F483286

General Info

Members Datasets Scaffolds Average Seq Length
846 592 615 383

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10080610|Ga0081538_100806102
Length 394
Sequence MKNVTCIEDLRQLARRKVPRAFFDYAEAGSYSEQTLHANRADLERVKLRQRVLVDVSARDTSTTILGEKVPMPLALGPVGMTGLEYGNGEIHACRAAHKAGIPFTLSTLSICSIEDVATTVDRPFWFQLYVMKDRGFVRSLIERASAVSCSALVLTVDLQVLGQRHIDIKNGLSVPPSLKIRNLANMAIKPRWVFSVLSGKDGHVKGMEGVKSLAQWVGSQFDETLSWNDVDWIRSIWPGKLIIKGILDVEDAKLATRTGATALVVSNHGGRQLDGAASSISVLPKVADAVGSEIEVMFDGGIRTGQDVLRALALGARSCLIGRAYIFGLGAGGEAGVARAIDIIRKELDVSMALTGVKSVKEIGRHILLQQSSRGSSPLVNGRCIRRQVRGRL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
17 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
20 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
21 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
22 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
25 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
34 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
35 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
36 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
37 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
38 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
39 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
40 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
41 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
42 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
43 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
44 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
45 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
46 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
49 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
50 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
51 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
52 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
53 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
54 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
57 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
58 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
59 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
60 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
61 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
62 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
63 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
64 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
65 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
66 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
67 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
68 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
69 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
70 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
71 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
74 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
75 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
76 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
77 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
78 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
79 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
80 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
81 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
82 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
86 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
87 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
88 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
89 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
90 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
91 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
92 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
93 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
94 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
95 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
96 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
97 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
98 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
99 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
100 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
101 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
102 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
103 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
104 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
105 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
110 2922368715
111 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
112 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
113 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
114 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
115 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
116 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
117 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
118 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
119 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
120 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
121 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
122 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
123 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
124 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
125 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
126 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
127 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
128 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
129 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
130 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
131 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
132 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
133 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
134 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
135 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
136 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
137 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
138 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
139 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
140 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
141 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
142 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
143 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
144 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
145 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
146 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
147 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
148 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
149 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
150 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
151 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
152 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
153 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
154 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
155 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
156 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
157 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
158 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
159 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
160 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
161 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
162 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
163 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
164 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
165 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
166 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
167 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
168 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
169 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
170 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
171 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
172 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
173 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
174 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
175 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
176 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
177 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
178 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
179 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
180 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
181 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
182 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
183 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
184 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
185 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
186 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
187 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
188 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
189 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
190 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
191 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
192 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
193 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
194 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
195 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
196 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
197 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
198 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
199 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
200 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
201 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
202 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
203 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
204 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
205 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
206 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
207 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
208 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
209 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
210 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
211 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
212 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
213 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
214 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
215 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
216 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
217 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
218 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
219 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
220 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
221 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
222 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
223 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
224 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
225 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
226 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
227 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
228 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
229 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
230 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
231 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
232 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
233 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
234 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
235 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
236 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
237 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
238 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
239 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
240 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
241 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
242 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
243 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
244 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
245 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
246 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
247 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
248 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
249 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
250 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
251 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
252 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
253 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
254 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
255 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
256 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
257 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
258 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
259 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
260 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
261 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
262 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
263 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
264 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
265 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
266 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
267 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
268 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
269 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
270 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
271 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
272 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
273 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
274 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
275 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
276 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
277 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
278 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
279 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
280 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
281 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
282 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
283 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
284 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
285 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
286 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
287 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
288 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
289 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
290 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
291 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
292 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
293 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
294 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
295 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
296 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
297 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
298 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
299 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
300 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
301 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
302 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
303 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
304 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
305 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
306 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
307 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
308 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
309 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
312 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
314 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
315 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
317 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
373 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
374 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
375 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
376 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
377 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
378 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
382 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
383 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
384 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
385 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
386 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
387 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
388 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
389 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
390 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
391 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
392 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
393 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
394 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
395 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
396 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
397 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
398 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
399 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
400 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
401 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
402 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
403 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
404 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
405 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
406 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
407 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
408 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
409 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
410 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
411 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
412 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
413 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
414 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
415 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
416 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
417 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
418 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
419 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
420 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
421 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
422 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
423 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
424 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
425 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
426 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
427 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
428 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
429 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
430 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
431 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
432 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
433 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
434 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
435 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
436 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
437 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
438 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
439 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
440 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
441 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
444 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
445 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
446 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
447 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
448 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
449 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
450 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
451 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
452 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
453 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
454 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
455 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
456 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
457 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
458 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
459 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
460 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
463 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
464 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
465 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
466 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
467 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
468 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
469 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
470 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
471 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
472 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
473 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
474 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
475 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
476 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
477 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
478 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
479 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
480 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
481 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
482 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
483 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
484 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
485 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
486 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
487 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
488 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
489 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
490 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
491 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
492 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
493 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
494 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
495 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
496 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
497 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
506 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
511 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
512 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
513 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
514 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
515 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
516 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
517 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
518 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
519 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
520 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
521 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
522 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
523 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
525 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
526 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
527 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
528 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
529 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
530 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
531 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
532 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
533 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
534 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
535 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
536 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
537 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
538 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
539 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
540 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
541 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
542 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
543 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
544 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
545 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
546 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
547 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
548 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
549 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
550 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
551 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
552 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
553 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
554 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
555 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
556 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
557 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
558 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
559 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
560 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
561 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
562 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
563 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
564 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
565 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
566 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
567 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
568 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
569 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
570 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
571 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
572 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
573 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
574 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
575 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
576 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
577 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
578 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
579 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
580 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
581 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
582 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
583 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
584 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
585 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
586 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
587 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
588 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
589 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
590 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
591 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
592 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.78
Metatranscriptomes 0
Isolates 27.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.22
Nodule 22.34
Rhizoplane 6.97
Rhizosphere 54.85
Stem 0
Stem Tuber 0
Unclassified 6.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10008874 3300001990 Bacteria 3356
2 JGI24750J21931_1000382 3300002070 Bacteria 7517
3 JGI24744J21845_10001405 3300002077 Bacteria 4769
4 JGI24034J26672_10001624 3300002239 Bacteria 3008
5 JGI24742J22300_10000921 3300002244 Bacteria 4486
6 JGI24751J29686_10001730 3300002459 Bacteria 4483
7 JGI25165J46597_1005784 3300003214 Bacteria 2309
8 rootH2_10015505 3300003320 Bacteria 11045
9 JGI25160J50197_1003229 3300003354 Bacteria 7360
10 JGI25160J50197_1007225 3300003354 Bacteria 4369
11 JGI25160J50197_1011223 3300003354 Bacteria 3187
12 Ga0055542_1006782 3300003762 Bacteria 2405
13 Ga0055531_10010606 3300003794 Bacteria 4554
14 Ga0055543_1004550 3300004625 Bacteria 3745
15 Ga0055543_1013727 3300004625 Bacteria 1595
16 Ga0065165_1002476 3300005262 Bacteria 15530
17 Ga0065165_1002846 3300005262 Bacteria 13437
18 Ga0065165_1022581 3300005262 Bacteria 2153
19 Ga0065715_10116981 3300005293 Bacteria 2362
20 Ga0070658_10027674 3300005327 Bacteria 4549
21 Ga0070658_10040277 3300005327 Bacteria 3769
22 Ga0070683_100306551 3300005329 Bacteria 1511
23 Ga0070683_100327714 3300005329 Bacteria 1458
24 Ga0070690_100008826 3300005330 Bacteria 5822
25 Ga0070690_100042239 3300005330 Bacteria 2888
26 Ga0070670_100002977 3300005331 Bacteria 14022
27 Ga0070670_100008937 3300005331 Bacteria 8557
28 Ga0070670_100028505 3300005331 Bacteria 4806
29 Ga0068869_100008177 3300005334 Bacteria 6731
30 Ga0070680_100031622 3300005336 Bacteria 4257
31 Ga0068868_100015712 3300005338 Bacteria 5607
32 Ga0070689_100002815 3300005340 Bacteria 11435
33 Ga0070689_100007192 3300005340 Bacteria 7761
34 Ga0070668_100054855 3300005347 Bacteria 3075
35 Ga0070669_100025557 3300005353 Bacteria 4242
36 Ga0070675_100016259 3300005354 Bacteria 5903
37 Ga0070675_100083571 3300005354 Bacteria 2665
38 Ga0070671_100004776 3300005355 Bacteria 10770
39 Ga0070671_100024253 3300005355 Bacteria 4965
40 Ga0070674_100072201 3300005356 Bacteria 2443
41 Ga0070674_100130993 3300005356 Bacteria 1870
42 Ga0070673_100006320 3300005364 Bacteria 7694
43 Ga0070673_100097118 3300005364 Bacteria 2419
44 Ga0070688_100022058 3300005365 Bacteria 3726
45 Ga0070714_100000214 3300005435 Bacteria 46204
46 Ga0070714_100167219 3300005435 Bacteria 1993
47 Ga0070713_100036597 3300005436 Bacteria 3962
48 Ga0070713_100084577 3300005436 Bacteria 2715
49 Ga0070701_10005926 3300005438 Bacteria 5101
50 Ga0070711_100040720 3300005439 Bacteria 3135
51 Ga0070705_100073406 3300005440 Bacteria 2076
52 Ga0070700_100005394 3300005441 Bacteria 6770
53 Ga0070663_100015368 3300005455 Bacteria 4939
54 Ga0070678_100079363 3300005456 Bacteria 2482
55 Ga0070662_100032717 3300005457 Bacteria 3655
56 Ga0068867_100027479 3300005459 Bacteria 4090
57 Ga0068867_100056366 3300005459 Bacteria 2907
58 Ga0068867_100225597 3300005459 Bacteria 1512
59 Ga0070685_10002191 3300005466 Bacteria 10092
60 Ga0070679_100009709 3300005530 Bacteria 9103
61 Ga0068853_100044985 3300005539 Bacteria 3780
62 Ga0070672_100003443 3300005543 Bacteria 10252
63 Ga0070672_100169329 3300005543 Bacteria 1816
64 Ga0070686_100003076 3300005544 Bacteria 9139
65 Ga0070695_100023103 3300005545 Bacteria 3818
66 Ga0070665_100024056 3300005548 Bacteria 6134
67 Ga0070665_100048262 3300005548 Bacteria 4275
68 Ga0070665_100076147 3300005548 Bacteria 3362
69 Ga0070665_100167591 3300005548 Bacteria 2198
70 Ga0070665_100193718 3300005548 Bacteria 2033
71 Ga0070664_100351603 3300005564 Bacteria 1341
72 Ga0068854_100022938 3300005578 Bacteria 4258
73 Ga0070702_100007919 3300005615 Bacteria 5116
74 Ga0068852_100035617 3300005616 Bacteria 4154
75 Ga0068852_100050258 3300005616 Bacteria 3571
76 Ga0068864_100011952 3300005618 Bacteria 7167
77 Ga0068861_100038125 3300005719 Bacteria 3576
78 Ga0068870_10001327 3300005840 Bacteria 9959
79 Ga0068863_100058152 3300005841 Bacteria 3659
80 Ga0068858_100011270 3300005842 Bacteria 8448
81 Ga0068860_100006468 3300005843 Bacteria 11765
82 Ga0068862_100010288 3300005844 Bacteria 7718
83 Ga0081538_10080610 3300005981 Bacteria 1735
84 Ga0081540_1003809 3300005983 Bacteria 11796
85 Ga0081540_1021644 3300005983 Bacteria 3820
86 Ga0081539_10042016 3300005985 Bacteria 2666
87 Ga0070717_10089776 3300006028 Bacteria 2592
88 Ga0075365_10006872 3300006038 Bacteria 6312
89 Ga0075365_10039395 3300006038 Bacteria 3077
90 Ga0075365_10063288 3300006038 Bacteria 2476
91 Ga0075368_10001970 3300006042 Bacteria 6618
92 Ga0075363_100002880 3300006048 Bacteria 7164
93 Ga0075363_100012377 3300006048 Bacteria 4111
94 Ga0075364_10016505 3300006051 Bacteria 4595
95 Ga0075364_10095620 3300006051 Bacteria 1975
96 Ga0070715_10074759 3300006163 Bacteria 1523
97 Ga0070712_100029075 3300006175 Bacteria 3703
98 Ga0075367_10117295 3300006178 Bacteria 1638
99 Ga0075369_10055983 3300006186 Bacteria 1714
100 Ga0075369_10066091 3300006186 Bacteria 1586
101 Ga0075366_10023925 3300006195 Bacteria 3559
102 Ga0075366_10027952 3300006195 Bacteria 3309
103 Ga0097621_100036852 3300006237 Bacteria 3914
104 Ga0075370_10002544 3300006353 Bacteria 8482
105 Ga0075370_10017867 3300006353 Bacteria 3837
106 Ga0075428_100001783 3300006844 Bacteria 22990
107 Ga0075428_100020439 3300006844 Bacteria 7328
108 Ga0075428_100072368 3300006844 Bacteria 3766
109 Ga0075430_100007526 3300006846 Bacteria 9194
110 Ga0075431_100000003 3300006847 Bacteria 112884
111 Ga0075431_100020676 3300006847 Bacteria 6726
112 Ga0075431_100026376 3300006847 Bacteria 5962
113 Ga0075431_100107206 3300006847 Bacteria 2882
114 Ga0075433_10007493 3300006852 Bacteria 8660
115 Ga0075433_10093255 3300006852 Bacteria 2664
116 Ga0075433_10151833 3300006852 Bacteria 2060
117 Ga0075434_100379866 3300006871 Bacteria 1433
118 Ga0075429_100013494 3300006880 Bacteria 7088
119 Ga0075429_100070201 3300006880 Bacteria 3050
120 Ga0075429_100159168 3300006880 Bacteria 1977
121 Ga0075429_100171874 3300006880 Bacteria 1898
122 Ga0068865_100042213 3300006881 Bacteria 3109
123 Ga0099824_1008513 3300006942 Bacteria 13101
124 Ga0099823_1004051 3300006944 Bacteria 14168
125 Ga0075435_100037674 3300007076 Bacteria 3851
126 Ga0099794_10014407 3300007265 Bacteria 3464
127 Ga0099795_10007396 3300007788 Bacteria 3063
128 Ga0105240_10448080 3300009093 Bacteria 1445
129 Ga0111539_10004128 3300009094 Bacteria 19061
130 Ga0111539_10007426 3300009094 Bacteria 14048
131 Ga0111539_10033800 3300009094 Bacteria 6206
132 Ga0111539_10343855 3300009094 Bacteria 1736
133 Ga0105247_10031333 3300009101 Bacteria 3227
134 Ga0105247_10064159 3300009101 Bacteria 2281
135 Ga0114129_10000104 3300009147 Bacteria 83195
136 Ga0114129_10021818 3300009147 Bacteria 9089
137 Ga0114129_10028120 3300009147 Bacteria 7966
138 Ga0114129_10070313 3300009147 Bacteria 4880
139 Ga0114129_10123428 3300009147 Bacteria 3562
140 Ga0105241_10052381 3300009174 Bacteria 3116
141 Ga0105242_10139315 3300009176 Bacteria 2103
142 Ga0105242_10305872 3300009176 Bacteria 1453
143 Ga0105248_10098846 3300009177 Bacteria 3288
144 Ga0105248_10491014 3300009177 Bacteria 1384
145 Ga0105237_10019250 3300009545 Bacteria 7053
146 Ga0105237_10092647 3300009545 Bacteria 3011
147 Ga0105237_10098727 3300009545 Bacteria 2911
148 Ga0105237_10114838 3300009545 Bacteria 2685
149 Ga0105238_10009521 3300009551 Bacteria 9724
150 Ga0105238_10013778 3300009551 Bacteria 8171
151 Ga0105238_10116747 3300009551 Bacteria 2649
152 Ga0105249_10232658 3300009553 Bacteria 1818
153 Ga0105239_10050734 3300010375 Bacteria 4549
154 Ga0105239_10064105 3300010375 Bacteria 4034
155 Ga0105239_10102667 3300010375 Bacteria 3164
156 Ga0105239_10242163 3300010375 Bacteria 2024
157 Ga0105239_10267167 3300010375 Bacteria 1923
158 Ga0105239_10332318 3300010375 Bacteria 1714
159 Ga0105239_10587753 3300010375 Bacteria 1269
160 Ga0105246_10020866 3300011119 Bacteria 4207
161 Ga0105246_10060053 3300011119 Bacteria 2640
162 Ga0157374_10029044 3300013296 Bacteria 5002
163 Ga0163162_10065535 3300013306 Bacteria 3679
164 Ga0157375_10023485 3300013308 Bacteria 5691
165 Ga0163163_10168817 3300014325 Bacteria 2234
166 Ga0157380_10019349 3300014326 Bacteria 5073
167 Ga0157380_10219680 3300014326 Bacteria 1699
168 Ga0157380_10270516 3300014326 Bacteria 1549
169 Ga0157380_10295977 3300014326 Bacteria 1488
170 Ga0182008_10031207 3300014497 Bacteria 2683
171 Ga0182008_10057241 3300014497 Bacteria 1925
172 Ga0157379_10018816 3300014968 Bacteria 6092
173 Ga0157376_10113500 3300014969 Bacteria 2389
174 Ga0157376_10165681 3300014969 Bacteria 2008
175 Ga0163161_10009513 3300017792 Bacteria 6724
176 Ga0214544_1000163 3300021320 Bacteria 101631
177 Ga0214542_1000156 3300021321 Bacteria 101631
178 Ga0214545_1000078 3300021324 Bacteria 101631
179 Ga0214543_1000136 3300021327 Bacteria 101629
180 Ga0209563_104066 3300025230 Bacteria 2868
181 Ga0209148_1000232 3300025254 Bacteria 90923
182 Ga0209233_1001298 3300025261 Bacteria 9984
183 Ga0209233_1007012 3300025261 Bacteria 3598
184 Ga0209455_1002245 3300025272 Bacteria 7595
185 Ga0209564_1013870 3300025295 Bacteria 3389
186 Ga0209758_1000294 3300025297 Bacteria 98618
187 Ga0209758_1000705 3300025297 Bacteria 49585
188 Ga0209758_1000986 3300025297 Bacteria 38258
189 Ga0209758_1002299 3300025297 Bacteria 19758
190 Ga0209758_1005881 3300025297 Bacteria 9155
191 Ga0209256_1008548 3300025299 Bacteria 4719
192 Ga0209256_1011833 3300025299 Bacteria 3432
193 Ga0207426_1000632 3300025302 Bacteria 44581
194 Ga0207426_1001240 3300025302 Bacteria 22455
195 Ga0207426_1015236 3300025302 Bacteria 2792
196 Ga0209257_1001185 3300025304 Bacteria 32850
197 Ga0209257_1010432 3300025304 Bacteria 4703
198 Ga0207697_10062690 3300025315 Bacteria 1548
199 Ga0207692_10086198 3300025898 Bacteria 1692
200 Ga0207642_10033422 3300025899 Bacteria 2176
201 Ga0207710_10002863 3300025900 Bacteria 7852
202 Ga0207688_10000552 3300025901 Bacteria 18231
203 Ga0207680_10008395 3300025903 Bacteria 5067
204 Ga0207647_10015498 3300025904 Bacteria 5223
205 Ga0207647_10065485 3300025904 Bacteria 2206
206 Ga0207645_10006892 3300025907 Bacteria 8103
207 Ga0207643_10081811 3300025908 Bacteria 1872
208 Ga0207654_10056393 3300025911 Bacteria 2279
209 Ga0207695_10000123 3300025913 Bacteria 232059
210 Ga0207671_10009480 3300025914 Bacteria 8132
211 Ga0207671_10108200 3300025914 Bacteria 2113
212 Ga0207693_10019950 3300025915 Bacteria 5332
213 Ga0207693_10237673 3300025915 Bacteria 1430
214 Ga0207663_10091876 3300025916 Bacteria 2016
215 Ga0207662_10000805 3300025918 Bacteria 14440
216 Ga0207657_10024966 3300025919 Bacteria 5522
217 Ga0207657_10084288 3300025919 Bacteria 2664
218 Ga0207649_10042813 3300025920 Bacteria 2764
219 Ga0207652_10074845 3300025921 Bacteria 2949
220 Ga0207681_10061879 3300025923 Bacteria 2575
221 Ga0207694_10212048 3300025924 Bacteria 1578
222 Ga0207650_10000973 3300025925 Bacteria 21537
223 Ga0207650_10003057 3300025925 Bacteria 11527
224 Ga0207650_10012596 3300025925 Bacteria 5837
225 Ga0207659_10005491 3300025926 Bacteria 7691
226 Ga0207659_10126139 3300025926 Bacteria 1969
227 Ga0207687_10005331 3300025927 Bacteria 8516
228 Ga0207687_10159318 3300025927 Bacteria 1730
229 Ga0207700_10046679 3300025928 Bacteria 3205
230 Ga0207664_10000016 3300025929 Bacteria 245001
231 Ga0207644_10007567 3300025931 Bacteria 7081
232 Ga0207644_10039499 3300025931 Bacteria 3331
233 Ga0207644_10156758 3300025931 Bacteria 1766
234 Ga0207706_10003516 3300025933 Bacteria 14964
235 Ga0207706_10080697 3300025933 Bacteria 2860
236 Ga0207686_10038341 3300025934 Bacteria 2899
237 Ga0207686_10230259 3300025934 Bacteria 1343
238 Ga0207670_10212804 3300025936 Bacteria 1475
239 Ga0207704_10036811 3300025938 Bacteria 2819
240 Ga0207665_10151085 3300025939 Bacteria 1663
241 Ga0207691_10001422 3300025940 Bacteria 23867
242 Ga0207691_10097741 3300025940 Bacteria 2624
243 Ga0207691_10105524 3300025940 Bacteria 2510
244 Ga0207711_10172825 3300025941 Bacteria 1961
245 Ga0207711_10180258 3300025941 Bacteria 1920
246 Ga0207689_10041758 3300025942 Bacteria 3795
247 Ga0207661_10286338 3300025944 Bacteria 1474
248 Ga0207661_10292122 3300025944 Bacteria 1459
249 Ga0207679_10022311 3300025945 Bacteria 4309
250 Ga0207651_10008623 3300025960 Bacteria 5518
251 Ga0207651_10011401 3300025960 Bacteria 4977
252 Ga0207712_10099663 3300025961 Bacteria 2157
253 Ga0207668_10013750 3300025972 Bacteria 4993
254 Ga0207640_10296752 3300025981 Bacteria 1277
255 Ga0207658_10251690 3300025986 Bacteria 1501
256 Ga0207677_10018376 3300026023 Bacteria 4194
257 Ga0207703_10003706 3300026035 Bacteria 12723
258 Ga0207703_10065560 3300026035 Bacteria 2985
259 Ga0207639_10032148 3300026041 Bacteria 3861
260 Ga0207639_10083920 3300026041 Bacteria 2529
261 Ga0207678_10229216 3300026067 Bacteria 1590
262 Ga0207708_10000402 3300026075 Bacteria 34168
263 Ga0207702_10075186 3300026078 Bacteria 2917
264 Ga0207641_10004016 3300026088 Bacteria 12839
265 Ga0207648_10001024 3300026089 Bacteria 31454
266 Ga0207648_10026793 3300026089 Bacteria 5120
267 Ga0207648_10259651 3300026089 Bacteria 1550
268 Ga0207676_10006308 3300026095 Bacteria 8373
269 Ga0207674_10114956 3300026116 Bacteria 2663
270 Ga0207675_100272084 3300026118 Bacteria 1644
271 Ga0207683_10004966 3300026121 Bacteria 11439
272 Ga0207683_10039056 3300026121 Bacteria 4140
273 Ga0207698_10007558 3300026142 Bacteria 6814
274 Ga0209389_1000019 3300027296 Bacteria 172067
275 Ga0209389_1000248 3300027296 Bacteria 34726
276 Ga0209589_1001871 3300027357 Bacteria 35557
277 Ga0209489_100033 3300027361 Bacteria 172166
278 Ga0209489_102684 3300027361 Bacteria 35799
279 Ga0209700_100012 3300027363 Bacteria 357892
280 Ga0209813_10032452 3300027866 Bacteria 1548
281 Ga0207428_10008981 3300027907 Bacteria 9003
282 Ga0268266_10009477 3300028379 Bacteria 8569
283 Ga0268266_10260314 3300028379 Bacteria 1607
284 Ga0268265_10035791 3300028380 Bacteria 3631
285 Ga0268264_10015936 3300028381 Bacteria 6157
286 Ga0265334_10048657 3300028573 Bacteria 1632
287 Ga0265323_10000498 3300028653 Bacteria 22094
288 Ga0265336_10000187 3300028666 Bacteria 43247
289 Ga0265338_10001016 3300028800 Bacteria 47131
290 Ga0265338_10126144 3300028800 Bacteria 2030
291 Ga0265324_10023195 3300029957 Bacteria 2212
292 Ga0265325_10001055 3300031241 Bacteria 19806
293 Ga0265325_10016565 3300031241 Bacteria 4118
294 Ga0265325_10033276 3300031241 Bacteria 2748
295 Ga0265325_10057213 3300031241 Bacteria 1989
296 Ga0265340_10070405 3300031247 Bacteria 1659
297 Ga0265339_10000201 3300031249 Bacteria 49070
298 Ga0265339_10011032 3300031249 Bacteria 5585
299 Ga0265339_10012299 3300031249 Bacteria 5228
300 Ga0265339_10031655 3300031249 Bacteria 2987
301 Ga0265313_10000152 3300031595 Bacteria 71968
302 Ga0265313_10007801 3300031595 Bacteria 7230
303 Ga0265314_10069516 3300031711 Bacteria 2362
304 Ga0265342_10005406 3300031712 Bacteria 9751
305 Ga0373923_0060575 3300035111 Bacteria 1607
306 Ga0373953_0044343 3300035117 Bacteria 1778
307 Ga0373956_0006216 3300035119 Bacteria 4777
308 Ga0373956_0012908 3300035119 Bacteria 3470
309 Ga0373957_0047750 3300035120 Bacteria 1629
310 Ga0373960_0010152 3300035121 Bacteria 2294
311 Ga0373955_0008230 3300035172 Bacteria 4835
312 Ga0373955_0074696 3300035172 Bacteria 1903
313 Ga0373955_0089084 3300035172 Bacteria 1756
314 Ga0373961_0024377 3300035241 Bacteria 1636
315 Ga0373962_0027387 3300035242 Bacteria 1542
316 Ga0373924_0017233 3300035410 Bacteria 2768
317 Ga0373931_0015917 3300035691 Bacteria 3694
318 Ga0373931_0063848 3300035691 Bacteria 1991
319 Ga0373935_0005677 3300035692 Bacteria 7364
320 Ga0373935_0117734 3300035692 Bacteria 1771
321 Ga0373935_0192941 3300035692 Bacteria 1404
322 Ga0373927_0012133 3300035695 Bacteria 5733
323 Ga0373927_0172444 3300035695 Bacteria 1418
324 Ga0373933_0001289 3300035724 Bacteria 14771
325 Ga0373933_0083376 3300035724 Bacteria 1963
326 Ga0373933_0096387 3300035724 Bacteria 1831
327 Ga0373947_0018469 3300035725 Bacteria 4014
328 Ga0373947_0076629 3300035725 Bacteria 2061
329 Ga0373937_0009153 3300036401 Bacteria 8593
330 Ga0373937_0029828 3300036401 Bacteria 4940
331 Ga0373937_0363268 3300036401 Bacteria 1372
332 Ga0373925_0027415 3300037068 Bacteria 4169
333 Ga0373925_0077879 3300037068 Bacteria 2517
334 Ga0373925_0153457 3300037068 Bacteria 1810
335 Ga0395900_0064212 3300037418 Bacteria 3774
336 Ga0395900_0396535 3300037418 Bacteria 1345
337 Ga0395898_0040780 3300037466 Bacteria 4589
338 Ga0395898_0194893 3300037466 Bacteria 1936
339 Ga0395905_0026848 3300037471 Bacteria 5431
340 Ga0395905_0084176 3300037471 Bacteria 2980
341 Ga0395905_0110414 3300037471 Bacteria 2582
342 Ga0395905_0138009 3300037471 Bacteria 2294
343 Ga0395905_0381614 3300037471 Bacteria 1303
344 Ga0436364_0879211 3300037853 Bacteria 2756
345 Ga0395901_0034257 3300038443 Bacteria 5244
346 Ga0436361_1074854 3300039447 Bacteria 5007
347 Ga0451797_1189235 3300041453 Bacteria 1261
348 Ga0466969_0030073 3300044656 Bacteria 2769
349 Ga0466972_0000164 3300044658 Bacteria 53019
350 Ga0466972_0031361 3300044658 Bacteria 2615
351 Ga0466966_0001614 3300044684 Bacteria 14525
352 Ga0466966_0045971 3300044684 Bacteria 2789
353 Ga0466966_0094249 3300044684 Bacteria 1856
354 Ga0466961_0000192 3300044693 Bacteria 40922
355 Ga0466961_0118147 3300044693 Bacteria 1666
356 Ga0466963_0003423 3300044694 Bacteria 9082
357 Ga0466963_0029700 3300044694 Bacteria 3521
358 Ga0466970_0026933 3300044765 Bacteria 3014
359 Ga0466959_0000934 3300045049 Bacteria 17340
360 Ga0466959_0033641 3300045049 Bacteria 3791
361 Ga0466967_0043144 3300045976 Bacteria 3903
362 Ga0466967_0063786 3300045976 Bacteria 3275
363 Ga0466967_0146409 3300045976 Bacteria 2203
364 Ga0495617_059668 3300046452 Bacteria 1263
365 Ga0495592_0024501 3300046454 Bacteria 4586
366 Ga0495590_0015955 3300046457 Bacteria 2717
367 Ga0495629_0044604 3300046459 Bacteria 3111
368 Ga0495638_0005230 3300046460 Bacteria 9693
369 Ga0495651_0000289 3300046462 Bacteria 38999
370 Ga0495651_0001839 3300046462 Bacteria 16395
371 Ga0495653_0020419 3300046463 Bacteria 5371
372 Ga0495653_0076046 3300046463 Bacteria 2497
373 Ga0495580_0011443 3300046472 Bacteria 6865
374 Ga0495582_0054292 3300046473 Bacteria 2210
375 Ga0495582_0159592 3300046473 Bacteria 1282
376 Ga0495605_0044303 3300046474 Bacteria 2201
377 Ga0495584_0041459 3300046491 Bacteria 2324
378 Ga0495594_0062923 3300046499 Bacteria 2055
379 Ga0495608_0022281 3300046511 Bacteria 4343
380 Ga0495608_0024703 3300046511 Bacteria 4106
381 Ga0495608_0134794 3300046511 Bacteria 1578
382 Ga0495618_0010089 3300046514 Bacteria 5711
383 Ga0495618_0133201 3300046514 Bacteria 1590
384 Ga0495628_0025037 3300046516 Bacteria 4879
385 Ga0495628_0026676 3300046516 Bacteria 4706
386 Ga0495630_0319363 3300046517 Bacteria 1187
387 Ga0495631_0091338 3300046518 Bacteria 1311
388 Ga0495643_0013829 3300046522 Bacteria 4816
389 Ga0495644_0045526 3300046523 Bacteria 1650
390 Ga0495648_0007226 3300046524 Bacteria 8920
391 Ga0495666_0094672 3300046526 Bacteria 1409
392 Ga0495652_0011343 3300046529 Bacteria 8059
393 Ga0495652_0016070 3300046529 Bacteria 6696
394 Ga0495665_0078423 3300046531 Bacteria 1738
395 Ga0495640_0015608 3300046533 Bacteria 5708
396 Ga0495640_0076374 3300046533 Bacteria 2235
397 Ga0495587_0023897 3300046536 Bacteria 3752
398 Ga0495587_0044076 3300046536 Bacteria 2654
399 Ga0495587_0056318 3300046536 Bacteria 2313
400 Ga0495621_0074245 3300046539 Bacteria 1258
401 Ga0495597_0078986 3300046542 Bacteria 1409
402 Ga0495645_0005611 3300046543 Bacteria 8631
403 Ga0495667_0022641 3300046559 Bacteria 4233
404 Ga0495667_0030231 3300046559 Bacteria 3642
405 Ga0495634_0013494 3300046642 Bacteria 5902
406 Ga0495634_0016981 3300046642 Bacteria 5199
407 Ga0495634_0110707 3300046642 Bacteria 1766
408 Ga0495625_0123959 3300046660 Bacteria 1756
409 Ga0495635_0030666 3300046663 Bacteria 3735
410 Ga0495588_0020997 3300046674 Bacteria 3214
411 Ga0495657_0004591 3300046675 Bacteria 11023
412 Ga0495657_0047211 3300046675 Bacteria 2912
413 Ga0495657_0168741 3300046675 Bacteria 1349
414 Ga0495599_0005172 3300046678 Bacteria 7778
415 Ga0495623_0009855 3300046679 Bacteria 6191
416 Ga0495623_0030892 3300046679 Bacteria 3446
417 Ga0495646_0087624 3300046680 Bacteria 1804
418 Ga0495646_0113172 3300046680 Bacteria 1543
419 Ga0495646_0160930 3300046680 Bacteria 1243
420 Ga0495658_0002851 3300046683 Bacteria 8688
421 Ga0495658_0006954 3300046683 Bacteria 5580
422 Ga0495658_0009239 3300046683 Bacteria 4903
423 Ga0495658_0083925 3300046683 Bacteria 1875
424 Ga0495649_0015557 3300046694 Bacteria 4328
425 Ga0495600_0013346 3300046809 Bacteria 5159
426 Ga0495600_0015147 3300046809 Bacteria 4871
427 Ga0495604_0005625 3300047317 Bacteria 9939
428 Ga0495604_0108437 3300047317 Bacteria 2028
429 Ga0495604_0201437 3300047317 Bacteria 1381
430 Ga0495674_0010369 3300047319 Bacteria 8820
431 Ga0495674_0011929 3300047319 Bacteria 8194
432 Ga0495674_0087310 3300047319 Bacteria 2669
433 Ga0495672_0101348 3300047320 Bacteria 1561
434 Ga0495676_0032821 3300047321 Bacteria 4379
435 Ga0495680_0001654 3300047322 Bacteria 23702
436 Ga0495680_0024726 3300047322 Bacteria 4978
437 Ga0495680_0024804 3300047322 Bacteria 4968
438 Ga0495675_0007713 3300047444 Bacteria 6637
439 Ga0495675_0135442 3300047444 Bacteria 1529
440 Ga0495677_0080197 3300047445 Bacteria 1223
441 Ga0495684_0028806 3300047471 Bacteria 4263
442 Ga0495684_0034799 3300047471 Bacteria 3865
443 Ga0495684_0043382 3300047471 Bacteria 3443
444 Ga0495684_0076387 3300047471 Bacteria 2544
445 Ga0495684_0085404 3300047471 Bacteria 2393
446 Ga0495686_0065217 3300047472 Bacteria 2252
447 Ga0495593_0039449 3300047673 Bacteria 2546
448 Ga0495602_0051018 3300048088 Bacteria 3689
449 Ga0495615_0017282 3300048090 Bacteria 1569
450 Ga0496100_0000883 3300048903 Bacteria 14297
451 Ga0496100_0026894 3300048903 Bacteria 3532
452 Ga0496100_0027461 3300048903 Bacteria 3500
453 Ga0496100_0150035 3300048903 Bacteria 1661
454 Ga0496101_0001721 3300048904 Bacteria 13111
455 Ga0496101_0010306 3300048904 Bacteria 6171
456 Ga0496101_0096070 3300048904 Bacteria 2211
457 Ga0496102_0002752 3300048905 Bacteria 14995
458 Ga0496102_0005298 3300048905 Bacteria 10948
459 Ga0496102_0125437 3300048905 Bacteria 2399
460 Ga0496102_0223476 3300048905 Bacteria 1775
461 Ga0496103_0002481 3300048906 Bacteria 11568
462 Ga0496103_0013626 3300048906 Bacteria 4823
463 Ga0496103_0074029 3300048906 Bacteria 2134
464 Ga0496104_0007237 3300048907 Bacteria 9793
465 Ga0496104_0007787 3300048907 Bacteria 9493
466 Ga0496104_0011552 3300048907 Bacteria 7912
467 Ga0496105_0001558 3300048908 Bacteria 16229
468 Ga0496105_0003169 3300048908 Bacteria 12121
469 Ga0496105_0011182 3300048908 Bacteria 7080
470 Ga0496105_0015800 3300048908 Bacteria 6022
471 Ga0496105_0170851 3300048908 Bacteria 1782
472 Ga0496106_0006865 3300048909 Bacteria 8425
473 Ga0496106_0009006 3300048909 Bacteria 7378
474 Ga0496106_0017900 3300048909 Bacteria 5240
475 Ga0496106_0176557 3300048909 Bacteria 1695
476 Ga0496107_0025595 3300048910 Bacteria 4178
477 Ga0496107_0041992 3300048910 Bacteria 3285
478 Ga0496108_0006599 3300048911 Bacteria 9408
479 Ga0496108_0013514 3300048911 Bacteria 6662
480 Ga0496108_0017132 3300048911 Bacteria 5925
481 Ga0496108_0026234 3300048911 Bacteria 4805
482 Ga0496109_0002993 3300048912 Bacteria 14119
483 Ga0496109_0003652 3300048912 Bacteria 12860
484 Ga0496110_0002213 3300048913 Bacteria 14531
485 Ga0496110_0003023 3300048913 Bacteria 12763
486 Ga0496110_0042720 3300048913 Bacteria 3957
487 Ga0496111_0002054 3300048914 Bacteria 11995
488 Ga0496111_0007911 3300048914 Bacteria 7010
489 Ga0496111_0094059 3300048914 Bacteria 2198
490 Ga0496112_0024108 3300048915 Bacteria 5823
491 Ga0496112_0036512 3300048915 Bacteria 4794
492 Ga0496112_0037830 3300048915 Bacteria 4711
493 Ga0496112_0095544 3300048915 Bacteria 2942
494 Ga0496113_0005117 3300048916 Bacteria 8146
495 Ga0496113_0005565 3300048916 Bacteria 7871
496 Ga0496113_0056499 3300048916 Bacteria 2947
497 Ga0496114_0003895 3300048917 Bacteria 11508
498 Ga0496114_0006922 3300048917 Bacteria 8930
499 Ga0496115_0016238 3300048918 Bacteria 5665
500 Ga0496115_0023466 3300048918 Bacteria 4788
501 Ga0496115_0034919 3300048918 Bacteria 3975
502 Ga0496115_0038291 3300048918 Bacteria 3804
503 Ga0496115_0079170 3300048918 Bacteria 2675
504 Ga0496115_0115028 3300048918 Bacteria 2212
505 Ga0496115_0122854 3300048918 Bacteria 2137
506 Ga0496118_0020990 3300048921 Bacteria 5768
507 Ga0496119_0020758 3300048922 Bacteria 4773
508 Ga0496120_0013345 3300048923 Bacteria 5538
509 Ga0496121_0015737 3300048924 Bacteria 7882
510 Ga0496121_0053118 3300048924 Bacteria 3396
511 Ga0496126_0035526 3300048929 Bacteria 4670
512 Ga0495682_0023857 3300049460 Bacteria 2282
513 Ga0501031_0021558 3300049568 Bacteria 4200
514 Ga0501032_0013465 3300049569 Bacteria 5815
515 Ga0501033_0093170 3300049570 Bacteria 2203
516 Ga0501034_0028780 3300049571 Bacteria 5652
517 Ga0501034_0372974 3300049571 Bacteria 1353
518 Ga0501036_0010044 3300049572 Bacteria 7798
519 Ga0501036_0015237 3300049572 Bacteria 6420
520 Ga0501037_0008767 3300049573 Bacteria 7414
521 Ga0501038_0003573 3300049574 Bacteria 14467
522 Ga0501039_0057503 3300049575 Bacteria 3011
523 Ga0501039_0208255 3300049575 Bacteria 1537
524 Ga0501042_0073201 3300049578 Bacteria 2451
525 Ga0501042_0084909 3300049578 Bacteria 2270
526 Ga0501043_0016285 3300049579 Bacteria 5830
527 Ga0501046_0007715 3300049580 Bacteria 9433
528 Ga0501046_0099345 3300049580 Bacteria 2234
529 Ga0501047_0045311 3300049581 Bacteria 4252
530 Ga0501048_0007056 3300049582 Bacteria 8534
531 Ga0501067_0023020 3300049583 Bacteria 3450
532 Ga0501068_0003549 3300049584 Bacteria 8427
533 Ga0501069_0011843 3300049585 Bacteria 4623
534 Ga0501070_0184796 3300049586 Bacteria 1714
535 Ga0501072_0095346 3300049588 Bacteria 2365
536 Ga0501072_0275789 3300049588 Bacteria 1338
537 Ga0501073_0026789 3300049589 Bacteria 4127
538 Ga0501073_0058946 3300049589 Bacteria 2682
539 Ga0501074_0013706 3300049590 Bacteria 5892
540 Ga0501076_0132736 3300049592 Bacteria 2020
541 Ga0501076_0158981 3300049592 Bacteria 1840
542 Ga0501079_0014563 3300049741 Bacteria 5998
543 Ga0501080_0029067 3300049742 Bacteria 5145
544 Ga0501080_0166332 3300049742 Bacteria 2035
545 Ga0501081_0112052 3300049743 Bacteria 1937
546 Ga0501083_0036721 3300049744 Bacteria 3340
547 Ga0501083_0170912 3300049744 Bacteria 1421
548 Ga0501035_0006796 3300049822 Bacteria 10687
549 Ga0501044_0003604 3300049823 Bacteria 17424
550 Ga0501044_0026832 3300049823 Bacteria 6096
551 Ga0501044_0098521 3300049823 Bacteria 2943
552 Ga0501044_0152533 3300049823 Bacteria 2292
553 Ga0501045_0012008 3300049824 Bacteria 6088
554 nmdc:mga03683_28913_c1 3300050489 Bacteria 2207
555 nmdc:mga03n38_13266_c1 3300050490 Bacteria 3124
556 nmdc:mga03n38_7124_c1 3300050490 Bacteria 3936
557 nmdc:mga00v17_124340_c1 3300050491 Bacteria 1645
558 nmdc:mga00v17_53361_c1 3300050491 Bacteria 2463
559 nmdc:mga0yw44_149246_c1 3300050492 Bacteria 1524
560 nmdc:mga0yw44_17392_c1 3300050492 Bacteria 3911
561 nmdc:mga0yw44_30206_c1 3300050492 Bacteria 3137
562 nmdc:mga0yw44_37486_c1 3300050492 Bacteria 2863
563 nmdc:mga0yw44_43992_c1 3300050492 Bacteria 2669
564 nmdc:mga0k408_31550_c1 3300050493 Bacteria 3026
565 nmdc:mga0k408_7165_c2 3300050493 Bacteria 4559
566 nmdc:mga06z11_46920_c1 3300050494 Bacteria 2192
567 nmdc:mga04h51_18406_c1 3300050495 Bacteria 2057
568 nmdc:mga07m45_18804_c1 3300050496 Bacteria 2402
569 nmdc:mga05p37_11620_c1 3300050507 Bacteria 10493
570 nmdc:mga05p37_1642_c1 3300050507 Bacteria 25943
571 nmdc:mga09592_104661_c1 3300050508 Bacteria 2425
572 nmdc:mga09592_2070_c1 3300050508 Bacteria 16178
573 nmdc:mga09592_34328_c1 3300050508 Bacteria 4240
574 nmdc:mga0qj67_74188_c1 3300050509 Bacteria 2718
575 nmdc:mga0qj67_96891_c1 3300050509 Bacteria 2375
576 nmdc:mga0qj67_9856_c1 3300050509 Bacteria 7121
577 nmdc:mga06r32_349_c1 3300050510 Bacteria 38472
578 nmdc:mga06r32_42434_c1 3300050510 Bacteria 4325
579 nmdc:mga06r32_68482_c1 3300050510 Bacteria 3429
580 nmdc:mga08y16_41385_c1 3300050511 Bacteria 4827
581 nmdc:mga08y16_4843_c1 3300050511 Bacteria 14047
582 nmdc:mga0n895_187155_c1 3300050512 Bacteria 2101
583 nmdc:mga0rr50_28999_c1 3300050513 Bacteria 3897
584 nmdc:mga0a205_132792_c1 3300050515 Bacteria 2390
585 nmdc:mga0sz30_83056_c1 3300050516 Bacteria 1388
586 Ga0495601_0001197 3300053077 Bacteria 14205
587 Ga0495601_0114243 3300053077 Bacteria 1750
588 Ga0495612_0056590 3300053078 Bacteria 1619
589 Ga0495595_0010792 3300053084 Bacteria 3806
590 Ga0495595_0016167 3300053084 Bacteria 3187
591 Ga0495595_0040458 3300053084 Bacteria 2130
592 Ga0495619_0000048 3300053085 Bacteria 102117
593 Ga0495619_0002108 3300053085 Bacteria 13188
594 Ga0495619_0048524 3300053085 Bacteria 2798
595 Ga0495619_0171497 3300053085 Bacteria 1500
596 Ga0500578_0167301 3300053086 Bacteria 1361
597 Ga0500583_0053008 3300053092 Bacteria 1889
598 Ga0500651_0001977 3300053093 Bacteria 10628
599 Ga0500641_0001652 3300053096 Bacteria 7949
600 Ga0500555_007835 3300053103 Bacteria 3037
601 Ga0500556_0014493 3300053104 Bacteria 2408
602 Ga0500572_005340 3300053111 Bacteria 2907
603 Ga0500595_006611 3300053119 Bacteria 4896
604 Ga0500642_0000381 3300053130 Bacteria 14828
605 Ga0500642_0020295 3300053130 Bacteria 2610
606 Ga0500642_0032672 3300053130 Bacteria 2185
607 Ga0500559_0000550 3300053136 Bacteria 25997
608 Ga0500616_0019706 3300053153 Bacteria 3799
609 Ga0500616_0053762 3300053153 Bacteria 2112
610 Ga0500622_0022869 3300053156 Bacteria 3310
611 Ga0500636_0000762 3300053177 Bacteria 17368
612 Ga0500636_0011675 3300053177 Bacteria 5142
613 Ga0501082_0022888 3300060353 Bacteria 5383
614 Ga0501082_0229774 3300060353 Bacteria 1614
615 Ga0530510_0055163 3300061734 Bacteria 2871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0001977 Ga0500651_0001977_8040_9122 360
2 3300053130 Ga0500642_0032672 Ga0500642_0032672_583_1665 360
3 iso_pu_bacteria 8019530166 8019538106 367
4 3300005981 Ga0081538_10080610 Ga0081538_100806102 369
5 iso_pu_bacteria 2693429783 2694631462 373
6 iso_pu_bacteria 2693429784 2694640140 373
7 3300005293 Ga0065715_10116981 Ga0065715_101169812 374
8 3300005327 Ga0070658_10027674 Ga0070658_100276742 374
9 3300005548 Ga0070665_100167591 Ga0070665_1001675912 374
10 3300006038 Ga0075365_10039395 Ga0075365_100393953 374
11 3300006048 Ga0075363_100002880 Ga0075363_1000028809 374
12 3300006051 Ga0075364_10016505 Ga0075364_100165054 374
13 3300006353 Ga0075370_10002544 Ga0075370_100025444 374
14 3300006847 Ga0075431_100026376 Ga0075431_1000263764 374
15 3300006880 Ga0075429_100070201 Ga0075429_1000702013 374
16 3300007788 Ga0099795_10007396 Ga0099795_100073961 374
17 3300009093 Ga0105240_10448080 Ga0105240_104480801 374
18 3300009147 Ga0114129_10021818 Ga0114129_100218189 374
19 3300009545 Ga0105237_10114838 Ga0105237_101148382 374
20 3300009551 Ga0105238_10009521 Ga0105238_100095218 374
21 3300010375 Ga0105239_10064105 Ga0105239_100641053 374
22 3300010375 Ga0105239_10242163 Ga0105239_102421632 374
23 3300010375 Ga0105239_10267167 Ga0105239_102671672 374
24 3300026041 Ga0207639_10032148 Ga0207639_100321483 374
25 3300026078 Ga0207702_10075186 Ga0207702_100751862 374
26 3300031241 Ga0265325_10057213 Ga0265325_100572132 374
27 3300035692 Ga0373935_0192941 Ga0373935_0192941_34_1167 374
28 3300035695 Ga0373927_0012133 Ga0373927_0012133_3897_5030 374
29 3300037068 Ga0373925_0077879 Ga0373925_0077879_433_1566 374
30 3300037418 Ga0395900_0064212 Ga0395900_0064212_744_1991 374
31 3300037471 Ga0395905_0084176 Ga0395905_0084176_1634_2860 374
32 3300037471 Ga0395905_0138009 Ga0395905_0138009_1030_2235 374
33 3300046526 Ga0495666_0094672 Ga0495666_0094672_32_1165 374
34 3300046660 Ga0495625_0123959 Ga0495625_0123959_539_1693 374
35 3300046683 Ga0495658_0009239 Ga0495658_0009239_854_1987 374
36 3300050490 nmdc:mga03n38_13266_c1 nmdc:mga03n38_13266_c1_1007_2233 374
37 3300050492 nmdc:mga0yw44_30206_c1 nmdc:mga0yw44_30206_c1_1561_2787 374
38 3300050508 nmdc:mga09592_104661_c1 nmdc:mga09592_104661_c1_937_2061 374
39 3300050510 nmdc:mga06r32_42434_c1 nmdc:mga06r32_42434_c1_2987_4111 374
40 iso_pu_bacteria 2507262055 2507511874 374
41 iso_pu_bacteria 2508501009 2508545538 374
42 iso_pu_bacteria 2508501042 2508694356 374
43 iso_pu_bacteria 2511231028 2511396661 374
44 iso_pu_bacteria 2513237090 2513609237 374
45 iso_pu_bacteria 2513237092 2513627762 374
46 iso_pu_bacteria 2513237095 2513651097 374
47 iso_pu_bacteria 2513237102 2513703539 374
48 iso_pu_bacteria 2513237104 2513717795 374
49 iso_pu_bacteria 2513237161 2514014403 374
50 iso_pu_bacteria 2515154112 2515624713 374
51 iso_pu_bacteria 2517093001 2517108570 374
52 iso_pu_bacteria 2524023205 2524438316 374
53 iso_pu_bacteria 2528768022 2528854953 374
54 iso_pu_bacteria 2588253730 2588517685 374
55 iso_pu_bacteria 2599185301 2599937830 374
56 iso_pu_bacteria 2617270735 2617349627 374
57 iso_pu_bacteria 2744054633 2745078538 374
58 iso_pu_bacteria 2791355196 2793059635 374
59 iso_pu_bacteria 2802429603 2805921870 374
60 iso_pu_bacteria 2816332527 2818242187 374
61 iso_pu_bacteria 2824600985 2824608013 374
62 iso_pu_bacteria 2824609381 2824615053 374
63 iso_pu_bacteria 2824617872 2824624847 374
64 iso_pu_bacteria 2824626560 2824633747 374
65 iso_pu_bacteria 2824635225 2824642310 374
66 iso_pu_bacteria 2824644064 2824649644 374
67 iso_pu_bacteria 2824653114 2824659527 374
68 iso_pu_bacteria 2824661429 2824670055 374
69 iso_pu_bacteria 2824671348 2824676706 374
70 iso_pu_bacteria 2824679649 2824686167 374
71 iso_pu_bacteria 2824687955 2824692993 374
72 iso_pu_bacteria 2824696289 2824702582 374
73 iso_pu_bacteria 2824704595 2824711455 374
74 iso_pu_bacteria 2824714736 2824719746 374
75 iso_pu_bacteria 2824723954 2824730049 374
76 iso_pu_bacteria 2824732956 2824738290 374
77 iso_pu_bacteria 2824746037 2824751733 374
78 iso_pu_bacteria 2824753945 2824762971 374
79 iso_pu_bacteria 2824763712 2824772960 374
80 iso_pu_bacteria 2824773399 2824776993 374
81 iso_pu_bacteria 2838074704 2838080725 374
82 iso_pu_bacteria 2838122688 2838128389 374
83 iso_pu_bacteria 2841941048 2841942249 374
84 iso_pu_bacteria 2841949485 2841955621 374
85 iso_pu_bacteria 2841957949 2841963517 374
86 iso_pu_bacteria 2841966195 2841971230 374
87 iso_pu_bacteria 2841974524 2841982350 374
88 iso_pu_bacteria 2841983080 2841984263 374
89 iso_pu_bacteria 2842038055 2842042005 374
90 iso_pu_bacteria 2842045827 2842050048 374
91 iso_pu_bacteria 2844315083 2844321091 374
92 iso_pu_bacteria 2847686936 2847687803 374
93 iso_pu_bacteria 2847930680 2847932307 374
94 iso_pu_bacteria 2847939898 2847943543 374
95 iso_pu_bacteria 2849076700 2849077265 374
96 iso_pu_bacteria 2856356410 2856361771 374
97 iso_pu_bacteria 2857509624 2857515160 374
98 iso_pu_bacteria 2871488783 2871493774 374
99 iso_pu_bacteria 2871495908 2871501151 374
100 iso_pu_bacteria 2874102143 2874106228 374
101 iso_pu_bacteria 2874590934 2874592254 374
102 iso_pu_bacteria 2874612657 2874618722 374
103 iso_pu_bacteria 2874620515 2874624008 374
104 iso_pu_bacteria 2874628541 2874630985 374
105 iso_pu_bacteria 2874645413 2874647370 374
106 iso_pu_bacteria 2876392853 2876399661 374
107 iso_pu_bacteria 2876761206 2876767412 374
108 iso_pu_bacteria 2876771140 2876774781 374
109 iso_pu_bacteria 2876818435 2876819734 374
110 iso_pu_bacteria 2878753008 2878756350 374
111 iso_pu_bacteria 2878760144 2878765142 374
112 iso_pu_bacteria 2878767105 2878772332 374
113 iso_pu_bacteria 2879074833 2879079349 374
114 iso_pu_bacteria 2879083081 2879091528 374
115 iso_pu_bacteria 2879099564 2879101401 374
116 iso_pu_bacteria 2879127579 2879129083 374
117 iso_pu_bacteria 2879142872 2879144762 374
118 iso_pu_bacteria 2881161766 2881162620 374
119 iso_pu_bacteria 2881364244 2881371132 374
120 iso_pu_bacteria 2881665667 2881673236 374
121 iso_pu_bacteria 2881845957 2881849976 374
122 iso_pu_bacteria 2881861095 2881866797 374
123 iso_pu_bacteria 2882912400 2882913146 374
124 iso_pu_bacteria 2885305155 2885311432 374
125 iso_pu_bacteria 2885318864 2885325487 374
126 iso_pu_bacteria 2885326080 2885329064 374
127 iso_pu_bacteria 2885334103 2885340478 374
128 iso_pu_bacteria 2885366525 2885374062 374
129 iso_pu_bacteria 2888378607 2888387384 374
130 iso_pu_bacteria 2888388044 2888391819 374
131 iso_pu_bacteria 2888419890 2888426605 374
132 iso_pu_bacteria 2903492973 2903502722 374
133 iso_pu_bacteria 2903540706 2903545964 374
134 iso_pu_bacteria 2903727486 2903728514 374
135 iso_pu_bacteria 2904659560 2904666188 374
136 iso_pu_bacteria 2904666416 2904670719 374
137 iso_pu_bacteria 2904711408 2904718960 374
138 iso_pu_bacteria 2906328253 2906332191 374
139 iso_pu_bacteria 2906602504 2906607706 374
140 iso_pu_bacteria 2906626472 2906629325 374
141 iso_pu_bacteria 2906643746 2906645376 374
142 iso_pu_bacteria 2922368715 2922370561 374
143 iso_pu_bacteria 2922393267 2922396438 374
144 iso_pu_bacteria 2924784321 2924787923 374
145 iso_pu_bacteria 2929615660 2929620137 374
146 iso_pu_bacteria 2929624759 2929629450 374
147 iso_pu_bacteria 2932784394 2932791492 374
148 iso_pu_bacteria 2932809354 2932816748 374
149 iso_pu_bacteria 2932818245 2932824070 374
150 iso_pu_bacteria 2932828146 2932835394 374
151 iso_pu_bacteria 2933577622 2933582054 374
152 iso_pu_bacteria 2935608549 2935613483 374
153 iso_pu_bacteria 2935616580 2935621137 374
154 iso_pu_bacteria 2935638405 2935643556 374
155 iso_pu_bacteria 2935648319 2935650479 374
156 iso_pu_bacteria 2935656913 2935662921 374
157 iso_pu_bacteria 2935665750 2935671134 374
158 iso_pu_bacteria 2935675223 2935681260 374
159 iso_pu_bacteria 2935684952 2935689397 374
160 iso_pu_bacteria 2935694250 2935699972 374
161 iso_pu_bacteria 2935703347 2935712097 374
162 iso_pu_bacteria 2935713505 2935720343 374
163 iso_pu_bacteria 2935722832 2935728040 374
164 iso_pu_bacteria 2935732158 2935737363 374
165 iso_pu_bacteria 2935741537 2935746576 374
166 iso_pu_bacteria 2935750917 2935757543 374
167 iso_pu_bacteria 2935760218 2935763920 374
168 iso_pu_bacteria 2935777560 2935781533 374
169 iso_pu_bacteria 2935801545 2935807897 374
170 iso_pu_bacteria 2935810662 2935818769 374
171 iso_pu_bacteria 2935819856 2935824664 374
172 iso_pu_bacteria 2935827899 2935833073 374
173 iso_pu_bacteria 2935837841 2935844271 374
174 iso_pu_bacteria 2935847175 2935851884 374
175 iso_pu_bacteria 2935855204 2935859670 374
176 iso_pu_bacteria 2935864058 2935872068 374
177 iso_pu_bacteria 2935873716 2935879008 374
178 iso_pu_bacteria 2935908558 2935911234 374
179 iso_pu_bacteria 2935916978 2935920766 374
180 iso_pu_bacteria 2935926038 2935928263 374
181 iso_pu_bacteria 2935934488 2935937908 374
182 iso_pu_bacteria 2935942939 2935945190 374
183 iso_pu_bacteria 2935951376 2935954304 374
184 iso_pu_bacteria 2935959822 2935965617 374
185 iso_pu_bacteria 2935967501 2935971428 374
186 iso_pu_bacteria 2935975950 2935982048 374
187 iso_pu_bacteria 2935984226 2935990613 374
188 iso_pu_bacteria 2935992306 2936000355 374
189 iso_pu_bacteria 2936002035 2936008513 374
190 iso_pu_bacteria 2936011229 2936017165 374
191 iso_pu_bacteria 2936019824 2936026700 374
192 iso_pu_bacteria 2936028420 2936035443 374
193 iso_pu_bacteria 2936037263 2936045579 374
194 iso_pu_bacteria 2936046547 2936053592 374
195 iso_pu_bacteria 2936055302 2936062670 374
196 iso_pu_bacteria 2937891427 2937891653 374
197 iso_pu_bacteria 2937994558 2937999820 374
198 iso_pu_bacteria 2938014810 2938018570 374
199 iso_pu_bacteria 2940556831 2940563635 374
200 iso_pu_bacteria 2941538514 2941542603 374
201 iso_pu_bacteria 2958115193 2958117222 374
202 iso_pu_bacteria 2958165035 2958170285 374
203 iso_pu_bacteria 2961114664 2961121531 374
204 iso_pu_bacteria 2961163497 2961168737 374
205 iso_pu_bacteria 2961170736 2961172639 374
206 iso_pu_bacteria 2965018300 2965023529 374
207 iso_pu_bacteria 2967996073 2967997851 374
208 iso_pu_bacteria 2968003550 2968008502 374
209 iso_pu_bacteria 2968097103 2968098263 374
210 iso_pu_bacteria 2968110612 2968117684 374
211 iso_pu_bacteria 2968171901 2968177143 374
212 iso_pu_bacteria 2970503327 2970505233 374
213 iso_pu_bacteria 2970554993 2970559989 374
214 iso_pu_bacteria 2977821940 2977825531 374
215 iso_pu_bacteria 2977828996 2977832445 374
216 iso_pu_bacteria 2977858184 2977864829 374
217 iso_pu_bacteria 2979779861 2979780065 374
218 iso_pu_bacteria 2979808191 2979809954 374
219 iso_pu_bacteria 2987659509 2987664769 374
220 iso_pu_bacteria 3004188549 3004193825 374
221 iso_pu_bacteria 3005483717 3005490194 374
222 iso_pu_bacteria 3005587118 3005591715 374
223 iso_pu_bacteria 3005710791 3005717153 374
224 iso_pu_bacteria 3005718088 3005724124 374
225 iso_pu_bacteria 8004374579 8004377939 374
226 iso_pu_bacteria 8004445564 8004451151 374
227 iso_pu_bacteria 8004703790 8004711105 374
228 iso_pu_bacteria 8006926726 8006929466 374
229 iso_pu_bacteria 8016511872 8016519491 374
230 iso_pu_bacteria 8016548790 8016550559 374
231 iso_pu_bacteria 8016583857 8016588687 374
232 iso_pu_bacteria 8016630954 8016637189 374
233 iso_pu_bacteria 8017057580 8017066031 374
234 iso_pu_bacteria 8019538911 8019541877 374
235 iso_pu_bacteria 8019576017 8019578601 374
236 iso_pu_bacteria 8019586578 8019596651 374
237 iso_pu_bacteria 8019597564 8019605052 374
238 iso_pu_bacteria 8019608314 8019613483 374
239 iso_pu_bacteria 8019629233 8019637874 374
240 iso_pu_bacteria 8019668869 8019675329 374
241 iso_pu_bacteria 8019678201 8019680776 374
242 iso_pu_bacteria 8019687851 8019694992 374
243 iso_pu_bacteria 8055742211 8055750110 374
244 iso_pu_bacteria 8056967851 8056975889 374
245 3300003214 JGI25165J46597_1005784 JGI25165J46597_10057842 375
246 3300003354 JGI25160J50197_1003229 JGI25160J50197_10032298 375
247 3300003354 JGI25160J50197_1007225 JGI25160J50197_10072255 375
248 3300003762 Ga0055542_1006782 Ga0055542_10067822 375
249 3300003794 Ga0055531_10010606 Ga0055531_100106064 375
250 3300004625 Ga0055543_1004550 Ga0055543_10045501 375
251 3300004625 Ga0055543_1013727 Ga0055543_10137271 375
252 3300005262 Ga0065165_1002476 Ga0065165_100247611 375
253 3300005262 Ga0065165_1022581 Ga0065165_10225812 375
254 3300005329 Ga0070683_100306551 Ga0070683_1003065511 375
255 3300005355 Ga0070671_100024253 Ga0070671_1000242533 375
256 3300005436 Ga0070713_100084577 Ga0070713_1000845772 375
257 3300005459 Ga0068867_100225597 Ga0068867_1002255972 375
258 3300005548 Ga0070665_100024056 Ga0070665_1000240563 375
259 3300005564 Ga0070664_100351603 Ga0070664_1003516031 375
260 3300005719 Ga0068861_100038125 Ga0068861_1000381252 375
261 3300005983 Ga0081540_1003809 Ga0081540_10038095 375
262 3300006038 Ga0075365_10063288 Ga0075365_100632883 375
263 3300006042 Ga0075368_10001970 Ga0075368_100019703 375
264 3300006048 Ga0075363_100012377 Ga0075363_1000123774 375
265 3300006051 Ga0075364_10095620 Ga0075364_100956202 375
266 3300006186 Ga0075369_10055983 Ga0075369_100559832 375
267 3300006195 Ga0075366_10023925 Ga0075366_100239253 375
268 3300006353 Ga0075370_10017867 Ga0075370_100178673 375
269 3300006844 Ga0075428_100020439 Ga0075428_1000204395 375
270 3300006846 Ga0075430_100007526 Ga0075430_1000075268 375
271 3300006847 Ga0075431_100020676 Ga0075431_1000206761 375
272 3300006852 Ga0075433_10007493 Ga0075433_100074932 375
273 3300006852 Ga0075433_10093255 Ga0075433_100932552 375
274 3300006852 Ga0075433_10151833 Ga0075433_101518332 375
275 3300006871 Ga0075434_100379866 Ga0075434_1003798661 375
276 3300006880 Ga0075429_100159168 Ga0075429_1001591682 375
277 3300006942 Ga0099824_1008513 Ga0099824_100851314 375
278 3300006944 Ga0099823_1004051 Ga0099823_10040516 375
279 3300007076 Ga0075435_100037674 Ga0075435_1000376742 375
280 3300007265 Ga0099794_10014407 Ga0099794_100144072 375
281 3300009094 Ga0111539_10004128 Ga0111539_1000412813 375
282 3300009174 Ga0105241_10052381 Ga0105241_100523814 375
283 3300009545 Ga0105237_10098727 Ga0105237_100987273 375
284 3300009551 Ga0105238_10013778 Ga0105238_100137782 375
285 3300010375 Ga0105239_10102667 Ga0105239_101026673 375
286 3300010375 Ga0105239_10587753 Ga0105239_105877531 375
287 3300014325 Ga0163163_10168817 Ga0163163_101688172 375
288 3300014497 Ga0182008_10057241 Ga0182008_100572412 375
289 3300021320 Ga0214544_1000163 Ga0214544_100016377 375
290 3300021321 Ga0214542_1000156 Ga0214542_100015633 375
291 3300021324 Ga0214545_1000078 Ga0214545_100007877 375
292 3300021327 Ga0214543_1000136 Ga0214543_100013677 375
293 3300025230 Ga0209563_104066 Ga0209563_1040661 375
294 3300025254 Ga0209148_1000232 Ga0209148_100023215 375
295 3300025261 Ga0209233_1001298 Ga0209233_10012983 375
296 3300025261 Ga0209233_1007012 Ga0209233_10070123 375
297 3300025272 Ga0209455_1002245 Ga0209455_10022457 375
298 3300025295 Ga0209564_1013870 Ga0209564_10138703 375
299 3300025297 Ga0209758_1000705 Ga0209758_100070530 375
300 3300025297 Ga0209758_1000986 Ga0209758_100098614 375
301 3300025297 Ga0209758_1002299 Ga0209758_100229917 375
302 3300025297 Ga0209758_1005881 Ga0209758_100588110 375
303 3300025299 Ga0209256_1008548 Ga0209256_10085483 375
304 3300025302 Ga0207426_1000632 Ga0207426_100063210 375
305 3300025302 Ga0207426_1015236 Ga0207426_10152362 375
306 3300025304 Ga0209257_1001185 Ga0209257_100118534 375
307 3300025304 Ga0209257_1010432 Ga0209257_10104322 375
308 3300025315 Ga0207697_10062690 Ga0207697_100626902 375
309 3300025904 Ga0207647_10065485 Ga0207647_100654851 375
310 3300025914 Ga0207671_10108200 Ga0207671_101082003 375
311 3300025915 Ga0207693_10237673 Ga0207693_102376731 375
312 3300025928 Ga0207700_10046679 Ga0207700_100466792 375
313 3300025931 Ga0207644_10156758 Ga0207644_101567581 375
314 3300025934 Ga0207686_10230259 Ga0207686_102302591 375
315 3300025941 Ga0207711_10180258 Ga0207711_101802582 375
316 3300025944 Ga0207661_10286338 Ga0207661_102863382 375
317 3300026035 Ga0207703_10065560 Ga0207703_100655601 375
318 3300026067 Ga0207678_10229216 Ga0207678_102292161 375
319 3300026089 Ga0207648_10259651 Ga0207648_102596511 375
320 3300027296 Ga0209389_1000019 Ga0209389_100001964 375
321 3300027296 Ga0209389_1000248 Ga0209389_100024817 375
322 3300027357 Ga0209589_1001871 Ga0209589_100187117 375
323 3300027361 Ga0209489_100033 Ga0209489_10003363 375
324 3300027361 Ga0209489_102684 Ga0209489_10268417 375
325 3300027363 Ga0209700_100012 Ga0209700_100012305 375
326 3300027866 Ga0209813_10032452 Ga0209813_100324522 375
327 3300028379 Ga0268266_10009477 Ga0268266_100094774 375
328 3300028573 Ga0265334_10048657 Ga0265334_100486571 375
329 3300028653 Ga0265323_10000498 Ga0265323_1000049821 375
330 3300028666 Ga0265336_10000187 Ga0265336_1000018737 375
331 3300028800 Ga0265338_10001016 Ga0265338_100010161 375
332 3300029957 Ga0265324_10023195 Ga0265324_100231952 375
333 3300031241 Ga0265325_10016565 Ga0265325_100165654 375
334 3300031249 Ga0265339_10011032 Ga0265339_100110324 375
335 3300031249 Ga0265339_10012299 Ga0265339_100122993 375
336 3300031249 Ga0265339_10031655 Ga0265339_100316553 375
337 3300031595 Ga0265313_10007801 Ga0265313_100078012 375
338 3300031711 Ga0265314_10069516 Ga0265314_100695162 375
339 3300031712 Ga0265342_10005406 Ga0265342_100054065 375
340 3300035692 Ga0373935_0005677 Ga0373935_0005677_5864_7000 375
341 3300035725 Ga0373947_0076629 Ga0373947_0076629_157_1293 375
342 3300037068 Ga0373925_0027415 Ga0373925_0027415_87_1223 375
343 3300037466 Ga0395898_0040780 Ga0395898_0040780_2659_3795 375
344 3300037466 Ga0395898_0194893 Ga0395898_0194893_239_1375 375
345 3300037471 Ga0395905_0026848 Ga0395905_0026848_1963_3099 375
346 3300037471 Ga0395905_0110414 Ga0395905_0110414_1043_2179 375
347 3300037853 Ga0436364_0879211 Ga0436364_0879211_1573_2709 375
348 3300038443 Ga0395901_0034257 Ga0395901_0034257_2983_4119 375
349 3300039447 Ga0436361_1074854 Ga0436361_1074854_3597_4736 375
350 3300041453 Ga0451797_1189235 Ga0451797_1189235_35_1171 375
351 3300044658 Ga0466972_0031361 Ga0466972_0031361_1167_2303 375
352 3300044684 Ga0466966_0094249 Ga0466966_0094249_14_1150 375
353 3300044694 Ga0466963_0029700 Ga0466963_0029700_548_1684 375
354 3300045049 Ga0466959_0033641 Ga0466959_0033641_1546_2682 375
355 3300045976 Ga0466967_0146409 Ga0466967_0146409_903_2039 375
356 3300046454 Ga0495592_0024501 Ga0495592_0024501_2070_3233 375
357 3300046459 Ga0495629_0044604 Ga0495629_0044604_1347_2483 375
358 3300046462 Ga0495651_0001839 Ga0495651_0001839_8637_9800 375
359 3300046463 Ga0495653_0076046 Ga0495653_0076046_895_2058 375
360 3300046472 Ga0495580_0011443 Ga0495580_0011443_5590_6738 375
361 3300046473 Ga0495582_0159592 Ga0495582_0159592_43_1179 375
362 3300046511 Ga0495608_0024703 Ga0495608_0024703_496_1659 375
363 3300046514 Ga0495618_0133201 Ga0495618_0133201_313_1449 375
364 3300046516 Ga0495628_0026676 Ga0495628_0026676_2650_3813 375
365 3300046517 Ga0495630_0319363 Ga0495630_0319363_41_1177 375
366 3300046522 Ga0495643_0013829 Ga0495643_0013829_3047_4183 375
367 3300046529 Ga0495652_0011343 Ga0495652_0011343_192_1355 375
368 3300046533 Ga0495640_0076374 Ga0495640_0076374_870_2006 375
369 3300046536 Ga0495587_0023897 Ga0495587_0023897_2182_3345 375
370 3300046542 Ga0495597_0078986 Ga0495597_0078986_88_1224 375
371 3300046543 Ga0495645_0005611 Ga0495645_0005611_2716_3879 375
372 3300046663 Ga0495635_0030666 Ga0495635_0030666_1253_2389 375
373 3300046674 Ga0495588_0020997 Ga0495588_0020997_395_1531 375
374 3300046675 Ga0495657_0004591 Ga0495657_0004591_6633_7796 375
375 3300046678 Ga0495599_0005172 Ga0495599_0005172_6213_7376 375
376 3300046679 Ga0495623_0030892 Ga0495623_0030892_840_2003 375
377 3300046680 Ga0495646_0087624 Ga0495646_0087624_188_1324 375
378 3300046683 Ga0495658_0002851 Ga0495658_0002851_4083_5231 375
379 3300046809 Ga0495600_0015147 Ga0495600_0015147_605_1768 375
380 3300047317 Ga0495604_0201437 Ga0495604_0201437_186_1349 375
381 3300047319 Ga0495674_0011929 Ga0495674_0011929_2553_3716 375
382 3300047320 Ga0495672_0101348 Ga0495672_0101348_203_1339 375
383 3300047321 Ga0495676_0032821 Ga0495676_0032821_894_2030 375
384 3300047322 Ga0495680_0001654 Ga0495680_0001654_10555_11718 375
385 3300047471 Ga0495684_0085404 Ga0495684_0085404_440_1603 375
386 3300048904 Ga0496101_0096070 Ga0496101_0096070_880_2016 375
387 3300048905 Ga0496102_0125437 Ga0496102_0125437_1155_2291 375
388 3300048906 Ga0496103_0013626 Ga0496103_0013626_3065_4201 375
389 3300048907 Ga0496104_0007787 Ga0496104_0007787_7428_8564 375
390 3300048907 Ga0496104_0011552 Ga0496104_0011552_6701_7837 375
391 3300048908 Ga0496105_0015800 Ga0496105_0015800_902_2038 375
392 3300048909 Ga0496106_0006865 Ga0496106_0006865_3802_4938 375
393 3300048911 Ga0496108_0026234 Ga0496108_0026234_3447_4583 375
394 3300048915 Ga0496112_0024108 Ga0496112_0024108_269_1405 375
395 3300048916 Ga0496113_0056499 Ga0496113_0056499_1761_2897 375
396 3300048918 Ga0496115_0023466 Ga0496115_0023466_3348_4484 375
397 3300048918 Ga0496115_0034919 Ga0496115_0034919_894_2030 375
398 3300048918 Ga0496115_0122854 Ga0496115_0122854_855_1991 375
399 3300048922 Ga0496119_0020758 Ga0496119_0020758_2291_3427 375
400 3300048923 Ga0496120_0013345 Ga0496120_0013345_4161_5297 375
401 3300048924 Ga0496121_0015737 Ga0496121_0015737_3554_4690 375
402 3300048924 Ga0496121_0053118 Ga0496121_0053118_923_2059 375
403 3300048929 Ga0496126_0035526 Ga0496126_0035526_733_1869 375
404 3300049571 Ga0501034_0372974 Ga0501034_0372974_138_1295 375
405 3300049588 Ga0501072_0275789 Ga0501072_0275789_122_1258 375
406 3300050490 nmdc:mga03n38_7124_c1 nmdc:mga03n38_7124_c1_567_1703 375
407 3300050491 nmdc:mga00v17_124340_c1 nmdc:mga00v17_124340_c1_144_1280 375
408 3300050492 nmdc:mga0yw44_149246_c1 nmdc:mga0yw44_149246_c1_276_1412 375
409 3300050492 nmdc:mga0yw44_37486_c1 nmdc:mga0yw44_37486_c1_297_1433 375
410 3300050492 nmdc:mga0yw44_43992_c1 nmdc:mga0yw44_43992_c1_820_1956 375
411 3300050493 nmdc:mga0k408_7165_c2 nmdc:mga0k408_7165_c2_2513_3649 375
412 3300050494 nmdc:mga06z11_46920_c1 nmdc:mga06z11_46920_c1_924_2060 375
413 3300050495 nmdc:mga04h51_18406_c1 nmdc:mga04h51_18406_c1_623_1759 375
414 3300050496 nmdc:mga07m45_18804_c1 nmdc:mga07m45_18804_c1_478_1614 375
415 3300050509 nmdc:mga0qj67_9856_c1 nmdc:mga0qj67_9856_c1_2412_3548 375
416 3300050513 nmdc:mga0rr50_28999_c1 nmdc:mga0rr50_28999_c1_1744_2880 375
417 3300050515 nmdc:mga0a205_132792_c1 nmdc:mga0a205_132792_c1_600_1736 375
418 3300050516 nmdc:mga0sz30_83056_c1 nmdc:mga0sz30_83056_c1_131_1267 375
419 3300053085 Ga0495619_0171497 Ga0495619_0171497_18_1181 375
420 3300053086 Ga0500578_0167301 Ga0500578_0167301_136_1299 375
421 3300053103 Ga0500555_007835 Ga0500555_007835_59_1222 375
422 3300053111 Ga0500572_005340 Ga0500572_005340_1630_2766 375
423 3300053130 Ga0500642_0000381 Ga0500642_0000381_5737_6873 375
424 3300053136 Ga0500559_0000550 Ga0500559_0000550_15435_16571 375
425 iso_pu_bacteria 2513237094 2513643307 375
426 iso_pu_bacteria 2617270741 2617376813 375
427 iso_pu_bacteria 2643221547 2643757516 375
428 iso_pu_bacteria 2767802442 2770196034 375
429 iso_pu_bacteria 2908775508 2908782711 375
430 iso_pu_bacteria 2932794094 2932796895 375
431 iso_pu_bacteria 2932801729 2932802327 375
432 iso_pu_bacteria 2935785616 2935789851 375
433 iso_pu_bacteria 2935793552 2935798383 375
434 iso_pu_bacteria 2935883170 2935887233 375
435 iso_pu_bacteria 2941531003 2941537267 375
436 iso_pu_bacteria 3005594810 3005601431 375
437 iso_pu_bacteria 8016522445 8016524866 375
438 iso_pu_bacteria 8016539877 8016542722 375
439 iso_pu_bacteria 8016575299 8016580782 375
440 iso_pu_bacteria 8016595262 8016596940 375
441 iso_pu_bacteria 8016603502 8016607848 375
442 iso_pu_bacteria 8016613128 8016619631 375
443 iso_pu_bacteria 8016622563 8016629977 375
444 iso_pu_bacteria 8019547302 8019548921 375
445 iso_pu_bacteria 8019619141 8019624153 375
446 iso_pu_bacteria 8019638758 8019641750 375
447 iso_pu_bacteria 8019648815 8019653673 375
448 3300001990 JGI24737J22298_10008874 JGI24737J22298_100088742 376
449 3300002070 JGI24750J21931_1000382 JGI24750J21931_10003827 376
450 3300002077 JGI24744J21845_10001405 JGI24744J21845_100014053 376
451 3300002239 JGI24034J26672_10001624 JGI24034J26672_100016243 376
452 3300002244 JGI24742J22300_10000921 JGI24742J22300_100009213 376
453 3300002459 JGI24751J29686_10001730 JGI24751J29686_100017303 376
454 3300003320 rootH2_10015505 rootH2_100155054 376
455 3300003354 JGI25160J50197_1011223 JGI25160J50197_10112233 376
456 3300005262 Ga0065165_1002846 Ga0065165_100284610 376
457 3300005327 Ga0070658_10040277 Ga0070658_100402774 376
458 3300005329 Ga0070683_100327714 Ga0070683_1003277141 376
459 3300005330 Ga0070690_100008826 Ga0070690_1000088262 376
460 3300005330 Ga0070690_100042239 Ga0070690_1000422393 376
461 3300005331 Ga0070670_100002977 Ga0070670_1000029778 376
462 3300005331 Ga0070670_100008937 Ga0070670_1000089373 376
463 3300005331 Ga0070670_100028505 Ga0070670_1000285053 376
464 3300005334 Ga0068869_100008177 Ga0068869_1000081773 376
465 3300005336 Ga0070680_100031622 Ga0070680_1000316223 376
466 3300005338 Ga0068868_100015712 Ga0068868_1000157126 376
467 3300005340 Ga0070689_100002815 Ga0070689_1000028154 376
468 3300005340 Ga0070689_100007192 Ga0070689_1000071928 376
469 3300005347 Ga0070668_100054855 Ga0070668_1000548552 376
470 3300005353 Ga0070669_100025557 Ga0070669_1000255575 376
471 3300005354 Ga0070675_100016259 Ga0070675_1000162594 376
472 3300005354 Ga0070675_100083571 Ga0070675_1000835712 376
473 3300005355 Ga0070671_100004776 Ga0070671_1000047763 376
474 3300005356 Ga0070674_100072201 Ga0070674_1000722012 376
475 3300005356 Ga0070674_100130993 Ga0070674_1001309932 376
476 3300005364 Ga0070673_100006320 Ga0070673_1000063203 376
477 3300005364 Ga0070673_100097118 Ga0070673_1000971182 376
478 3300005365 Ga0070688_100022058 Ga0070688_1000220584 376
479 3300005435 Ga0070714_100000214 Ga0070714_1000002143 376
480 3300005435 Ga0070714_100167219 Ga0070714_1001672192 376
481 3300005436 Ga0070713_100036597 Ga0070713_1000365973 376
482 3300005438 Ga0070701_10005926 Ga0070701_100059264 376
483 3300005439 Ga0070711_100040720 Ga0070711_1000407202 376
484 3300005440 Ga0070705_100073406 Ga0070705_1000734062 376
485 3300005441 Ga0070700_100005394 Ga0070700_1000053944 376
486 3300005455 Ga0070663_100015368 Ga0070663_1000153683 376
487 3300005456 Ga0070678_100079363 Ga0070678_1000793632 376
488 3300005457 Ga0070662_100032717 Ga0070662_1000327172 376
489 3300005459 Ga0068867_100027479 Ga0068867_1000274791 376
490 3300005459 Ga0068867_100056366 Ga0068867_1000563662 376
491 3300005466 Ga0070685_10002191 Ga0070685_100021917 376
492 3300005530 Ga0070679_100009709 Ga0070679_1000097099 376
493 3300005539 Ga0068853_100044985 Ga0068853_1000449853 376
494 3300005543 Ga0070672_100003443 Ga0070672_1000034434 376
495 3300005543 Ga0070672_100169329 Ga0070672_1001693292 376
496 3300005544 Ga0070686_100003076 Ga0070686_10000307610 376
497 3300005545 Ga0070695_100023103 Ga0070695_1000231033 376
498 3300005548 Ga0070665_100048262 Ga0070665_1000482623 376
499 3300005548 Ga0070665_100076147 Ga0070665_1000761473 376
500 3300005548 Ga0070665_100193718 Ga0070665_1001937183 376
501 3300005578 Ga0068854_100022938 Ga0068854_1000229383 376
502 3300005615 Ga0070702_100007919 Ga0070702_1000079193 376
503 3300005616 Ga0068852_100035617 Ga0068852_1000356174 376
504 3300005616 Ga0068852_100050258 Ga0068852_1000502583 376
505 3300005618 Ga0068864_100011952 Ga0068864_1000119524 376
506 3300005840 Ga0068870_10001327 Ga0068870_100013277 376
507 3300005841 Ga0068863_100058152 Ga0068863_1000581523 376
508 3300005842 Ga0068858_100011270 Ga0068858_1000112702 376
509 3300005843 Ga0068860_100006468 Ga0068860_1000064686 376
510 3300005844 Ga0068862_100010288 Ga0068862_1000102884 376
511 3300005983 Ga0081540_1021644 Ga0081540_10216441 376
512 3300005985 Ga0081539_10042016 Ga0081539_100420162 376
513 3300006028 Ga0070717_10089776 Ga0070717_100897763 376
514 3300006038 Ga0075365_10006872 Ga0075365_100068722 376
515 3300006163 Ga0070715_10074759 Ga0070715_100747591 376
516 3300006175 Ga0070712_100029075 Ga0070712_1000290753 376
517 3300006178 Ga0075367_10117295 Ga0075367_101172951 376
518 3300006186 Ga0075369_10066091 Ga0075369_100660912 376
519 3300006195 Ga0075366_10027952 Ga0075366_100279522 376
520 3300006237 Ga0097621_100036852 Ga0097621_1000368524 376
521 3300006844 Ga0075428_100001783 Ga0075428_1000017838 376
522 3300006844 Ga0075428_100072368 Ga0075428_1000723683 376
523 3300006847 Ga0075431_100000003 Ga0075431_10000000311 376
524 3300006847 Ga0075431_100107206 Ga0075431_1001072063 376
525 3300006880 Ga0075429_100013494 Ga0075429_1000134944 376
526 3300006880 Ga0075429_100171874 Ga0075429_1001718742 376
527 3300006881 Ga0068865_100042213 Ga0068865_1000422133 376
528 3300009094 Ga0111539_10007426 Ga0111539_100074268 376
529 3300009094 Ga0111539_10033800 Ga0111539_100338001 376
530 3300009094 Ga0111539_10343855 Ga0111539_103438552 376
531 3300009101 Ga0105247_10031333 Ga0105247_100313332 376
532 3300009101 Ga0105247_10064159 Ga0105247_100641592 376
533 3300009147 Ga0114129_10000104 Ga0114129_100001046 376
534 3300009147 Ga0114129_10028120 Ga0114129_100281202 376
535 3300009147 Ga0114129_10070313 Ga0114129_100703136 376
536 3300009147 Ga0114129_10123428 Ga0114129_101234283 376
537 3300009176 Ga0105242_10139315 Ga0105242_101393153 376
538 3300009176 Ga0105242_10305872 Ga0105242_103058722 376
539 3300009177 Ga0105248_10098846 Ga0105248_100988463 376
540 3300009177 Ga0105248_10491014 Ga0105248_104910141 376
541 3300009545 Ga0105237_10019250 Ga0105237_100192507 376
542 3300009545 Ga0105237_10092647 Ga0105237_100926473 376
543 3300009551 Ga0105238_10116747 Ga0105238_101167473 376
544 3300009553 Ga0105249_10232658 Ga0105249_102326582 376
545 3300010375 Ga0105239_10050734 Ga0105239_100507345 376
546 3300010375 Ga0105239_10332318 Ga0105239_103323182 376
547 3300011119 Ga0105246_10020866 Ga0105246_100208662 376
548 3300011119 Ga0105246_10060053 Ga0105246_100600533 376
549 3300013296 Ga0157374_10029044 Ga0157374_100290443 376
550 3300013306 Ga0163162_10065535 Ga0163162_100655353 376
551 3300013308 Ga0157375_10023485 Ga0157375_100234854 376
552 3300014326 Ga0157380_10019349 Ga0157380_100193492 376
553 3300014326 Ga0157380_10219680 Ga0157380_102196802 376
554 3300014326 Ga0157380_10270516 Ga0157380_102705161 376
555 3300014326 Ga0157380_10295977 Ga0157380_102959772 376
556 3300014497 Ga0182008_10031207 Ga0182008_100312073 376
557 3300014968 Ga0157379_10018816 Ga0157379_100188163 376
558 3300014969 Ga0157376_10113500 Ga0157376_101135002 376
559 3300014969 Ga0157376_10165681 Ga0157376_101656812 376
560 3300017792 Ga0163161_10009513 Ga0163161_100095132 376
561 3300025297 Ga0209758_1000294 Ga0209758_100029476 376
562 3300025299 Ga0209256_1011833 Ga0209256_10118333 376
563 3300025302 Ga0207426_1001240 Ga0207426_10012408 376
564 3300025898 Ga0207692_10086198 Ga0207692_100861982 376
565 3300025899 Ga0207642_10033422 Ga0207642_100334222 376
566 3300025900 Ga0207710_10002863 Ga0207710_100028636 376
567 3300025901 Ga0207688_10000552 Ga0207688_100005529 376
568 3300025903 Ga0207680_10008395 Ga0207680_100083953 376
569 3300025904 Ga0207647_10015498 Ga0207647_100154983 376
570 3300025907 Ga0207645_10006892 Ga0207645_100068924 376
571 3300025908 Ga0207643_10081811 Ga0207643_100818111 376
572 3300025911 Ga0207654_10056393 Ga0207654_100563932 376
573 3300025913 Ga0207695_10000123 Ga0207695_1000012314 376
574 3300025914 Ga0207671_10009480 Ga0207671_100094803 376
575 3300025915 Ga0207693_10019950 Ga0207693_100199504 376
576 3300025916 Ga0207663_10091876 Ga0207663_100918763 376
577 3300025918 Ga0207662_10000805 Ga0207662_1000080512 376
578 3300025919 Ga0207657_10024966 Ga0207657_100249664 376
579 3300025919 Ga0207657_10084288 Ga0207657_100842882 376
580 3300025920 Ga0207649_10042813 Ga0207649_100428133 376
581 3300025921 Ga0207652_10074845 Ga0207652_100748452 376
582 3300025923 Ga0207681_10061879 Ga0207681_100618792 376
583 3300025924 Ga0207694_10212048 Ga0207694_102120481 376
584 3300025925 Ga0207650_10000973 Ga0207650_1000097310 376
585 3300025925 Ga0207650_10003057 Ga0207650_100030575 376
586 3300025925 Ga0207650_10012596 Ga0207650_100125962 376
587 3300025926 Ga0207659_10005491 Ga0207659_100054913 376
588 3300025926 Ga0207659_10126139 Ga0207659_101261393 376
589 3300025927 Ga0207687_10005331 Ga0207687_100053313 376
590 3300025927 Ga0207687_10159318 Ga0207687_101593182 376
591 3300025929 Ga0207664_10000016 Ga0207664_10000016131 376
592 3300025931 Ga0207644_10007567 Ga0207644_100075677 376
593 3300025931 Ga0207644_10039499 Ga0207644_100394991 376
594 3300025933 Ga0207706_10003516 Ga0207706_100035163 376
595 3300025933 Ga0207706_10080697 Ga0207706_100806973 376
596 3300025934 Ga0207686_10038341 Ga0207686_100383413 376
597 3300025936 Ga0207670_10212804 Ga0207670_102128042 376
598 3300025938 Ga0207704_10036811 Ga0207704_100368111 376
599 3300025939 Ga0207665_10151085 Ga0207665_101510851 376
600 3300025940 Ga0207691_10001422 Ga0207691_100014225 376
601 3300025940 Ga0207691_10097741 Ga0207691_100977413 376
602 3300025940 Ga0207691_10105524 Ga0207691_101055242 376
603 3300025941 Ga0207711_10172825 Ga0207711_101728253 376
604 3300025942 Ga0207689_10041758 Ga0207689_100417582 376
605 3300025944 Ga0207661_10292122 Ga0207661_102921222 376
606 3300025945 Ga0207679_10022311 Ga0207679_100223113 376
607 3300025960 Ga0207651_10008623 Ga0207651_100086232 376
608 3300025960 Ga0207651_10011401 Ga0207651_100114013 376
609 3300025961 Ga0207712_10099663 Ga0207712_100996632 376
610 3300025972 Ga0207668_10013750 Ga0207668_100137503 376
611 3300025981 Ga0207640_10296752 Ga0207640_102967521 376
612 3300025986 Ga0207658_10251690 Ga0207658_102516902 376
613 3300026023 Ga0207677_10018376 Ga0207677_100183763 376
614 3300026035 Ga0207703_10003706 Ga0207703_100037069 376
615 3300026041 Ga0207639_10083920 Ga0207639_100839202 376
616 3300026075 Ga0207708_10000402 Ga0207708_1000040217 376
617 3300026088 Ga0207641_10004016 Ga0207641_100040169 376
618 3300026089 Ga0207648_10001024 Ga0207648_1000102421 376
619 3300026089 Ga0207648_10026793 Ga0207648_100267933 376
620 3300026095 Ga0207676_10006308 Ga0207676_100063084 376
621 3300026116 Ga0207674_10114956 Ga0207674_101149562 376
622 3300026118 Ga0207675_100272084 Ga0207675_1002720841 376
623 3300026121 Ga0207683_10004966 Ga0207683_100049664 376
624 3300026121 Ga0207683_10039056 Ga0207683_100390561 376
625 3300026142 Ga0207698_10007558 Ga0207698_100075581 376
626 3300027907 Ga0207428_10008981 Ga0207428_100089818 376
627 3300028379 Ga0268266_10260314 Ga0268266_102603142 376
628 3300028380 Ga0268265_10035791 Ga0268265_100357911 376
629 3300028381 Ga0268264_10015936 Ga0268264_100159364 376
630 3300028800 Ga0265338_10126144 Ga0265338_101261443 376
631 3300031241 Ga0265325_10001055 Ga0265325_1000105522 376
632 3300031241 Ga0265325_10033276 Ga0265325_100332763 376
633 3300031247 Ga0265340_10070405 Ga0265340_100704052 376
634 3300031249 Ga0265339_10000201 Ga0265339_1000020110 376
635 3300031595 Ga0265313_10000152 Ga0265313_1000015249 376
636 3300035111 Ga0373923_0060575 Ga0373923_0060575_445_1584 376
637 3300035117 Ga0373953_0044343 Ga0373953_0044343_28_1167 376
638 3300035119 Ga0373956_0006216 Ga0373956_0006216_597_1736 376
639 3300035119 Ga0373956_0012908 Ga0373956_0012908_1705_2844 376
640 3300035120 Ga0373957_0047750 Ga0373957_0047750_116_1255 376
641 3300035121 Ga0373960_0010152 Ga0373960_0010152_406_1590 376
642 3300035172 Ga0373955_0008230 Ga0373955_0008230_2454_3593 376
643 3300035172 Ga0373955_0074696 Ga0373955_0074696_634_1764 376
644 3300035172 Ga0373955_0089084 Ga0373955_0089084_209_1375 376
645 3300035241 Ga0373961_0024377 Ga0373961_0024377_423_1607 376
646 3300035242 Ga0373962_0027387 Ga0373962_0027387_363_1523 376
647 3300035410 Ga0373924_0017233 Ga0373924_0017233_1496_2626 376
648 3300035691 Ga0373931_0015917 Ga0373931_0015917_1651_2811 376
649 3300035691 Ga0373931_0063848 Ga0373931_0063848_382_1566 376
650 3300035692 Ga0373935_0117734 Ga0373935_0117734_155_1312 376
651 3300035695 Ga0373927_0172444 Ga0373927_0172444_47_1213 376
652 3300035724 Ga0373933_0001289 Ga0373933_0001289_3248_4387 376
653 3300035724 Ga0373933_0083376 Ga0373933_0083376_32_1162 376
654 3300035724 Ga0373933_0096387 Ga0373933_0096387_267_1406 376
655 3300035725 Ga0373947_0018469 Ga0373947_0018469_1006_2145 376
656 3300036401 Ga0373937_0009153 Ga0373937_0009153_3855_4994 376
657 3300036401 Ga0373937_0029828 Ga0373937_0029828_1213_2352 376
658 3300036401 Ga0373937_0363268 Ga0373937_0363268_134_1282 376
659 3300037068 Ga0373925_0153457 Ga0373925_0153457_332_1489 376
660 3300037418 Ga0395900_0396535 Ga0395900_0396535_124_1254 376
661 3300037471 Ga0395905_0381614 Ga0395905_0381614_55_1185 376
662 3300044656 Ga0466969_0030073 Ga0466969_0030073_801_1943 376
663 3300044658 Ga0466972_0000164 Ga0466972_0000164_32477_33619 376
664 3300044684 Ga0466966_0001614 Ga0466966_0001614_9505_10647 376
665 3300044684 Ga0466966_0045971 Ga0466966_0045971_377_1591 376
666 3300044693 Ga0466961_0000192 Ga0466961_0000192_10008_11150 376
667 3300044693 Ga0466961_0118147 Ga0466961_0118147_273_1415 376
668 3300044694 Ga0466963_0003423 Ga0466963_0003423_4805_6025 376
669 3300044765 Ga0466970_0026933 Ga0466970_0026933_734_1876 376
670 3300045049 Ga0466959_0000934 Ga0466959_0000934_10079_11221 376
671 3300045976 Ga0466967_0043144 Ga0466967_0043144_1864_3084 376
672 3300045976 Ga0466967_0063786 Ga0466967_0063786_1972_3204 376
673 3300046452 Ga0495617_059668 Ga0495617_059668_102_1241 376
674 3300046457 Ga0495590_0015955 Ga0495590_0015955_46_1188 376
675 3300046460 Ga0495638_0005230 Ga0495638_0005230_7309_8478 376
676 3300046462 Ga0495651_0000289 Ga0495651_0000289_10970_12109 376
677 3300046463 Ga0495653_0020419 Ga0495653_0020419_1787_2926 376
678 3300046473 Ga0495582_0054292 Ga0495582_0054292_741_1871 376
679 3300046474 Ga0495605_0044303 Ga0495605_0044303_88_1227 376
680 3300046491 Ga0495584_0041459 Ga0495584_0041459_815_1945 376
681 3300046499 Ga0495594_0062923 Ga0495594_0062923_77_1216 376
682 3300046511 Ga0495608_0022281 Ga0495608_0022281_2219_3358 376
683 3300046511 Ga0495608_0134794 Ga0495608_0134794_252_1382 376
684 3300046514 Ga0495618_0010089 Ga0495618_0010089_1839_2978 376
685 3300046516 Ga0495628_0025037 Ga0495628_0025037_676_1815 376
686 3300046518 Ga0495631_0091338 Ga0495631_0091338_68_1207 376
687 3300046523 Ga0495644_0045526 Ga0495644_0045526_439_1578 376
688 3300046524 Ga0495648_0007226 Ga0495648_0007226_2465_3607 376
689 3300046529 Ga0495652_0016070 Ga0495652_0016070_2866_4005 376
690 3300046531 Ga0495665_0078423 Ga0495665_0078423_477_1607 376
691 3300046533 Ga0495640_0015608 Ga0495640_0015608_2192_3331 376
692 3300046536 Ga0495587_0044076 Ga0495587_0044076_854_1993 376
693 3300046536 Ga0495587_0056318 Ga0495587_0056318_767_1897 376
694 3300046539 Ga0495621_0074245 Ga0495621_0074245_34_1173 376
695 3300046559 Ga0495667_0022641 Ga0495667_0022641_554_1693 376
696 3300046559 Ga0495667_0030231 Ga0495667_0030231_2112_3359 376
697 3300046642 Ga0495634_0013494 Ga0495634_0013494_1256_2539 376
698 3300046642 Ga0495634_0016981 Ga0495634_0016981_526_1665 376
699 3300046642 Ga0495634_0110707 Ga0495634_0110707_420_1571 376
700 3300046675 Ga0495657_0047211 Ga0495657_0047211_946_2076 376
701 3300046675 Ga0495657_0168741 Ga0495657_0168741_72_1247 376
702 3300046679 Ga0495623_0009855 Ga0495623_0009855_582_1721 376
703 3300046680 Ga0495646_0113172 Ga0495646_0113172_307_1437 376
704 3300046680 Ga0495646_0160930 Ga0495646_0160930_43_1209 376
705 3300046683 Ga0495658_0006954 Ga0495658_0006954_3857_4996 376
706 3300046683 Ga0495658_0083925 Ga0495658_0083925_41_1171 376
707 3300046694 Ga0495649_0015557 Ga0495649_0015557_2461_3603 376
708 3300046809 Ga0495600_0013346 Ga0495600_0013346_3642_4781 376
709 3300047317 Ga0495604_0005625 Ga0495604_0005625_8628_9875 376
710 3300047317 Ga0495604_0108437 Ga0495604_0108437_428_1558 376
711 3300047319 Ga0495674_0010369 Ga0495674_0010369_5372_6511 376
712 3300047319 Ga0495674_0087310 Ga0495674_0087310_1379_2626 376
713 3300047322 Ga0495680_0024726 Ga0495680_0024726_1046_2185 376
714 3300047322 Ga0495680_0024804 Ga0495680_0024804_78_1325 376
715 3300047444 Ga0495675_0007713 Ga0495675_0007713_1149_2288 376
716 3300047444 Ga0495675_0135442 Ga0495675_0135442_163_1293 376
717 3300047445 Ga0495677_0080197 Ga0495677_0080197_37_1176 376
718 3300047471 Ga0495684_0028806 Ga0495684_0028806_2105_3244 376
719 3300047471 Ga0495684_0034799 Ga0495684_0034799_2385_3542 376
720 3300047471 Ga0495684_0043382 Ga0495684_0043382_1256_2539 376
721 3300047471 Ga0495684_0076387 Ga0495684_0076387_694_1824 376
722 3300047472 Ga0495686_0065217 Ga0495686_0065217_60_1202 376
723 3300047673 Ga0495593_0039449 Ga0495593_0039449_1243_2382 376
724 3300048088 Ga0495602_0051018 Ga0495602_0051018_2432_3562 376
725 3300048090 Ga0495615_0017282 Ga0495615_0017282_199_1338 376
726 3300048903 Ga0496100_0000883 Ga0496100_0000883_9285_10424 376
727 3300048903 Ga0496100_0026894 Ga0496100_0026894_1930_3087 376
728 3300048903 Ga0496100_0027461 Ga0496100_0027461_369_1553 376
729 3300048903 Ga0496100_0150035 Ga0496100_0150035_51_1190 376
730 3300048904 Ga0496101_0001721 Ga0496101_0001721_8394_9578 376
731 3300048904 Ga0496101_0010306 Ga0496101_0010306_2255_3394 376
732 3300048905 Ga0496102_0002752 Ga0496102_0002752_3266_4423 376
733 3300048905 Ga0496102_0005298 Ga0496102_0005298_8412_9551 376
734 3300048905 Ga0496102_0223476 Ga0496102_0223476_279_1463 376
735 3300048906 Ga0496103_0002481 Ga0496103_0002481_196_1335 376
736 3300048906 Ga0496103_0074029 Ga0496103_0074029_337_1494 376
737 3300048907 Ga0496104_0007237 Ga0496104_0007237_8279_9418 376
738 3300048908 Ga0496105_0001558 Ga0496105_0001558_8173_9312 376
739 3300048908 Ga0496105_0003169 Ga0496105_0003169_10477_11634 376
740 3300048908 Ga0496105_0011182 Ga0496105_0011182_5644_6828 376
741 3300048908 Ga0496105_0170851 Ga0496105_0170851_437_1591 376
742 3300048909 Ga0496106_0009006 Ga0496106_0009006_1373_2512 376
743 3300048909 Ga0496106_0017900 Ga0496106_0017900_2456_3640 376
744 3300048909 Ga0496106_0176557 Ga0496106_0176557_129_1307 376
745 3300048910 Ga0496107_0025595 Ga0496107_0025595_1588_2748 376
746 3300048910 Ga0496107_0041992 Ga0496107_0041992_1771_2910 376
747 3300048911 Ga0496108_0006599 Ga0496108_0006599_7335_8492 376
748 3300048911 Ga0496108_0013514 Ga0496108_0013514_1655_2839 376
749 3300048911 Ga0496108_0017132 Ga0496108_0017132_1373_2512 376
750 3300048912 Ga0496109_0002993 Ga0496109_0002993_821_1978 376
751 3300048912 Ga0496109_0003652 Ga0496109_0003652_9951_11090 376
752 3300048913 Ga0496110_0002213 Ga0496110_0002213_7314_8471 376
753 3300048913 Ga0496110_0003023 Ga0496110_0003023_10235_11374 376
754 3300048913 Ga0496110_0042720 Ga0496110_0042720_45_1205 376
755 3300048914 Ga0496111_0002054 Ga0496111_0002054_9056_10195 376
756 3300048914 Ga0496111_0007911 Ga0496111_0007911_5611_6795 376
757 3300048914 Ga0496111_0094059 Ga0496111_0094059_537_1691 376
758 3300048915 Ga0496112_0036512 Ga0496112_0036512_557_1735 376
759 3300048915 Ga0496112_0037830 Ga0496112_0037830_2002_3141 376
760 3300048915 Ga0496112_0095544 Ga0496112_0095544_327_1565 376
761 3300048916 Ga0496113_0005117 Ga0496113_0005117_6073_7230 376
762 3300048916 Ga0496113_0005565 Ga0496113_0005565_2488_3627 376
763 3300048917 Ga0496114_0003895 Ga0496114_0003895_7223_8407 376
764 3300048917 Ga0496114_0006922 Ga0496114_0006922_7302_8441 376
765 3300048918 Ga0496115_0016238 Ga0496115_0016238_1520_2704 376
766 3300048918 Ga0496115_0038291 Ga0496115_0038291_1832_2971 376
767 3300048918 Ga0496115_0079170 Ga0496115_0079170_74_1231 376
768 3300048918 Ga0496115_0115028 Ga0496115_0115028_275_1414 376
769 3300048921 Ga0496118_0020990 Ga0496118_0020990_1838_3007 376
770 3300049460 Ga0495682_0023857 Ga0495682_0023857_186_1328 376
771 3300049568 Ga0501031_0021558 Ga0501031_0021558_2963_4123 376
772 3300049569 Ga0501032_0013465 Ga0501032_0013465_616_1776 376
773 3300049570 Ga0501033_0093170 Ga0501033_0093170_614_1804 376
774 3300049571 Ga0501034_0028780 Ga0501034_0028780_2787_3947 376
775 3300049572 Ga0501036_0010044 Ga0501036_0010044_5531_6691 376
776 3300049572 Ga0501036_0015237 Ga0501036_0015237_1169_2377 376
777 3300049573 Ga0501037_0008767 Ga0501037_0008767_465_1625 376
778 3300049574 Ga0501038_0003573 Ga0501038_0003573_6871_8031 376
779 3300049575 Ga0501039_0057503 Ga0501039_0057503_1658_2818 376
780 3300049575 Ga0501039_0208255 Ga0501039_0208255_262_1470 376
781 3300049578 Ga0501042_0073201 Ga0501042_0073201_181_1341 376
782 3300049578 Ga0501042_0084909 Ga0501042_0084909_505_1713 376
783 3300049579 Ga0501043_0016285 Ga0501043_0016285_4238_5398 376
784 3300049580 Ga0501046_0007715 Ga0501046_0007715_1849_3009 376
785 3300049580 Ga0501046_0099345 Ga0501046_0099345_684_1832 376
786 3300049581 Ga0501047_0045311 Ga0501047_0045311_2394_3554 376
787 3300049582 Ga0501048_0007056 Ga0501048_0007056_359_1519 376
788 3300049583 Ga0501067_0023020 Ga0501067_0023020_1919_3079 376
789 3300049584 Ga0501068_0003549 Ga0501068_0003549_4230_5390 376
790 3300049585 Ga0501069_0011843 Ga0501069_0011843_546_1706 376
791 3300049586 Ga0501070_0184796 Ga0501070_0184796_264_1484 376
792 3300049588 Ga0501072_0095346 Ga0501072_0095346_997_2157 376
793 3300049589 Ga0501073_0026789 Ga0501073_0026789_2565_3725 376
794 3300049589 Ga0501073_0058946 Ga0501073_0058946_441_1649 376
795 3300049590 Ga0501074_0013706 Ga0501074_0013706_1833_2993 376
796 3300049592 Ga0501076_0132736 Ga0501076_0132736_626_1765 376
797 3300049592 Ga0501076_0158981 Ga0501076_0158981_226_1386 376
798 3300049741 Ga0501079_0014563 Ga0501079_0014563_484_1644 376
799 3300049742 Ga0501080_0029067 Ga0501080_0029067_827_1987 376
800 3300049742 Ga0501080_0166332 Ga0501080_0166332_436_1662 376
801 3300049743 Ga0501081_0112052 Ga0501081_0112052_207_1346 376
802 3300049744 Ga0501083_0036721 Ga0501083_0036721_826_1986 376
803 3300049744 Ga0501083_0170912 Ga0501083_0170912_135_1340 376
804 3300049822 Ga0501035_0006796 Ga0501035_0006796_5071_6231 376
805 3300049823 Ga0501044_0003604 Ga0501044_0003604_13204_14361 376
806 3300049823 Ga0501044_0026832 Ga0501044_0026832_699_1859 376
807 3300049823 Ga0501044_0098521 Ga0501044_0098521_613_1773 376
808 3300049823 Ga0501044_0152533 Ga0501044_0152533_980_2170 376
809 3300049824 Ga0501045_0012008 Ga0501045_0012008_2041_3201 376
810 3300050489 nmdc:mga03683_28913_c1 nmdc:mga03683_28913_c1_126_1265 376
811 3300050491 nmdc:mga00v17_53361_c1 nmdc:mga00v17_53361_c1_401_1540 376
812 3300050492 nmdc:mga0yw44_17392_c1 nmdc:mga0yw44_17392_c1_568_1707 376
813 3300050493 nmdc:mga0k408_31550_c1 nmdc:mga0k408_31550_c1_1128_2279 376
814 3300050507 nmdc:mga05p37_11620_c1 nmdc:mga05p37_11620_c1_7316_8455 376
815 3300050507 nmdc:mga05p37_1642_c1 nmdc:mga05p37_1642_c1_10559_11722 376
816 3300050508 nmdc:mga09592_2070_c1 nmdc:mga09592_2070_c1_14513_15676 376
817 3300050508 nmdc:mga09592_34328_c1 nmdc:mga09592_34328_c1_1383_2522 376
818 3300050509 nmdc:mga0qj67_74188_c1 nmdc:mga0qj67_74188_c1_122_1261 376
819 3300050509 nmdc:mga0qj67_96891_c1 nmdc:mga0qj67_96891_c1_818_1957 376
820 3300050510 nmdc:mga06r32_349_c1 nmdc:mga06r32_349_c1_20288_21451 376
821 3300050510 nmdc:mga06r32_68482_c1 nmdc:mga06r32_68482_c1_599_1738 376
822 3300050511 nmdc:mga08y16_41385_c1 nmdc:mga08y16_41385_c1_906_2063 376
823 3300050511 nmdc:mga08y16_4843_c1 nmdc:mga08y16_4843_c1_8666_9829 376
824 3300050512 nmdc:mga0n895_187155_c1 nmdc:mga0n895_187155_c1_73_1233 376
825 3300053077 Ga0495601_0001197 Ga0495601_0001197_10478_11617 376
826 3300053077 Ga0495601_0114243 Ga0495601_0114243_383_1513 376
827 3300053078 Ga0495612_0056590 Ga0495612_0056590_28_1203 376
828 3300053084 Ga0495595_0010792 Ga0495595_0010792_2574_3713 376
829 3300053084 Ga0495595_0016167 Ga0495595_0016167_773_2020 376
830 3300053084 Ga0495595_0040458 Ga0495595_0040458_717_1847 376
831 3300053085 Ga0495619_0000048 Ga0495619_0000048_71700_72947 376
832 3300053085 Ga0495619_0002108 Ga0495619_0002108_10806_11945 376
833 3300053085 Ga0495619_0048524 Ga0495619_0048524_1042_2229 376
834 3300053092 Ga0500583_0053008 Ga0500583_0053008_596_1765 376
835 3300053096 Ga0500641_0001652 Ga0500641_0001652_755_1960 376
836 3300053104 Ga0500556_0014493 Ga0500556_0014493_719_1888 376
837 3300053119 Ga0500595_006611 Ga0500595_006611_3703_4854 376
838 3300053130 Ga0500642_0020295 Ga0500642_0020295_888_2048 376
839 3300053153 Ga0500616_0019706 Ga0500616_0019706_2486_3655 376
840 3300053153 Ga0500616_0053762 Ga0500616_0053762_521_1681 376
841 3300053156 Ga0500622_0022869 Ga0500622_0022869_1701_2843 376
842 3300053177 Ga0500636_0000762 Ga0500636_0000762_7488_8630 376
843 3300053177 Ga0500636_0011675 Ga0500636_0011675_3921_5081 376
844 3300060353 Ga0501082_0022888 Ga0501082_0022888_1775_2935 376
845 3300060353 Ga0501082_0229774 Ga0501082_0229774_58_1266 376
846 3300061734 Ga0530510_0055163 Ga0530510_0055163_826_1965 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01070

FMN_dh

FMN-dependent dehydrogenase

14

371

0.98

PF01645

Glu_synthase

Conserved region in glutamate synthase

256

334

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_0 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9592 59 359
2cdh-assembly1.cif.gz_0 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9469 59 359
6w45-assembly1.cif.gz_A crystal structure of hao1 in complex with biaryl acid inhibitor - compound 3 0.9325 1 376
6w45-assembly1.cif.gz_A crystal structure of hao1 in complex with biaryl acid inhibitor - compound 3 0.9242 1 376
6w44-assembly1.cif.gz_A crystal structure of hao1 in complex with indazole acid inhibitor - compound 4 0.9159 2 375
ID Description Score Start End Superfamily
af_P9WND5_34_407_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9205 1 375 3.20.20.70
af_P9WND5_34_407_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9087 1 375 3.20.20.70
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9061 1 376 3.20.20.70
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.904 1 376 3.20.20.70
2nliA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8824 1 374 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A847KEL5-F1-model_v4 deleted 0.9642 231 374
AF-A0A2N4YRY1-F1-model_v4 Alpha-hydroxy-acid oxidizing protein 0.9589 239 375 GO:0004459
GO:0005886
GO:0009060
AF-A0A1H3VMC8-F1-model_v4 4-hydroxymandelate oxidase 0.9577 231 372 GO:0016491
AF-A0A3S4HUI6-F1-model_v4 L-lactate dehydrogenase (EC 1.1.2.3) 0.9559 247 375 GO:0004459
GO:0004460
GO:0005886
GO:0009060
AF-A0A0Q6XNU0-F1-model_v4 Alpha-hydroxy-acid oxidizing enzyme (EC 1.1.2.3) 0.9541 1 376 GO:0004459
GO:0004460
GO:0005886
GO:0009060
GO:0010181

Feature Viewer

pLDDT pTM Quality
87.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map