc:mga08x19_367453_c1 nmdc:mga08x19_367453_c1_415_846 127
419 3300054114 Ga0501084_0247834 Ga0501084_0247834_58_489 127
420 3300005328 Ga0070676_10321970 Ga0070676_103219702 128
421 3300005330 Ga0070690_100212354 Ga0070690_1002123541 128
422 3300005331 Ga0070670_100006809 Ga0070670_1000068092 128
423 3300005334 Ga0068869_100003638 Ga0068869_1000036382 128
424 3300005335 Ga0070666_10076897 Ga0070666_100768973 128
425 3300005338 Ga0068868_100011037 Ga0068868_1000110376 128
426 3300005339 Ga0070660_101015659 Ga0070660_1010156592 128
427 3300005340 Ga0070689_100279327 Ga0070689_1002793272 128
428 3300005347 Ga0070668_100044359 Ga0070668_1000443594 128
429 3300005347 Ga0070668_100914659 Ga0070668_1009146592 128
430 3300005355 Ga0070671_101221548 Ga0070671_1012215482 128
431 3300005364 Ga0070673_100011832 Ga0070673_1000118325 128
432 3300005365 Ga0070688_100837337 Ga0070688_1008373371 128
433 3300005367 Ga0070667_100000406 Ga0070667_1000004065 128
434 3300005440 Ga0070705_100195599 Ga0070705_1001955993 128
435 3300005441 Ga0070700_101278560 Ga0070700_1012785601 128
436 3300005455 Ga0070663_100545131 Ga0070663_1005451312 128
437 3300005457 Ga0070662_100027596 Ga0070662_1000275963 128
438 3300005459 Ga0068867_100009099 Ga0068867_1000090996 128
439 3300005468 Ga0070707_100705744 Ga0070707_1007057442 128
440 3300005539 Ga0068853_100377690 Ga0068853_1003776903 128
441 3300005543 Ga0070672_100062486 Ga0070672_1000624863 128
442 3300005563 Ga0068855_100431680 Ga0068855_1004316802 128
443 3300005617 Ga0068859_100000527 Ga0068859_10000052736 128
444 3300005618 Ga0068864_100005302 Ga0068864_1000053028 128
445 3300005719 Ga0068861_100019824 Ga0068861_1000198244 128
446 3300005840 Ga0068870_10095920 Ga0068870_100959202 128
447 3300005841 Ga0068863_100003159 Ga0068863_10000315912 128
448 3300005842 Ga0068858_100005279 Ga0068858_1000052792 128
449 3300005843 Ga0068860_100000976 Ga0068860_10000097626 128
450 3300005843 Ga0068860_101989050 Ga0068860_1019890501 128
451 3300005844 Ga0068862_100002697 Ga0068862_1000026975 128
452 3300006237 Ga0097621_100804923 Ga0097621_1008049232 128
453 3300006852 Ga0075433_10285057 Ga0075433_102850573 128
454 3300006871 Ga0075434_100750620 Ga0075434_1007506202 128
455 3300006881 Ga0068865_100035685 Ga0068865_1000356856 128
456 3300006931 Ga0097620_100000527 Ga0097620_10000052736 128
457 3300009177 Ga0105248_10007721 Ga0105248_100077212 128
458 3300009553 Ga0105249_11300621 Ga0105249_113006212 128
459 3300013104 Ga0157370_10012128 Ga0157370_100121282 128
460 3300013297 Ga0157378_10046393 Ga0157378_100463932 128
461 3300013306 Ga0163162_10515419 Ga0163162_105154193 128
462 3300013308 Ga0157375_10123821 Ga0157375_101238214 128
463 3300014325 Ga0163163_10010153 Ga0163163_100101535 128
464 3300014326 Ga0157380_10580775 Ga0157380_105807752 128
465 3300014968 Ga0157379_10002763 Ga0157379_1000276312 128
466 3300025901 Ga0207688_10485466 Ga0207688_104854661 128
467 3300025907 Ga0207645_10021957 Ga0207645_100219572 128
468 3300025925 Ga0207650_10002190 Ga0207650_1000219012 128
469 3300025931 Ga0207644_11557781 Ga0207644_115577811 128
470 3300025933 Ga0207706_10223524 Ga0207706_102235242 128
471 3300025936 Ga0207670_10250880 Ga0207670_102508802 128
472 3300025938 Ga0207704_10226291 Ga0207704_102262912 128
473 3300025941 Ga0207711_10279790 Ga0207711_102797902 128
474 3300025942 Ga0207689_10004985 Ga0207689_100049858 128
475 3300025949 Ga0207667_10172367 Ga0207667_101723672 128
476 3300025960 Ga0207651_10017237 Ga0207651_100172373 128
477 3300025972 Ga0207668_10077542 Ga0207668_100775424 128
478 3300025972 Ga0207668_10683607 Ga0207668_106836072 128
479 3300025986 Ga0207658_10024238 Ga0207658_100242385 128
480 3300026023 Ga0207677_10017625 Ga0207677_100176254 128
481 3300026035 Ga0207703_10002568 Ga0207703_1000256810 128
482 3300026041 Ga0207639_10316610 Ga0207639_103166103 128
483 3300026075 Ga0207708_10575052 Ga0207708_105750522 128
484 3300026078 Ga0207702_10815600 Ga0207702_108156002 128
485 3300026088 Ga0207641_10036346 Ga0207641_100363465 128
486 3300026089 Ga0207648_10002230 Ga0207648_1000223018 128
487 3300026095 Ga0207676_10007800 Ga0207676_100078004 128
488 3300026118 Ga0207675_100018204 Ga0207675_1000182044 128
489 3300028381 Ga0268264_10000967 Ga0268264_1000096724 128
490 3300035695 Ga0373927_0001525 Ga0373927_0001525_15810_16244 128
491 3300035725 Ga0373947_1167743 Ga0373947_1167743_63_497 128
492 3300036401 Ga0373937_0692006 Ga0373937_0692006_166_600 128
493 3300037068 Ga0373925_0023008 Ga0373925_0023008_3806_4240 128
494 3300037068 Ga0373925_0236453 Ga0373925_0236453_549_983 128
495 3300041492 Ga0451835_0250944 Ga0451835_0250944_128_565 128
496 3300044842 Ga0466957_0757849 Ga0466957_0757849_52_492 128
497 3300045836 Ga0466958_0241512 Ga0466958_0241512_26_466 128
498 3300048905 Ga0496102_0078545 Ga0496102_0078545_2155_2589 128
499 3300048906 Ga0496103_0043380 Ga0496103_0043380_1084_1518 128
500 3300048909 Ga0496106_0098618 Ga0496106_0098618_719_1153 128
501 3300048911 Ga0496108_0312849 Ga0496108_0312849_224_658 128
502 3300048912 Ga0496109_0229782 Ga0496109_0229782_573_1007 128
503 3300050512 nmdc:mga0n895_362172_c1 nmdc:mga0n895_362172_c1_297_734 128
504 3300050515 nmdc:mga0a205_419155_c1 nmdc:mga0a205_419155_c1_110_544 128
505 3300001976 JGI24752J21851_1010643 JGI24752J21851_10106433 129
506 3300002074 JGI24748J21848_1011999 JGI24748J21848_10119992 129
507 3300002075 JGI24738J21930_10018936 JGI24738J21930_100189362 129
508 3300002076 JGI24749J21850_1019575 JGI24749J21850_10195752 129
509 3300002155 JGI24033J26618_1007210 JGI24033J26618_10072102 129
510 3300002239 JGI24034J26672_10010575 JGI24034J26672_100105752 129
511 3300002459 JGI24751J29686_10044553 JGI24751J29686_100445532 129
512 3300005290 Ga0065712_10129191 Ga0065712_101291912 129
513 3300005293 Ga0065715_10105326 Ga0065715_101053265 129
514 3300005293 Ga0065715_10150410 Ga0065715_101504102 129
515 3300005327 Ga0070658_10102203 Ga0070658_101022034 129
516 3300005327 Ga0070658_10325556 Ga0070658_103255561 129
517 3300005328 Ga0070676_10040257 Ga0070676_100402573 129
518 3300005329 Ga0070683_100004758 Ga0070683_1000047588 129
519 3300005329 Ga0070683_100049601 Ga0070683_1000496016 129
520 3300005329 Ga0070683_100052029 Ga0070683_1000520293 129
521 3300005330 Ga0070690_100019262 Ga0070690_1000192626 129
522 3300005331 Ga0070670_100076130 Ga0070670_1000761302 129
523 3300005331 Ga0070670_100082257 Ga0070670_1000822575 129
524 3300005333 Ga0070677_10003225 Ga0070677_100032252 129
525 3300005334 Ga0068869_100051214 Ga0068869_1000512143 129
526 3300005335 Ga0070666_10251072 Ga0070666_102510722 129
527 3300005337 Ga0070682_100055241 Ga0070682_1000552413 129
528 3300005338 Ga0068868_100040170 Ga0068868_1000401706 129
529 3300005339 Ga0070660_100000551 Ga0070660_10000055117 129
530 3300005339 Ga0070660_100113162 Ga0070660_1001131622 129
531 3300005339 Ga0070660_100256552 Ga0070660_1002565522 129
532 3300005339 Ga0070660_100387922 Ga0070660_1003879221 129
533 3300005340 Ga0070689_100079378 Ga0070689_1000793784 129
534 3300005344 Ga0070661_100007142 Ga0070661_1000071427 129
535 3300005344 Ga0070661_100013445 Ga0070661_1000134453 129
536 3300005344 Ga0070661_100041563 Ga0070661_1000415636 129
537 3300005344 Ga0070661_100238474 Ga0070661_1002384742 129
538 3300005347 Ga0070668_100301473 Ga0070668_1003014733 129
539 3300005347 Ga0070668_100317601 Ga0070668_1003176012 129
540 3300005353 Ga0070669_100042357 Ga0070669_1000423575 129
541 3300005354 Ga0070675_100032188 Ga0070675_1000321886 129
542 3300005354 Ga0070675_100748439 Ga0070675_1007484392 129
543 3300005354 Ga0070675_101085289 Ga0070675_1010852892 129
544 3300005355 Ga0070671_100020178 Ga0070671_1000201783 129
545 3300005355 Ga0070671_100058212 Ga0070671_1000582124 129
546 3300005355 Ga0070671_100194496 Ga0070671_1001944962 129
547 3300005355 Ga0070671_101033111 Ga0070671_1010331111 129
548 3300005364 Ga0070673_100647597 Ga0070673_1006475972 129
549 3300005364 Ga0070673_100957650 Ga0070673_1009576502 129
550 3300005365 Ga0070688_100013445 Ga0070688_1000134453 129
551 3300005366 Ga0070659_100000779 Ga0070659_1000007797 129
552 3300005366 Ga0070659_100018637 Ga0070659_1000186376 129
553 3300005366 Ga0070659_100023800 Ga0070659_1000238004 129
554 3300005366 Ga0070659_100343555 Ga0070659_1003435553 129
555 3300005367 Ga0070667_100053943 Ga0070667_1000539435 129
556 3300005367 Ga0070667_100087714 Ga0070667_1000877142 129
557 3300005435 Ga0070714_100005077 Ga0070714_1000050773 129
558 3300005441 Ga0070700_100336905 Ga0070700_1003369052 129
559 3300005455 Ga0070663_100016715 Ga0070663_1000167155 129
560 3300005455 Ga0070663_100053096 Ga0070663_1000530961 129
561 3300005455 Ga0070663_100077225 Ga0070663_1000772251 129
562 3300005455 Ga0070663_101422153 Ga0070663_1014221531 129
563 3300005456 Ga0070678_101611830 Ga0070678_1016118302 129
564 3300005457 Ga0070662_100000211 Ga0070662_1000002119 129
565 3300005457 Ga0070662_100074089 Ga0070662_1000740892 129
566 3300005458 Ga0070681_10188673 Ga0070681_101886733 129
567 3300005459 Ga0068867_100278648 Ga0068867_1002786482 129
568 3300005459 Ga0068867_100309215 Ga0068867_1003092152 129
569 3300005466 Ga0070685_10011328 Ga0070685_100113282 129
570 3300005535 Ga0070684_100003917 Ga0070684_1000039178 129
571 3300005539 Ga0068853_100006893 Ga0068853_1000068935 129
572 3300005539 Ga0068853_100051166 Ga0068853_1000511662 129
573 3300005539 Ga0068853_101066876 Ga0068853_1010668761 129
574 3300005543 Ga0070672_100511109 Ga0070672_1005111092 129
575 3300005543 Ga0070672_100803947 Ga0070672_1008039471 129
576 3300005544 Ga0070686_100322126 Ga0070686_1003221262 129
577 3300005545 Ga0070695_101221839 Ga0070695_1012218391 129
578 3300005545 Ga0070695_101246514 Ga0070695_1012465141 129
579 3300005547 Ga0070693_100108418 Ga0070693_1001084183 129
580 3300005547 Ga0070693_100248777 Ga0070693_1002487772 129
581 3300005548 Ga0070665_100009685 Ga0070665_1000096855 129
582 3300005548 Ga0070665_100077530 Ga0070665_1000775302 129
583 3300005548 Ga0070665_100201390 Ga0070665_1002013902 129
584 3300005563 Ga0068855_100010927 Ga0068855_1000109275 129
585 3300005563 Ga0068855_100418212 Ga0068855_1004182122 129
586 3300005563 Ga0068855_100505548 Ga0068855_1005055482 129
587 3300005564 Ga0070664_100017006 Ga0070664_1000170067 129
588 3300005564 Ga0070664_100034982 Ga0070664_1000349824 129
589 3300005564 Ga0070664_101297291 Ga0070664_1012972912 129
590 3300005577 Ga0068857_100069369 Ga0068857_1000693696 129
591 3300005577 Ga0068857_100071664 Ga0068857_1000716645 129
592 3300005578 Ga0068854_100048212 Ga0068854_1000482122 129
593 3300005578 Ga0068854_100253011 Ga0068854_1002530112 129
594 3300005614 Ga0068856_100004235 Ga0068856_1000042358 129
595 3300005614 Ga0068856_100010690 Ga0068856_1000106905 129
596 3300005615 Ga0070702_100301479 Ga0070702_1003014792 129
597 3300005616 Ga0068852_100003693 Ga0068852_1000036936 129
598 3300005616 Ga0068852_100010012 Ga0068852_1000100125 129
599 3300005616 Ga0068852_100014944 Ga0068852_1000149442 129
600 3300005616 Ga0068852_101167920 Ga0068852_1011679202 129
601 3300005617 Ga0068859_100015175 Ga0068859_1000151757 129
602 3300005617 Ga0068859_101363790 Ga0068859_1013637902 129
603 3300005618 Ga0068864_100238796 Ga0068864_1002387962 129
604 3300005719 Ga0068861_100034998 Ga0068861_1000349986 129
605 3300005719 Ga0068861_100934040 Ga0068861_1009340402 129
606 3300005834 Ga0068851_10001801 Ga0068851_100018019 129
607 3300005834 Ga0068851_10009400 Ga0068851_100094004 129
608 3300005834 Ga0068851_10553019 Ga0068851_105530191 129
609 3300005840 Ga0068870_10198353 Ga0068870_101983532 129
610 3300005841 Ga0068863_100190937 Ga0068863_1001909373 129
611 3300005842 Ga0068858_100573120 Ga0068858_1005731202 129
612 3300005843 Ga0068860_100057406 Ga0068860_1000574063 129
613 3300005843 Ga0068860_100752028 Ga0068860_1007520282 129
614 3300006163 Ga0070715_10494719 Ga0070715_104947192 129
615 3300006173 Ga0070716_100351355 Ga0070716_1003513552 129
616 3300006175 Ga0070712_100398064 Ga0070712_1003980642 129
617 3300006358 Ga0068871_100249240 Ga0068871_1002492403 129
618 3300006358 Ga0068871_100888331 Ga0068871_1008883312 129
619 3300006871 Ga0075434_100553720 Ga0075434_1005537203 129
620 3300006881 Ga0068865_100462689 Ga0068865_1004626892 129
621 3300006881 Ga0068865_100497947 Ga0068865_1004979472 129
622 3300006881 Ga0068865_100612271 Ga0068865_1006122712 129
623 3300006881 Ga0068865_100847818 Ga0068865_1008478182 129
624 3300006931 Ga0097620_100015174 Ga0097620_1000151747 129
625 3300006931 Ga0097620_101364163 Ga0097620_1013641632 129
626 3300007076 Ga0075435_100644198 Ga0075435_1006441982 129
627 3300009093 Ga0105240_10022687 Ga0105240_100226877 129
628 3300009094 Ga0111539_11996554 Ga0111539_119965542 129
629 3300009098 Ga0105245_10721422 Ga0105245_107214222 129
630 3300009098 Ga0105245_12481724 Ga0105245_124817242 129
631 3300009101 Ga0105247_11080124 Ga0105247_110801241 129
632 3300009174 Ga0105241_10015461 Ga0105241_100154617 129
633 3300009177 Ga0105248_10019006 Ga0105248_100190067 129
634 3300009177 Ga0105248_10033264 Ga0105248_100332647 129
635 3300009177 Ga0105248_10277003 Ga0105248_102770032 129
636 3300009177 Ga0105248_10525587 Ga0105248_105255872 129
637 3300009545 Ga0105237_10368335 Ga0105237_103683351 129
638 3300009551 Ga0105238_10034778 Ga0105238_100347785 129
639 3300010375 Ga0105239_10057486 Ga0105239_100574865 129
640 3300011119 Ga0105246_10085830 Ga0105246_100858301 129
641 3300012485 Ga0157325_1023402 Ga0157325_10234021 129
642 3300012513 Ga0157326_1003717 Ga0157326_10037172 129
643 3300013100 Ga0157373_10003956 Ga0157373_100039564 129
644 3300013100 Ga0157373_10270501 Ga0157373_102705012 129
645 3300013102 Ga0157371_10000446 Ga0157371_1000044625 129
646 3300013102 Ga0157371_10179093 Ga0157371_101790932 129
647 3300013102 Ga0157371_10515985 Ga0157371_105159852 129
648 3300013102 Ga0157371_10566585 Ga0157371_105665852 129
649 3300013104 Ga0157370_10093865 Ga0157370_100938655 129
650 3300013104 Ga0157370_11624898 Ga0157370_116248981 129
651 3300013105 Ga0157369_10012261 Ga0157369_100122612 129
652 3300013105 Ga0157369_10726265 Ga0157369_107262652 129
653 3300013296 Ga0157374_10084887 Ga0157374_100848873 129
654 3300013296 Ga0157374_10246103 Ga0157374_102461032 129
655 3300013297 Ga0157378_10014139 Ga0157378_100141398 129
656 3300013306 Ga0163162_10138414 Ga0163162_101384143 129
657 3300013306 Ga0163162_10299866 Ga0163162_102998662 129
658 3300013306 Ga0163162_10303148 Ga0163162_103031483 129
659 3300013306 Ga0163162_10585285 Ga0163162_105852853 129
660 3300013307 Ga0157372_10000523 Ga0157372_1000052325 129
661 3300013307 Ga0157372_10092901 Ga0157372_100929014 129
662 3300013307 Ga0157372_10131156 Ga0157372_101311562 129
663 3300013307 Ga0157372_10305617 Ga0157372_103056172 129
664 3300013307 Ga0157372_10590193 Ga0157372_105901932 129
665 3300013307 Ga0157372_11548556 Ga0157372_115485561 129
666 3300013308 Ga0157375_10055728 Ga0157375_100557281 129
667 3300014325 Ga0163163_10162204 Ga0163163_101622041 129
668 3300014325 Ga0163163_10986437 Ga0163163_109864371 129
669 3300014326 Ga0157380_11847194 Ga0157380_118471941 129
670 3300014497 Ga0182008_10117288 Ga0182008_101172882 129
671 3300014968 Ga0157379_10092851 Ga0157379_100928512 129
672 3300014968 Ga0157379_10366482 Ga0157379_103664823 129
673 3300014969 Ga0157376_10182942 Ga0157376_101829422 129
674 3300014969 Ga0157376_11075366 Ga0157376_110753661 129
675 3300014969 Ga0157376_11084092 Ga0157376_110840921 129
676 3300020070 Ga0206356_10546372 Ga0206356_105463722 129
677 3300025315 Ga0207697_10001270 Ga0207697_100012705 129
678 3300025321 Ga0207656_10002941 Ga0207656_100029411 129
679 3300025321 Ga0207656_10008891 Ga0207656_100088913 129
680 3300025321 Ga0207656_10014121 Ga0207656_100141212 129
681 3300025321 Ga0207656_10308718 Ga0207656_103087182 129
682 3300025893 Ga0207682_10004140 Ga0207682_100041406 129
683 3300025898 Ga0207692_11040042 Ga0207692_110400421 129
684 3300025901 Ga0207688_10139443 Ga0207688_101394432 129
685 3300025901 Ga0207688_10272526 Ga0207688_102725262 129
686 3300025903 Ga0207680_10015863 Ga0207680_100158633 129
687 3300025903 Ga0207680_10056147 Ga0207680_100561474 129
688 3300025904 Ga0207647_10158855 Ga0207647_101588552 129
689 3300025907 Ga0207645_10015925 Ga0207645_100159257 129
690 3300025907 Ga0207645_10036864 Ga0207645_100368643 129
691 3300025908 Ga0207643_10102350 Ga0207643_101023502 129
692 3300025909 Ga0207705_10052596 Ga0207705_100525962 129
693 3300025911 Ga0207654_10210518 Ga0207654_102105182 129
694 3300025912 Ga0207707_10005207 Ga0207707_1000520713 129
695 3300025912 Ga0207707_10328500 Ga0207707_103285001 129
696 3300025913 Ga0207695_10007532 Ga0207695_100075325 129
697 3300025915 Ga0207693_10160135 Ga0207693_101601353 129
698 3300025916 Ga0207663_10047577 Ga0207663_100475773 129
699 3300025917 Ga0207660_10012654 Ga0207660_100126544 129
700 3300025918 Ga0207662_10026822 Ga0207662_100268222 129
701 3300025919 Ga0207657_10000229 Ga0207657_1000022926 129
702 3300025919 Ga0207657_10008077 Ga0207657_100080775 129
703 3300025919 Ga0207657_10024320 Ga0207657_100243202 129
704 3300025919 Ga0207657_10305144 Ga0207657_103051442 129
705 3300025920 Ga0207649_10002277 Ga0207649_100022775 129
706 3300025920 Ga0207649_10056653 Ga0207649_100566532 129
707 3300025920 Ga0207649_11567963 Ga0207649_115679631 129
708 3300025921 Ga0207652_10003991 Ga0207652_100039914 129
709 3300025923 Ga0207681_10460754 Ga0207681_104607541 129
710 3300025923 Ga0207681_10492627 Ga0207681_104926271 129
711 3300025924 Ga0207694_10028324 Ga0207694_100283245 129
712 3300025925 Ga0207650_10026509 Ga0207650_100265095 129
713 3300025926 Ga0207659_10002335 Ga0207659_100023357 129
714 3300025926 Ga0207659_10666030 Ga0207659_106660302 129
715 3300025926 Ga0207659_11149511 Ga0207659_111495112 129
716 3300025927 Ga0207687_10602065 Ga0207687_106020652 129
717 3300025929 Ga0207664_10006738 Ga0207664_100067385 129
718 3300025931 Ga0207644_10000405 Ga0207644_100004058 129
719 3300025931 Ga0207644_10054422 Ga0207644_100544223 129
720 3300025931 Ga0207644_10116881 Ga0207644_101168813 129
721 3300025931 Ga0207644_10266450 Ga0207644_102664503 129
722 3300025932 Ga0207690_10000348 Ga0207690_1000034822 129
723 3300025932 Ga0207690_10006051 Ga0207690_100060514 129
724 3300025932 Ga0207690_10035029 Ga0207690_100350296 129
725 3300025932 Ga0207690_10220567 Ga0207690_102205672 129
726 3300025932 Ga0207690_10346607 Ga0207690_103466071 129
727 3300025933 Ga0207706_10000045 Ga0207706_1000004572 129
728 3300025933 Ga0207706_10064814 Ga0207706_100648145 129
729 3300025935 Ga0207709_10507096 Ga0207709_105070962 129
730 3300025937 Ga0207669_10791340 Ga0207669_107913402 129
731 3300025940 Ga0207691_10050344 Ga0207691_100503445 129
732 3300025940 Ga0207691_10085085 Ga0207691_100850854 129
733 3300025941 Ga0207711_10011574 Ga0207711_100115744 129
734 3300025941 Ga0207711_10174265 Ga0207711_101742652 129
735 3300025942 Ga0207689_10013147 Ga0207689_100131472 129
736 3300025944 Ga0207661_10074070 Ga0207661_100740705 129
737 3300025944 Ga0207661_10172727 Ga0207661_101727272 129
738 3300025944 Ga0207661_10502796 Ga0207661_105027962 129
739 3300025945 Ga0207679_10003526 Ga0207679_100035264 129
740 3300025945 Ga0207679_10011829 Ga0207679_100118295 129
741 3300025945 Ga0207679_10049245 Ga0207679_100492453 129
742 3300025945 Ga0207679_10051924 Ga0207679_100519244 129
743 3300025945 Ga0207679_10781540 Ga0207679_107815401 129
744 3300025945 Ga0207679_10859607 Ga0207679_108596071 129
745 3300025949 Ga0207667_10002826 Ga0207667_100028265 129
746 3300025949 Ga0207667_10003469 Ga0207667_1000346914 129
747 3300025949 Ga0207667_10105193 Ga0207667_101051933 129
748 3300025949 Ga0207667_10435293 Ga0207667_104352932 129
749 3300025949 Ga0207667_11710818 Ga0207667_117108182 129
750 3300025960 Ga0207651_10005532 Ga0207651_100055323 129
751 3300025960 Ga0207651_10150139 Ga0207651_101501392 129
752 3300025960 Ga0207651_10176290 Ga0207651_101762902 129
753 3300025961 Ga0207712_10201372 Ga0207712_102013723 129
754 3300025972 Ga0207668_10221403 Ga0207668_102214032 129
755 3300025972 Ga0207668_10258794 Ga0207668_102587943 129
756 3300025972 Ga0207668_10327768 Ga0207668_103277682 129
757 3300025981 Ga0207640_10019747 Ga0207640_100197475 129
758 3300025981 Ga0207640_10056577 Ga0207640_100565772 129
759 3300025981 Ga0207640_10063512 Ga0207640_100635124 129
760 3300025986 Ga0207658_10336284 Ga0207658_103362842 129
761 3300026023 Ga0207677_10784901 Ga0207677_107849011 129
762 3300026041 Ga0207639_10008842 Ga0207639_100088428 129
763 3300026041 Ga0207639_10018465 Ga0207639_100184655 129
764 3300026041 Ga0207639_10991470 Ga0207639_109914702 129
765 3300026041 Ga0207639_12189938 Ga0207639_121899381 129
766 3300026067 Ga0207678_10001996 Ga0207678_1000199616 129
767 3300026067 Ga0207678_10032115 Ga0207678_100321154 129
768 3300026067 Ga0207678_10104144 Ga0207678_101041444 129
769 3300026067 Ga0207678_10934802 Ga0207678_109348022 129
770 3300026075 Ga0207708_10304201 Ga0207708_103042012 129
771 3300026078 Ga0207702_10000715 Ga0207702_1000071520 129
772 3300026078 Ga0207702_10056652 Ga0207702_100566526 129
773 3300026088 Ga0207641_10056891 Ga0207641_100568915 129
774 3300026088 Ga0207641_10101932 Ga0207641_101019322 129
775 3300026088 Ga0207641_10512363 Ga0207641_105123633 129
776 3300026089 Ga0207648_10083123 Ga0207648_100831232 129
777 3300026095 Ga0207676_10093737 Ga0207676_100937375 129
778 3300026116 Ga0207674_10000225 Ga0207674_1000022553 129
779 3300026116 Ga0207674_10015172 Ga0207674_100151727 129
780 3300026118 Ga0207675_100863415 Ga0207675_1008634152 129
781 3300026121 Ga0207683_10016965 Ga0207683_100169657 129
782 3300026142 Ga0207698_10004376 Ga0207698_100043768 129
783 3300026142 Ga0207698_10007522 Ga0207698_100075225 129
784 3300026142 Ga0207698_10587420 Ga0207698_105874202 129
785 3300027617 Ga0210002_1019853 Ga0210002_10198532 129
786 3300027876 Ga0209974_10072542 Ga0209974_100725423 129
787 3300028379 Ga0268266_10516993 Ga0268266_105169932 129
788 3300028380 Ga0268265_10181670 Ga0268265_101816704 129
789 3300028380 Ga0268265_11012437 Ga0268265_110124372 129
790 3300028381 Ga0268264_10065017 Ga0268264_100650173 129
791 3300031548 Ga0307408_100064934 Ga0307408_1000649343 129
792 3300031731 Ga0307405_10058582 Ga0307405_100585822 129
793 3300031852 Ga0307410_10039366 Ga0307410_100393663 129
794 3300031901 Ga0307406_10127050 Ga0307406_101270502 129
795 3300031901 Ga0307406_10966201 Ga0307406_109662012 129
796 3300031911 Ga0307412_10045789 Ga0307412_100457893 129
797 3300031995 Ga0307409_100006788 Ga0307409_1000067887 129
798 3300032002 Ga0307416_100245809 Ga0307416_1002458093 129
799 3300032004 Ga0307414_10205034 Ga0307414_102050342 129
800 3300032005 Ga0307411_10019396 Ga0307411_100193964 129
801 3300032126 Ga0307415_100007976 Ga0307415_1000079766 129
802 3300034817 Ga0373948_0049468 Ga0373948_0049468_126_563 129
803 3300034819 Ga0373958_0077024 Ga0373958_0077024_139_573 129
804 3300035083 Ga0373926_0181431 Ga0373926_0181431_37_474 129
805 3300035118 Ga0373954_0174717 Ga0373954_0174717_80_517 129
806 3300035695 Ga0373927_0256857 Ga0373927_0256857_88_525 129
807 3300035724 Ga0373933_0599995 Ga0373933_0599995_134_571 129
808 3300035725 Ga0373947_0401072 Ga0373947_0401072_195_632 129
809 3300037312 Ga0395899_0275335 Ga0395899_0275335_268_708 129
810 3300037418 Ga0395900_0035910 Ga0395900_0035910_2298_2738 129
811 3300037418 Ga0395900_0542778 Ga0395900_0542778_86_526 129
812 3300037466 Ga0395898_0058539 Ga0395898_0058539_582_1022 129
813 3300037471 Ga0395905_0958466 Ga0395905_0958466_163_603 129
814 3300038443 Ga0395901_0254916 Ga0395901_0254916_1270_1710 129
815 3300038443 Ga0395901_0401510 Ga0395901_0401510_151_591 129
816 3300038996 Ga0242420_065050 Ga0242420_065050_206_646 129
817 3300042157 Ga0439458_0059704 Ga0439458_0059704_468_908 129
818 3300044712 Ga0453684_0238511 Ga0453684_0238511_491_931 129
819 3300044712 Ga0453684_1072153 Ga0453684_1072153_80_514 129
820 3300045051 Ga0451576_1087686 Ga0451576_1087686_254_688 129
821 3300046459 Ga0495629_0302645 Ga0495629_0302645_179_616 129
822 3300046472 Ga0495580_0092998 Ga0495580_0092998_543_977 129
823 3300046681 Ga0495647_0441462 Ga0495647_0441462_148_582 129
824 3300046683 Ga0495658_0384686 Ga0495658_0384686_230_667 129
825 3300048903 Ga0496100_0159488 Ga0496100_0159488_558_992 129
826 3300048903 Ga0496100_0551114 Ga0496100_0551114_417_854 129
827 3300048904 Ga0496101_0082914 Ga0496101_0082914_752_1186 129
828 3300048904 Ga0496101_0269512 Ga0496101_0269512_722_1159 129
829 3300048905 Ga0496102_0062700 Ga0496102_0062700_2525_2962 129
830 3300048906 Ga0496103_0035997 Ga0496103_0035997_1385_1822 129
831 3300048907 Ga0496104_0006095 Ga0496104_0006095_3904_4338 129
832 3300048907 Ga0496104_0797096 Ga0496104_0797096_251_688 129
833 3300048909 Ga0496106_0000931 Ga0496106_0000931_11321_11758 129
834 3300048909 Ga0496106_0460274 Ga0496106_0460274_61_501 129
835 3300048910 Ga0496107_0139594 Ga0496107_0139594_1168_1605 129
836 3300048911 Ga0496108_0009652 Ga0496108_0009652_5520_5954 129
837 3300048912 Ga0496109_0028312 Ga0496109_0028312_127_561 129
838 3300048913 Ga0496110_0005169 Ga0496110_0005169_6570_7004 129
839 3300048913 Ga0496110_0330460 Ga0496110_0330460_440_880 129
840 3300048914 Ga0496111_0133240 Ga0496111_0133240_1010_1444 129
841 3300049583 Ga0501067_0339975 Ga0501067_0339975_155_592 129
842 3300050511 nmdc:mga08y16_1669785_c1 nmdc:mga08y16_1669785_c1_24_458 129
843 3300050513 nmdc:mga0rr50_630279_c1 nmdc:mga0rr50_630279_c1_64_504 129
844 3300059640 Ga0587067_026936 Ga0587067_026936_98_538 129
845 3300060344 Ga0587071_052560 Ga0587071_052560_250_690 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

12

139

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8205 46 119
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8011 46 119
1vdm-assembly1.cif.gz_I crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.7275 86 118
6sxa-assembly1.cif.gz_G xpf-ercc1 cryo-em structure, apo-form 0.7144 72 122
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.7085 48 114
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7085 48 114 3.30.420.270
3f7tA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain 0.7076 88 119 3.40.1010.20
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7068 87 119 3.40.50.2020
2vzvA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6897 69 119 3.20.20.80
af_A0A1D6NEB8_5_191_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.6828 68 120 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A536ZWN2-F1-model_v4 Biopolymer transporter ExbD 0.9438 54 126 GO:0005886
GO:0015031
GO:0022857
AF-A0A5E9Q4F2-F1-model_v4 deleted 0.9401 46 120
AF-A0A1I7IB77-F1-model_v4 Biopolymer transport protein ExbD 0.9377 43 119 GO:0005886
GO:0015031
GO:0022857
AF-A0A2S9GU90-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9194 49 120 GO:0005886
GO:0015031
GO:0022857
AF-A0A7X8V0M5-F1-model_v4 deleted 0.9093 45 122

Feature Viewer

pLDDT pTM Quality
73.1 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map