F483286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 846 | 592 | 615 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10080610|Ga0081538_100806102 |
| Length | 394 |
| Sequence | MKNVTCIEDLRQLARRKVPRAFFDYAEAGSYSEQTLHANRADLERVKLRQRVLVDVSARDTSTTILGEKVPMPLALGPVGMTGLEYGNGEIHACRAAHKAGIPFTLSTLSICSIEDVATTVDRPFWFQLYVMKDRGFVRSLIERASAVSCSALVLTVDLQVLGQRHIDIKNGLSVPPSLKIRNLANMAIKPRWVFSVLSGKDGHVKGMEGVKSLAQWVGSQFDETLSWNDVDWIRSIWPGKLIIKGILDVEDAKLATRTGATALVVSNHGGRQLDGAASSISVLPKVADAVGSEIEVMFDGGIRTGQDVLRALALGARSCLIGRAYIFGLGAGGEAGVARAIDIIRKELDVSMALTGVKSVKEIGRHILLQQSSRGSSPLVNGRCIRRQVRGRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 17 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 18 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 19 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 20 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 21 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 22 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 23 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 24 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 25 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 26 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 27 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 28 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 31 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 32 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 33 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 34 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 35 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 36 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 37 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 38 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 39 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 40 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 41 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 42 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 43 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 44 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 45 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 46 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 47 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 48 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 49 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 50 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 51 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 52 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 53 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 54 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 55 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 56 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 57 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 58 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 59 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 60 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 61 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 62 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 63 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 64 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 65 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 66 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 67 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 68 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 69 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 70 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 71 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 72 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 73 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 74 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 75 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 76 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 77 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 78 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 79 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 80 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 81 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 82 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 83 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 84 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 85 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 86 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 87 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 88 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 89 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 90 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 91 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 92 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 93 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 94 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 95 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 96 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 97 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 98 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 99 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 100 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 101 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 102 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 103 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 104 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 105 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 106 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 107 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 110 | 2922368715 | |||
| 111 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 112 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 113 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 114 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 115 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 116 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 117 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 118 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 119 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 120 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 121 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 122 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 123 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 124 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 125 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 126 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 127 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 128 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 129 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 130 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 131 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 132 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 133 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 134 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 135 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 136 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 137 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 138 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 139 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 140 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 141 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 142 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 143 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 144 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 145 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 146 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 147 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 148 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 149 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 150 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 151 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 152 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 153 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 154 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 155 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 156 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 157 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 158 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 159 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 160 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 161 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 162 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 163 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 164 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 165 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 166 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 167 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 168 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 169 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 170 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 171 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 172 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 173 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 174 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 175 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 176 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 177 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 178 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 179 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 180 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 181 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 182 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 183 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 184 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 185 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 186 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 187 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 188 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 189 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 190 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 191 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 192 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 193 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 194 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 195 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 196 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 197 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 198 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 199 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 200 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 201 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 202 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 203 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 204 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 205 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 206 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 207 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 208 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 209 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 210 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 211 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 212 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 213 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 214 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 216 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 217 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 219 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 220 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 221 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 222 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 229 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 232 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 239 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 240 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 241 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 242 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 244 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 245 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 248 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 250 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 251 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 252 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 253 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 254 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 255 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 256 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 257 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 258 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 259 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 260 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 262 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 263 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 264 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 265 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 266 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 267 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 268 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 269 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 270 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 272 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 273 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 274 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 275 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 276 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 277 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 278 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 279 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 280 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 281 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 282 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 283 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 284 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 302 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 306 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 307 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 308 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 309 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 314 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 316 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 373 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 374 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 375 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 376 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 378 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 382 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 383 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 384 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 385 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 386 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 387 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 388 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 389 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 390 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 391 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 392 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 393 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 394 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 395 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 396 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 397 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 398 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 399 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 400 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 401 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 402 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 403 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 404 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 405 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 406 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 407 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 408 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 409 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 410 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 411 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 412 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 413 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 414 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 415 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 416 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 417 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 418 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 419 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 420 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 421 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 422 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 423 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 476 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 477 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 478 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 479 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 480 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 481 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 482 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 483 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 486 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 487 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 488 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 489 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 490 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 491 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 492 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 493 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 494 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 495 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 496 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 526 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 527 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 528 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 529 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 530 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 531 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 532 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 533 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 534 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 542 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 547 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 548 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 549 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 550 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 551 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 552 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 553 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 554 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 555 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 556 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 557 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 558 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 559 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 561 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 562 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 563 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 564 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 565 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 566 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 567 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 568 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 569 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 570 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 571 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 572 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 573 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 574 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 575 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 576 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 577 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 578 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 579 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 580 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 581 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 582 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 583 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 584 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 585 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 586 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 587 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 588 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 589 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 590 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 591 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 592 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.78 |
| Metatranscriptomes | 0 |
| Isolates | 27.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.22 |
| Nodule | 22.34 |
| Rhizoplane | 6.97 |
| Rhizosphere | 54.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10008874 | 3300001990 | Bacteria | 3356 |
| 2 | JGI24750J21931_1000382 | 3300002070 | Bacteria | 7517 |
| 3 | JGI24744J21845_10001405 | 3300002077 | Bacteria | 4769 |
| 4 | JGI24034J26672_10001624 | 3300002239 | Bacteria | 3008 |
| 5 | JGI24742J22300_10000921 | 3300002244 | Bacteria | 4486 |
| 6 | JGI24751J29686_10001730 | 3300002459 | Bacteria | 4483 |
| 7 | JGI25165J46597_1005784 | 3300003214 | Bacteria | 2309 |
| 8 | rootH2_10015505 | 3300003320 | Bacteria | 11045 |
| 9 | JGI25160J50197_1003229 | 3300003354 | Bacteria | 7360 |
| 10 | JGI25160J50197_1007225 | 3300003354 | Bacteria | 4369 |
| 11 | JGI25160J50197_1011223 | 3300003354 | Bacteria | 3187 |
| 12 | Ga0055542_1006782 | 3300003762 | Bacteria | 2405 |
| 13 | Ga0055531_10010606 | 3300003794 | Bacteria | 4554 |
| 14 | Ga0055543_1004550 | 3300004625 | Bacteria | 3745 |
| 15 | Ga0055543_1013727 | 3300004625 | Bacteria | 1595 |
| 16 | Ga0065165_1002476 | 3300005262 | Bacteria | 15530 |
| 17 | Ga0065165_1002846 | 3300005262 | Bacteria | 13437 |
| 18 | Ga0065165_1022581 | 3300005262 | Bacteria | 2153 |
| 19 | Ga0065715_10116981 | 3300005293 | Bacteria | 2362 |
| 20 | Ga0070658_10027674 | 3300005327 | Bacteria | 4549 |
| 21 | Ga0070658_10040277 | 3300005327 | Bacteria | 3769 |
| 22 | Ga0070683_100306551 | 3300005329 | Bacteria | 1511 |
| 23 | Ga0070683_100327714 | 3300005329 | Bacteria | 1458 |
| 24 | Ga0070690_100008826 | 3300005330 | Bacteria | 5822 |
| 25 | Ga0070690_100042239 | 3300005330 | Bacteria | 2888 |
| 26 | Ga0070670_100002977 | 3300005331 | Bacteria | 14022 |
| 27 | Ga0070670_100008937 | 3300005331 | Bacteria | 8557 |
| 28 | Ga0070670_100028505 | 3300005331 | Bacteria | 4806 |
| 29 | Ga0068869_100008177 | 3300005334 | Bacteria | 6731 |
| 30 | Ga0070680_100031622 | 3300005336 | Bacteria | 4257 |
| 31 | Ga0068868_100015712 | 3300005338 | Bacteria | 5607 |
| 32 | Ga0070689_100002815 | 3300005340 | Bacteria | 11435 |
| 33 | Ga0070689_100007192 | 3300005340 | Bacteria | 7761 |
| 34 | Ga0070668_100054855 | 3300005347 | Bacteria | 3075 |
| 35 | Ga0070669_100025557 | 3300005353 | Bacteria | 4242 |
| 36 | Ga0070675_100016259 | 3300005354 | Bacteria | 5903 |
| 37 | Ga0070675_100083571 | 3300005354 | Bacteria | 2665 |
| 38 | Ga0070671_100004776 | 3300005355 | Bacteria | 10770 |
| 39 | Ga0070671_100024253 | 3300005355 | Bacteria | 4965 |
| 40 | Ga0070674_100072201 | 3300005356 | Bacteria | 2443 |
| 41 | Ga0070674_100130993 | 3300005356 | Bacteria | 1870 |
| 42 | Ga0070673_100006320 | 3300005364 | Bacteria | 7694 |
| 43 | Ga0070673_100097118 | 3300005364 | Bacteria | 2419 |
| 44 | Ga0070688_100022058 | 3300005365 | Bacteria | 3726 |
| 45 | Ga0070714_100000214 | 3300005435 | Bacteria | 46204 |
| 46 | Ga0070714_100167219 | 3300005435 | Bacteria | 1993 |
| 47 | Ga0070713_100036597 | 3300005436 | Bacteria | 3962 |
| 48 | Ga0070713_100084577 | 3300005436 | Bacteria | 2715 |
| 49 | Ga0070701_10005926 | 3300005438 | Bacteria | 5101 |
| 50 | Ga0070711_100040720 | 3300005439 | Bacteria | 3135 |
| 51 | Ga0070705_100073406 | 3300005440 | Bacteria | 2076 |
| 52 | Ga0070700_100005394 | 3300005441 | Bacteria | 6770 |
| 53 | Ga0070663_100015368 | 3300005455 | Bacteria | 4939 |
| 54 | Ga0070678_100079363 | 3300005456 | Bacteria | 2482 |
| 55 | Ga0070662_100032717 | 3300005457 | Bacteria | 3655 |
| 56 | Ga0068867_100027479 | 3300005459 | Bacteria | 4090 |
| 57 | Ga0068867_100056366 | 3300005459 | Bacteria | 2907 |
| 58 | Ga0068867_100225597 | 3300005459 | Bacteria | 1512 |
| 59 | Ga0070685_10002191 | 3300005466 | Bacteria | 10092 |
| 60 | Ga0070679_100009709 | 3300005530 | Bacteria | 9103 |
| 61 | Ga0068853_100044985 | 3300005539 | Bacteria | 3780 |
| 62 | Ga0070672_100003443 | 3300005543 | Bacteria | 10252 |
| 63 | Ga0070672_100169329 | 3300005543 | Bacteria | 1816 |
| 64 | Ga0070686_100003076 | 3300005544 | Bacteria | 9139 |
| 65 | Ga0070695_100023103 | 3300005545 | Bacteria | 3818 |
| 66 | Ga0070665_100024056 | 3300005548 | Bacteria | 6134 |
| 67 | Ga0070665_100048262 | 3300005548 | Bacteria | 4275 |
| 68 | Ga0070665_100076147 | 3300005548 | Bacteria | 3362 |
| 69 | Ga0070665_100167591 | 3300005548 | Bacteria | 2198 |
| 70 | Ga0070665_100193718 | 3300005548 | Bacteria | 2033 |
| 71 | Ga0070664_100351603 | 3300005564 | Bacteria | 1341 |
| 72 | Ga0068854_100022938 | 3300005578 | Bacteria | 4258 |
| 73 | Ga0070702_100007919 | 3300005615 | Bacteria | 5116 |
| 74 | Ga0068852_100035617 | 3300005616 | Bacteria | 4154 |
| 75 | Ga0068852_100050258 | 3300005616 | Bacteria | 3571 |
| 76 | Ga0068864_100011952 | 3300005618 | Bacteria | 7167 |
| 77 | Ga0068861_100038125 | 3300005719 | Bacteria | 3576 |
| 78 | Ga0068870_10001327 | 3300005840 | Bacteria | 9959 |
| 79 | Ga0068863_100058152 | 3300005841 | Bacteria | 3659 |
| 80 | Ga0068858_100011270 | 3300005842 | Bacteria | 8448 |
| 81 | Ga0068860_100006468 | 3300005843 | Bacteria | 11765 |
| 82 | Ga0068862_100010288 | 3300005844 | Bacteria | 7718 |
| 83 | Ga0081538_10080610 | 3300005981 | Bacteria | 1735 |
| 84 | Ga0081540_1003809 | 3300005983 | Bacteria | 11796 |
| 85 | Ga0081540_1021644 | 3300005983 | Bacteria | 3820 |
| 86 | Ga0081539_10042016 | 3300005985 | Bacteria | 2666 |
| 87 | Ga0070717_10089776 | 3300006028 | Bacteria | 2592 |
| 88 | Ga0075365_10006872 | 3300006038 | Bacteria | 6312 |
| 89 | Ga0075365_10039395 | 3300006038 | Bacteria | 3077 |
| 90 | Ga0075365_10063288 | 3300006038 | Bacteria | 2476 |
| 91 | Ga0075368_10001970 | 3300006042 | Bacteria | 6618 |
| 92 | Ga0075363_100002880 | 3300006048 | Bacteria | 7164 |
| 93 | Ga0075363_100012377 | 3300006048 | Bacteria | 4111 |
| 94 | Ga0075364_10016505 | 3300006051 | Bacteria | 4595 |
| 95 | Ga0075364_10095620 | 3300006051 | Bacteria | 1975 |
| 96 | Ga0070715_10074759 | 3300006163 | Bacteria | 1523 |
| 97 | Ga0070712_100029075 | 3300006175 | Bacteria | 3703 |
| 98 | Ga0075367_10117295 | 3300006178 | Bacteria | 1638 |
| 99 | Ga0075369_10055983 | 3300006186 | Bacteria | 1714 |
| 100 | Ga0075369_10066091 | 3300006186 | Bacteria | 1586 |
| 101 | Ga0075366_10023925 | 3300006195 | Bacteria | 3559 |
| 102 | Ga0075366_10027952 | 3300006195 | Bacteria | 3309 |
| 103 | Ga0097621_100036852 | 3300006237 | Bacteria | 3914 |
| 104 | Ga0075370_10002544 | 3300006353 | Bacteria | 8482 |
| 105 | Ga0075370_10017867 | 3300006353 | Bacteria | 3837 |
| 106 | Ga0075428_100001783 | 3300006844 | Bacteria | 22990 |
| 107 | Ga0075428_100020439 | 3300006844 | Bacteria | 7328 |
| 108 | Ga0075428_100072368 | 3300006844 | Bacteria | 3766 |
| 109 | Ga0075430_100007526 | 3300006846 | Bacteria | 9194 |
| 110 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 111 | Ga0075431_100020676 | 3300006847 | Bacteria | 6726 |
| 112 | Ga0075431_100026376 | 3300006847 | Bacteria | 5962 |
| 113 | Ga0075431_100107206 | 3300006847 | Bacteria | 2882 |
| 114 | Ga0075433_10007493 | 3300006852 | Bacteria | 8660 |
| 115 | Ga0075433_10093255 | 3300006852 | Bacteria | 2664 |
| 116 | Ga0075433_10151833 | 3300006852 | Bacteria | 2060 |
| 117 | Ga0075434_100379866 | 3300006871 | Bacteria | 1433 |
| 118 | Ga0075429_100013494 | 3300006880 | Bacteria | 7088 |
| 119 | Ga0075429_100070201 | 3300006880 | Bacteria | 3050 |
| 120 | Ga0075429_100159168 | 3300006880 | Bacteria | 1977 |
| 121 | Ga0075429_100171874 | 3300006880 | Bacteria | 1898 |
| 122 | Ga0068865_100042213 | 3300006881 | Bacteria | 3109 |
| 123 | Ga0099824_1008513 | 3300006942 | Bacteria | 13101 |
| 124 | Ga0099823_1004051 | 3300006944 | Bacteria | 14168 |
| 125 | Ga0075435_100037674 | 3300007076 | Bacteria | 3851 |
| 126 | Ga0099794_10014407 | 3300007265 | Bacteria | 3464 |
| 127 | Ga0099795_10007396 | 3300007788 | Bacteria | 3063 |
| 128 | Ga0105240_10448080 | 3300009093 | Bacteria | 1445 |
| 129 | Ga0111539_10004128 | 3300009094 | Bacteria | 19061 |
| 130 | Ga0111539_10007426 | 3300009094 | Bacteria | 14048 |
| 131 | Ga0111539_10033800 | 3300009094 | Bacteria | 6206 |
| 132 | Ga0111539_10343855 | 3300009094 | Bacteria | 1736 |
| 133 | Ga0105247_10031333 | 3300009101 | Bacteria | 3227 |
| 134 | Ga0105247_10064159 | 3300009101 | Bacteria | 2281 |
| 135 | Ga0114129_10000104 | 3300009147 | Bacteria | 83195 |
| 136 | Ga0114129_10021818 | 3300009147 | Bacteria | 9089 |
| 137 | Ga0114129_10028120 | 3300009147 | Bacteria | 7966 |
| 138 | Ga0114129_10070313 | 3300009147 | Bacteria | 4880 |
| 139 | Ga0114129_10123428 | 3300009147 | Bacteria | 3562 |
| 140 | Ga0105241_10052381 | 3300009174 | Bacteria | 3116 |
| 141 | Ga0105242_10139315 | 3300009176 | Bacteria | 2103 |
| 142 | Ga0105242_10305872 | 3300009176 | Bacteria | 1453 |
| 143 | Ga0105248_10098846 | 3300009177 | Bacteria | 3288 |
| 144 | Ga0105248_10491014 | 3300009177 | Bacteria | 1384 |
| 145 | Ga0105237_10019250 | 3300009545 | Bacteria | 7053 |
| 146 | Ga0105237_10092647 | 3300009545 | Bacteria | 3011 |
| 147 | Ga0105237_10098727 | 3300009545 | Bacteria | 2911 |
| 148 | Ga0105237_10114838 | 3300009545 | Bacteria | 2685 |
| 149 | Ga0105238_10009521 | 3300009551 | Bacteria | 9724 |
| 150 | Ga0105238_10013778 | 3300009551 | Bacteria | 8171 |
| 151 | Ga0105238_10116747 | 3300009551 | Bacteria | 2649 |
| 152 | Ga0105249_10232658 | 3300009553 | Bacteria | 1818 |
| 153 | Ga0105239_10050734 | 3300010375 | Bacteria | 4549 |
| 154 | Ga0105239_10064105 | 3300010375 | Bacteria | 4034 |
| 155 | Ga0105239_10102667 | 3300010375 | Bacteria | 3164 |
| 156 | Ga0105239_10242163 | 3300010375 | Bacteria | 2024 |
| 157 | Ga0105239_10267167 | 3300010375 | Bacteria | 1923 |
| 158 | Ga0105239_10332318 | 3300010375 | Bacteria | 1714 |
| 159 | Ga0105239_10587753 | 3300010375 | Bacteria | 1269 |
| 160 | Ga0105246_10020866 | 3300011119 | Bacteria | 4207 |
| 161 | Ga0105246_10060053 | 3300011119 | Bacteria | 2640 |
| 162 | Ga0157374_10029044 | 3300013296 | Bacteria | 5002 |
| 163 | Ga0163162_10065535 | 3300013306 | Bacteria | 3679 |
| 164 | Ga0157375_10023485 | 3300013308 | Bacteria | 5691 |
| 165 | Ga0163163_10168817 | 3300014325 | Bacteria | 2234 |
| 166 | Ga0157380_10019349 | 3300014326 | Bacteria | 5073 |
| 167 | Ga0157380_10219680 | 3300014326 | Bacteria | 1699 |
| 168 | Ga0157380_10270516 | 3300014326 | Bacteria | 1549 |
| 169 | Ga0157380_10295977 | 3300014326 | Bacteria | 1488 |
| 170 | Ga0182008_10031207 | 3300014497 | Bacteria | 2683 |
| 171 | Ga0182008_10057241 | 3300014497 | Bacteria | 1925 |
| 172 | Ga0157379_10018816 | 3300014968 | Bacteria | 6092 |
| 173 | Ga0157376_10113500 | 3300014969 | Bacteria | 2389 |
| 174 | Ga0157376_10165681 | 3300014969 | Bacteria | 2008 |
| 175 | Ga0163161_10009513 | 3300017792 | Bacteria | 6724 |
| 176 | Ga0214544_1000163 | 3300021320 | Bacteria | 101631 |
| 177 | Ga0214542_1000156 | 3300021321 | Bacteria | 101631 |
| 178 | Ga0214545_1000078 | 3300021324 | Bacteria | 101631 |
| 179 | Ga0214543_1000136 | 3300021327 | Bacteria | 101629 |
| 180 | Ga0209563_104066 | 3300025230 | Bacteria | 2868 |
| 181 | Ga0209148_1000232 | 3300025254 | Bacteria | 90923 |
| 182 | Ga0209233_1001298 | 3300025261 | Bacteria | 9984 |
| 183 | Ga0209233_1007012 | 3300025261 | Bacteria | 3598 |
| 184 | Ga0209455_1002245 | 3300025272 | Bacteria | 7595 |
| 185 | Ga0209564_1013870 | 3300025295 | Bacteria | 3389 |
| 186 | Ga0209758_1000294 | 3300025297 | Bacteria | 98618 |
| 187 | Ga0209758_1000705 | 3300025297 | Bacteria | 49585 |
| 188 | Ga0209758_1000986 | 3300025297 | Bacteria | 38258 |
| 189 | Ga0209758_1002299 | 3300025297 | Bacteria | 19758 |
| 190 | Ga0209758_1005881 | 3300025297 | Bacteria | 9155 |
| 191 | Ga0209256_1008548 | 3300025299 | Bacteria | 4719 |
| 192 | Ga0209256_1011833 | 3300025299 | Bacteria | 3432 |
| 193 | Ga0207426_1000632 | 3300025302 | Bacteria | 44581 |
| 194 | Ga0207426_1001240 | 3300025302 | Bacteria | 22455 |
| 195 | Ga0207426_1015236 | 3300025302 | Bacteria | 2792 |
| 196 | Ga0209257_1001185 | 3300025304 | Bacteria | 32850 |
| 197 | Ga0209257_1010432 | 3300025304 | Bacteria | 4703 |
| 198 | Ga0207697_10062690 | 3300025315 | Bacteria | 1548 |
| 199 | Ga0207692_10086198 | 3300025898 | Bacteria | 1692 |
| 200 | Ga0207642_10033422 | 3300025899 | Bacteria | 2176 |
| 201 | Ga0207710_10002863 | 3300025900 | Bacteria | 7852 |
| 202 | Ga0207688_10000552 | 3300025901 | Bacteria | 18231 |
| 203 | Ga0207680_10008395 | 3300025903 | Bacteria | 5067 |
| 204 | Ga0207647_10015498 | 3300025904 | Bacteria | 5223 |
| 205 | Ga0207647_10065485 | 3300025904 | Bacteria | 2206 |
| 206 | Ga0207645_10006892 | 3300025907 | Bacteria | 8103 |
| 207 | Ga0207643_10081811 | 3300025908 | Bacteria | 1872 |
| 208 | Ga0207654_10056393 | 3300025911 | Bacteria | 2279 |
| 209 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 210 | Ga0207671_10009480 | 3300025914 | Bacteria | 8132 |
| 211 | Ga0207671_10108200 | 3300025914 | Bacteria | 2113 |
| 212 | Ga0207693_10019950 | 3300025915 | Bacteria | 5332 |
| 213 | Ga0207693_10237673 | 3300025915 | Bacteria | 1430 |
| 214 | Ga0207663_10091876 | 3300025916 | Bacteria | 2016 |
| 215 | Ga0207662_10000805 | 3300025918 | Bacteria | 14440 |
| 216 | Ga0207657_10024966 | 3300025919 | Bacteria | 5522 |
| 217 | Ga0207657_10084288 | 3300025919 | Bacteria | 2664 |
| 218 | Ga0207649_10042813 | 3300025920 | Bacteria | 2764 |
| 219 | Ga0207652_10074845 | 3300025921 | Bacteria | 2949 |
| 220 | Ga0207681_10061879 | 3300025923 | Bacteria | 2575 |
| 221 | Ga0207694_10212048 | 3300025924 | Bacteria | 1578 |
| 222 | Ga0207650_10000973 | 3300025925 | Bacteria | 21537 |
| 223 | Ga0207650_10003057 | 3300025925 | Bacteria | 11527 |
| 224 | Ga0207650_10012596 | 3300025925 | Bacteria | 5837 |
| 225 | Ga0207659_10005491 | 3300025926 | Bacteria | 7691 |
| 226 | Ga0207659_10126139 | 3300025926 | Bacteria | 1969 |
| 227 | Ga0207687_10005331 | 3300025927 | Bacteria | 8516 |
| 228 | Ga0207687_10159318 | 3300025927 | Bacteria | 1730 |
| 229 | Ga0207700_10046679 | 3300025928 | Bacteria | 3205 |
| 230 | Ga0207664_10000016 | 3300025929 | Bacteria | 245001 |
| 231 | Ga0207644_10007567 | 3300025931 | Bacteria | 7081 |
| 232 | Ga0207644_10039499 | 3300025931 | Bacteria | 3331 |
| 233 | Ga0207644_10156758 | 3300025931 | Bacteria | 1766 |
| 234 | Ga0207706_10003516 | 3300025933 | Bacteria | 14964 |
| 235 | Ga0207706_10080697 | 3300025933 | Bacteria | 2860 |
| 236 | Ga0207686_10038341 | 3300025934 | Bacteria | 2899 |
| 237 | Ga0207686_10230259 | 3300025934 | Bacteria | 1343 |
| 238 | Ga0207670_10212804 | 3300025936 | Bacteria | 1475 |
| 239 | Ga0207704_10036811 | 3300025938 | Bacteria | 2819 |
| 240 | Ga0207665_10151085 | 3300025939 | Bacteria | 1663 |
| 241 | Ga0207691_10001422 | 3300025940 | Bacteria | 23867 |
| 242 | Ga0207691_10097741 | 3300025940 | Bacteria | 2624 |
| 243 | Ga0207691_10105524 | 3300025940 | Bacteria | 2510 |
| 244 | Ga0207711_10172825 | 3300025941 | Bacteria | 1961 |
| 245 | Ga0207711_10180258 | 3300025941 | Bacteria | 1920 |
| 246 | Ga0207689_10041758 | 3300025942 | Bacteria | 3795 |
| 247 | Ga0207661_10286338 | 3300025944 | Bacteria | 1474 |
| 248 | Ga0207661_10292122 | 3300025944 | Bacteria | 1459 |
| 249 | Ga0207679_10022311 | 3300025945 | Bacteria | 4309 |
| 250 | Ga0207651_10008623 | 3300025960 | Bacteria | 5518 |
| 251 | Ga0207651_10011401 | 3300025960 | Bacteria | 4977 |
| 252 | Ga0207712_10099663 | 3300025961 | Bacteria | 2157 |
| 253 | Ga0207668_10013750 | 3300025972 | Bacteria | 4993 |
| 254 | Ga0207640_10296752 | 3300025981 | Bacteria | 1277 |
| 255 | Ga0207658_10251690 | 3300025986 | Bacteria | 1501 |
| 256 | Ga0207677_10018376 | 3300026023 | Bacteria | 4194 |
| 257 | Ga0207703_10003706 | 3300026035 | Bacteria | 12723 |
| 258 | Ga0207703_10065560 | 3300026035 | Bacteria | 2985 |
| 259 | Ga0207639_10032148 | 3300026041 | Bacteria | 3861 |
| 260 | Ga0207639_10083920 | 3300026041 | Bacteria | 2529 |
| 261 | Ga0207678_10229216 | 3300026067 | Bacteria | 1590 |
| 262 | Ga0207708_10000402 | 3300026075 | Bacteria | 34168 |
| 263 | Ga0207702_10075186 | 3300026078 | Bacteria | 2917 |
| 264 | Ga0207641_10004016 | 3300026088 | Bacteria | 12839 |
| 265 | Ga0207648_10001024 | 3300026089 | Bacteria | 31454 |
| 266 | Ga0207648_10026793 | 3300026089 | Bacteria | 5120 |
| 267 | Ga0207648_10259651 | 3300026089 | Bacteria | 1550 |
| 268 | Ga0207676_10006308 | 3300026095 | Bacteria | 8373 |
| 269 | Ga0207674_10114956 | 3300026116 | Bacteria | 2663 |
| 270 | Ga0207675_100272084 | 3300026118 | Bacteria | 1644 |
| 271 | Ga0207683_10004966 | 3300026121 | Bacteria | 11439 |
| 272 | Ga0207683_10039056 | 3300026121 | Bacteria | 4140 |
| 273 | Ga0207698_10007558 | 3300026142 | Bacteria | 6814 |
| 274 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 275 | Ga0209389_1000248 | 3300027296 | Bacteria | 34726 |
| 276 | Ga0209589_1001871 | 3300027357 | Bacteria | 35557 |
| 277 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 278 | Ga0209489_102684 | 3300027361 | Bacteria | 35799 |
| 279 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 280 | Ga0209813_10032452 | 3300027866 | Bacteria | 1548 |
| 281 | Ga0207428_10008981 | 3300027907 | Bacteria | 9003 |
| 282 | Ga0268266_10009477 | 3300028379 | Bacteria | 8569 |
| 283 | Ga0268266_10260314 | 3300028379 | Bacteria | 1607 |
| 284 | Ga0268265_10035791 | 3300028380 | Bacteria | 3631 |
| 285 | Ga0268264_10015936 | 3300028381 | Bacteria | 6157 |
| 286 | Ga0265334_10048657 | 3300028573 | Bacteria | 1632 |
| 287 | Ga0265323_10000498 | 3300028653 | Bacteria | 22094 |
| 288 | Ga0265336_10000187 | 3300028666 | Bacteria | 43247 |
| 289 | Ga0265338_10001016 | 3300028800 | Bacteria | 47131 |
| 290 | Ga0265338_10126144 | 3300028800 | Bacteria | 2030 |
| 291 | Ga0265324_10023195 | 3300029957 | Bacteria | 2212 |
| 292 | Ga0265325_10001055 | 3300031241 | Bacteria | 19806 |
| 293 | Ga0265325_10016565 | 3300031241 | Bacteria | 4118 |
| 294 | Ga0265325_10033276 | 3300031241 | Bacteria | 2748 |
| 295 | Ga0265325_10057213 | 3300031241 | Bacteria | 1989 |
| 296 | Ga0265340_10070405 | 3300031247 | Bacteria | 1659 |
| 297 | Ga0265339_10000201 | 3300031249 | Bacteria | 49070 |
| 298 | Ga0265339_10011032 | 3300031249 | Bacteria | 5585 |
| 299 | Ga0265339_10012299 | 3300031249 | Bacteria | 5228 |
| 300 | Ga0265339_10031655 | 3300031249 | Bacteria | 2987 |
| 301 | Ga0265313_10000152 | 3300031595 | Bacteria | 71968 |
| 302 | Ga0265313_10007801 | 3300031595 | Bacteria | 7230 |
| 303 | Ga0265314_10069516 | 3300031711 | Bacteria | 2362 |
| 304 | Ga0265342_10005406 | 3300031712 | Bacteria | 9751 |
| 305 | Ga0373923_0060575 | 3300035111 | Bacteria | 1607 |
| 306 | Ga0373953_0044343 | 3300035117 | Bacteria | 1778 |
| 307 | Ga0373956_0006216 | 3300035119 | Bacteria | 4777 |
| 308 | Ga0373956_0012908 | 3300035119 | Bacteria | 3470 |
| 309 | Ga0373957_0047750 | 3300035120 | Bacteria | 1629 |
| 310 | Ga0373960_0010152 | 3300035121 | Bacteria | 2294 |
| 311 | Ga0373955_0008230 | 3300035172 | Bacteria | 4835 |
| 312 | Ga0373955_0074696 | 3300035172 | Bacteria | 1903 |
| 313 | Ga0373955_0089084 | 3300035172 | Bacteria | 1756 |
| 314 | Ga0373961_0024377 | 3300035241 | Bacteria | 1636 |
| 315 | Ga0373962_0027387 | 3300035242 | Bacteria | 1542 |
| 316 | Ga0373924_0017233 | 3300035410 | Bacteria | 2768 |
| 317 | Ga0373931_0015917 | 3300035691 | Bacteria | 3694 |
| 318 | Ga0373931_0063848 | 3300035691 | Bacteria | 1991 |
| 319 | Ga0373935_0005677 | 3300035692 | Bacteria | 7364 |
| 320 | Ga0373935_0117734 | 3300035692 | Bacteria | 1771 |
| 321 | Ga0373935_0192941 | 3300035692 | Bacteria | 1404 |
| 322 | Ga0373927_0012133 | 3300035695 | Bacteria | 5733 |
| 323 | Ga0373927_0172444 | 3300035695 | Bacteria | 1418 |
| 324 | Ga0373933_0001289 | 3300035724 | Bacteria | 14771 |
| 325 | Ga0373933_0083376 | 3300035724 | Bacteria | 1963 |
| 326 | Ga0373933_0096387 | 3300035724 | Bacteria | 1831 |
| 327 | Ga0373947_0018469 | 3300035725 | Bacteria | 4014 |
| 328 | Ga0373947_0076629 | 3300035725 | Bacteria | 2061 |
| 329 | Ga0373937_0009153 | 3300036401 | Bacteria | 8593 |
| 330 | Ga0373937_0029828 | 3300036401 | Bacteria | 4940 |
| 331 | Ga0373937_0363268 | 3300036401 | Bacteria | 1372 |
| 332 | Ga0373925_0027415 | 3300037068 | Bacteria | 4169 |
| 333 | Ga0373925_0077879 | 3300037068 | Bacteria | 2517 |
| 334 | Ga0373925_0153457 | 3300037068 | Bacteria | 1810 |
| 335 | Ga0395900_0064212 | 3300037418 | Bacteria | 3774 |
| 336 | Ga0395900_0396535 | 3300037418 | Bacteria | 1345 |
| 337 | Ga0395898_0040780 | 3300037466 | Bacteria | 4589 |
| 338 | Ga0395898_0194893 | 3300037466 | Bacteria | 1936 |
| 339 | Ga0395905_0026848 | 3300037471 | Bacteria | 5431 |
| 340 | Ga0395905_0084176 | 3300037471 | Bacteria | 2980 |
| 341 | Ga0395905_0110414 | 3300037471 | Bacteria | 2582 |
| 342 | Ga0395905_0138009 | 3300037471 | Bacteria | 2294 |
| 343 | Ga0395905_0381614 | 3300037471 | Bacteria | 1303 |
| 344 | Ga0436364_0879211 | 3300037853 | Bacteria | 2756 |
| 345 | Ga0395901_0034257 | 3300038443 | Bacteria | 5244 |
| 346 | Ga0436361_1074854 | 3300039447 | Bacteria | 5007 |
| 347 | Ga0451797_1189235 | 3300041453 | Bacteria | 1261 |
| 348 | Ga0466969_0030073 | 3300044656 | Bacteria | 2769 |
| 349 | Ga0466972_0000164 | 3300044658 | Bacteria | 53019 |
| 350 | Ga0466972_0031361 | 3300044658 | Bacteria | 2615 |
| 351 | Ga0466966_0001614 | 3300044684 | Bacteria | 14525 |
| 352 | Ga0466966_0045971 | 3300044684 | Bacteria | 2789 |
| 353 | Ga0466966_0094249 | 3300044684 | Bacteria | 1856 |
| 354 | Ga0466961_0000192 | 3300044693 | Bacteria | 40922 |
| 355 | Ga0466961_0118147 | 3300044693 | Bacteria | 1666 |
| 356 | Ga0466963_0003423 | 3300044694 | Bacteria | 9082 |
| 357 | Ga0466963_0029700 | 3300044694 | Bacteria | 3521 |
| 358 | Ga0466970_0026933 | 3300044765 | Bacteria | 3014 |
| 359 | Ga0466959_0000934 | 3300045049 | Bacteria | 17340 |
| 360 | Ga0466959_0033641 | 3300045049 | Bacteria | 3791 |
| 361 | Ga0466967_0043144 | 3300045976 | Bacteria | 3903 |
| 362 | Ga0466967_0063786 | 3300045976 | Bacteria | 3275 |
| 363 | Ga0466967_0146409 | 3300045976 | Bacteria | 2203 |
| 364 | Ga0495617_059668 | 3300046452 | Bacteria | 1263 |
| 365 | Ga0495592_0024501 | 3300046454 | Bacteria | 4586 |
| 366 | Ga0495590_0015955 | 3300046457 | Bacteria | 2717 |
| 367 | Ga0495629_0044604 | 3300046459 | Bacteria | 3111 |
| 368 | Ga0495638_0005230 | 3300046460 | Bacteria | 9693 |
| 369 | Ga0495651_0000289 | 3300046462 | Bacteria | 38999 |
| 370 | Ga0495651_0001839 | 3300046462 | Bacteria | 16395 |
| 371 | Ga0495653_0020419 | 3300046463 | Bacteria | 5371 |
| 372 | Ga0495653_0076046 | 3300046463 | Bacteria | 2497 |
| 373 | Ga0495580_0011443 | 3300046472 | Bacteria | 6865 |
| 374 | Ga0495582_0054292 | 3300046473 | Bacteria | 2210 |
| 375 | Ga0495582_0159592 | 3300046473 | Bacteria | 1282 |
| 376 | Ga0495605_0044303 | 3300046474 | Bacteria | 2201 |
| 377 | Ga0495584_0041459 | 3300046491 | Bacteria | 2324 |
| 378 | Ga0495594_0062923 | 3300046499 | Bacteria | 2055 |
| 379 | Ga0495608_0022281 | 3300046511 | Bacteria | 4343 |
| 380 | Ga0495608_0024703 | 3300046511 | Bacteria | 4106 |
| 381 | Ga0495608_0134794 | 3300046511 | Bacteria | 1578 |
| 382 | Ga0495618_0010089 | 3300046514 | Bacteria | 5711 |
| 383 | Ga0495618_0133201 | 3300046514 | Bacteria | 1590 |
| 384 | Ga0495628_0025037 | 3300046516 | Bacteria | 4879 |
| 385 | Ga0495628_0026676 | 3300046516 | Bacteria | 4706 |
| 386 | Ga0495630_0319363 | 3300046517 | Bacteria | 1187 |
| 387 | Ga0495631_0091338 | 3300046518 | Bacteria | 1311 |
| 388 | Ga0495643_0013829 | 3300046522 | Bacteria | 4816 |
| 389 | Ga0495644_0045526 | 3300046523 | Bacteria | 1650 |
| 390 | Ga0495648_0007226 | 3300046524 | Bacteria | 8920 |
| 391 | Ga0495666_0094672 | 3300046526 | Bacteria | 1409 |
| 392 | Ga0495652_0011343 | 3300046529 | Bacteria | 8059 |
| 393 | Ga0495652_0016070 | 3300046529 | Bacteria | 6696 |
| 394 | Ga0495665_0078423 | 3300046531 | Bacteria | 1738 |
| 395 | Ga0495640_0015608 | 3300046533 | Bacteria | 5708 |
| 396 | Ga0495640_0076374 | 3300046533 | Bacteria | 2235 |
| 397 | Ga0495587_0023897 | 3300046536 | Bacteria | 3752 |
| 398 | Ga0495587_0044076 | 3300046536 | Bacteria | 2654 |
| 399 | Ga0495587_0056318 | 3300046536 | Bacteria | 2313 |
| 400 | Ga0495621_0074245 | 3300046539 | Bacteria | 1258 |
| 401 | Ga0495597_0078986 | 3300046542 | Bacteria | 1409 |
| 402 | Ga0495645_0005611 | 3300046543 | Bacteria | 8631 |
| 403 | Ga0495667_0022641 | 3300046559 | Bacteria | 4233 |
| 404 | Ga0495667_0030231 | 3300046559 | Bacteria | 3642 |
| 405 | Ga0495634_0013494 | 3300046642 | Bacteria | 5902 |
| 406 | Ga0495634_0016981 | 3300046642 | Bacteria | 5199 |
| 407 | Ga0495634_0110707 | 3300046642 | Bacteria | 1766 |
| 408 | Ga0495625_0123959 | 3300046660 | Bacteria | 1756 |
| 409 | Ga0495635_0030666 | 3300046663 | Bacteria | 3735 |
| 410 | Ga0495588_0020997 | 3300046674 | Bacteria | 3214 |
| 411 | Ga0495657_0004591 | 3300046675 | Bacteria | 11023 |
| 412 | Ga0495657_0047211 | 3300046675 | Bacteria | 2912 |
| 413 | Ga0495657_0168741 | 3300046675 | Bacteria | 1349 |
| 414 | Ga0495599_0005172 | 3300046678 | Bacteria | 7778 |
| 415 | Ga0495623_0009855 | 3300046679 | Bacteria | 6191 |
| 416 | Ga0495623_0030892 | 3300046679 | Bacteria | 3446 |
| 417 | Ga0495646_0087624 | 3300046680 | Bacteria | 1804 |
| 418 | Ga0495646_0113172 | 3300046680 | Bacteria | 1543 |
| 419 | Ga0495646_0160930 | 3300046680 | Bacteria | 1243 |
| 420 | Ga0495658_0002851 | 3300046683 | Bacteria | 8688 |
| 421 | Ga0495658_0006954 | 3300046683 | Bacteria | 5580 |
| 422 | Ga0495658_0009239 | 3300046683 | Bacteria | 4903 |
| 423 | Ga0495658_0083925 | 3300046683 | Bacteria | 1875 |
| 424 | Ga0495649_0015557 | 3300046694 | Bacteria | 4328 |
| 425 | Ga0495600_0013346 | 3300046809 | Bacteria | 5159 |
| 426 | Ga0495600_0015147 | 3300046809 | Bacteria | 4871 |
| 427 | Ga0495604_0005625 | 3300047317 | Bacteria | 9939 |
| 428 | Ga0495604_0108437 | 3300047317 | Bacteria | 2028 |
| 429 | Ga0495604_0201437 | 3300047317 | Bacteria | 1381 |
| 430 | Ga0495674_0010369 | 3300047319 | Bacteria | 8820 |
| 431 | Ga0495674_0011929 | 3300047319 | Bacteria | 8194 |
| 432 | Ga0495674_0087310 | 3300047319 | Bacteria | 2669 |
| 433 | Ga0495672_0101348 | 3300047320 | Bacteria | 1561 |
| 434 | Ga0495676_0032821 | 3300047321 | Bacteria | 4379 |
| 435 | Ga0495680_0001654 | 3300047322 | Bacteria | 23702 |
| 436 | Ga0495680_0024726 | 3300047322 | Bacteria | 4978 |
| 437 | Ga0495680_0024804 | 3300047322 | Bacteria | 4968 |
| 438 | Ga0495675_0007713 | 3300047444 | Bacteria | 6637 |
| 439 | Ga0495675_0135442 | 3300047444 | Bacteria | 1529 |
| 440 | Ga0495677_0080197 | 3300047445 | Bacteria | 1223 |
| 441 | Ga0495684_0028806 | 3300047471 | Bacteria | 4263 |
| 442 | Ga0495684_0034799 | 3300047471 | Bacteria | 3865 |
| 443 | Ga0495684_0043382 | 3300047471 | Bacteria | 3443 |
| 444 | Ga0495684_0076387 | 3300047471 | Bacteria | 2544 |
| 445 | Ga0495684_0085404 | 3300047471 | Bacteria | 2393 |
| 446 | Ga0495686_0065217 | 3300047472 | Bacteria | 2252 |
| 447 | Ga0495593_0039449 | 3300047673 | Bacteria | 2546 |
| 448 | Ga0495602_0051018 | 3300048088 | Bacteria | 3689 |
| 449 | Ga0495615_0017282 | 3300048090 | Bacteria | 1569 |
| 450 | Ga0496100_0000883 | 3300048903 | Bacteria | 14297 |
| 451 | Ga0496100_0026894 | 3300048903 | Bacteria | 3532 |
| 452 | Ga0496100_0027461 | 3300048903 | Bacteria | 3500 |
| 453 | Ga0496100_0150035 | 3300048903 | Bacteria | 1661 |
| 454 | Ga0496101_0001721 | 3300048904 | Bacteria | 13111 |
| 455 | Ga0496101_0010306 | 3300048904 | Bacteria | 6171 |
| 456 | Ga0496101_0096070 | 3300048904 | Bacteria | 2211 |
| 457 | Ga0496102_0002752 | 3300048905 | Bacteria | 14995 |
| 458 | Ga0496102_0005298 | 3300048905 | Bacteria | 10948 |
| 459 | Ga0496102_0125437 | 3300048905 | Bacteria | 2399 |
| 460 | Ga0496102_0223476 | 3300048905 | Bacteria | 1775 |
| 461 | Ga0496103_0002481 | 3300048906 | Bacteria | 11568 |
| 462 | Ga0496103_0013626 | 3300048906 | Bacteria | 4823 |
| 463 | Ga0496103_0074029 | 3300048906 | Bacteria | 2134 |
| 464 | Ga0496104_0007237 | 3300048907 | Bacteria | 9793 |
| 465 | Ga0496104_0007787 | 3300048907 | Bacteria | 9493 |
| 466 | Ga0496104_0011552 | 3300048907 | Bacteria | 7912 |
| 467 | Ga0496105_0001558 | 3300048908 | Bacteria | 16229 |
| 468 | Ga0496105_0003169 | 3300048908 | Bacteria | 12121 |
| 469 | Ga0496105_0011182 | 3300048908 | Bacteria | 7080 |
| 470 | Ga0496105_0015800 | 3300048908 | Bacteria | 6022 |
| 471 | Ga0496105_0170851 | 3300048908 | Bacteria | 1782 |
| 472 | Ga0496106_0006865 | 3300048909 | Bacteria | 8425 |
| 473 | Ga0496106_0009006 | 3300048909 | Bacteria | 7378 |
| 474 | Ga0496106_0017900 | 3300048909 | Bacteria | 5240 |
| 475 | Ga0496106_0176557 | 3300048909 | Bacteria | 1695 |
| 476 | Ga0496107_0025595 | 3300048910 | Bacteria | 4178 |
| 477 | Ga0496107_0041992 | 3300048910 | Bacteria | 3285 |
| 478 | Ga0496108_0006599 | 3300048911 | Bacteria | 9408 |
| 479 | Ga0496108_0013514 | 3300048911 | Bacteria | 6662 |
| 480 | Ga0496108_0017132 | 3300048911 | Bacteria | 5925 |
| 481 | Ga0496108_0026234 | 3300048911 | Bacteria | 4805 |
| 482 | Ga0496109_0002993 | 3300048912 | Bacteria | 14119 |
| 483 | Ga0496109_0003652 | 3300048912 | Bacteria | 12860 |
| 484 | Ga0496110_0002213 | 3300048913 | Bacteria | 14531 |
| 485 | Ga0496110_0003023 | 3300048913 | Bacteria | 12763 |
| 486 | Ga0496110_0042720 | 3300048913 | Bacteria | 3957 |
| 487 | Ga0496111_0002054 | 3300048914 | Bacteria | 11995 |
| 488 | Ga0496111_0007911 | 3300048914 | Bacteria | 7010 |
| 489 | Ga0496111_0094059 | 3300048914 | Bacteria | 2198 |
| 490 | Ga0496112_0024108 | 3300048915 | Bacteria | 5823 |
| 491 | Ga0496112_0036512 | 3300048915 | Bacteria | 4794 |
| 492 | Ga0496112_0037830 | 3300048915 | Bacteria | 4711 |
| 493 | Ga0496112_0095544 | 3300048915 | Bacteria | 2942 |
| 494 | Ga0496113_0005117 | 3300048916 | Bacteria | 8146 |
| 495 | Ga0496113_0005565 | 3300048916 | Bacteria | 7871 |
| 496 | Ga0496113_0056499 | 3300048916 | Bacteria | 2947 |
| 497 | Ga0496114_0003895 | 3300048917 | Bacteria | 11508 |
| 498 | Ga0496114_0006922 | 3300048917 | Bacteria | 8930 |
| 499 | Ga0496115_0016238 | 3300048918 | Bacteria | 5665 |
| 500 | Ga0496115_0023466 | 3300048918 | Bacteria | 4788 |
| 501 | Ga0496115_0034919 | 3300048918 | Bacteria | 3975 |
| 502 | Ga0496115_0038291 | 3300048918 | Bacteria | 3804 |
| 503 | Ga0496115_0079170 | 3300048918 | Bacteria | 2675 |
| 504 | Ga0496115_0115028 | 3300048918 | Bacteria | 2212 |
| 505 | Ga0496115_0122854 | 3300048918 | Bacteria | 2137 |
| 506 | Ga0496118_0020990 | 3300048921 | Bacteria | 5768 |
| 507 | Ga0496119_0020758 | 3300048922 | Bacteria | 4773 |
| 508 | Ga0496120_0013345 | 3300048923 | Bacteria | 5538 |
| 509 | Ga0496121_0015737 | 3300048924 | Bacteria | 7882 |
| 510 | Ga0496121_0053118 | 3300048924 | Bacteria | 3396 |
| 511 | Ga0496126_0035526 | 3300048929 | Bacteria | 4670 |
| 512 | Ga0495682_0023857 | 3300049460 | Bacteria | 2282 |
| 513 | Ga0501031_0021558 | 3300049568 | Bacteria | 4200 |
| 514 | Ga0501032_0013465 | 3300049569 | Bacteria | 5815 |
| 515 | Ga0501033_0093170 | 3300049570 | Bacteria | 2203 |
| 516 | Ga0501034_0028780 | 3300049571 | Bacteria | 5652 |
| 517 | Ga0501034_0372974 | 3300049571 | Bacteria | 1353 |
| 518 | Ga0501036_0010044 | 3300049572 | Bacteria | 7798 |
| 519 | Ga0501036_0015237 | 3300049572 | Bacteria | 6420 |
| 520 | Ga0501037_0008767 | 3300049573 | Bacteria | 7414 |
| 521 | Ga0501038_0003573 | 3300049574 | Bacteria | 14467 |
| 522 | Ga0501039_0057503 | 3300049575 | Bacteria | 3011 |
| 523 | Ga0501039_0208255 | 3300049575 | Bacteria | 1537 |
| 524 | Ga0501042_0073201 | 3300049578 | Bacteria | 2451 |
| 525 | Ga0501042_0084909 | 3300049578 | Bacteria | 2270 |
| 526 | Ga0501043_0016285 | 3300049579 | Bacteria | 5830 |
| 527 | Ga0501046_0007715 | 3300049580 | Bacteria | 9433 |
| 528 | Ga0501046_0099345 | 3300049580 | Bacteria | 2234 |
| 529 | Ga0501047_0045311 | 3300049581 | Bacteria | 4252 |
| 530 | Ga0501048_0007056 | 3300049582 | Bacteria | 8534 |
| 531 | Ga0501067_0023020 | 3300049583 | Bacteria | 3450 |
| 532 | Ga0501068_0003549 | 3300049584 | Bacteria | 8427 |
| 533 | Ga0501069_0011843 | 3300049585 | Bacteria | 4623 |
| 534 | Ga0501070_0184796 | 3300049586 | Bacteria | 1714 |
| 535 | Ga0501072_0095346 | 3300049588 | Bacteria | 2365 |
| 536 | Ga0501072_0275789 | 3300049588 | Bacteria | 1338 |
| 537 | Ga0501073_0026789 | 3300049589 | Bacteria | 4127 |
| 538 | Ga0501073_0058946 | 3300049589 | Bacteria | 2682 |
| 539 | Ga0501074_0013706 | 3300049590 | Bacteria | 5892 |
| 540 | Ga0501076_0132736 | 3300049592 | Bacteria | 2020 |
| 541 | Ga0501076_0158981 | 3300049592 | Bacteria | 1840 |
| 542 | Ga0501079_0014563 | 3300049741 | Bacteria | 5998 |
| 543 | Ga0501080_0029067 | 3300049742 | Bacteria | 5145 |
| 544 | Ga0501080_0166332 | 3300049742 | Bacteria | 2035 |
| 545 | Ga0501081_0112052 | 3300049743 | Bacteria | 1937 |
| 546 | Ga0501083_0036721 | 3300049744 | Bacteria | 3340 |
| 547 | Ga0501083_0170912 | 3300049744 | Bacteria | 1421 |
| 548 | Ga0501035_0006796 | 3300049822 | Bacteria | 10687 |
| 549 | Ga0501044_0003604 | 3300049823 | Bacteria | 17424 |
| 550 | Ga0501044_0026832 | 3300049823 | Bacteria | 6096 |
| 551 | Ga0501044_0098521 | 3300049823 | Bacteria | 2943 |
| 552 | Ga0501044_0152533 | 3300049823 | Bacteria | 2292 |
| 553 | Ga0501045_0012008 | 3300049824 | Bacteria | 6088 |
| 554 | nmdc:mga03683_28913_c1 | 3300050489 | Bacteria | 2207 |
| 555 | nmdc:mga03n38_13266_c1 | 3300050490 | Bacteria | 3124 |
| 556 | nmdc:mga03n38_7124_c1 | 3300050490 | Bacteria | 3936 |
| 557 | nmdc:mga00v17_124340_c1 | 3300050491 | Bacteria | 1645 |
| 558 | nmdc:mga00v17_53361_c1 | 3300050491 | Bacteria | 2463 |
| 559 | nmdc:mga0yw44_149246_c1 | 3300050492 | Bacteria | 1524 |
| 560 | nmdc:mga0yw44_17392_c1 | 3300050492 | Bacteria | 3911 |
| 561 | nmdc:mga0yw44_30206_c1 | 3300050492 | Bacteria | 3137 |
| 562 | nmdc:mga0yw44_37486_c1 | 3300050492 | Bacteria | 2863 |
| 563 | nmdc:mga0yw44_43992_c1 | 3300050492 | Bacteria | 2669 |
| 564 | nmdc:mga0k408_31550_c1 | 3300050493 | Bacteria | 3026 |
| 565 | nmdc:mga0k408_7165_c2 | 3300050493 | Bacteria | 4559 |
| 566 | nmdc:mga06z11_46920_c1 | 3300050494 | Bacteria | 2192 |
| 567 | nmdc:mga04h51_18406_c1 | 3300050495 | Bacteria | 2057 |
| 568 | nmdc:mga07m45_18804_c1 | 3300050496 | Bacteria | 2402 |
| 569 | nmdc:mga05p37_11620_c1 | 3300050507 | Bacteria | 10493 |
| 570 | nmdc:mga05p37_1642_c1 | 3300050507 | Bacteria | 25943 |
| 571 | nmdc:mga09592_104661_c1 | 3300050508 | Bacteria | 2425 |
| 572 | nmdc:mga09592_2070_c1 | 3300050508 | Bacteria | 16178 |
| 573 | nmdc:mga09592_34328_c1 | 3300050508 | Bacteria | 4240 |
| 574 | nmdc:mga0qj67_74188_c1 | 3300050509 | Bacteria | 2718 |
| 575 | nmdc:mga0qj67_96891_c1 | 3300050509 | Bacteria | 2375 |
| 576 | nmdc:mga0qj67_9856_c1 | 3300050509 | Bacteria | 7121 |
| 577 | nmdc:mga06r32_349_c1 | 3300050510 | Bacteria | 38472 |
| 578 | nmdc:mga06r32_42434_c1 | 3300050510 | Bacteria | 4325 |
| 579 | nmdc:mga06r32_68482_c1 | 3300050510 | Bacteria | 3429 |
| 580 | nmdc:mga08y16_41385_c1 | 3300050511 | Bacteria | 4827 |
| 581 | nmdc:mga08y16_4843_c1 | 3300050511 | Bacteria | 14047 |
| 582 | nmdc:mga0n895_187155_c1 | 3300050512 | Bacteria | 2101 |
| 583 | nmdc:mga0rr50_28999_c1 | 3300050513 | Bacteria | 3897 |
| 584 | nmdc:mga0a205_132792_c1 | 3300050515 | Bacteria | 2390 |
| 585 | nmdc:mga0sz30_83056_c1 | 3300050516 | Bacteria | 1388 |
| 586 | Ga0495601_0001197 | 3300053077 | Bacteria | 14205 |
| 587 | Ga0495601_0114243 | 3300053077 | Bacteria | 1750 |
| 588 | Ga0495612_0056590 | 3300053078 | Bacteria | 1619 |
| 589 | Ga0495595_0010792 | 3300053084 | Bacteria | 3806 |
| 590 | Ga0495595_0016167 | 3300053084 | Bacteria | 3187 |
| 591 | Ga0495595_0040458 | 3300053084 | Bacteria | 2130 |
| 592 | Ga0495619_0000048 | 3300053085 | Bacteria | 102117 |
| 593 | Ga0495619_0002108 | 3300053085 | Bacteria | 13188 |
| 594 | Ga0495619_0048524 | 3300053085 | Bacteria | 2798 |
| 595 | Ga0495619_0171497 | 3300053085 | Bacteria | 1500 |
| 596 | Ga0500578_0167301 | 3300053086 | Bacteria | 1361 |
| 597 | Ga0500583_0053008 | 3300053092 | Bacteria | 1889 |
| 598 | Ga0500651_0001977 | 3300053093 | Bacteria | 10628 |
| 599 | Ga0500641_0001652 | 3300053096 | Bacteria | 7949 |
| 600 | Ga0500555_007835 | 3300053103 | Bacteria | 3037 |
| 601 | Ga0500556_0014493 | 3300053104 | Bacteria | 2408 |
| 602 | Ga0500572_005340 | 3300053111 | Bacteria | 2907 |
| 603 | Ga0500595_006611 | 3300053119 | Bacteria | 4896 |
| 604 | Ga0500642_0000381 | 3300053130 | Bacteria | 14828 |
| 605 | Ga0500642_0020295 | 3300053130 | Bacteria | 2610 |
| 606 | Ga0500642_0032672 | 3300053130 | Bacteria | 2185 |
| 607 | Ga0500559_0000550 | 3300053136 | Bacteria | 25997 |
| 608 | Ga0500616_0019706 | 3300053153 | Bacteria | 3799 |
| 609 | Ga0500616_0053762 | 3300053153 | Bacteria | 2112 |
| 610 | Ga0500622_0022869 | 3300053156 | Bacteria | 3310 |
| 611 | Ga0500636_0000762 | 3300053177 | Bacteria | 17368 |
| 612 | Ga0500636_0011675 | 3300053177 | Bacteria | 5142 |
| 613 | Ga0501082_0022888 | 3300060353 | Bacteria | 5383 |
| 614 | Ga0501082_0229774 | 3300060353 | Bacteria | 1614 |
| 615 | Ga0530510_0055163 | 3300061734 | Bacteria | 2871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053093 | Ga0500651_0001977 | Ga0500651_0001977_8040_9122 | 360 |
| 2 | 3300053130 | Ga0500642_0032672 | Ga0500642_0032672_583_1665 | 360 |
| 3 | iso_pu_bacteria | 8019530166 | 8019538106 | 367 |
| 4 | 3300005981 | Ga0081538_10080610 | Ga0081538_100806102 | 369 |
| 5 | iso_pu_bacteria | 2693429783 | 2694631462 | 373 |
| 6 | iso_pu_bacteria | 2693429784 | 2694640140 | 373 |
| 7 | 3300005293 | Ga0065715_10116981 | Ga0065715_101169812 | 374 |
| 8 | 3300005327 | Ga0070658_10027674 | Ga0070658_100276742 | 374 |
| 9 | 3300005548 | Ga0070665_100167591 | Ga0070665_1001675912 | 374 |
| 10 | 3300006038 | Ga0075365_10039395 | Ga0075365_100393953 | 374 |
| 11 | 3300006048 | Ga0075363_100002880 | Ga0075363_1000028809 | 374 |
| 12 | 3300006051 | Ga0075364_10016505 | Ga0075364_100165054 | 374 |
| 13 | 3300006353 | Ga0075370_10002544 | Ga0075370_100025444 | 374 |
| 14 | 3300006847 | Ga0075431_100026376 | Ga0075431_1000263764 | 374 |
| 15 | 3300006880 | Ga0075429_100070201 | Ga0075429_1000702013 | 374 |
| 16 | 3300007788 | Ga0099795_10007396 | Ga0099795_100073961 | 374 |
| 17 | 3300009093 | Ga0105240_10448080 | Ga0105240_104480801 | 374 |
| 18 | 3300009147 | Ga0114129_10021818 | Ga0114129_100218189 | 374 |
| 19 | 3300009545 | Ga0105237_10114838 | Ga0105237_101148382 | 374 |
| 20 | 3300009551 | Ga0105238_10009521 | Ga0105238_100095218 | 374 |
| 21 | 3300010375 | Ga0105239_10064105 | Ga0105239_100641053 | 374 |
| 22 | 3300010375 | Ga0105239_10242163 | Ga0105239_102421632 | 374 |
| 23 | 3300010375 | Ga0105239_10267167 | Ga0105239_102671672 | 374 |
| 24 | 3300026041 | Ga0207639_10032148 | Ga0207639_100321483 | 374 |
| 25 | 3300026078 | Ga0207702_10075186 | Ga0207702_100751862 | 374 |
| 26 | 3300031241 | Ga0265325_10057213 | Ga0265325_100572132 | 374 |
| 27 | 3300035692 | Ga0373935_0192941 | Ga0373935_0192941_34_1167 | 374 |
| 28 | 3300035695 | Ga0373927_0012133 | Ga0373927_0012133_3897_5030 | 374 |
| 29 | 3300037068 | Ga0373925_0077879 | Ga0373925_0077879_433_1566 | 374 |
| 30 | 3300037418 | Ga0395900_0064212 | Ga0395900_0064212_744_1991 | 374 |
| 31 | 3300037471 | Ga0395905_0084176 | Ga0395905_0084176_1634_2860 | 374 |
| 32 | 3300037471 | Ga0395905_0138009 | Ga0395905_0138009_1030_2235 | 374 |
| 33 | 3300046526 | Ga0495666_0094672 | Ga0495666_0094672_32_1165 | 374 |
| 34 | 3300046660 | Ga0495625_0123959 | Ga0495625_0123959_539_1693 | 374 |
| 35 | 3300046683 | Ga0495658_0009239 | Ga0495658_0009239_854_1987 | 374 |
| 36 | 3300050490 | nmdc:mga03n38_13266_c1 | nmdc:mga03n38_13266_c1_1007_2233 | 374 |
| 37 | 3300050492 | nmdc:mga0yw44_30206_c1 | nmdc:mga0yw44_30206_c1_1561_2787 | 374 |
| 38 | 3300050508 | nmdc:mga09592_104661_c1 | nmdc:mga09592_104661_c1_937_2061 | 374 |
| 39 | 3300050510 | nmdc:mga06r32_42434_c1 | nmdc:mga06r32_42434_c1_2987_4111 | 374 |
| 40 | iso_pu_bacteria | 2507262055 | 2507511874 | 374 |
| 41 | iso_pu_bacteria | 2508501009 | 2508545538 | 374 |
| 42 | iso_pu_bacteria | 2508501042 | 2508694356 | 374 |
| 43 | iso_pu_bacteria | 2511231028 | 2511396661 | 374 |
| 44 | iso_pu_bacteria | 2513237090 | 2513609237 | 374 |
| 45 | iso_pu_bacteria | 2513237092 | 2513627762 | 374 |
| 46 | iso_pu_bacteria | 2513237095 | 2513651097 | 374 |
| 47 | iso_pu_bacteria | 2513237102 | 2513703539 | 374 |
| 48 | iso_pu_bacteria | 2513237104 | 2513717795 | 374 |
| 49 | iso_pu_bacteria | 2513237161 | 2514014403 | 374 |
| 50 | iso_pu_bacteria | 2515154112 | 2515624713 | 374 |
| 51 | iso_pu_bacteria | 2517093001 | 2517108570 | 374 |
| 52 | iso_pu_bacteria | 2524023205 | 2524438316 | 374 |
| 53 | iso_pu_bacteria | 2528768022 | 2528854953 | 374 |
| 54 | iso_pu_bacteria | 2588253730 | 2588517685 | 374 |
| 55 | iso_pu_bacteria | 2599185301 | 2599937830 | 374 |
| 56 | iso_pu_bacteria | 2617270735 | 2617349627 | 374 |
| 57 | iso_pu_bacteria | 2744054633 | 2745078538 | 374 |
| 58 | iso_pu_bacteria | 2791355196 | 2793059635 | 374 |
| 59 | iso_pu_bacteria | 2802429603 | 2805921870 | 374 |
| 60 | iso_pu_bacteria | 2816332527 | 2818242187 | 374 |
| 61 | iso_pu_bacteria | 2824600985 | 2824608013 | 374 |
| 62 | iso_pu_bacteria | 2824609381 | 2824615053 | 374 |
| 63 | iso_pu_bacteria | 2824617872 | 2824624847 | 374 |
| 64 | iso_pu_bacteria | 2824626560 | 2824633747 | 374 |
| 65 | iso_pu_bacteria | 2824635225 | 2824642310 | 374 |
| 66 | iso_pu_bacteria | 2824644064 | 2824649644 | 374 |
| 67 | iso_pu_bacteria | 2824653114 | 2824659527 | 374 |
| 68 | iso_pu_bacteria | 2824661429 | 2824670055 | 374 |
| 69 | iso_pu_bacteria | 2824671348 | 2824676706 | 374 |
| 70 | iso_pu_bacteria | 2824679649 | 2824686167 | 374 |
| 71 | iso_pu_bacteria | 2824687955 | 2824692993 | 374 |
| 72 | iso_pu_bacteria | 2824696289 | 2824702582 | 374 |
| 73 | iso_pu_bacteria | 2824704595 | 2824711455 | 374 |
| 74 | iso_pu_bacteria | 2824714736 | 2824719746 | 374 |
| 75 | iso_pu_bacteria | 2824723954 | 2824730049 | 374 |
| 76 | iso_pu_bacteria | 2824732956 | 2824738290 | 374 |
| 77 | iso_pu_bacteria | 2824746037 | 2824751733 | 374 |
| 78 | iso_pu_bacteria | 2824753945 | 2824762971 | 374 |
| 79 | iso_pu_bacteria | 2824763712 | 2824772960 | 374 |
| 80 | iso_pu_bacteria | 2824773399 | 2824776993 | 374 |
| 81 | iso_pu_bacteria | 2838074704 | 2838080725 | 374 |
| 82 | iso_pu_bacteria | 2838122688 | 2838128389 | 374 |
| 83 | iso_pu_bacteria | 2841941048 | 2841942249 | 374 |
| 84 | iso_pu_bacteria | 2841949485 | 2841955621 | 374 |
| 85 | iso_pu_bacteria | 2841957949 | 2841963517 | 374 |
| 86 | iso_pu_bacteria | 2841966195 | 2841971230 | 374 |
| 87 | iso_pu_bacteria | 2841974524 | 2841982350 | 374 |
| 88 | iso_pu_bacteria | 2841983080 | 2841984263 | 374 |
| 89 | iso_pu_bacteria | 2842038055 | 2842042005 | 374 |
| 90 | iso_pu_bacteria | 2842045827 | 2842050048 | 374 |
| 91 | iso_pu_bacteria | 2844315083 | 2844321091 | 374 |
| 92 | iso_pu_bacteria | 2847686936 | 2847687803 | 374 |
| 93 | iso_pu_bacteria | 2847930680 | 2847932307 | 374 |
| 94 | iso_pu_bacteria | 2847939898 | 2847943543 | 374 |
| 95 | iso_pu_bacteria | 2849076700 | 2849077265 | 374 |
| 96 | iso_pu_bacteria | 2856356410 | 2856361771 | 374 |
| 97 | iso_pu_bacteria | 2857509624 | 2857515160 | 374 |
| 98 | iso_pu_bacteria | 2871488783 | 2871493774 | 374 |
| 99 | iso_pu_bacteria | 2871495908 | 2871501151 | 374 |
| 100 | iso_pu_bacteria | 2874102143 | 2874106228 | 374 |
| 101 | iso_pu_bacteria | 2874590934 | 2874592254 | 374 |
| 102 | iso_pu_bacteria | 2874612657 | 2874618722 | 374 |
| 103 | iso_pu_bacteria | 2874620515 | 2874624008 | 374 |
| 104 | iso_pu_bacteria | 2874628541 | 2874630985 | 374 |
| 105 | iso_pu_bacteria | 2874645413 | 2874647370 | 374 |
| 106 | iso_pu_bacteria | 2876392853 | 2876399661 | 374 |
| 107 | iso_pu_bacteria | 2876761206 | 2876767412 | 374 |
| 108 | iso_pu_bacteria | 2876771140 | 2876774781 | 374 |
| 109 | iso_pu_bacteria | 2876818435 | 2876819734 | 374 |
| 110 | iso_pu_bacteria | 2878753008 | 2878756350 | 374 |
| 111 | iso_pu_bacteria | 2878760144 | 2878765142 | 374 |
| 112 | iso_pu_bacteria | 2878767105 | 2878772332 | 374 |
| 113 | iso_pu_bacteria | 2879074833 | 2879079349 | 374 |
| 114 | iso_pu_bacteria | 2879083081 | 2879091528 | 374 |
| 115 | iso_pu_bacteria | 2879099564 | 2879101401 | 374 |
| 116 | iso_pu_bacteria | 2879127579 | 2879129083 | 374 |
| 117 | iso_pu_bacteria | 2879142872 | 2879144762 | 374 |
| 118 | iso_pu_bacteria | 2881161766 | 2881162620 | 374 |
| 119 | iso_pu_bacteria | 2881364244 | 2881371132 | 374 |
| 120 | iso_pu_bacteria | 2881665667 | 2881673236 | 374 |
| 121 | iso_pu_bacteria | 2881845957 | 2881849976 | 374 |
| 122 | iso_pu_bacteria | 2881861095 | 2881866797 | 374 |
| 123 | iso_pu_bacteria | 2882912400 | 2882913146 | 374 |
| 124 | iso_pu_bacteria | 2885305155 | 2885311432 | 374 |
| 125 | iso_pu_bacteria | 2885318864 | 2885325487 | 374 |
| 126 | iso_pu_bacteria | 2885326080 | 2885329064 | 374 |
| 127 | iso_pu_bacteria | 2885334103 | 2885340478 | 374 |
| 128 | iso_pu_bacteria | 2885366525 | 2885374062 | 374 |
| 129 | iso_pu_bacteria | 2888378607 | 2888387384 | 374 |
| 130 | iso_pu_bacteria | 2888388044 | 2888391819 | 374 |
| 131 | iso_pu_bacteria | 2888419890 | 2888426605 | 374 |
| 132 | iso_pu_bacteria | 2903492973 | 2903502722 | 374 |
| 133 | iso_pu_bacteria | 2903540706 | 2903545964 | 374 |
| 134 | iso_pu_bacteria | 2903727486 | 2903728514 | 374 |
| 135 | iso_pu_bacteria | 2904659560 | 2904666188 | 374 |
| 136 | iso_pu_bacteria | 2904666416 | 2904670719 | 374 |
| 137 | iso_pu_bacteria | 2904711408 | 2904718960 | 374 |
| 138 | iso_pu_bacteria | 2906328253 | 2906332191 | 374 |
| 139 | iso_pu_bacteria | 2906602504 | 2906607706 | 374 |
| 140 | iso_pu_bacteria | 2906626472 | 2906629325 | 374 |
| 141 | iso_pu_bacteria | 2906643746 | 2906645376 | 374 |
| 142 | iso_pu_bacteria | 2922368715 | 2922370561 | 374 |
| 143 | iso_pu_bacteria | 2922393267 | 2922396438 | 374 |
| 144 | iso_pu_bacteria | 2924784321 | 2924787923 | 374 |
| 145 | iso_pu_bacteria | 2929615660 | 2929620137 | 374 |
| 146 | iso_pu_bacteria | 2929624759 | 2929629450 | 374 |
| 147 | iso_pu_bacteria | 2932784394 | 2932791492 | 374 |
| 148 | iso_pu_bacteria | 2932809354 | 2932816748 | 374 |
| 149 | iso_pu_bacteria | 2932818245 | 2932824070 | 374 |
| 150 | iso_pu_bacteria | 2932828146 | 2932835394 | 374 |
| 151 | iso_pu_bacteria | 2933577622 | 2933582054 | 374 |
| 152 | iso_pu_bacteria | 2935608549 | 2935613483 | 374 |
| 153 | iso_pu_bacteria | 2935616580 | 2935621137 | 374 |
| 154 | iso_pu_bacteria | 2935638405 | 2935643556 | 374 |
| 155 | iso_pu_bacteria | 2935648319 | 2935650479 | 374 |
| 156 | iso_pu_bacteria | 2935656913 | 2935662921 | 374 |
| 157 | iso_pu_bacteria | 2935665750 | 2935671134 | 374 |
| 158 | iso_pu_bacteria | 2935675223 | 2935681260 | 374 |
| 159 | iso_pu_bacteria | 2935684952 | 2935689397 | 374 |
| 160 | iso_pu_bacteria | 2935694250 | 2935699972 | 374 |
| 161 | iso_pu_bacteria | 2935703347 | 2935712097 | 374 |
| 162 | iso_pu_bacteria | 2935713505 | 2935720343 | 374 |
| 163 | iso_pu_bacteria | 2935722832 | 2935728040 | 374 |
| 164 | iso_pu_bacteria | 2935732158 | 2935737363 | 374 |
| 165 | iso_pu_bacteria | 2935741537 | 2935746576 | 374 |
| 166 | iso_pu_bacteria | 2935750917 | 2935757543 | 374 |
| 167 | iso_pu_bacteria | 2935760218 | 2935763920 | 374 |
| 168 | iso_pu_bacteria | 2935777560 | 2935781533 | 374 |
| 169 | iso_pu_bacteria | 2935801545 | 2935807897 | 374 |
| 170 | iso_pu_bacteria | 2935810662 | 2935818769 | 374 |
| 171 | iso_pu_bacteria | 2935819856 | 2935824664 | 374 |
| 172 | iso_pu_bacteria | 2935827899 | 2935833073 | 374 |
| 173 | iso_pu_bacteria | 2935837841 | 2935844271 | 374 |
| 174 | iso_pu_bacteria | 2935847175 | 2935851884 | 374 |
| 175 | iso_pu_bacteria | 2935855204 | 2935859670 | 374 |
| 176 | iso_pu_bacteria | 2935864058 | 2935872068 | 374 |
| 177 | iso_pu_bacteria | 2935873716 | 2935879008 | 374 |
| 178 | iso_pu_bacteria | 2935908558 | 2935911234 | 374 |
| 179 | iso_pu_bacteria | 2935916978 | 2935920766 | 374 |
| 180 | iso_pu_bacteria | 2935926038 | 2935928263 | 374 |
| 181 | iso_pu_bacteria | 2935934488 | 2935937908 | 374 |
| 182 | iso_pu_bacteria | 2935942939 | 2935945190 | 374 |
| 183 | iso_pu_bacteria | 2935951376 | 2935954304 | 374 |
| 184 | iso_pu_bacteria | 2935959822 | 2935965617 | 374 |
| 185 | iso_pu_bacteria | 2935967501 | 2935971428 | 374 |
| 186 | iso_pu_bacteria | 2935975950 | 2935982048 | 374 |
| 187 | iso_pu_bacteria | 2935984226 | 2935990613 | 374 |
| 188 | iso_pu_bacteria | 2935992306 | 2936000355 | 374 |
| 189 | iso_pu_bacteria | 2936002035 | 2936008513 | 374 |
| 190 | iso_pu_bacteria | 2936011229 | 2936017165 | 374 |
| 191 | iso_pu_bacteria | 2936019824 | 2936026700 | 374 |
| 192 | iso_pu_bacteria | 2936028420 | 2936035443 | 374 |
| 193 | iso_pu_bacteria | 2936037263 | 2936045579 | 374 |
| 194 | iso_pu_bacteria | 2936046547 | 2936053592 | 374 |
| 195 | iso_pu_bacteria | 2936055302 | 2936062670 | 374 |
| 196 | iso_pu_bacteria | 2937891427 | 2937891653 | 374 |
| 197 | iso_pu_bacteria | 2937994558 | 2937999820 | 374 |
| 198 | iso_pu_bacteria | 2938014810 | 2938018570 | 374 |
| 199 | iso_pu_bacteria | 2940556831 | 2940563635 | 374 |
| 200 | iso_pu_bacteria | 2941538514 | 2941542603 | 374 |
| 201 | iso_pu_bacteria | 2958115193 | 2958117222 | 374 |
| 202 | iso_pu_bacteria | 2958165035 | 2958170285 | 374 |
| 203 | iso_pu_bacteria | 2961114664 | 2961121531 | 374 |
| 204 | iso_pu_bacteria | 2961163497 | 2961168737 | 374 |
| 205 | iso_pu_bacteria | 2961170736 | 2961172639 | 374 |
| 206 | iso_pu_bacteria | 2965018300 | 2965023529 | 374 |
| 207 | iso_pu_bacteria | 2967996073 | 2967997851 | 374 |
| 208 | iso_pu_bacteria | 2968003550 | 2968008502 | 374 |
| 209 | iso_pu_bacteria | 2968097103 | 2968098263 | 374 |
| 210 | iso_pu_bacteria | 2968110612 | 2968117684 | 374 |
| 211 | iso_pu_bacteria | 2968171901 | 2968177143 | 374 |
| 212 | iso_pu_bacteria | 2970503327 | 2970505233 | 374 |
| 213 | iso_pu_bacteria | 2970554993 | 2970559989 | 374 |
| 214 | iso_pu_bacteria | 2977821940 | 2977825531 | 374 |
| 215 | iso_pu_bacteria | 2977828996 | 2977832445 | 374 |
| 216 | iso_pu_bacteria | 2977858184 | 2977864829 | 374 |
| 217 | iso_pu_bacteria | 2979779861 | 2979780065 | 374 |
| 218 | iso_pu_bacteria | 2979808191 | 2979809954 | 374 |
| 219 | iso_pu_bacteria | 2987659509 | 2987664769 | 374 |
| 220 | iso_pu_bacteria | 3004188549 | 3004193825 | 374 |
| 221 | iso_pu_bacteria | 3005483717 | 3005490194 | 374 |
| 222 | iso_pu_bacteria | 3005587118 | 3005591715 | 374 |
| 223 | iso_pu_bacteria | 3005710791 | 3005717153 | 374 |
| 224 | iso_pu_bacteria | 3005718088 | 3005724124 | 374 |
| 225 | iso_pu_bacteria | 8004374579 | 8004377939 | 374 |
| 226 | iso_pu_bacteria | 8004445564 | 8004451151 | 374 |
| 227 | iso_pu_bacteria | 8004703790 | 8004711105 | 374 |
| 228 | iso_pu_bacteria | 8006926726 | 8006929466 | 374 |
| 229 | iso_pu_bacteria | 8016511872 | 8016519491 | 374 |
| 230 | iso_pu_bacteria | 8016548790 | 8016550559 | 374 |
| 231 | iso_pu_bacteria | 8016583857 | 8016588687 | 374 |
| 232 | iso_pu_bacteria | 8016630954 | 8016637189 | 374 |
| 233 | iso_pu_bacteria | 8017057580 | 8017066031 | 374 |
| 234 | iso_pu_bacteria | 8019538911 | 8019541877 | 374 |
| 235 | iso_pu_bacteria | 8019576017 | 8019578601 | 374 |
| 236 | iso_pu_bacteria | 8019586578 | 8019596651 | 374 |
| 237 | iso_pu_bacteria | 8019597564 | 8019605052 | 374 |
| 238 | iso_pu_bacteria | 8019608314 | 8019613483 | 374 |
| 239 | iso_pu_bacteria | 8019629233 | 8019637874 | 374 |
| 240 | iso_pu_bacteria | 8019668869 | 8019675329 | 374 |
| 241 | iso_pu_bacteria | 8019678201 | 8019680776 | 374 |
| 242 | iso_pu_bacteria | 8019687851 | 8019694992 | 374 |
| 243 | iso_pu_bacteria | 8055742211 | 8055750110 | 374 |
| 244 | iso_pu_bacteria | 8056967851 | 8056975889 | 374 |
| 245 | 3300003214 | JGI25165J46597_1005784 | JGI25165J46597_10057842 | 375 |
| 246 | 3300003354 | JGI25160J50197_1003229 | JGI25160J50197_10032298 | 375 |
| 247 | 3300003354 | JGI25160J50197_1007225 | JGI25160J50197_10072255 | 375 |
| 248 | 3300003762 | Ga0055542_1006782 | Ga0055542_10067822 | 375 |
| 249 | 3300003794 | Ga0055531_10010606 | Ga0055531_100106064 | 375 |
| 250 | 3300004625 | Ga0055543_1004550 | Ga0055543_10045501 | 375 |
| 251 | 3300004625 | Ga0055543_1013727 | Ga0055543_10137271 | 375 |
| 252 | 3300005262 | Ga0065165_1002476 | Ga0065165_100247611 | 375 |
| 253 | 3300005262 | Ga0065165_1022581 | Ga0065165_10225812 | 375 |
| 254 | 3300005329 | Ga0070683_100306551 | Ga0070683_1003065511 | 375 |
| 255 | 3300005355 | Ga0070671_100024253 | Ga0070671_1000242533 | 375 |
| 256 | 3300005436 | Ga0070713_100084577 | Ga0070713_1000845772 | 375 |
| 257 | 3300005459 | Ga0068867_100225597 | Ga0068867_1002255972 | 375 |
| 258 | 3300005548 | Ga0070665_100024056 | Ga0070665_1000240563 | 375 |
| 259 | 3300005564 | Ga0070664_100351603 | Ga0070664_1003516031 | 375 |
| 260 | 3300005719 | Ga0068861_100038125 | Ga0068861_1000381252 | 375 |
| 261 | 3300005983 | Ga0081540_1003809 | Ga0081540_10038095 | 375 |
| 262 | 3300006038 | Ga0075365_10063288 | Ga0075365_100632883 | 375 |
| 263 | 3300006042 | Ga0075368_10001970 | Ga0075368_100019703 | 375 |
| 264 | 3300006048 | Ga0075363_100012377 | Ga0075363_1000123774 | 375 |
| 265 | 3300006051 | Ga0075364_10095620 | Ga0075364_100956202 | 375 |
| 266 | 3300006186 | Ga0075369_10055983 | Ga0075369_100559832 | 375 |
| 267 | 3300006195 | Ga0075366_10023925 | Ga0075366_100239253 | 375 |
| 268 | 3300006353 | Ga0075370_10017867 | Ga0075370_100178673 | 375 |
| 269 | 3300006844 | Ga0075428_100020439 | Ga0075428_1000204395 | 375 |
| 270 | 3300006846 | Ga0075430_100007526 | Ga0075430_1000075268 | 375 |
| 271 | 3300006847 | Ga0075431_100020676 | Ga0075431_1000206761 | 375 |
| 272 | 3300006852 | Ga0075433_10007493 | Ga0075433_100074932 | 375 |
| 273 | 3300006852 | Ga0075433_10093255 | Ga0075433_100932552 | 375 |
| 274 | 3300006852 | Ga0075433_10151833 | Ga0075433_101518332 | 375 |
| 275 | 3300006871 | Ga0075434_100379866 | Ga0075434_1003798661 | 375 |
| 276 | 3300006880 | Ga0075429_100159168 | Ga0075429_1001591682 | 375 |
| 277 | 3300006942 | Ga0099824_1008513 | Ga0099824_100851314 | 375 |
| 278 | 3300006944 | Ga0099823_1004051 | Ga0099823_10040516 | 375 |
| 279 | 3300007076 | Ga0075435_100037674 | Ga0075435_1000376742 | 375 |
| 280 | 3300007265 | Ga0099794_10014407 | Ga0099794_100144072 | 375 |
| 281 | 3300009094 | Ga0111539_10004128 | Ga0111539_1000412813 | 375 |
| 282 | 3300009174 | Ga0105241_10052381 | Ga0105241_100523814 | 375 |
| 283 | 3300009545 | Ga0105237_10098727 | Ga0105237_100987273 | 375 |
| 284 | 3300009551 | Ga0105238_10013778 | Ga0105238_100137782 | 375 |
| 285 | 3300010375 | Ga0105239_10102667 | Ga0105239_101026673 | 375 |
| 286 | 3300010375 | Ga0105239_10587753 | Ga0105239_105877531 | 375 |
| 287 | 3300014325 | Ga0163163_10168817 | Ga0163163_101688172 | 375 |
| 288 | 3300014497 | Ga0182008_10057241 | Ga0182008_100572412 | 375 |
| 289 | 3300021320 | Ga0214544_1000163 | Ga0214544_100016377 | 375 |
| 290 | 3300021321 | Ga0214542_1000156 | Ga0214542_100015633 | 375 |
| 291 | 3300021324 | Ga0214545_1000078 | Ga0214545_100007877 | 375 |
| 292 | 3300021327 | Ga0214543_1000136 | Ga0214543_100013677 | 375 |
| 293 | 3300025230 | Ga0209563_104066 | Ga0209563_1040661 | 375 |
| 294 | 3300025254 | Ga0209148_1000232 | Ga0209148_100023215 | 375 |
| 295 | 3300025261 | Ga0209233_1001298 | Ga0209233_10012983 | 375 |
| 296 | 3300025261 | Ga0209233_1007012 | Ga0209233_10070123 | 375 |
| 297 | 3300025272 | Ga0209455_1002245 | Ga0209455_10022457 | 375 |
| 298 | 3300025295 | Ga0209564_1013870 | Ga0209564_10138703 | 375 |
| 299 | 3300025297 | Ga0209758_1000705 | Ga0209758_100070530 | 375 |
| 300 | 3300025297 | Ga0209758_1000986 | Ga0209758_100098614 | 375 |
| 301 | 3300025297 | Ga0209758_1002299 | Ga0209758_100229917 | 375 |
| 302 | 3300025297 | Ga0209758_1005881 | Ga0209758_100588110 | 375 |
| 303 | 3300025299 | Ga0209256_1008548 | Ga0209256_10085483 | 375 |
| 304 | 3300025302 | Ga0207426_1000632 | Ga0207426_100063210 | 375 |
| 305 | 3300025302 | Ga0207426_1015236 | Ga0207426_10152362 | 375 |
| 306 | 3300025304 | Ga0209257_1001185 | Ga0209257_100118534 | 375 |
| 307 | 3300025304 | Ga0209257_1010432 | Ga0209257_10104322 | 375 |
| 308 | 3300025315 | Ga0207697_10062690 | Ga0207697_100626902 | 375 |
| 309 | 3300025904 | Ga0207647_10065485 | Ga0207647_100654851 | 375 |
| 310 | 3300025914 | Ga0207671_10108200 | Ga0207671_101082003 | 375 |
| 311 | 3300025915 | Ga0207693_10237673 | Ga0207693_102376731 | 375 |
| 312 | 3300025928 | Ga0207700_10046679 | Ga0207700_100466792 | 375 |
| 313 | 3300025931 | Ga0207644_10156758 | Ga0207644_101567581 | 375 |
| 314 | 3300025934 | Ga0207686_10230259 | Ga0207686_102302591 | 375 |
| 315 | 3300025941 | Ga0207711_10180258 | Ga0207711_101802582 | 375 |
| 316 | 3300025944 | Ga0207661_10286338 | Ga0207661_102863382 | 375 |
| 317 | 3300026035 | Ga0207703_10065560 | Ga0207703_100655601 | 375 |
| 318 | 3300026067 | Ga0207678_10229216 | Ga0207678_102292161 | 375 |
| 319 | 3300026089 | Ga0207648_10259651 | Ga0207648_102596511 | 375 |
| 320 | 3300027296 | Ga0209389_1000019 | Ga0209389_100001964 | 375 |
| 321 | 3300027296 | Ga0209389_1000248 | Ga0209389_100024817 | 375 |
| 322 | 3300027357 | Ga0209589_1001871 | Ga0209589_100187117 | 375 |
| 323 | 3300027361 | Ga0209489_100033 | Ga0209489_10003363 | 375 |
| 324 | 3300027361 | Ga0209489_102684 | Ga0209489_10268417 | 375 |
| 325 | 3300027363 | Ga0209700_100012 | Ga0209700_100012305 | 375 |
| 326 | 3300027866 | Ga0209813_10032452 | Ga0209813_100324522 | 375 |
| 327 | 3300028379 | Ga0268266_10009477 | Ga0268266_100094774 | 375 |
| 328 | 3300028573 | Ga0265334_10048657 | Ga0265334_100486571 | 375 |
| 329 | 3300028653 | Ga0265323_10000498 | Ga0265323_1000049821 | 375 |
| 330 | 3300028666 | Ga0265336_10000187 | Ga0265336_1000018737 | 375 |
| 331 | 3300028800 | Ga0265338_10001016 | Ga0265338_100010161 | 375 |
| 332 | 3300029957 | Ga0265324_10023195 | Ga0265324_100231952 | 375 |
| 333 | 3300031241 | Ga0265325_10016565 | Ga0265325_100165654 | 375 |
| 334 | 3300031249 | Ga0265339_10011032 | Ga0265339_100110324 | 375 |
| 335 | 3300031249 | Ga0265339_10012299 | Ga0265339_100122993 | 375 |
| 336 | 3300031249 | Ga0265339_10031655 | Ga0265339_100316553 | 375 |
| 337 | 3300031595 | Ga0265313_10007801 | Ga0265313_100078012 | 375 |
| 338 | 3300031711 | Ga0265314_10069516 | Ga0265314_100695162 | 375 |
| 339 | 3300031712 | Ga0265342_10005406 | Ga0265342_100054065 | 375 |
| 340 | 3300035692 | Ga0373935_0005677 | Ga0373935_0005677_5864_7000 | 375 |
| 341 | 3300035725 | Ga0373947_0076629 | Ga0373947_0076629_157_1293 | 375 |
| 342 | 3300037068 | Ga0373925_0027415 | Ga0373925_0027415_87_1223 | 375 |
| 343 | 3300037466 | Ga0395898_0040780 | Ga0395898_0040780_2659_3795 | 375 |
| 344 | 3300037466 | Ga0395898_0194893 | Ga0395898_0194893_239_1375 | 375 |
| 345 | 3300037471 | Ga0395905_0026848 | Ga0395905_0026848_1963_3099 | 375 |
| 346 | 3300037471 | Ga0395905_0110414 | Ga0395905_0110414_1043_2179 | 375 |
| 347 | 3300037853 | Ga0436364_0879211 | Ga0436364_0879211_1573_2709 | 375 |
| 348 | 3300038443 | Ga0395901_0034257 | Ga0395901_0034257_2983_4119 | 375 |
| 349 | 3300039447 | Ga0436361_1074854 | Ga0436361_1074854_3597_4736 | 375 |
| 350 | 3300041453 | Ga0451797_1189235 | Ga0451797_1189235_35_1171 | 375 |
| 351 | 3300044658 | Ga0466972_0031361 | Ga0466972_0031361_1167_2303 | 375 |
| 352 | 3300044684 | Ga0466966_0094249 | Ga0466966_0094249_14_1150 | 375 |
| 353 | 3300044694 | Ga0466963_0029700 | Ga0466963_0029700_548_1684 | 375 |
| 354 | 3300045049 | Ga0466959_0033641 | Ga0466959_0033641_1546_2682 | 375 |
| 355 | 3300045976 | Ga0466967_0146409 | Ga0466967_0146409_903_2039 | 375 |
| 356 | 3300046454 | Ga0495592_0024501 | Ga0495592_0024501_2070_3233 | 375 |
| 357 | 3300046459 | Ga0495629_0044604 | Ga0495629_0044604_1347_2483 | 375 |
| 358 | 3300046462 | Ga0495651_0001839 | Ga0495651_0001839_8637_9800 | 375 |
| 359 | 3300046463 | Ga0495653_0076046 | Ga0495653_0076046_895_2058 | 375 |
| 360 | 3300046472 | Ga0495580_0011443 | Ga0495580_0011443_5590_6738 | 375 |
| 361 | 3300046473 | Ga0495582_0159592 | Ga0495582_0159592_43_1179 | 375 |
| 362 | 3300046511 | Ga0495608_0024703 | Ga0495608_0024703_496_1659 | 375 |
| 363 | 3300046514 | Ga0495618_0133201 | Ga0495618_0133201_313_1449 | 375 |
| 364 | 3300046516 | Ga0495628_0026676 | Ga0495628_0026676_2650_3813 | 375 |
| 365 | 3300046517 | Ga0495630_0319363 | Ga0495630_0319363_41_1177 | 375 |
| 366 | 3300046522 | Ga0495643_0013829 | Ga0495643_0013829_3047_4183 | 375 |
| 367 | 3300046529 | Ga0495652_0011343 | Ga0495652_0011343_192_1355 | 375 |
| 368 | 3300046533 | Ga0495640_0076374 | Ga0495640_0076374_870_2006 | 375 |
| 369 | 3300046536 | Ga0495587_0023897 | Ga0495587_0023897_2182_3345 | 375 |
| 370 | 3300046542 | Ga0495597_0078986 | Ga0495597_0078986_88_1224 | 375 |
| 371 | 3300046543 | Ga0495645_0005611 | Ga0495645_0005611_2716_3879 | 375 |
| 372 | 3300046663 | Ga0495635_0030666 | Ga0495635_0030666_1253_2389 | 375 |
| 373 | 3300046674 | Ga0495588_0020997 | Ga0495588_0020997_395_1531 | 375 |
| 374 | 3300046675 | Ga0495657_0004591 | Ga0495657_0004591_6633_7796 | 375 |
| 375 | 3300046678 | Ga0495599_0005172 | Ga0495599_0005172_6213_7376 | 375 |
| 376 | 3300046679 | Ga0495623_0030892 | Ga0495623_0030892_840_2003 | 375 |
| 377 | 3300046680 | Ga0495646_0087624 | Ga0495646_0087624_188_1324 | 375 |
| 378 | 3300046683 | Ga0495658_0002851 | Ga0495658_0002851_4083_5231 | 375 |
| 379 | 3300046809 | Ga0495600_0015147 | Ga0495600_0015147_605_1768 | 375 |
| 380 | 3300047317 | Ga0495604_0201437 | Ga0495604_0201437_186_1349 | 375 |
| 381 | 3300047319 | Ga0495674_0011929 | Ga0495674_0011929_2553_3716 | 375 |
| 382 | 3300047320 | Ga0495672_0101348 | Ga0495672_0101348_203_1339 | 375 |
| 383 | 3300047321 | Ga0495676_0032821 | Ga0495676_0032821_894_2030 | 375 |
| 384 | 3300047322 | Ga0495680_0001654 | Ga0495680_0001654_10555_11718 | 375 |
| 385 | 3300047471 | Ga0495684_0085404 | Ga0495684_0085404_440_1603 | 375 |
| 386 | 3300048904 | Ga0496101_0096070 | Ga0496101_0096070_880_2016 | 375 |
| 387 | 3300048905 | Ga0496102_0125437 | Ga0496102_0125437_1155_2291 | 375 |
| 388 | 3300048906 | Ga0496103_0013626 | Ga0496103_0013626_3065_4201 | 375 |
| 389 | 3300048907 | Ga0496104_0007787 | Ga0496104_0007787_7428_8564 | 375 |
| 390 | 3300048907 | Ga0496104_0011552 | Ga0496104_0011552_6701_7837 | 375 |
| 391 | 3300048908 | Ga0496105_0015800 | Ga0496105_0015800_902_2038 | 375 |
| 392 | 3300048909 | Ga0496106_0006865 | Ga0496106_0006865_3802_4938 | 375 |
| 393 | 3300048911 | Ga0496108_0026234 | Ga0496108_0026234_3447_4583 | 375 |
| 394 | 3300048915 | Ga0496112_0024108 | Ga0496112_0024108_269_1405 | 375 |
| 395 | 3300048916 | Ga0496113_0056499 | Ga0496113_0056499_1761_2897 | 375 |
| 396 | 3300048918 | Ga0496115_0023466 | Ga0496115_0023466_3348_4484 | 375 |
| 397 | 3300048918 | Ga0496115_0034919 | Ga0496115_0034919_894_2030 | 375 |
| 398 | 3300048918 | Ga0496115_0122854 | Ga0496115_0122854_855_1991 | 375 |
| 399 | 3300048922 | Ga0496119_0020758 | Ga0496119_0020758_2291_3427 | 375 |
| 400 | 3300048923 | Ga0496120_0013345 | Ga0496120_0013345_4161_5297 | 375 |
| 401 | 3300048924 | Ga0496121_0015737 | Ga0496121_0015737_3554_4690 | 375 |
| 402 | 3300048924 | Ga0496121_0053118 | Ga0496121_0053118_923_2059 | 375 |
| 403 | 3300048929 | Ga0496126_0035526 | Ga0496126_0035526_733_1869 | 375 |
| 404 | 3300049571 | Ga0501034_0372974 | Ga0501034_0372974_138_1295 | 375 |
| 405 | 3300049588 | Ga0501072_0275789 | Ga0501072_0275789_122_1258 | 375 |
| 406 | 3300050490 | nmdc:mga03n38_7124_c1 | nmdc:mga03n38_7124_c1_567_1703 | 375 |
| 407 | 3300050491 | nmdc:mga00v17_124340_c1 | nmdc:mga00v17_124340_c1_144_1280 | 375 |
| 408 | 3300050492 | nmdc:mga0yw44_149246_c1 | nmdc:mga0yw44_149246_c1_276_1412 | 375 |
| 409 | 3300050492 | nmdc:mga0yw44_37486_c1 | nmdc:mga0yw44_37486_c1_297_1433 | 375 |
| 410 | 3300050492 | nmdc:mga0yw44_43992_c1 | nmdc:mga0yw44_43992_c1_820_1956 | 375 |
| 411 | 3300050493 | nmdc:mga0k408_7165_c2 | nmdc:mga0k408_7165_c2_2513_3649 | 375 |
| 412 | 3300050494 | nmdc:mga06z11_46920_c1 | nmdc:mga06z11_46920_c1_924_2060 | 375 |
| 413 | 3300050495 | nmdc:mga04h51_18406_c1 | nmdc:mga04h51_18406_c1_623_1759 | 375 |
| 414 | 3300050496 | nmdc:mga07m45_18804_c1 | nmdc:mga07m45_18804_c1_478_1614 | 375 |
| 415 | 3300050509 | nmdc:mga0qj67_9856_c1 | nmdc:mga0qj67_9856_c1_2412_3548 | 375 |
| 416 | 3300050513 | nmdc:mga0rr50_28999_c1 | nmdc:mga0rr50_28999_c1_1744_2880 | 375 |
| 417 | 3300050515 | nmdc:mga0a205_132792_c1 | nmdc:mga0a205_132792_c1_600_1736 | 375 |
| 418 | 3300050516 | nmdc:mga0sz30_83056_c1 | nmdc:mga0sz30_83056_c1_131_1267 | 375 |
| 419 | 3300053085 | Ga0495619_0171497 | Ga0495619_0171497_18_1181 | 375 |
| 420 | 3300053086 | Ga0500578_0167301 | Ga0500578_0167301_136_1299 | 375 |
| 421 | 3300053103 | Ga0500555_007835 | Ga0500555_007835_59_1222 | 375 |
| 422 | 3300053111 | Ga0500572_005340 | Ga0500572_005340_1630_2766 | 375 |
| 423 | 3300053130 | Ga0500642_0000381 | Ga0500642_0000381_5737_6873 | 375 |
| 424 | 3300053136 | Ga0500559_0000550 | Ga0500559_0000550_15435_16571 | 375 |
| 425 | iso_pu_bacteria | 2513237094 | 2513643307 | 375 |
| 426 | iso_pu_bacteria | 2617270741 | 2617376813 | 375 |
| 427 | iso_pu_bacteria | 2643221547 | 2643757516 | 375 |
| 428 | iso_pu_bacteria | 2767802442 | 2770196034 | 375 |
| 429 | iso_pu_bacteria | 2908775508 | 2908782711 | 375 |
| 430 | iso_pu_bacteria | 2932794094 | 2932796895 | 375 |
| 431 | iso_pu_bacteria | 2932801729 | 2932802327 | 375 |
| 432 | iso_pu_bacteria | 2935785616 | 2935789851 | 375 |
| 433 | iso_pu_bacteria | 2935793552 | 2935798383 | 375 |
| 434 | iso_pu_bacteria | 2935883170 | 2935887233 | 375 |
| 435 | iso_pu_bacteria | 2941531003 | 2941537267 | 375 |
| 436 | iso_pu_bacteria | 3005594810 | 3005601431 | 375 |
| 437 | iso_pu_bacteria | 8016522445 | 8016524866 | 375 |
| 438 | iso_pu_bacteria | 8016539877 | 8016542722 | 375 |
| 439 | iso_pu_bacteria | 8016575299 | 8016580782 | 375 |
| 440 | iso_pu_bacteria | 8016595262 | 8016596940 | 375 |
| 441 | iso_pu_bacteria | 8016603502 | 8016607848 | 375 |
| 442 | iso_pu_bacteria | 8016613128 | 8016619631 | 375 |
| 443 | iso_pu_bacteria | 8016622563 | 8016629977 | 375 |
| 444 | iso_pu_bacteria | 8019547302 | 8019548921 | 375 |
| 445 | iso_pu_bacteria | 8019619141 | 8019624153 | 375 |
| 446 | iso_pu_bacteria | 8019638758 | 8019641750 | 375 |
| 447 | iso_pu_bacteria | 8019648815 | 8019653673 | 375 |
| 448 | 3300001990 | JGI24737J22298_10008874 | JGI24737J22298_100088742 | 376 |
| 449 | 3300002070 | JGI24750J21931_1000382 | JGI24750J21931_10003827 | 376 |
| 450 | 3300002077 | JGI24744J21845_10001405 | JGI24744J21845_100014053 | 376 |
| 451 | 3300002239 | JGI24034J26672_10001624 | JGI24034J26672_100016243 | 376 |
| 452 | 3300002244 | JGI24742J22300_10000921 | JGI24742J22300_100009213 | 376 |
| 453 | 3300002459 | JGI24751J29686_10001730 | JGI24751J29686_100017303 | 376 |
| 454 | 3300003320 | rootH2_10015505 | rootH2_100155054 | 376 |
| 455 | 3300003354 | JGI25160J50197_1011223 | JGI25160J50197_10112233 | 376 |
| 456 | 3300005262 | Ga0065165_1002846 | Ga0065165_100284610 | 376 |
| 457 | 3300005327 | Ga0070658_10040277 | Ga0070658_100402774 | 376 |
| 458 | 3300005329 | Ga0070683_100327714 | Ga0070683_1003277141 | 376 |
| 459 | 3300005330 | Ga0070690_100008826 | Ga0070690_1000088262 | 376 |
| 460 | 3300005330 | Ga0070690_100042239 | Ga0070690_1000422393 | 376 |
| 461 | 3300005331 | Ga0070670_100002977 | Ga0070670_1000029778 | 376 |
| 462 | 3300005331 | Ga0070670_100008937 | Ga0070670_1000089373 | 376 |
| 463 | 3300005331 | Ga0070670_100028505 | Ga0070670_1000285053 | 376 |
| 464 | 3300005334 | Ga0068869_100008177 | Ga0068869_1000081773 | 376 |
| 465 | 3300005336 | Ga0070680_100031622 | Ga0070680_1000316223 | 376 |
| 466 | 3300005338 | Ga0068868_100015712 | Ga0068868_1000157126 | 376 |
| 467 | 3300005340 | Ga0070689_100002815 | Ga0070689_1000028154 | 376 |
| 468 | 3300005340 | Ga0070689_100007192 | Ga0070689_1000071928 | 376 |
| 469 | 3300005347 | Ga0070668_100054855 | Ga0070668_1000548552 | 376 |
| 470 | 3300005353 | Ga0070669_100025557 | Ga0070669_1000255575 | 376 |
| 471 | 3300005354 | Ga0070675_100016259 | Ga0070675_1000162594 | 376 |
| 472 | 3300005354 | Ga0070675_100083571 | Ga0070675_1000835712 | 376 |
| 473 | 3300005355 | Ga0070671_100004776 | Ga0070671_1000047763 | 376 |
| 474 | 3300005356 | Ga0070674_100072201 | Ga0070674_1000722012 | 376 |
| 475 | 3300005356 | Ga0070674_100130993 | Ga0070674_1001309932 | 376 |
| 476 | 3300005364 | Ga0070673_100006320 | Ga0070673_1000063203 | 376 |
| 477 | 3300005364 | Ga0070673_100097118 | Ga0070673_1000971182 | 376 |
| 478 | 3300005365 | Ga0070688_100022058 | Ga0070688_1000220584 | 376 |
| 479 | 3300005435 | Ga0070714_100000214 | Ga0070714_1000002143 | 376 |
| 480 | 3300005435 | Ga0070714_100167219 | Ga0070714_1001672192 | 376 |
| 481 | 3300005436 | Ga0070713_100036597 | Ga0070713_1000365973 | 376 |
| 482 | 3300005438 | Ga0070701_10005926 | Ga0070701_100059264 | 376 |
| 483 | 3300005439 | Ga0070711_100040720 | Ga0070711_1000407202 | 376 |
| 484 | 3300005440 | Ga0070705_100073406 | Ga0070705_1000734062 | 376 |
| 485 | 3300005441 | Ga0070700_100005394 | Ga0070700_1000053944 | 376 |
| 486 | 3300005455 | Ga0070663_100015368 | Ga0070663_1000153683 | 376 |
| 487 | 3300005456 | Ga0070678_100079363 | Ga0070678_1000793632 | 376 |
| 488 | 3300005457 | Ga0070662_100032717 | Ga0070662_1000327172 | 376 |
| 489 | 3300005459 | Ga0068867_100027479 | Ga0068867_1000274791 | 376 |
| 490 | 3300005459 | Ga0068867_100056366 | Ga0068867_1000563662 | 376 |
| 491 | 3300005466 | Ga0070685_10002191 | Ga0070685_100021917 | 376 |
| 492 | 3300005530 | Ga0070679_100009709 | Ga0070679_1000097099 | 376 |
| 493 | 3300005539 | Ga0068853_100044985 | Ga0068853_1000449853 | 376 |
| 494 | 3300005543 | Ga0070672_100003443 | Ga0070672_1000034434 | 376 |
| 495 | 3300005543 | Ga0070672_100169329 | Ga0070672_1001693292 | 376 |
| 496 | 3300005544 | Ga0070686_100003076 | Ga0070686_10000307610 | 376 |
| 497 | 3300005545 | Ga0070695_100023103 | Ga0070695_1000231033 | 376 |
| 498 | 3300005548 | Ga0070665_100048262 | Ga0070665_1000482623 | 376 |
| 499 | 3300005548 | Ga0070665_100076147 | Ga0070665_1000761473 | 376 |
| 500 | 3300005548 | Ga0070665_100193718 | Ga0070665_1001937183 | 376 |
| 501 | 3300005578 | Ga0068854_100022938 | Ga0068854_1000229383 | 376 |
| 502 | 3300005615 | Ga0070702_100007919 | Ga0070702_1000079193 | 376 |
| 503 | 3300005616 | Ga0068852_100035617 | Ga0068852_1000356174 | 376 |
| 504 | 3300005616 | Ga0068852_100050258 | Ga0068852_1000502583 | 376 |
| 505 | 3300005618 | Ga0068864_100011952 | Ga0068864_1000119524 | 376 |
| 506 | 3300005840 | Ga0068870_10001327 | Ga0068870_100013277 | 376 |
| 507 | 3300005841 | Ga0068863_100058152 | Ga0068863_1000581523 | 376 |
| 508 | 3300005842 | Ga0068858_100011270 | Ga0068858_1000112702 | 376 |
| 509 | 3300005843 | Ga0068860_100006468 | Ga0068860_1000064686 | 376 |
| 510 | 3300005844 | Ga0068862_100010288 | Ga0068862_1000102884 | 376 |
| 511 | 3300005983 | Ga0081540_1021644 | Ga0081540_10216441 | 376 |
| 512 | 3300005985 | Ga0081539_10042016 | Ga0081539_100420162 | 376 |
| 513 | 3300006028 | Ga0070717_10089776 | Ga0070717_100897763 | 376 |
| 514 | 3300006038 | Ga0075365_10006872 | Ga0075365_100068722 | 376 |
| 515 | 3300006163 | Ga0070715_10074759 | Ga0070715_100747591 | 376 |
| 516 | 3300006175 | Ga0070712_100029075 | Ga0070712_1000290753 | 376 |
| 517 | 3300006178 | Ga0075367_10117295 | Ga0075367_101172951 | 376 |
| 518 | 3300006186 | Ga0075369_10066091 | Ga0075369_100660912 | 376 |
| 519 | 3300006195 | Ga0075366_10027952 | Ga0075366_100279522 | 376 |
| 520 | 3300006237 | Ga0097621_100036852 | Ga0097621_1000368524 | 376 |
| 521 | 3300006844 | Ga0075428_100001783 | Ga0075428_1000017838 | 376 |
| 522 | 3300006844 | Ga0075428_100072368 | Ga0075428_1000723683 | 376 |
| 523 | 3300006847 | Ga0075431_100000003 | Ga0075431_10000000311 | 376 |
| 524 | 3300006847 | Ga0075431_100107206 | Ga0075431_1001072063 | 376 |
| 525 | 3300006880 | Ga0075429_100013494 | Ga0075429_1000134944 | 376 |
| 526 | 3300006880 | Ga0075429_100171874 | Ga0075429_1001718742 | 376 |
| 527 | 3300006881 | Ga0068865_100042213 | Ga0068865_1000422133 | 376 |
| 528 | 3300009094 | Ga0111539_10007426 | Ga0111539_100074268 | 376 |
| 529 | 3300009094 | Ga0111539_10033800 | Ga0111539_100338001 | 376 |
| 530 | 3300009094 | Ga0111539_10343855 | Ga0111539_103438552 | 376 |
| 531 | 3300009101 | Ga0105247_10031333 | Ga0105247_100313332 | 376 |
| 532 | 3300009101 | Ga0105247_10064159 | Ga0105247_100641592 | 376 |
| 533 | 3300009147 | Ga0114129_10000104 | Ga0114129_100001046 | 376 |
| 534 | 3300009147 | Ga0114129_10028120 | Ga0114129_100281202 | 376 |
| 535 | 3300009147 | Ga0114129_10070313 | Ga0114129_100703136 | 376 |
| 536 | 3300009147 | Ga0114129_10123428 | Ga0114129_101234283 | 376 |
| 537 | 3300009176 | Ga0105242_10139315 | Ga0105242_101393153 | 376 |
| 538 | 3300009176 | Ga0105242_10305872 | Ga0105242_103058722 | 376 |
| 539 | 3300009177 | Ga0105248_10098846 | Ga0105248_100988463 | 376 |
| 540 | 3300009177 | Ga0105248_10491014 | Ga0105248_104910141 | 376 |
| 541 | 3300009545 | Ga0105237_10019250 | Ga0105237_100192507 | 376 |
| 542 | 3300009545 | Ga0105237_10092647 | Ga0105237_100926473 | 376 |
| 543 | 3300009551 | Ga0105238_10116747 | Ga0105238_101167473 | 376 |
| 544 | 3300009553 | Ga0105249_10232658 | Ga0105249_102326582 | 376 |
| 545 | 3300010375 | Ga0105239_10050734 | Ga0105239_100507345 | 376 |
| 546 | 3300010375 | Ga0105239_10332318 | Ga0105239_103323182 | 376 |
| 547 | 3300011119 | Ga0105246_10020866 | Ga0105246_100208662 | 376 |
| 548 | 3300011119 | Ga0105246_10060053 | Ga0105246_100600533 | 376 |
| 549 | 3300013296 | Ga0157374_10029044 | Ga0157374_100290443 | 376 |
| 550 | 3300013306 | Ga0163162_10065535 | Ga0163162_100655353 | 376 |
| 551 | 3300013308 | Ga0157375_10023485 | Ga0157375_100234854 | 376 |
| 552 | 3300014326 | Ga0157380_10019349 | Ga0157380_100193492 | 376 |
| 553 | 3300014326 | Ga0157380_10219680 | Ga0157380_102196802 | 376 |
| 554 | 3300014326 | Ga0157380_10270516 | Ga0157380_102705161 | 376 |
| 555 | 3300014326 | Ga0157380_10295977 | Ga0157380_102959772 | 376 |
| 556 | 3300014497 | Ga0182008_10031207 | Ga0182008_100312073 | 376 |
| 557 | 3300014968 | Ga0157379_10018816 | Ga0157379_100188163 | 376 |
| 558 | 3300014969 | Ga0157376_10113500 | Ga0157376_101135002 | 376 |
| 559 | 3300014969 | Ga0157376_10165681 | Ga0157376_101656812 | 376 |
| 560 | 3300017792 | Ga0163161_10009513 | Ga0163161_100095132 | 376 |
| 561 | 3300025297 | Ga0209758_1000294 | Ga0209758_100029476 | 376 |
| 562 | 3300025299 | Ga0209256_1011833 | Ga0209256_10118333 | 376 |
| 563 | 3300025302 | Ga0207426_1001240 | Ga0207426_10012408 | 376 |
| 564 | 3300025898 | Ga0207692_10086198 | Ga0207692_100861982 | 376 |
| 565 | 3300025899 | Ga0207642_10033422 | Ga0207642_100334222 | 376 |
| 566 | 3300025900 | Ga0207710_10002863 | Ga0207710_100028636 | 376 |
| 567 | 3300025901 | Ga0207688_10000552 | Ga0207688_100005529 | 376 |
| 568 | 3300025903 | Ga0207680_10008395 | Ga0207680_100083953 | 376 |
| 569 | 3300025904 | Ga0207647_10015498 | Ga0207647_100154983 | 376 |
| 570 | 3300025907 | Ga0207645_10006892 | Ga0207645_100068924 | 376 |
| 571 | 3300025908 | Ga0207643_10081811 | Ga0207643_100818111 | 376 |
| 572 | 3300025911 | Ga0207654_10056393 | Ga0207654_100563932 | 376 |
| 573 | 3300025913 | Ga0207695_10000123 | Ga0207695_1000012314 | 376 |
| 574 | 3300025914 | Ga0207671_10009480 | Ga0207671_100094803 | 376 |
| 575 | 3300025915 | Ga0207693_10019950 | Ga0207693_100199504 | 376 |
| 576 | 3300025916 | Ga0207663_10091876 | Ga0207663_100918763 | 376 |
| 577 | 3300025918 | Ga0207662_10000805 | Ga0207662_1000080512 | 376 |
| 578 | 3300025919 | Ga0207657_10024966 | Ga0207657_100249664 | 376 |
| 579 | 3300025919 | Ga0207657_10084288 | Ga0207657_100842882 | 376 |
| 580 | 3300025920 | Ga0207649_10042813 | Ga0207649_100428133 | 376 |
| 581 | 3300025921 | Ga0207652_10074845 | Ga0207652_100748452 | 376 |
| 582 | 3300025923 | Ga0207681_10061879 | Ga0207681_100618792 | 376 |
| 583 | 3300025924 | Ga0207694_10212048 | Ga0207694_102120481 | 376 |
| 584 | 3300025925 | Ga0207650_10000973 | Ga0207650_1000097310 | 376 |
| 585 | 3300025925 | Ga0207650_10003057 | Ga0207650_100030575 | 376 |
| 586 | 3300025925 | Ga0207650_10012596 | Ga0207650_100125962 | 376 |
| 587 | 3300025926 | Ga0207659_10005491 | Ga0207659_100054913 | 376 |
| 588 | 3300025926 | Ga0207659_10126139 | Ga0207659_101261393 | 376 |
| 589 | 3300025927 | Ga0207687_10005331 | Ga0207687_100053313 | 376 |
| 590 | 3300025927 | Ga0207687_10159318 | Ga0207687_101593182 | 376 |
| 591 | 3300025929 | Ga0207664_10000016 | Ga0207664_10000016131 | 376 |
| 592 | 3300025931 | Ga0207644_10007567 | Ga0207644_100075677 | 376 |
| 593 | 3300025931 | Ga0207644_10039499 | Ga0207644_100394991 | 376 |
| 594 | 3300025933 | Ga0207706_10003516 | Ga0207706_100035163 | 376 |
| 595 | 3300025933 | Ga0207706_10080697 | Ga0207706_100806973 | 376 |
| 596 | 3300025934 | Ga0207686_10038341 | Ga0207686_100383413 | 376 |
| 597 | 3300025936 | Ga0207670_10212804 | Ga0207670_102128042 | 376 |
| 598 | 3300025938 | Ga0207704_10036811 | Ga0207704_100368111 | 376 |
| 599 | 3300025939 | Ga0207665_10151085 | Ga0207665_101510851 | 376 |
| 600 | 3300025940 | Ga0207691_10001422 | Ga0207691_100014225 | 376 |
| 601 | 3300025940 | Ga0207691_10097741 | Ga0207691_100977413 | 376 |
| 602 | 3300025940 | Ga0207691_10105524 | Ga0207691_101055242 | 376 |
| 603 | 3300025941 | Ga0207711_10172825 | Ga0207711_101728253 | 376 |
| 604 | 3300025942 | Ga0207689_10041758 | Ga0207689_100417582 | 376 |
| 605 | 3300025944 | Ga0207661_10292122 | Ga0207661_102921222 | 376 |
| 606 | 3300025945 | Ga0207679_10022311 | Ga0207679_100223113 | 376 |
| 607 | 3300025960 | Ga0207651_10008623 | Ga0207651_100086232 | 376 |
| 608 | 3300025960 | Ga0207651_10011401 | Ga0207651_100114013 | 376 |
| 609 | 3300025961 | Ga0207712_10099663 | Ga0207712_100996632 | 376 |
| 610 | 3300025972 | Ga0207668_10013750 | Ga0207668_100137503 | 376 |
| 611 | 3300025981 | Ga0207640_10296752 | Ga0207640_102967521 | 376 |
| 612 | 3300025986 | Ga0207658_10251690 | Ga0207658_102516902 | 376 |
| 613 | 3300026023 | Ga0207677_10018376 | Ga0207677_100183763 | 376 |
| 614 | 3300026035 | Ga0207703_10003706 | Ga0207703_100037069 | 376 |
| 615 | 3300026041 | Ga0207639_10083920 | Ga0207639_100839202 | 376 |
| 616 | 3300026075 | Ga0207708_10000402 | Ga0207708_1000040217 | 376 |
| 617 | 3300026088 | Ga0207641_10004016 | Ga0207641_100040169 | 376 |
| 618 | 3300026089 | Ga0207648_10001024 | Ga0207648_1000102421 | 376 |
| 619 | 3300026089 | Ga0207648_10026793 | Ga0207648_100267933 | 376 |
| 620 | 3300026095 | Ga0207676_10006308 | Ga0207676_100063084 | 376 |
| 621 | 3300026116 | Ga0207674_10114956 | Ga0207674_101149562 | 376 |
| 622 | 3300026118 | Ga0207675_100272084 | Ga0207675_1002720841 | 376 |
| 623 | 3300026121 | Ga0207683_10004966 | Ga0207683_100049664 | 376 |
| 624 | 3300026121 | Ga0207683_10039056 | Ga0207683_100390561 | 376 |
| 625 | 3300026142 | Ga0207698_10007558 | Ga0207698_100075581 | 376 |
| 626 | 3300027907 | Ga0207428_10008981 | Ga0207428_100089818 | 376 |
| 627 | 3300028379 | Ga0268266_10260314 | Ga0268266_102603142 | 376 |
| 628 | 3300028380 | Ga0268265_10035791 | Ga0268265_100357911 | 376 |
| 629 | 3300028381 | Ga0268264_10015936 | Ga0268264_100159364 | 376 |
| 630 | 3300028800 | Ga0265338_10126144 | Ga0265338_101261443 | 376 |
| 631 | 3300031241 | Ga0265325_10001055 | Ga0265325_1000105522 | 376 |
| 632 | 3300031241 | Ga0265325_10033276 | Ga0265325_100332763 | 376 |
| 633 | 3300031247 | Ga0265340_10070405 | Ga0265340_100704052 | 376 |
| 634 | 3300031249 | Ga0265339_10000201 | Ga0265339_1000020110 | 376 |
| 635 | 3300031595 | Ga0265313_10000152 | Ga0265313_1000015249 | 376 |
| 636 | 3300035111 | Ga0373923_0060575 | Ga0373923_0060575_445_1584 | 376 |
| 637 | 3300035117 | Ga0373953_0044343 | Ga0373953_0044343_28_1167 | 376 |
| 638 | 3300035119 | Ga0373956_0006216 | Ga0373956_0006216_597_1736 | 376 |
| 639 | 3300035119 | Ga0373956_0012908 | Ga0373956_0012908_1705_2844 | 376 |
| 640 | 3300035120 | Ga0373957_0047750 | Ga0373957_0047750_116_1255 | 376 |
| 641 | 3300035121 | Ga0373960_0010152 | Ga0373960_0010152_406_1590 | 376 |
| 642 | 3300035172 | Ga0373955_0008230 | Ga0373955_0008230_2454_3593 | 376 |
| 643 | 3300035172 | Ga0373955_0074696 | Ga0373955_0074696_634_1764 | 376 |
| 644 | 3300035172 | Ga0373955_0089084 | Ga0373955_0089084_209_1375 | 376 |
| 645 | 3300035241 | Ga0373961_0024377 | Ga0373961_0024377_423_1607 | 376 |
| 646 | 3300035242 | Ga0373962_0027387 | Ga0373962_0027387_363_1523 | 376 |
| 647 | 3300035410 | Ga0373924_0017233 | Ga0373924_0017233_1496_2626 | 376 |
| 648 | 3300035691 | Ga0373931_0015917 | Ga0373931_0015917_1651_2811 | 376 |
| 649 | 3300035691 | Ga0373931_0063848 | Ga0373931_0063848_382_1566 | 376 |
| 650 | 3300035692 | Ga0373935_0117734 | Ga0373935_0117734_155_1312 | 376 |
| 651 | 3300035695 | Ga0373927_0172444 | Ga0373927_0172444_47_1213 | 376 |
| 652 | 3300035724 | Ga0373933_0001289 | Ga0373933_0001289_3248_4387 | 376 |
| 653 | 3300035724 | Ga0373933_0083376 | Ga0373933_0083376_32_1162 | 376 |
| 654 | 3300035724 | Ga0373933_0096387 | Ga0373933_0096387_267_1406 | 376 |
| 655 | 3300035725 | Ga0373947_0018469 | Ga0373947_0018469_1006_2145 | 376 |
| 656 | 3300036401 | Ga0373937_0009153 | Ga0373937_0009153_3855_4994 | 376 |
| 657 | 3300036401 | Ga0373937_0029828 | Ga0373937_0029828_1213_2352 | 376 |
| 658 | 3300036401 | Ga0373937_0363268 | Ga0373937_0363268_134_1282 | 376 |
| 659 | 3300037068 | Ga0373925_0153457 | Ga0373925_0153457_332_1489 | 376 |
| 660 | 3300037418 | Ga0395900_0396535 | Ga0395900_0396535_124_1254 | 376 |
| 661 | 3300037471 | Ga0395905_0381614 | Ga0395905_0381614_55_1185 | 376 |
| 662 | 3300044656 | Ga0466969_0030073 | Ga0466969_0030073_801_1943 | 376 |
| 663 | 3300044658 | Ga0466972_0000164 | Ga0466972_0000164_32477_33619 | 376 |
| 664 | 3300044684 | Ga0466966_0001614 | Ga0466966_0001614_9505_10647 | 376 |
| 665 | 3300044684 | Ga0466966_0045971 | Ga0466966_0045971_377_1591 | 376 |
| 666 | 3300044693 | Ga0466961_0000192 | Ga0466961_0000192_10008_11150 | 376 |
| 667 | 3300044693 | Ga0466961_0118147 | Ga0466961_0118147_273_1415 | 376 |
| 668 | 3300044694 | Ga0466963_0003423 | Ga0466963_0003423_4805_6025 | 376 |
| 669 | 3300044765 | Ga0466970_0026933 | Ga0466970_0026933_734_1876 | 376 |
| 670 | 3300045049 | Ga0466959_0000934 | Ga0466959_0000934_10079_11221 | 376 |
| 671 | 3300045976 | Ga0466967_0043144 | Ga0466967_0043144_1864_3084 | 376 |
| 672 | 3300045976 | Ga0466967_0063786 | Ga0466967_0063786_1972_3204 | 376 |
| 673 | 3300046452 | Ga0495617_059668 | Ga0495617_059668_102_1241 | 376 |
| 674 | 3300046457 | Ga0495590_0015955 | Ga0495590_0015955_46_1188 | 376 |
| 675 | 3300046460 | Ga0495638_0005230 | Ga0495638_0005230_7309_8478 | 376 |
| 676 | 3300046462 | Ga0495651_0000289 | Ga0495651_0000289_10970_12109 | 376 |
| 677 | 3300046463 | Ga0495653_0020419 | Ga0495653_0020419_1787_2926 | 376 |
| 678 | 3300046473 | Ga0495582_0054292 | Ga0495582_0054292_741_1871 | 376 |
| 679 | 3300046474 | Ga0495605_0044303 | Ga0495605_0044303_88_1227 | 376 |
| 680 | 3300046491 | Ga0495584_0041459 | Ga0495584_0041459_815_1945 | 376 |
| 681 | 3300046499 | Ga0495594_0062923 | Ga0495594_0062923_77_1216 | 376 |
| 682 | 3300046511 | Ga0495608_0022281 | Ga0495608_0022281_2219_3358 | 376 |
| 683 | 3300046511 | Ga0495608_0134794 | Ga0495608_0134794_252_1382 | 376 |
| 684 | 3300046514 | Ga0495618_0010089 | Ga0495618_0010089_1839_2978 | 376 |
| 685 | 3300046516 | Ga0495628_0025037 | Ga0495628_0025037_676_1815 | 376 |
| 686 | 3300046518 | Ga0495631_0091338 | Ga0495631_0091338_68_1207 | 376 |
| 687 | 3300046523 | Ga0495644_0045526 | Ga0495644_0045526_439_1578 | 376 |
| 688 | 3300046524 | Ga0495648_0007226 | Ga0495648_0007226_2465_3607 | 376 |
| 689 | 3300046529 | Ga0495652_0016070 | Ga0495652_0016070_2866_4005 | 376 |
| 690 | 3300046531 | Ga0495665_0078423 | Ga0495665_0078423_477_1607 | 376 |
| 691 | 3300046533 | Ga0495640_0015608 | Ga0495640_0015608_2192_3331 | 376 |
| 692 | 3300046536 | Ga0495587_0044076 | Ga0495587_0044076_854_1993 | 376 |
| 693 | 3300046536 | Ga0495587_0056318 | Ga0495587_0056318_767_1897 | 376 |
| 694 | 3300046539 | Ga0495621_0074245 | Ga0495621_0074245_34_1173 | 376 |
| 695 | 3300046559 | Ga0495667_0022641 | Ga0495667_0022641_554_1693 | 376 |
| 696 | 3300046559 | Ga0495667_0030231 | Ga0495667_0030231_2112_3359 | 376 |
| 697 | 3300046642 | Ga0495634_0013494 | Ga0495634_0013494_1256_2539 | 376 |
| 698 | 3300046642 | Ga0495634_0016981 | Ga0495634_0016981_526_1665 | 376 |
| 699 | 3300046642 | Ga0495634_0110707 | Ga0495634_0110707_420_1571 | 376 |
| 700 | 3300046675 | Ga0495657_0047211 | Ga0495657_0047211_946_2076 | 376 |
| 701 | 3300046675 | Ga0495657_0168741 | Ga0495657_0168741_72_1247 | 376 |
| 702 | 3300046679 | Ga0495623_0009855 | Ga0495623_0009855_582_1721 | 376 |
| 703 | 3300046680 | Ga0495646_0113172 | Ga0495646_0113172_307_1437 | 376 |
| 704 | 3300046680 | Ga0495646_0160930 | Ga0495646_0160930_43_1209 | 376 |
| 705 | 3300046683 | Ga0495658_0006954 | Ga0495658_0006954_3857_4996 | 376 |
| 706 | 3300046683 | Ga0495658_0083925 | Ga0495658_0083925_41_1171 | 376 |
| 707 | 3300046694 | Ga0495649_0015557 | Ga0495649_0015557_2461_3603 | 376 |
| 708 | 3300046809 | Ga0495600_0013346 | Ga0495600_0013346_3642_4781 | 376 |
| 709 | 3300047317 | Ga0495604_0005625 | Ga0495604_0005625_8628_9875 | 376 |
| 710 | 3300047317 | Ga0495604_0108437 | Ga0495604_0108437_428_1558 | 376 |
| 711 | 3300047319 | Ga0495674_0010369 | Ga0495674_0010369_5372_6511 | 376 |
| 712 | 3300047319 | Ga0495674_0087310 | Ga0495674_0087310_1379_2626 | 376 |
| 713 | 3300047322 | Ga0495680_0024726 | Ga0495680_0024726_1046_2185 | 376 |
| 714 | 3300047322 | Ga0495680_0024804 | Ga0495680_0024804_78_1325 | 376 |
| 715 | 3300047444 | Ga0495675_0007713 | Ga0495675_0007713_1149_2288 | 376 |
| 716 | 3300047444 | Ga0495675_0135442 | Ga0495675_0135442_163_1293 | 376 |
| 717 | 3300047445 | Ga0495677_0080197 | Ga0495677_0080197_37_1176 | 376 |
| 718 | 3300047471 | Ga0495684_0028806 | Ga0495684_0028806_2105_3244 | 376 |
| 719 | 3300047471 | Ga0495684_0034799 | Ga0495684_0034799_2385_3542 | 376 |
| 720 | 3300047471 | Ga0495684_0043382 | Ga0495684_0043382_1256_2539 | 376 |
| 721 | 3300047471 | Ga0495684_0076387 | Ga0495684_0076387_694_1824 | 376 |
| 722 | 3300047472 | Ga0495686_0065217 | Ga0495686_0065217_60_1202 | 376 |
| 723 | 3300047673 | Ga0495593_0039449 | Ga0495593_0039449_1243_2382 | 376 |
| 724 | 3300048088 | Ga0495602_0051018 | Ga0495602_0051018_2432_3562 | 376 |
| 725 | 3300048090 | Ga0495615_0017282 | Ga0495615_0017282_199_1338 | 376 |
| 726 | 3300048903 | Ga0496100_0000883 | Ga0496100_0000883_9285_10424 | 376 |
| 727 | 3300048903 | Ga0496100_0026894 | Ga0496100_0026894_1930_3087 | 376 |
| 728 | 3300048903 | Ga0496100_0027461 | Ga0496100_0027461_369_1553 | 376 |
| 729 | 3300048903 | Ga0496100_0150035 | Ga0496100_0150035_51_1190 | 376 |
| 730 | 3300048904 | Ga0496101_0001721 | Ga0496101_0001721_8394_9578 | 376 |
| 731 | 3300048904 | Ga0496101_0010306 | Ga0496101_0010306_2255_3394 | 376 |
| 732 | 3300048905 | Ga0496102_0002752 | Ga0496102_0002752_3266_4423 | 376 |
| 733 | 3300048905 | Ga0496102_0005298 | Ga0496102_0005298_8412_9551 | 376 |
| 734 | 3300048905 | Ga0496102_0223476 | Ga0496102_0223476_279_1463 | 376 |
| 735 | 3300048906 | Ga0496103_0002481 | Ga0496103_0002481_196_1335 | 376 |
| 736 | 3300048906 | Ga0496103_0074029 | Ga0496103_0074029_337_1494 | 376 |
| 737 | 3300048907 | Ga0496104_0007237 | Ga0496104_0007237_8279_9418 | 376 |
| 738 | 3300048908 | Ga0496105_0001558 | Ga0496105_0001558_8173_9312 | 376 |
| 739 | 3300048908 | Ga0496105_0003169 | Ga0496105_0003169_10477_11634 | 376 |
| 740 | 3300048908 | Ga0496105_0011182 | Ga0496105_0011182_5644_6828 | 376 |
| 741 | 3300048908 | Ga0496105_0170851 | Ga0496105_0170851_437_1591 | 376 |
| 742 | 3300048909 | Ga0496106_0009006 | Ga0496106_0009006_1373_2512 | 376 |
| 743 | 3300048909 | Ga0496106_0017900 | Ga0496106_0017900_2456_3640 | 376 |
| 744 | 3300048909 | Ga0496106_0176557 | Ga0496106_0176557_129_1307 | 376 |
| 745 | 3300048910 | Ga0496107_0025595 | Ga0496107_0025595_1588_2748 | 376 |
| 746 | 3300048910 | Ga0496107_0041992 | Ga0496107_0041992_1771_2910 | 376 |
| 747 | 3300048911 | Ga0496108_0006599 | Ga0496108_0006599_7335_8492 | 376 |
| 748 | 3300048911 | Ga0496108_0013514 | Ga0496108_0013514_1655_2839 | 376 |
| 749 | 3300048911 | Ga0496108_0017132 | Ga0496108_0017132_1373_2512 | 376 |
| 750 | 3300048912 | Ga0496109_0002993 | Ga0496109_0002993_821_1978 | 376 |
| 751 | 3300048912 | Ga0496109_0003652 | Ga0496109_0003652_9951_11090 | 376 |
| 752 | 3300048913 | Ga0496110_0002213 | Ga0496110_0002213_7314_8471 | 376 |
| 753 | 3300048913 | Ga0496110_0003023 | Ga0496110_0003023_10235_11374 | 376 |
| 754 | 3300048913 | Ga0496110_0042720 | Ga0496110_0042720_45_1205 | 376 |
| 755 | 3300048914 | Ga0496111_0002054 | Ga0496111_0002054_9056_10195 | 376 |
| 756 | 3300048914 | Ga0496111_0007911 | Ga0496111_0007911_5611_6795 | 376 |
| 757 | 3300048914 | Ga0496111_0094059 | Ga0496111_0094059_537_1691 | 376 |
| 758 | 3300048915 | Ga0496112_0036512 | Ga0496112_0036512_557_1735 | 376 |
| 759 | 3300048915 | Ga0496112_0037830 | Ga0496112_0037830_2002_3141 | 376 |
| 760 | 3300048915 | Ga0496112_0095544 | Ga0496112_0095544_327_1565 | 376 |
| 761 | 3300048916 | Ga0496113_0005117 | Ga0496113_0005117_6073_7230 | 376 |
| 762 | 3300048916 | Ga0496113_0005565 | Ga0496113_0005565_2488_3627 | 376 |
| 763 | 3300048917 | Ga0496114_0003895 | Ga0496114_0003895_7223_8407 | 376 |
| 764 | 3300048917 | Ga0496114_0006922 | Ga0496114_0006922_7302_8441 | 376 |
| 765 | 3300048918 | Ga0496115_0016238 | Ga0496115_0016238_1520_2704 | 376 |
| 766 | 3300048918 | Ga0496115_0038291 | Ga0496115_0038291_1832_2971 | 376 |
| 767 | 3300048918 | Ga0496115_0079170 | Ga0496115_0079170_74_1231 | 376 |
| 768 | 3300048918 | Ga0496115_0115028 | Ga0496115_0115028_275_1414 | 376 |
| 769 | 3300048921 | Ga0496118_0020990 | Ga0496118_0020990_1838_3007 | 376 |
| 770 | 3300049460 | Ga0495682_0023857 | Ga0495682_0023857_186_1328 | 376 |
| 771 | 3300049568 | Ga0501031_0021558 | Ga0501031_0021558_2963_4123 | 376 |
| 772 | 3300049569 | Ga0501032_0013465 | Ga0501032_0013465_616_1776 | 376 |
| 773 | 3300049570 | Ga0501033_0093170 | Ga0501033_0093170_614_1804 | 376 |
| 774 | 3300049571 | Ga0501034_0028780 | Ga0501034_0028780_2787_3947 | 376 |
| 775 | 3300049572 | Ga0501036_0010044 | Ga0501036_0010044_5531_6691 | 376 |
| 776 | 3300049572 | Ga0501036_0015237 | Ga0501036_0015237_1169_2377 | 376 |
| 777 | 3300049573 | Ga0501037_0008767 | Ga0501037_0008767_465_1625 | 376 |
| 778 | 3300049574 | Ga0501038_0003573 | Ga0501038_0003573_6871_8031 | 376 |
| 779 | 3300049575 | Ga0501039_0057503 | Ga0501039_0057503_1658_2818 | 376 |
| 780 | 3300049575 | Ga0501039_0208255 | Ga0501039_0208255_262_1470 | 376 |
| 781 | 3300049578 | Ga0501042_0073201 | Ga0501042_0073201_181_1341 | 376 |
| 782 | 3300049578 | Ga0501042_0084909 | Ga0501042_0084909_505_1713 | 376 |
| 783 | 3300049579 | Ga0501043_0016285 | Ga0501043_0016285_4238_5398 | 376 |
| 784 | 3300049580 | Ga0501046_0007715 | Ga0501046_0007715_1849_3009 | 376 |
| 785 | 3300049580 | Ga0501046_0099345 | Ga0501046_0099345_684_1832 | 376 |
| 786 | 3300049581 | Ga0501047_0045311 | Ga0501047_0045311_2394_3554 | 376 |
| 787 | 3300049582 | Ga0501048_0007056 | Ga0501048_0007056_359_1519 | 376 |
| 788 | 3300049583 | Ga0501067_0023020 | Ga0501067_0023020_1919_3079 | 376 |
| 789 | 3300049584 | Ga0501068_0003549 | Ga0501068_0003549_4230_5390 | 376 |
| 790 | 3300049585 | Ga0501069_0011843 | Ga0501069_0011843_546_1706 | 376 |
| 791 | 3300049586 | Ga0501070_0184796 | Ga0501070_0184796_264_1484 | 376 |
| 792 | 3300049588 | Ga0501072_0095346 | Ga0501072_0095346_997_2157 | 376 |
| 793 | 3300049589 | Ga0501073_0026789 | Ga0501073_0026789_2565_3725 | 376 |
| 794 | 3300049589 | Ga0501073_0058946 | Ga0501073_0058946_441_1649 | 376 |
| 795 | 3300049590 | Ga0501074_0013706 | Ga0501074_0013706_1833_2993 | 376 |
| 796 | 3300049592 | Ga0501076_0132736 | Ga0501076_0132736_626_1765 | 376 |
| 797 | 3300049592 | Ga0501076_0158981 | Ga0501076_0158981_226_1386 | 376 |
| 798 | 3300049741 | Ga0501079_0014563 | Ga0501079_0014563_484_1644 | 376 |
| 799 | 3300049742 | Ga0501080_0029067 | Ga0501080_0029067_827_1987 | 376 |
| 800 | 3300049742 | Ga0501080_0166332 | Ga0501080_0166332_436_1662 | 376 |
| 801 | 3300049743 | Ga0501081_0112052 | Ga0501081_0112052_207_1346 | 376 |
| 802 | 3300049744 | Ga0501083_0036721 | Ga0501083_0036721_826_1986 | 376 |
| 803 | 3300049744 | Ga0501083_0170912 | Ga0501083_0170912_135_1340 | 376 |
| 804 | 3300049822 | Ga0501035_0006796 | Ga0501035_0006796_5071_6231 | 376 |
| 805 | 3300049823 | Ga0501044_0003604 | Ga0501044_0003604_13204_14361 | 376 |
| 806 | 3300049823 | Ga0501044_0026832 | Ga0501044_0026832_699_1859 | 376 |
| 807 | 3300049823 | Ga0501044_0098521 | Ga0501044_0098521_613_1773 | 376 |
| 808 | 3300049823 | Ga0501044_0152533 | Ga0501044_0152533_980_2170 | 376 |
| 809 | 3300049824 | Ga0501045_0012008 | Ga0501045_0012008_2041_3201 | 376 |
| 810 | 3300050489 | nmdc:mga03683_28913_c1 | nmdc:mga03683_28913_c1_126_1265 | 376 |
| 811 | 3300050491 | nmdc:mga00v17_53361_c1 | nmdc:mga00v17_53361_c1_401_1540 | 376 |
| 812 | 3300050492 | nmdc:mga0yw44_17392_c1 | nmdc:mga0yw44_17392_c1_568_1707 | 376 |
| 813 | 3300050493 | nmdc:mga0k408_31550_c1 | nmdc:mga0k408_31550_c1_1128_2279 | 376 |
| 814 | 3300050507 | nmdc:mga05p37_11620_c1 | nmdc:mga05p37_11620_c1_7316_8455 | 376 |
| 815 | 3300050507 | nmdc:mga05p37_1642_c1 | nmdc:mga05p37_1642_c1_10559_11722 | 376 |
| 816 | 3300050508 | nmdc:mga09592_2070_c1 | nmdc:mga09592_2070_c1_14513_15676 | 376 |
| 817 | 3300050508 | nmdc:mga09592_34328_c1 | nmdc:mga09592_34328_c1_1383_2522 | 376 |
| 818 | 3300050509 | nmdc:mga0qj67_74188_c1 | nmdc:mga0qj67_74188_c1_122_1261 | 376 |
| 819 | 3300050509 | nmdc:mga0qj67_96891_c1 | nmdc:mga0qj67_96891_c1_818_1957 | 376 |
| 820 | 3300050510 | nmdc:mga06r32_349_c1 | nmdc:mga06r32_349_c1_20288_21451 | 376 |
| 821 | 3300050510 | nmdc:mga06r32_68482_c1 | nmdc:mga06r32_68482_c1_599_1738 | 376 |
| 822 | 3300050511 | nmdc:mga08y16_41385_c1 | nmdc:mga08y16_41385_c1_906_2063 | 376 |
| 823 | 3300050511 | nmdc:mga08y16_4843_c1 | nmdc:mga08y16_4843_c1_8666_9829 | 376 |
| 824 | 3300050512 | nmdc:mga0n895_187155_c1 | nmdc:mga0n895_187155_c1_73_1233 | 376 |
| 825 | 3300053077 | Ga0495601_0001197 | Ga0495601_0001197_10478_11617 | 376 |
| 826 | 3300053077 | Ga0495601_0114243 | Ga0495601_0114243_383_1513 | 376 |
| 827 | 3300053078 | Ga0495612_0056590 | Ga0495612_0056590_28_1203 | 376 |
| 828 | 3300053084 | Ga0495595_0010792 | Ga0495595_0010792_2574_3713 | 376 |
| 829 | 3300053084 | Ga0495595_0016167 | Ga0495595_0016167_773_2020 | 376 |
| 830 | 3300053084 | Ga0495595_0040458 | Ga0495595_0040458_717_1847 | 376 |
| 831 | 3300053085 | Ga0495619_0000048 | Ga0495619_0000048_71700_72947 | 376 |
| 832 | 3300053085 | Ga0495619_0002108 | Ga0495619_0002108_10806_11945 | 376 |
| 833 | 3300053085 | Ga0495619_0048524 | Ga0495619_0048524_1042_2229 | 376 |
| 834 | 3300053092 | Ga0500583_0053008 | Ga0500583_0053008_596_1765 | 376 |
| 835 | 3300053096 | Ga0500641_0001652 | Ga0500641_0001652_755_1960 | 376 |
| 836 | 3300053104 | Ga0500556_0014493 | Ga0500556_0014493_719_1888 | 376 |
| 837 | 3300053119 | Ga0500595_006611 | Ga0500595_006611_3703_4854 | 376 |
| 838 | 3300053130 | Ga0500642_0020295 | Ga0500642_0020295_888_2048 | 376 |
| 839 | 3300053153 | Ga0500616_0019706 | Ga0500616_0019706_2486_3655 | 376 |
| 840 | 3300053153 | Ga0500616_0053762 | Ga0500616_0053762_521_1681 | 376 |
| 841 | 3300053156 | Ga0500622_0022869 | Ga0500622_0022869_1701_2843 | 376 |
| 842 | 3300053177 | Ga0500636_0000762 | Ga0500636_0000762_7488_8630 | 376 |
| 843 | 3300053177 | Ga0500636_0011675 | Ga0500636_0011675_3921_5081 | 376 |
| 844 | 3300060353 | Ga0501082_0022888 | Ga0501082_0022888_1775_2935 | 376 |
| 845 | 3300060353 | Ga0501082_0229774 | Ga0501082_0229774_58_1266 | 376 |
| 846 | 3300061734 | Ga0530510_0055163 | Ga0530510_0055163_826_1965 | 376 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cdh-assembly1.cif.gz_0 | architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. | 0.9592 | 59 | 359 |
| 2cdh-assembly1.cif.gz_0 | architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. | 0.9469 | 59 | 359 |
| 6w45-assembly1.cif.gz_A | crystal structure of hao1 in complex with biaryl acid inhibitor - compound 3 | 0.9325 | 1 | 376 |
| 6w45-assembly1.cif.gz_A | crystal structure of hao1 in complex with biaryl acid inhibitor - compound 3 | 0.9242 | 1 | 376 |
| 6w44-assembly1.cif.gz_A | crystal structure of hao1 in complex with indazole acid inhibitor - compound 4 | 0.9159 | 2 | 375 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WND5_34_407_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9205 | 1 | 375 | 3.20.20.70 |
| af_P9WND5_34_407_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9087 | 1 | 375 | 3.20.20.70 |
| af_P33232_3_380_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9061 | 1 | 376 | 3.20.20.70 |
| af_P33232_3_380_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.904 | 1 | 376 | 3.20.20.70 |
| 2nliA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8824 | 1 | 374 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847KEL5-F1-model_v4 | deleted | 0.9642 | 231 | 374 |
|
| AF-A0A2N4YRY1-F1-model_v4 | Alpha-hydroxy-acid oxidizing protein | 0.9589 | 239 | 375 |
GO:0004459
GO:0005886 GO:0009060 |
| AF-A0A1H3VMC8-F1-model_v4 | 4-hydroxymandelate oxidase | 0.9577 | 231 | 372 |
GO:0016491
|
| AF-A0A3S4HUI6-F1-model_v4 | L-lactate dehydrogenase (EC 1.1.2.3) | 0.9559 | 247 | 375 |
GO:0004459
GO:0004460 GO:0005886 GO:0009060 |
| AF-A0A0Q6XNU0-F1-model_v4 | Alpha-hydroxy-acid oxidizing enzyme (EC 1.1.2.3) | 0.9541 | 1 | 376 |
GO:0004459
GO:0004460 GO:0005886 GO:0009060 GO:0010181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar