F483301
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 846 | 434 | 1690 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0215157|Ga0436361_0215157_148655_148966 |
| Length | 103 |
| Sequence | MCYAGRTHRQGKFMSHTIRDQAKLLARVRRLSGQTAALEKQLTNGTECSAVLQQIAAIRGAVNGLMAAVIEGHLSVHLVDQPDEAQRQKDLEVVLQVIKSYLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 77 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 78 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 87 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 102 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 103 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 104 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 105 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 183 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 184 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 193 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 198 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 199 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 200 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 201 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 202 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 203 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 209 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 210 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 283 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 292 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 293 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 295 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 297 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 299 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 302 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 303 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 304 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 305 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 306 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 307 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 308 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 309 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 310 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 311 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 312 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 313 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 314 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 315 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 316 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 317 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 318 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 319 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 320 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 321 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 322 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 323 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 324 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 325 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 326 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 327 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 328 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 329 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 330 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 331 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 332 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 333 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 334 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 335 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 336 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 337 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 338 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 339 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 340 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 341 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 342 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 343 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 344 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 345 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 346 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 347 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 348 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 349 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 350 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 351 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 352 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 353 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 354 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 355 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 356 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 357 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 358 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 359 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 360 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 361 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 362 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 363 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 364 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 365 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 366 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 367 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 368 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 369 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 370 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 371 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 372 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 373 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 374 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 375 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 376 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 377 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 378 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 379 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 380 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 381 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 382 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 383 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 384 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 385 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 386 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 387 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 388 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 389 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 390 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 391 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 392 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 393 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 394 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 395 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 396 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 397 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 398 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 399 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 400 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 401 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 402 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 403 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 404 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 405 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 406 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 407 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 408 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 409 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 410 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 411 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 412 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 413 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 414 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 415 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 416 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 417 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 418 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 419 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 420 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 421 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 422 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 423 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 424 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 425 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 426 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 427 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 428 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 429 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 430 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 431 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 432 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 433 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 434 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.22 |
| Metatranscriptomes | 0.35 |
| Isolates | 16.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 14.78 |
| Nodule | 4.61 |
| Rhizoplane | 9.93 |
| Rhizosphere | 49.88 |
| Stem | 0.12 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_0215157 | 3300039447 | Bacteria | 166868 |
| 2 | SwRhRL2b_contig_126825 | 2162886007 | Bacteria | 6799 |
| 3 | SwRhRL2b_contig_1451602 | 2162886007 | Bacteria | 1926 |
| 4 | SwRhRL2b_contig_2947596 | 2162886007 | Bacteria | 5019 |
| 5 | SwRhRL2b_contig_3517994 | 2162886007 | Bacteria | 2072 |
| 6 | SwRhRL2b_contig_372564 | 2162886007 | Bacteria | 2805 |
| 7 | JGI24741J21665_1000832 | 3300001915 | Bacteria | 9280 |
| 8 | JGI24740J21852_10000282 | 3300001979 | Bacteria | 21596 |
| 9 | JGI24740J21852_10000391 | 3300001979 | Bacteria | 18782 |
| 10 | JGI24742J22300_10056359 | 3300002244 | Bacteria | 718 |
| 11 | JGI25156J39149_1002231 | 3300002705 | Bacteria | 7160 |
| 12 | JGI25156J39149_1022518 | 3300002705 | Bacteria | 1069 |
| 13 | JGI25156J39149_1034333 | 3300002705 | Bacteria | 735 |
| 14 | JGI25162J39368_1000009 | 3300002737 | Bacteria | 389795 |
| 15 | JGI25154J39366_1003436 | 3300002738 | Bacteria | 3328 |
| 16 | JGI25163J39215_1000150 | 3300002771 | Bacteria | 27415 |
| 17 | JGI25164J39214_1000002 | 3300002772 | Bacteria | 406570 |
| 18 | JGI25152J39213_1000878 | 3300002773 | Bacteria | 14793 |
| 19 | JGI25152J39213_1005507 | 3300002773 | Bacteria | 3668 |
| 20 | JGI25150J39212_1009220 | 3300002774 | Bacteria | 1892 |
| 21 | JGI25153J46596_10001192 | 3300003215 | Bacteria | 15710 |
| 22 | rootH2_10055337 | 3300003320 | Bacteria | 4704 |
| 23 | rootL2_10039490 | 3300003322 | Bacteria | 3756 |
| 24 | rootH1_10139962 | 3300003323 | Bacteria | 1000 |
| 25 | Ga0006562J51391_1101642 | 3300003578 | Bacteria | 2160 |
| 26 | Ga0055538_1000015 | 3300003751 | Bacteria | 311166 |
| 27 | Ga0055538_1006716 | 3300003751 | Bacteria | 1098 |
| 28 | Ga0055538_1006820 | 3300003751 | Bacteria | 1082 |
| 29 | Ga0055539_1000009 | 3300003752 | Bacteria | 406566 |
| 30 | Ga0055539_1000231 | 3300003752 | Bacteria | 39116 |
| 31 | Ga0055533_1000012 | 3300003756 | Bacteria | 406566 |
| 32 | Ga0055533_1002682 | 3300003756 | Bacteria | 3932 |
| 33 | Ga0055533_1010696 | 3300003756 | Bacteria | 1028 |
| 34 | Ga0055533_1011907 | 3300003756 | Bacteria | 930 |
| 35 | Ga0055532_1000040 | 3300003758 | Bacteria | 198031 |
| 36 | Ga0055525_1000014 | 3300003759 | Bacteria | 406566 |
| 37 | Ga0055525_1000161 | 3300003759 | Bacteria | 87478 |
| 38 | Ga0055525_1000412 | 3300003759 | Bacteria | 26101 |
| 39 | Ga0055527_1003918 | 3300003760 | Bacteria | 2121 |
| 40 | Ga0055535_1000029 | 3300003761 | Bacteria | 198031 |
| 41 | Ga0055542_1000896 | 3300003762 | Bacteria | 20368 |
| 42 | Ga0055542_1017797 | 3300003762 | Bacteria | 1092 |
| 43 | Ga0055529_1000055 | 3300003763 | Bacteria | 197545 |
| 44 | Ga0055529_1000358 | 3300003763 | Bacteria | 49858 |
| 45 | Ga0055526_1000392 | 3300003771 | Bacteria | 35369 |
| 46 | Ga0055537_1000099 | 3300003773 | Bacteria | 65218 |
| 47 | Ga0055524_1000106 | 3300003775 | Bacteria | 103668 |
| 48 | Ga0055524_1000720 | 3300003775 | Bacteria | 22675 |
| 49 | Ga0055524_1003256 | 3300003775 | Bacteria | 7951 |
| 50 | Ga0055536_1025590 | 3300003781 | Bacteria | 1677 |
| 51 | Ga0055536_1051273 | 3300003781 | Bacteria | 905 |
| 52 | Ga0055534_1000023 | 3300003784 | Bacteria | 135301 |
| 53 | Ga0055528_1000030 | 3300003790 | Bacteria | 121679 |
| 54 | Ga0055530_10001128 | 3300003791 | Bacteria | 20838 |
| 55 | Ga0055530_10057085 | 3300003791 | Bacteria | 883 |
| 56 | Ga0055540_1000110 | 3300003792 | Bacteria | 88766 |
| 57 | Ga0055540_1023871 | 3300003792 | Bacteria | 1530 |
| 58 | Ga0055540_1043757 | 3300003792 | Bacteria | 954 |
| 59 | Ga0055531_10006208 | 3300003794 | Bacteria | 6822 |
| 60 | Ga0055531_10012991 | 3300003794 | Bacteria | 3873 |
| 61 | Ga0055531_10014883 | 3300003794 | Bacteria | 3473 |
| 62 | Ga0055541_1000006 | 3300003841 | Bacteria | 406566 |
| 63 | Ga0055541_1000930 | 3300003841 | Bacteria | 6953 |
| 64 | Ga0055541_1011058 | 3300003841 | Bacteria | 1336 |
| 65 | Ga0055541_1026099 | 3300003841 | Bacteria | 623 |
| 66 | Ga0058692_1000113 | 3300003856 | Bacteria | 52711 |
| 67 | Ga0058692_1000602 | 3300003856 | Bacteria | 15103 |
| 68 | Ga0058692_1000693 | 3300003856 | Bacteria | 13849 |
| 69 | Ga0058692_1004633 | 3300003856 | Bacteria | 4049 |
| 70 | Ga0058692_1006711 | 3300003856 | Bacteria | 3126 |
| 71 | Ga0058692_1035184 | 3300003856 | Bacteria | 915 |
| 72 | Ga0065165_1000087 | 3300005262 | Bacteria | 152471 |
| 73 | Ga0065704_10000330 | 3300005289 | Bacteria | 31445 |
| 74 | Ga0065704_10000780 | 3300005289 | Bacteria | 47095 |
| 75 | Ga0065704_10000959 | 3300005289 | Bacteria | 34794 |
| 76 | Ga0065704_10002644 | 3300005289 | Bacteria | 8029 |
| 77 | Ga0065704_10004459 | 3300005289 | Bacteria | 4891 |
| 78 | Ga0065704_10075146 | 3300005289 | Bacteria | 5767 |
| 79 | Ga0065704_10235622 | 3300005289 | Bacteria | 1000 |
| 80 | Ga0065704_10488540 | 3300005289 | Bacteria | 676 |
| 81 | Ga0070658_10044744 | 3300005327 | Bacteria | 3578 |
| 82 | Ga0070658_10906998 | 3300005327 | Bacteria | 766 |
| 83 | Ga0070658_11624685 | 3300005327 | Bacteria | 560 |
| 84 | Ga0070676_10115665 | 3300005328 | Bacteria | 1676 |
| 85 | Ga0070683_100369963 | 3300005329 | Bacteria | 1365 |
| 86 | Ga0070670_100605951 | 3300005331 | Bacteria | 980 |
| 87 | Ga0070677_10032659 | 3300005333 | Bacteria | 1998 |
| 88 | Ga0070666_10006517 | 3300005335 | Bacteria | 7169 |
| 89 | Ga0070682_100079964 | 3300005337 | Bacteria | 2112 |
| 90 | Ga0068868_100142618 | 3300005338 | Bacteria | 1968 |
| 91 | Ga0070661_100000037 | 3300005344 | Bacteria | 107325 |
| 92 | Ga0070661_100301568 | 3300005344 | Bacteria | 1247 |
| 93 | Ga0070668_100192959 | 3300005347 | Bacteria | 1669 |
| 94 | Ga0070675_100039642 | 3300005354 | Bacteria | 3845 |
| 95 | Ga0070674_100027072 | 3300005356 | Bacteria | 3754 |
| 96 | Ga0070673_100083429 | 3300005364 | Bacteria | 2596 |
| 97 | Ga0070688_100838368 | 3300005365 | Bacteria | 721 |
| 98 | Ga0070659_100048378 | 3300005366 | Bacteria | 3340 |
| 99 | Ga0070667_100282219 | 3300005367 | Bacteria | 1491 |
| 100 | Ga0070667_101888182 | 3300005367 | Bacteria | 562 |
| 101 | Ga0070663_100000001 | 3300005455 | Bacteria | 318372 |
| 102 | Ga0070663_100076870 | 3300005455 | Bacteria | 2443 |
| 103 | Ga0070678_100001501 | 3300005456 | Bacteria | 12460 |
| 104 | Ga0070662_100684936 | 3300005457 | Bacteria | 866 |
| 105 | Ga0068867_100125519 | 3300005459 | Bacteria | 1988 |
| 106 | Ga0070699_100166688 | 3300005518 | Bacteria | 1951 |
| 107 | Ga0070672_100000254 | 3300005543 | Bacteria | 30164 |
| 108 | Ga0070665_100010108 | 3300005548 | Bacteria | 9545 |
| 109 | Ga0070665_101356378 | 3300005548 | Bacteria | 721 |
| 110 | Ga0070664_100000006 | 3300005564 | Bacteria | 189856 |
| 111 | Ga0070664_100035207 | 3300005564 | Bacteria | 4203 |
| 112 | Ga0068857_100015730 | 3300005577 | Bacteria | 6618 |
| 113 | Ga0068857_100016805 | 3300005577 | Bacteria | 6410 |
| 114 | Ga0068854_100000048 | 3300005578 | Bacteria | 88075 |
| 115 | Ga0068854_101870349 | 3300005578 | Bacteria | 551 |
| 116 | Ga0068856_100001024 | 3300005614 | Bacteria | 29757 |
| 117 | Ga0068852_100015788 | 3300005616 | Bacteria | 5871 |
| 118 | Ga0068860_100323014 | 3300005843 | Bacteria | 1515 |
| 119 | Ga0075364_10007807 | 3300006051 | Bacteria | 6371 |
| 120 | Ga0075364_10020788 | 3300006051 | Bacteria | 4131 |
| 121 | Ga0075364_10083933 | 3300006051 | Bacteria | 2108 |
| 122 | Ga0075369_10366777 | 3300006186 | Bacteria | 677 |
| 123 | Ga0075366_10164832 | 3300006195 | Bacteria | 1343 |
| 124 | Ga0097621_100079914 | 3300006237 | Bacteria | 2719 |
| 125 | Ga0075370_10092920 | 3300006353 | Bacteria | 1741 |
| 126 | Ga0068871_100017779 | 3300006358 | Bacteria | 5390 |
| 127 | Ga0068865_100428289 | 3300006881 | Bacteria | 1089 |
| 128 | Ga0099823_1000188 | 3300006944 | Bacteria | 34181 |
| 129 | Ga0099823_1023592 | 3300006944 | Bacteria | 5624 |
| 130 | Ga0099823_1046333 | 3300006944 | Bacteria | 2860 |
| 131 | Ga0079104_1000021 | 3300006946 | Bacteria | 247219 |
| 132 | Ga0079104_1000030 | 3300006946 | Bacteria | 207526 |
| 133 | Ga0079104_1000074 | 3300006946 | Bacteria | 150348 |
| 134 | Ga0079104_1000233 | 3300006946 | Bacteria | 75184 |
| 135 | Ga0079104_1000304 | 3300006946 | Bacteria | 62246 |
| 136 | Ga0079104_1000379 | 3300006946 | Bacteria | 52134 |
| 137 | Ga0079104_1000614 | 3300006946 | Bacteria | 34956 |
| 138 | Ga0079104_1001907 | 3300006946 | Bacteria | 12579 |
| 139 | Ga0079104_1001912 | 3300006946 | Bacteria | 12553 |
| 140 | Ga0079104_1003263 | 3300006946 | Bacteria | 7759 |
| 141 | Ga0079104_1003310 | 3300006946 | Bacteria | 7646 |
| 142 | Ga0079104_1027699 | 3300006946 | Bacteria | 1449 |
| 143 | Ga0099826_10314074 | 3300006948 | Bacteria | 795 |
| 144 | Ga0105251_10000116 | 3300009011 | Bacteria | 79645 |
| 145 | Ga0105251_10000391 | 3300009011 | Bacteria | 42881 |
| 146 | Ga0105251_10000402 | 3300009011 | Bacteria | 42216 |
| 147 | Ga0105251_10001684 | 3300009011 | Bacteria | 18581 |
| 148 | Ga0105251_10001933 | 3300009011 | Bacteria | 16960 |
| 149 | Ga0105251_10007995 | 3300009011 | Bacteria | 6415 |
| 150 | Ga0105251_10047940 | 3300009011 | Bacteria | 2050 |
| 151 | Ga0105251_10140078 | 3300009011 | Bacteria | 1094 |
| 152 | Ga0105251_10189782 | 3300009011 | Bacteria | 926 |
| 153 | Ga0105251_10419148 | 3300009011 | Bacteria | 617 |
| 154 | Ga0105244_10000014 | 3300009036 | Bacteria | 257018 |
| 155 | Ga0105244_10000037 | 3300009036 | Bacteria | 161621 |
| 156 | Ga0105244_10000441 | 3300009036 | Bacteria | 38203 |
| 157 | Ga0105244_10001143 | 3300009036 | Bacteria | 22016 |
| 158 | Ga0105244_10002103 | 3300009036 | Bacteria | 15310 |
| 159 | Ga0105244_10003362 | 3300009036 | Bacteria | 11460 |
| 160 | Ga0105244_10004018 | 3300009036 | Bacteria | 10285 |
| 161 | Ga0105244_10004186 | 3300009036 | Bacteria | 10037 |
| 162 | Ga0105244_10016508 | 3300009036 | Bacteria | 4204 |
| 163 | Ga0105244_10039965 | 3300009036 | Bacteria | 2439 |
| 164 | Ga0105244_10044840 | 3300009036 | Bacteria | 2277 |
| 165 | Ga0105244_10180488 | 3300009036 | Bacteria | 1001 |
| 166 | Ga0105244_10224961 | 3300009036 | Bacteria | 879 |
| 167 | Ga0105250_10000059 | 3300009092 | Bacteria | 109549 |
| 168 | Ga0105250_10000095 | 3300009092 | Bacteria | 78639 |
| 169 | Ga0105250_10000114 | 3300009092 | Bacteria | 72357 |
| 170 | Ga0105250_10000314 | 3300009092 | Bacteria | 37777 |
| 171 | Ga0105250_10001759 | 3300009092 | Bacteria | 11382 |
| 172 | Ga0105250_10003658 | 3300009092 | Bacteria | 7236 |
| 173 | Ga0105250_10007459 | 3300009092 | Bacteria | 4696 |
| 174 | Ga0105250_10029457 | 3300009092 | Bacteria | 2208 |
| 175 | Ga0105250_10056063 | 3300009092 | Bacteria | 1582 |
| 176 | Ga0105250_10158913 | 3300009092 | Bacteria | 943 |
| 177 | Ga0105250_10166296 | 3300009092 | Bacteria | 922 |
| 178 | Ga0105250_10371351 | 3300009092 | Bacteria | 630 |
| 179 | Ga0105240_10065701 | 3300009093 | Bacteria | 4502 |
| 180 | Ga0105240_11229364 | 3300009093 | Bacteria | 792 |
| 181 | Ga0105243_10092171 | 3300009148 | Bacteria | 2497 |
| 182 | Ga0105243_10390862 | 3300009148 | Bacteria | 1289 |
| 183 | Ga0105242_11770245 | 3300009176 | Bacteria | 656 |
| 184 | Ga0105248_10371889 | 3300009177 | Bacteria | 1609 |
| 185 | Ga0105248_11417259 | 3300009177 | Bacteria | 786 |
| 186 | Ga0105035_102206 | 3300009988 | Bacteria | 1419 |
| 187 | Ga0157319_1000004 | 3300012497 | Bacteria | 394735 |
| 188 | Ga0157373_10027127 | 3300013100 | Bacteria | 4133 |
| 189 | Ga0157373_10705675 | 3300013100 | Bacteria | 739 |
| 190 | Ga0157371_10000080 | 3300013102 | Bacteria | 152121 |
| 191 | Ga0157371_10004407 | 3300013102 | Bacteria | 12303 |
| 192 | Ga0157371_10010046 | 3300013102 | Bacteria | 7400 |
| 193 | Ga0157371_10027367 | 3300013102 | Bacteria | 4136 |
| 194 | Ga0157370_10000032 | 3300013104 | Bacteria | 138963 |
| 195 | Ga0157370_10013528 | 3300013104 | Bacteria | 8401 |
| 196 | Ga0157370_11337536 | 3300013104 | Bacteria | 645 |
| 197 | Ga0157369_10004887 | 3300013105 | Bacteria | 15718 |
| 198 | Ga0157369_10012746 | 3300013105 | Bacteria | 9532 |
| 199 | Ga0157374_10001918 | 3300013296 | Bacteria | 17429 |
| 200 | Ga0157378_10002043 | 3300013297 | Bacteria | 18066 |
| 201 | Ga0163162_10202467 | 3300013306 | Unclassified | 2114 |
| 202 | Ga0163162_11279187 | 3300013306 | Bacteria | 833 |
| 203 | Ga0157372_10000235 | 3300013307 | Bacteria | 61511 |
| 204 | Ga0157372_10042246 | 3300013307 | Bacteria | 5042 |
| 205 | Ga0157372_11150297 | 3300013307 | Bacteria | 897 |
| 206 | Ga0157375_10228889 | 3300013308 | Bacteria | 2018 |
| 207 | Ga0182008_10020234 | 3300014497 | Bacteria | 3429 |
| 208 | Ga0157379_11779471 | 3300014968 | Bacteria | 605 |
| 209 | Ga0182006_1000051 | 3300015261 | Bacteria | 183089 |
| 210 | Ga0182006_1008993 | 3300015261 | Bacteria | 4500 |
| 211 | Ga0182006_1101162 | 3300015261 | Bacteria | 1023 |
| 212 | Ga0182006_1161344 | 3300015261 | Bacteria | 755 |
| 213 | Ga0182007_10013207 | 3300015262 | Bacteria | 3157 |
| 214 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 215 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 216 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 217 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 218 | Ga0183361_15589 | 3300016635 | Bacteria | 681 |
| 219 | Ga0163161_10039031 | 3300017792 | Bacteria | 3407 |
| 220 | Ga0163161_10043096 | 3300017792 | Bacteria | 3249 |
| 221 | Ga0163161_10154321 | 3300017792 | Bacteria | 1747 |
| 222 | Ga0206351_10514496 | 3300020077 | Bacteria | 2992 |
| 223 | Ga0154015_1601999 | 3300020610 | Bacteria | 9748 |
| 224 | Ga0213872_10000007 | 3300021361 | Bacteria | 228206 |
| 225 | Ga0213872_10000101 | 3300021361 | Bacteria | 79972 |
| 226 | Ga0213872_10000114 | 3300021361 | Bacteria | 74773 |
| 227 | Ga0213872_10023478 | 3300021361 | Bacteria | 2838 |
| 228 | Ga0213872_10036776 | 3300021361 | Bacteria | 2236 |
| 229 | Ga0213872_10045189 | 3300021361 | Bacteria | 2004 |
| 230 | Ga0213872_10083600 | 3300021361 | Unclassified | 1432 |
| 231 | Ga0213876_10000069 | 3300021384 | Bacteria | 125594 |
| 232 | Ga0209760_100051 | 3300025207 | Bacteria | 105257 |
| 233 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 234 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 235 | Ga0209784_100177 | 3300025224 | Bacteria | 53382 |
| 236 | Ga0209784_100373 | 3300025224 | Bacteria | 21044 |
| 237 | Ga0209784_104707 | 3300025224 | Bacteria | 941 |
| 238 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 239 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 240 | Ga0209566_100615 | 3300025225 | Bacteria | 22046 |
| 241 | Ga0209566_102391 | 3300025225 | Bacteria | 3522 |
| 242 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 243 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 244 | Ga0209674_100060 | 3300025226 | Bacteria | 282102 |
| 245 | Ga0209674_100076 | 3300025226 | Bacteria | 210323 |
| 246 | Ga0209674_111246 | 3300025226 | Bacteria | 920 |
| 247 | Ga0209674_115881 | 3300025226 | Bacteria | 640 |
| 248 | Ga0209672_100231 | 3300025228 | Bacteria | 42532 |
| 249 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 250 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 251 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 252 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 253 | Ga0209563_109598 | 3300025230 | Bacteria | 1455 |
| 254 | Ga0209563_112646 | 3300025230 | Bacteria | 1146 |
| 255 | Ga0209563_128624 | 3300025230 | Bacteria | 548 |
| 256 | Ga0207427_100020 | 3300025231 | Bacteria | 507515 |
| 257 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 258 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 259 | Ga0207425_1000851 | 3300025245 | Bacteria | 15022 |
| 260 | Ga0207425_1007356 | 3300025245 | Bacteria | 2916 |
| 261 | Ga0209646_1000043 | 3300025246 | Bacteria | 343652 |
| 262 | Ga0209026_1008003 | 3300025250 | Bacteria | 2273 |
| 263 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 264 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 265 | Ga0209148_1000265 | 3300025254 | Bacteria | 82436 |
| 266 | Ga0209148_1003982 | 3300025254 | Bacteria | 3788 |
| 267 | Ga0209759_1001678 | 3300025256 | Bacteria | 11541 |
| 268 | Ga0209759_1006235 | 3300025256 | Bacteria | 4042 |
| 269 | Ga0209759_1007283 | 3300025256 | Bacteria | 3581 |
| 270 | Ga0209759_1025248 | 3300025256 | Bacteria | 1268 |
| 271 | Ga0209129_1000004 | 3300025258 | Bacteria | 884499 |
| 272 | Ga0209129_1000095 | 3300025258 | Bacteria | 171644 |
| 273 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 274 | Ga0209565_1013066 | 3300025263 | Bacteria | 1954 |
| 275 | Ga0209565_1065433 | 3300025263 | Bacteria | 623 |
| 276 | Ga0209455_1000065 | 3300025272 | Bacteria | 321272 |
| 277 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 278 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 279 | Ga0209675_1033427 | 3300025291 | Bacteria | 1193 |
| 280 | Ga0209676_1004975 | 3300025292 | Bacteria | 7131 |
| 281 | Ga0209676_1021713 | 3300025292 | Bacteria | 2146 |
| 282 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 283 | Ga0209564_1000062 | 3300025295 | Bacteria | 321275 |
| 284 | Ga0209758_1000072 | 3300025297 | Bacteria | 277776 |
| 285 | Ga0209758_1000121 | 3300025297 | Bacteria | 192028 |
| 286 | Ga0209050_1000596 | 3300025298 | Bacteria | 57689 |
| 287 | Ga0209050_1008139 | 3300025298 | Bacteria | 5682 |
| 288 | Ga0209256_1000225 | 3300025299 | Bacteria | 103720 |
| 289 | Ga0209256_1000235 | 3300025299 | Bacteria | 98834 |
| 290 | Ga0209256_1000570 | 3300025299 | Bacteria | 52605 |
| 291 | Ga0209051_1000148 | 3300025303 | Bacteria | 132600 |
| 292 | Ga0209257_1000380 | 3300025304 | Bacteria | 88824 |
| 293 | Ga0209257_1000973 | 3300025304 | Bacteria | 39141 |
| 294 | Ga0209257_1144702 | 3300025304 | Bacteria | 530 |
| 295 | Ga0207696_1000005 | 3300025711 | Bacteria | 642078 |
| 296 | Ga0207696_1000024 | 3300025711 | Bacteria | 420123 |
| 297 | Ga0207696_1000038 | 3300025711 | Bacteria | 328221 |
| 298 | Ga0207696_1000088 | 3300025711 | Bacteria | 190313 |
| 299 | Ga0207696_1000876 | 3300025711 | Bacteria | 18743 |
| 300 | Ga0207696_1001588 | 3300025711 | Bacteria | 12013 |
| 301 | Ga0207696_1003787 | 3300025711 | Bacteria | 6738 |
| 302 | Ga0207696_1009538 | 3300025711 | Bacteria | 3615 |
| 303 | Ga0207696_1011547 | 3300025711 | Bacteria | 3172 |
| 304 | Ga0207696_1022646 | 3300025711 | Bacteria | 1993 |
| 305 | Ga0207696_1047875 | 3300025711 | Bacteria | 1231 |
| 306 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 307 | Ga0207655_1000009 | 3300025728 | Bacteria | 664676 |
| 308 | Ga0207655_1000063 | 3300025728 | Bacteria | 257028 |
| 309 | Ga0207655_1000117 | 3300025728 | Bacteria | 161655 |
| 310 | Ga0207655_1000247 | 3300025728 | Bacteria | 87805 |
| 311 | Ga0207655_1000413 | 3300025728 | Bacteria | 58877 |
| 312 | Ga0207655_1007341 | 3300025728 | Bacteria | 7155 |
| 313 | Ga0207655_1011857 | 3300025728 | Bacteria | 5147 |
| 314 | Ga0207655_1037020 | 3300025728 | Bacteria | 2154 |
| 315 | Ga0207655_1039934 | 3300025728 | Bacteria | 2032 |
| 316 | Ga0207655_1073796 | 3300025728 | Bacteria | 1257 |
| 317 | Ga0207655_1153162 | 3300025728 | Bacteria | 727 |
| 318 | Ga0207655_1240663 | 3300025728 | Bacteria | 518 |
| 319 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 320 | Ga0207713_1000003 | 3300025735 | Bacteria | 860698 |
| 321 | Ga0207713_1000029 | 3300025735 | Bacteria | 285054 |
| 322 | Ga0207713_1001125 | 3300025735 | Bacteria | 22736 |
| 323 | Ga0207713_1001486 | 3300025735 | Bacteria | 18542 |
| 324 | Ga0207713_1001919 | 3300025735 | Bacteria | 15755 |
| 325 | Ga0207713_1003804 | 3300025735 | Bacteria | 10108 |
| 326 | Ga0207713_1040624 | 3300025735 | Bacteria | 1950 |
| 327 | Ga0207713_1059498 | 3300025735 | Bacteria | 1466 |
| 328 | Ga0207713_1073884 | 3300025735 | Bacteria | 1249 |
| 329 | Ga0207713_1098300 | 3300025735 | Bacteria | 1015 |
| 330 | Ga0207680_10017223 | 3300025903 | Bacteria | 3813 |
| 331 | Ga0207645_10120582 | 3300025907 | Bacteria | 1702 |
| 332 | Ga0207705_10904618 | 3300025909 | Bacteria | 684 |
| 333 | Ga0207705_11174230 | 3300025909 | Bacteria | 589 |
| 334 | Ga0207684_10923533 | 3300025910 | Unclassified | 733 |
| 335 | Ga0207695_10001905 | 3300025913 | Bacteria | 32553 |
| 336 | Ga0207649_10000622 | 3300025920 | Bacteria | 23839 |
| 337 | Ga0207649_10255087 | 3300025920 | Bacteria | 1265 |
| 338 | Ga0207650_10499866 | 3300025925 | Bacteria | 1016 |
| 339 | Ga0207659_10069391 | 3300025926 | Bacteria | 2567 |
| 340 | Ga0207644_10046235 | 3300025931 | Bacteria | 3100 |
| 341 | Ga0207706_10693556 | 3300025933 | Bacteria | 870 |
| 342 | Ga0207686_10622463 | 3300025934 | Bacteria | 852 |
| 343 | Ga0207709_10238524 | 3300025935 | Bacteria | 1321 |
| 344 | Ga0207709_10279130 | 3300025935 | Bacteria | 1233 |
| 345 | Ga0207669_10057947 | 3300025937 | Bacteria | 2361 |
| 346 | Ga0207704_10590550 | 3300025938 | Bacteria | 908 |
| 347 | Ga0207691_10000218 | 3300025940 | Bacteria | 55649 |
| 348 | Ga0207711_10803426 | 3300025941 | Bacteria | 876 |
| 349 | Ga0207679_10000012 | 3300025945 | Bacteria | 339773 |
| 350 | Ga0207679_11238541 | 3300025945 | Bacteria | 685 |
| 351 | Ga0207651_10055698 | 3300025960 | Bacteria | 2717 |
| 352 | Ga0207640_10000055 | 3300025981 | Bacteria | 94930 |
| 353 | Ga0207658_10226035 | 3300025986 | Bacteria | 1577 |
| 354 | Ga0207658_11601086 | 3300025986 | Bacteria | 595 |
| 355 | Ga0207677_10110953 | 3300026023 | Bacteria | 2042 |
| 356 | Ga0207678_10000243 | 3300026067 | Bacteria | 49278 |
| 357 | Ga0207678_10105618 | 3300026067 | Bacteria | 2403 |
| 358 | Ga0207702_10000028 | 3300026078 | Bacteria | 183005 |
| 359 | Ga0207674_10012817 | 3300026116 | Bacteria | 9358 |
| 360 | Ga0207674_10093516 | 3300026116 | Bacteria | 2995 |
| 361 | Ga0207675_102443981 | 3300026118 | Bacteria | 534 |
| 362 | Ga0207683_10001508 | 3300026121 | Bacteria | 20979 |
| 363 | Ga0207698_10014504 | 3300026142 | Bacteria | 5241 |
| 364 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 365 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 366 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 367 | Ga0209281_1000012 | 3300027111 | Bacteria | 684886 |
| 368 | Ga0209281_1000024 | 3300027111 | Bacteria | 499062 |
| 369 | Ga0209281_1000066 | 3300027111 | Bacteria | 284953 |
| 370 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 371 | Ga0209281_1000078 | 3300027111 | Bacteria | 261622 |
| 372 | Ga0209281_1000143 | 3300027111 | Bacteria | 174070 |
| 373 | Ga0209281_1000441 | 3300027111 | Bacteria | 59960 |
| 374 | Ga0209281_1000495 | 3300027111 | Bacteria | 53514 |
| 375 | Ga0209281_1001539 | 3300027111 | Bacteria | 12846 |
| 376 | Ga0209281_1001686 | 3300027111 | Bacteria | 11558 |
| 377 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 378 | Ga0209389_1062744 | 3300027296 | Bacteria | 2247 |
| 379 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 380 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 381 | Ga0209371_1000060 | 3300027312 | Bacteria | 235042 |
| 382 | Ga0209371_1000409 | 3300027312 | Bacteria | 44442 |
| 383 | Ga0209371_1000461 | 3300027312 | Bacteria | 40005 |
| 384 | Ga0209371_1002127 | 3300027312 | Bacteria | 11670 |
| 385 | Ga0209371_1003406 | 3300027312 | Bacteria | 7774 |
| 386 | Ga0209371_1010149 | 3300027312 | Bacteria | 2924 |
| 387 | Ga0209371_1014177 | 3300027312 | Bacteria | 2196 |
| 388 | Ga0209371_1016332 | 3300027312 | Bacteria | 1962 |
| 389 | Ga0209371_1020821 | 3300027312 | Bacteria | 1606 |
| 390 | Ga0209371_1021744 | 3300027312 | Bacteria | 1549 |
| 391 | Ga0209371_1032234 | 3300027312 | Bacteria | 1129 |
| 392 | Ga0209371_1046621 | 3300027312 | Bacteria | 851 |
| 393 | Ga0209981_1018028 | 3300027378 | Bacteria | 999 |
| 394 | Ga0209984_1027163 | 3300027424 | Bacteria | 801 |
| 395 | Ga0209982_1002637 | 3300027552 | Bacteria | 2522 |
| 396 | Ga0209983_1002692 | 3300027665 | Bacteria | 3856 |
| 397 | Ga0209971_1001469 | 3300027682 | Bacteria | 5861 |
| 398 | Ga0268266_10004753 | 3300028379 | Bacteria | 12912 |
| 399 | Ga0268266_10325382 | 3300028379 | Bacteria | 1440 |
| 400 | Ga0265318_10094615 | 3300028577 | Bacteria | 1100 |
| 401 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 402 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 403 | Ga0268256_1000084 | 3300030500 | Bacteria | 164658 |
| 404 | Ga0268256_1000204 | 3300030500 | Bacteria | 67389 |
| 405 | Ga0268256_1000350 | 3300030500 | Bacteria | 44442 |
| 406 | Ga0268256_1001863 | 3300030500 | Bacteria | 11670 |
| 407 | Ga0268256_1003174 | 3300030500 | Bacteria | 7639 |
| 408 | Ga0268256_1005705 | 3300030500 | Bacteria | 4807 |
| 409 | Ga0268256_1008045 | 3300030500 | Bacteria | 3660 |
| 410 | Ga0268256_1013096 | 3300030500 | Bacteria | 2531 |
| 411 | Ga0268256_1015719 | 3300030500 | Bacteria | 2196 |
| 412 | Ga0268256_1018151 | 3300030500 | Bacteria | 1962 |
| 413 | Ga0268256_1023345 | 3300030500 | Bacteria | 1607 |
| 414 | Ga0268256_1036660 | 3300030500 | Bacteria | 1129 |
| 415 | Ga0268256_1052522 | 3300030500 | Bacteria | 851 |
| 416 | Ga0265327_10000082 | 3300031251 | Bacteria | 205610 |
| 417 | Ga0265327_10019345 | 3300031251 | Bacteria | 4190 |
| 418 | Ga0307408_100000132 | 3300031548 | Bacteria | 82821 |
| 419 | Ga0307408_100054074 | 3300031548 | Bacteria | 2902 |
| 420 | Ga0307408_100592827 | 3300031548 | Bacteria | 984 |
| 421 | Ga0307514_10001593 | 3300031649 | Bacteria | 26758 |
| 422 | Ga0316576_10029059 | 3300031727 | Bacteria | 3903 |
| 423 | Ga0316578_10009605 | 3300031728 | Bacteria | 4978 |
| 424 | Ga0307405_10200390 | 3300031731 | Bacteria | 1449 |
| 425 | Ga0307406_10021259 | 3300031901 | Bacteria | 3836 |
| 426 | Ga0373937_1707707 | 3300036401 | Unclassified | 576 |
| 427 | Ga0395899_0347015 | 3300037312 | Bacteria | 994 |
| 428 | Ga0395900_0005028 | 3300037418 | Bacteria | 13874 |
| 429 | Ga0395900_1002697 | 3300037418 | Bacteria | 755 |
| 430 | Ga0395905_0211363 | 3300037471 | Bacteria | 1818 |
| 431 | Ga0436365_0368505 | 3300039437 | Bacteria | 454216 |
| 432 | Ga0436361_0163583 | 3300039447 | Bacteria | 173204 |
| 433 | Ga0436361_0213400 | 3300039447 | Bacteria | 127007 |
| 434 | Ga0436361_0383736 | 3300039447 | Unclassified | 866 |
| 435 | Ga0436361_0470793 | 3300039447 | Bacteria | 641 |
| 436 | Ga0436361_0900730 | 3300039447 | Bacteria | 6275 |
| 437 | Ga0436361_0947981 | 3300039447 | Bacteria | 1372 |
| 438 | Ga0436361_1016242 | 3300039447 | Bacteria | 21235 |
| 439 | Ga0436361_1029236 | 3300039447 | Bacteria | 2952 |
| 440 | Ga0436361_1157107 | 3300039447 | Bacteria | 11574 |
| 441 | Ga0439438_038487 | 3300041405 | Bacteria | 1248 |
| 442 | Ga0451791_0647974 | 3300041451 | Bacteria | 552 |
| 443 | Ga0451807_0601058 | 3300041486 | Bacteria | 1558 |
| 444 | Ga0451837_0103931 | 3300041494 | Bacteria | 502 |
| 445 | Ga0451853_0649462 | 3300041512 | Bacteria | 523 |
| 446 | Ga0451853_1040831 | 3300041512 | Bacteria | 1165 |
| 447 | Ga0439432_002855 | 3300042006 | Bacteria | 6441 |
| 448 | Ga0439432_066336 | 3300042006 | Bacteria | 1105 |
| 449 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 450 | Ga0439452_000014 | 3300042010 | Bacteria | 344969 |
| 451 | Ga0439452_000016 | 3300042010 | Bacteria | 338131 |
| 452 | Ga0439452_000175 | 3300042010 | Bacteria | 47916 |
| 453 | Ga0450890_003582 | 3300042127 | Bacteria | 2061 |
| 454 | Ga0450900_002594 | 3300042136 | Bacteria | 1931 |
| 455 | Ga0450900_015129 | 3300042136 | Bacteria | 1035 |
| 456 | Ga0450902_045051 | 3300042137 | Bacteria | 753 |
| 457 | Ga0439459_0001664 | 3300042438 | Bacteria | 3308 |
| 458 | Ga0439464_0106781 | 3300042439 | Bacteria | 854 |
| 459 | Ga0451577_0012119 | 3300042876 | Bacteria | 8110 |
| 460 | Ga0466986_0012345 | 3300044650 | Bacteria | 5332 |
| 461 | Ga0466969_0026952 | 3300044656 | Bacteria | 2945 |
| 462 | Ga0466969_0440708 | 3300044656 | Unclassified | 592 |
| 463 | Ga0466969_0465759 | 3300044656 | Bacteria | 575 |
| 464 | Ga0466972_0004818 | 3300044658 | Bacteria | 6765 |
| 465 | Ga0466981_0000010 | 3300044669 | Bacteria | 133630 |
| 466 | Ga0466978_0027080 | 3300044671 | Bacteria | 3455 |
| 467 | Ga0466982_0006994 | 3300044672 | Bacteria | 5517 |
| 468 | Ga0453683_0760638 | 3300044673 | Bacteria | 637 |
| 469 | Ga0466965_0008065 | 3300044683 | Bacteria | 4863 |
| 470 | Ga0466965_0070097 | 3300044683 | Bacteria | 1762 |
| 471 | Ga0466966_0045072 | 3300044684 | Bacteria | 2820 |
| 472 | Ga0466966_0114479 | 3300044684 | Bacteria | 1661 |
| 473 | Ga0466961_0000995 | 3300044693 | Bacteria | 17488 |
| 474 | Ga0466961_0005576 | 3300044693 | Bacteria | 7948 |
| 475 | Ga0466963_0109955 | 3300044694 | Bacteria | 1891 |
| 476 | Ga0466963_0274098 | 3300044694 | Bacteria | 1185 |
| 477 | Ga0466964_0025662 | 3300044706 | Bacteria | 2302 |
| 478 | Ga0466964_0096091 | 3300044706 | Bacteria | 1298 |
| 479 | Ga0453684_0763665 | 3300044712 | Bacteria | 1045 |
| 480 | Ga0466971_0010314 | 3300044719 | Bacteria | 4081 |
| 481 | Ga0466970_0003254 | 3300044765 | Bacteria | 7896 |
| 482 | Ga0466957_0044066 | 3300044842 | Bacteria | 2703 |
| 483 | Ga0466960_0018919 | 3300044901 | Bacteria | 3025 |
| 484 | Ga0466959_0007774 | 3300045049 | Bacteria | 7541 |
| 485 | Ga0466959_0055576 | 3300045049 | Bacteria | 2890 |
| 486 | Ga0451576_0005011 | 3300045051 | Bacteria | 16829 |
| 487 | Ga0466958_1009096 | 3300045836 | Bacteria | 543 |
| 488 | Ga0466967_0076032 | 3300045976 | Bacteria | 3019 |
| 489 | Ga0466967_0086004 | 3300045976 | Bacteria | 2848 |
| 490 | Ga0495591_020952 | 3300046458 | Bacteria | 2145 |
| 491 | Ga0495638_0021272 | 3300046460 | Bacteria | 4277 |
| 492 | Ga0495651_0137910 | 3300046462 | Bacteria | 1773 |
| 493 | Ga0495653_0637304 | 3300046463 | Bacteria | 652 |
| 494 | Ga0495650_0000005 | 3300046471 | Bacteria | 766553 |
| 495 | Ga0495650_0000043 | 3300046471 | Bacteria | 357197 |
| 496 | Ga0495650_0008788 | 3300046471 | Bacteria | 5843 |
| 497 | Ga0495650_0071835 | 3300046471 | Bacteria | 1356 |
| 498 | Ga0495582_0219873 | 3300046473 | Bacteria | 1087 |
| 499 | Ga0495616_0312196 | 3300046513 | Bacteria | 662 |
| 500 | Ga0495620_0214757 | 3300046515 | Bacteria | 737 |
| 501 | Ga0495628_0810451 | 3300046516 | Bacteria | 655 |
| 502 | Ga0495637_0088113 | 3300046520 | Bacteria | 1228 |
| 503 | Ga0495648_0148793 | 3300046524 | Bacteria | 1223 |
| 504 | Ga0495642_0123996 | 3300046528 | Bacteria | 1109 |
| 505 | Ga0495654_0000223 | 3300046530 | Bacteria | 52992 |
| 506 | Ga0495654_0040481 | 3300046530 | Bacteria | 2322 |
| 507 | Ga0495654_0397735 | 3300046530 | Bacteria | 547 |
| 508 | Ga0495609_0237918 | 3300046538 | Bacteria | 752 |
| 509 | Ga0495597_0000632 | 3300046542 | Bacteria | 28707 |
| 510 | Ga0495597_0005786 | 3300046542 | Bacteria | 6483 |
| 511 | Ga0495645_0707312 | 3300046543 | Bacteria | 611 |
| 512 | Ga0495625_0000662 | 3300046660 | Bacteria | 49094 |
| 513 | Ga0495588_0037160 | 3300046674 | Bacteria | 2473 |
| 514 | Ga0495623_0302316 | 3300046679 | Bacteria | 884 |
| 515 | Ga0495624_0508079 | 3300046690 | Bacteria | 721 |
| 516 | Ga0495649_0001472 | 3300046694 | Bacteria | 17707 |
| 517 | Ga0495649_0040716 | 3300046694 | Bacteria | 2542 |
| 518 | Ga0495660_0000012 | 3300046810 | Bacteria | 350701 |
| 519 | Ga0495672_0000034 | 3300047320 | Bacteria | 290832 |
| 520 | Ga0495672_0000036 | 3300047320 | Bacteria | 279648 |
| 521 | Ga0495680_0547774 | 3300047322 | Bacteria | 780 |
| 522 | Ga0495675_0037724 | 3300047444 | Bacteria | 3077 |
| 523 | Ga0495675_0138223 | 3300047444 | Bacteria | 1511 |
| 524 | Ga0495675_0323718 | 3300047444 | Bacteria | 911 |
| 525 | Ga0495679_029788 | 3300047446 | Bacteria | 1778 |
| 526 | Ga0495679_039542 | 3300047446 | Bacteria | 1470 |
| 527 | Ga0495679_056463 | 3300047446 | Bacteria | 1163 |
| 528 | Ga0495679_171935 | 3300047446 | Bacteria | 576 |
| 529 | Ga0495673_0000007 | 3300047469 | Bacteria | 796722 |
| 530 | Ga0495684_0194989 | 3300047471 | Bacteria | 1495 |
| 531 | Ga0496100_0014438 | 3300048903 | Bacteria | 4585 |
| 532 | Ga0496100_0041571 | 3300048903 | Bacteria | 2931 |
| 533 | Ga0496100_0680463 | 3300048903 | Bacteria | 802 |
| 534 | Ga0496101_0303289 | 3300048904 | Bacteria | 1251 |
| 535 | Ga0496101_1335683 | 3300048904 | Bacteria | 560 |
| 536 | Ga0496104_0000043 | 3300048907 | Bacteria | 154773 |
| 537 | Ga0496104_0001633 | 3300048907 | Bacteria | 19357 |
| 538 | Ga0496104_0011028 | 3300048907 | Bacteria | 8086 |
| 539 | Ga0496104_0039938 | 3300048907 | Bacteria | 4396 |
| 540 | Ga0496104_0233549 | 3300048907 | Bacteria | 1751 |
| 541 | Ga0496104_1313605 | 3300048907 | Bacteria | 626 |
| 542 | Ga0496105_0008843 | 3300048908 | Bacteria | 7845 |
| 543 | Ga0496105_0902545 | 3300048908 | Bacteria | 666 |
| 544 | Ga0496107_1042305 | 3300048910 | Bacteria | 592 |
| 545 | Ga0496108_0236379 | 3300048911 | Bacteria | 1589 |
| 546 | Ga0496108_0408826 | 3300048911 | Bacteria | 1185 |
| 547 | Ga0496109_0086533 | 3300048912 | Bacteria | 2894 |
| 548 | Ga0496109_0120028 | 3300048912 | Bacteria | 2449 |
| 549 | Ga0496109_0417172 | 3300048912 | Bacteria | 1268 |
| 550 | Ga0496110_0081513 | 3300048913 | Bacteria | 2884 |
| 551 | Ga0496110_0095437 | 3300048913 | Bacteria | 2663 |
| 552 | Ga0496110_0230681 | 3300048913 | Bacteria | 1684 |
| 553 | Ga0496111_0157304 | 3300048914 | Bacteria | 1686 |
| 554 | Ga0496113_0471996 | 3300048916 | Bacteria | 1008 |
| 555 | Ga0496114_0004699 | 3300048917 | Bacteria | 10623 |
| 556 | Ga0496114_0174075 | 3300048917 | Bacteria | 1877 |
| 557 | Ga0496114_0896757 | 3300048917 | Bacteria | 768 |
| 558 | Ga0496115_0440301 | 3300048918 | Bacteria | 1054 |
| 559 | Ga0496116_0000066 | 3300048919 | Bacteria | 264035 |
| 560 | Ga0496116_0000870 | 3300048919 | Bacteria | 37662 |
| 561 | Ga0496116_0006527 | 3300048919 | Bacteria | 10568 |
| 562 | Ga0496116_0077663 | 3300048919 | Bacteria | 2073 |
| 563 | Ga0496116_0094773 | 3300048919 | Bacteria | 1803 |
| 564 | Ga0496117_0000020 | 3300048920 | Bacteria | 458405 |
| 565 | Ga0496117_0001276 | 3300048920 | Bacteria | 37337 |
| 566 | Ga0496117_0003356 | 3300048920 | Bacteria | 18676 |
| 567 | Ga0496117_0003520 | 3300048920 | Bacteria | 18130 |
| 568 | Ga0496117_0008312 | 3300048920 | Bacteria | 9876 |
| 569 | Ga0496117_0010307 | 3300048920 | Bacteria | 8544 |
| 570 | Ga0496117_0014895 | 3300048920 | Bacteria | 6669 |
| 571 | Ga0496117_0023798 | 3300048920 | Bacteria | 4865 |
| 572 | Ga0496117_0106419 | 3300048920 | Bacteria | 1760 |
| 573 | Ga0496118_0000015 | 3300048921 | Bacteria | 551359 |
| 574 | Ga0496118_0001324 | 3300048921 | Bacteria | 37554 |
| 575 | Ga0496118_0001862 | 3300048921 | Bacteria | 30191 |
| 576 | Ga0496118_0004771 | 3300048921 | Bacteria | 15859 |
| 577 | Ga0496118_0013175 | 3300048921 | Bacteria | 7844 |
| 578 | Ga0496118_0024247 | 3300048921 | Bacteria | 5244 |
| 579 | Ga0496118_0024879 | 3300048921 | Bacteria | 5153 |
| 580 | Ga0496118_0294103 | 3300048921 | Bacteria | 895 |
| 581 | Ga0496119_0000001 | 3300048922 | Bacteria | 789520 |
| 582 | Ga0496119_0000157 | 3300048922 | Bacteria | 93908 |
| 583 | Ga0496119_0000230 | 3300048922 | Bacteria | 78527 |
| 584 | Ga0496119_0001866 | 3300048922 | Bacteria | 24347 |
| 585 | Ga0496119_0012016 | 3300048922 | Bacteria | 7083 |
| 586 | Ga0496119_0016595 | 3300048922 | Bacteria | 5592 |
| 587 | Ga0496119_0018063 | 3300048922 | Bacteria | 5269 |
| 588 | Ga0496120_0000237 | 3300048923 | Bacteria | 94224 |
| 589 | Ga0496120_0000324 | 3300048923 | Bacteria | 79261 |
| 590 | Ga0496120_0004284 | 3300048923 | Bacteria | 12115 |
| 591 | Ga0496120_0013419 | 3300048923 | Bacteria | 5515 |
| 592 | Ga0496120_0015493 | 3300048923 | Bacteria | 5023 |
| 593 | Ga0496120_0052113 | 3300048923 | Bacteria | 2332 |
| 594 | Ga0496121_0000160 | 3300048924 | Bacteria | 146354 |
| 595 | Ga0496121_0000415 | 3300048924 | Bacteria | 84560 |
| 596 | Ga0496121_0001137 | 3300048924 | Bacteria | 46735 |
| 597 | Ga0496121_0001182 | 3300048924 | Bacteria | 45659 |
| 598 | Ga0496121_0001228 | 3300048924 | Bacteria | 44611 |
| 599 | Ga0496121_0001573 | 3300048924 | Bacteria | 38016 |
| 600 | Ga0496121_0010366 | 3300048924 | Bacteria | 10526 |
| 601 | Ga0496121_0015722 | 3300048924 | Bacteria | 7889 |
| 602 | Ga0496121_0136003 | 3300048924 | Bacteria | 1831 |
| 603 | Ga0496121_0169499 | 3300048924 | Bacteria | 1587 |
| 604 | Ga0496122_0000110 | 3300048925 | Bacteria | 190142 |
| 605 | Ga0496122_0000265 | 3300048925 | Bacteria | 117022 |
| 606 | Ga0496122_0002210 | 3300048925 | Bacteria | 28395 |
| 607 | Ga0496122_0003353 | 3300048925 | Bacteria | 21111 |
| 608 | Ga0496122_0013774 | 3300048925 | Bacteria | 7884 |
| 609 | Ga0496122_0014483 | 3300048925 | Bacteria | 7618 |
| 610 | Ga0496122_0018211 | 3300048925 | Bacteria | 6504 |
| 611 | Ga0496122_0029788 | 3300048925 | Bacteria | 4591 |
| 612 | Ga0496122_0030520 | 3300048925 | Bacteria | 4514 |
| 613 | Ga0496122_0048913 | 3300048925 | Bacteria | 3246 |
| 614 | Ga0496122_0069357 | 3300048925 | Bacteria | 2525 |
| 615 | Ga0496122_0071347 | 3300048925 | Bacteria | 2476 |
| 616 | Ga0496122_0137985 | 3300048925 | Bacteria | 1532 |
| 617 | Ga0496122_0264419 | 3300048925 | Bacteria | 952 |
| 618 | Ga0496122_0383982 | 3300048925 | Bacteria | 719 |
| 619 | Ga0496122_0464532 | 3300048925 | Bacteria | 624 |
| 620 | Ga0496123_0000014 | 3300048926 | Bacteria | 433465 |
| 621 | Ga0496123_0000081 | 3300048926 | Bacteria | 190142 |
| 622 | Ga0496123_0000836 | 3300048926 | Bacteria | 49282 |
| 623 | Ga0496123_0002902 | 3300048926 | Bacteria | 20057 |
| 624 | Ga0496123_0004375 | 3300048926 | Bacteria | 14912 |
| 625 | Ga0496123_0009244 | 3300048926 | Bacteria | 8905 |
| 626 | Ga0496123_0018392 | 3300048926 | Bacteria | 5562 |
| 627 | Ga0496123_0020602 | 3300048926 | Bacteria | 5153 |
| 628 | Ga0496123_0022982 | 3300048926 | Bacteria | 4787 |
| 629 | Ga0496123_0072065 | 3300048926 | Bacteria | 2152 |
| 630 | Ga0496123_0125578 | 3300048926 | Bacteria | 1433 |
| 631 | Ga0496123_0155295 | 3300048926 | Bacteria | 1228 |
| 632 | Ga0496123_0156102 | 3300048926 | Bacteria | 1223 |
| 633 | Ga0496123_0208454 | 3300048926 | Bacteria | 995 |
| 634 | Ga0496123_0507797 | 3300048926 | Bacteria | 525 |
| 635 | Ga0496124_0000425 | 3300048927 | Bacteria | 75572 |
| 636 | Ga0496124_0000530 | 3300048927 | Bacteria | 65033 |
| 637 | Ga0496124_0002230 | 3300048927 | Bacteria | 25811 |
| 638 | Ga0496124_0007334 | 3300048927 | Bacteria | 11745 |
| 639 | Ga0496124_0007785 | 3300048927 | Bacteria | 11314 |
| 640 | Ga0496124_0020587 | 3300048927 | Bacteria | 6089 |
| 641 | Ga0496124_0022612 | 3300048927 | Bacteria | 5758 |
| 642 | Ga0496124_0038214 | 3300048927 | Bacteria | 4169 |
| 643 | Ga0496124_0046466 | 3300048927 | Bacteria | 3717 |
| 644 | Ga0496124_0052569 | 3300048927 | Bacteria | 3460 |
| 645 | Ga0496124_0064702 | 3300048927 | Bacteria | 3052 |
| 646 | Ga0496124_0386554 | 3300048927 | Bacteria | 976 |
| 647 | Ga0496124_0857130 | 3300048927 | Unclassified | 556 |
| 648 | Ga0496125_0000009 | 3300048928 | Bacteria | 677678 |
| 649 | Ga0496125_0000033 | 3300048928 | Bacteria | 351850 |
| 650 | Ga0496125_0000081 | 3300048928 | Bacteria | 228069 |
| 651 | Ga0496125_0000485 | 3300048928 | Bacteria | 69763 |
| 652 | Ga0496125_0000500 | 3300048928 | Bacteria | 68387 |
| 653 | Ga0496125_0001753 | 3300048928 | Bacteria | 30084 |
| 654 | Ga0496125_0011561 | 3300048928 | Bacteria | 8817 |
| 655 | Ga0496125_0012612 | 3300048928 | Bacteria | 8372 |
| 656 | Ga0496125_0021460 | 3300048928 | Bacteria | 6023 |
| 657 | Ga0496125_0031255 | 3300048928 | Bacteria | 4747 |
| 658 | Ga0496125_0158093 | 3300048928 | Bacteria | 1544 |
| 659 | Ga0496125_0299173 | 3300048928 | Bacteria | 986 |
| 660 | Ga0496126_0000125 | 3300048929 | Bacteria | 180236 |
| 661 | Ga0496126_0000142 | 3300048929 | Bacteria | 164438 |
| 662 | Ga0496126_0001066 | 3300048929 | Bacteria | 46225 |
| 663 | Ga0496126_0011764 | 3300048929 | Bacteria | 9011 |
| 664 | Ga0496126_0015085 | 3300048929 | Bacteria | 7785 |
| 665 | Ga0496126_0070970 | 3300048929 | Bacteria | 3101 |
| 666 | Ga0496126_0072656 | 3300048929 | Bacteria | 3059 |
| 667 | Ga0496126_0123048 | 3300048929 | Bacteria | 2247 |
| 668 | Ga0496126_0271622 | 3300048929 | Bacteria | 1407 |
| 669 | Ga0496126_0353454 | 3300048929 | Bacteria | 1201 |
| 670 | Ga0496126_0544862 | 3300048929 | Bacteria | 921 |
| 671 | Ga0496126_0595563 | 3300048929 | Bacteria | 871 |
| 672 | Ga0496126_0615915 | 3300048929 | Bacteria | 853 |
| 673 | Ga0496126_1078239 | 3300048929 | Bacteria | 598 |
| 674 | Ga0496126_1199688 | 3300048929 | Bacteria | 558 |
| 675 | Ga0496126_1320864 | 3300048929 | Bacteria | 524 |
| 676 | Ga0495682_0326167 | 3300049460 | Unclassified | 541 |
| 677 | Ga0501043_0000010 | 3300049579 | Bacteria | 206374 |
| 678 | Ga0501046_0000097 | 3300049580 | Bacteria | 93650 |
| 679 | Ga0501046_0221889 | 3300049580 | Bacteria | 1399 |
| 680 | Ga0501047_0000026 | 3300049581 | Bacteria | 225296 |
| 681 | Ga0501048_0001099 | 3300049582 | Bacteria | 20303 |
| 682 | Ga0501209_284628 | 3300049656 | Bacteria | 519 |
| 683 | Ga0501241_020201 | 3300049758 | Bacteria | 1224 |
| 684 | Ga0501035_1034296 | 3300049822 | Unclassified | 644 |
| 685 | Ga0501044_0248561 | 3300049823 | Bacteria | 1720 |
| 686 | Ga0501044_0349284 | 3300049823 | Bacteria | 1399 |
| 687 | Ga0501044_0471667 | 3300049823 | Bacteria | 1159 |
| 688 | Ga0501044_0508542 | 3300049823 | Bacteria | 1105 |
| 689 | Ga0501044_1065913 | 3300049823 | Bacteria | 678 |
| 690 | Ga0501045_0014425 | 3300049824 | Bacteria | 5599 |
| 691 | nmdc:mga00v17_265436_c1 | 3300050491 | Bacteria | 1114 |
| 692 | nmdc:mga00v17_461224_c1 | 3300050491 | Bacteria | 825 |
| 693 | nmdc:mga0k408_61882_c1 | 3300050493 | Bacteria | 2176 |
| 694 | nmdc:mga07m45_51893_c1 | 3300050496 | Bacteria | 2314 |
| 695 | Ga0495655_0240109 | 3300053083 | Unclassified | 606 |
| 696 | Ga0500651_0000354 | 3300053093 | Bacteria | 25764 |
| 697 | Ga0500651_0024668 | 3300053093 | Bacteria | 3771 |
| 698 | Ga0500607_061665 | 3300053121 | Bacteria | 1962 |
| 699 | Ga0500618_000007 | 3300053125 | Bacteria | 226268 |
| 700 | Ga0500559_0555969 | 3300053136 | Unclassified | 523 |
| 701 | Ga0500564_373155 | 3300053138 | Unclassified | 524 |
| 702 | Ga0500573_0005353 | 3300053140 | Bacteria | 6871 |
| 703 | Ga0500627_0187982 | 3300053158 | Bacteria | 928 |
| 704 | Ga0500634_0000356 | 3300053161 | Bacteria | 14511 |
| 705 | Ga0500636_0000081 | 3300053177 | Bacteria | 47382 |
| 706 | Ga0466962_0004792 | 3300061719 | Bacteria | 6509 |
| 707 | 2511168992 | 2510917026 | Bacteria | 7046020 |
| 708 | 2547695908 | 2547132181 | Bacteria | 4945084 |
| 709 | 2554816430 | 2554235132 | Bacteria | 6772433 |
| 710 | 2555245629 | 2554235231 | Bacteria | 5215788 |
| 711 | 2555258054 | 2554235234 | Bacteria | 5762085 |
| 712 | 2562462593 | 2561511199 | Bacteria | 5155034 |
| 713 | 2585829481 | 2585427591 | Bacteria | 5482980 |
| 714 | 2585834846 | 2585427592 | Bacteria | 5370892 |
| 715 | 2585994865 | 2585427633 | Bacteria | 6413184 |
| 716 | 2585999405 | 2585427634 | Bacteria | 6455027 |
| 717 | 2597029415 | 2596583598 | Bacteria | 5251611 |
| 718 | 2599409108 | 2599185169 | Bacteria | 5441380 |
| 719 | 2599447353 | 2599185178 | Bacteria | 5365746 |
| 720 | 2601522385 | 2600255254 | Bacteria | 5281859 |
| 721 | 2601527411 | 2600255255 | Bacteria | 5282785 |
| 722 | 2601532831 | 2600255256 | Bacteria | 5597742 |
| 723 | 2601538201 | 2600255257 | Bacteria | 5597196 |
| 724 | 2601614241 | 2600255280 | Bacteria | 5292309 |
| 725 | 2601618963 | 2600255281 | Bacteria | 5288753 |
| 726 | 2601642433 | 2600255287 | Bacteria | 5210468 |
| 727 | 2601647280 | 2600255288 | Bacteria | 5282738 |
| 728 | 2601652389 | 2600255289 | Bacteria | 5281907 |
| 729 | 2601657716 | 2600255290 | Bacteria | 5282218 |
| 730 | 2601662254 | 2600255291 | Bacteria | 5217298 |
| 731 | 2601695211 | 2600255298 | Bacteria | 5215185 |
| 732 | 2601699886 | 2600255299 | Bacteria | 5218662 |
| 733 | 2601705513 | 2600255300 | Bacteria | 5287774 |
| 734 | 2601710541 | 2600255301 | Bacteria | 5280532 |
| 735 | 2601715554 | 2600255302 | Bacteria | 5288235 |
| 736 | 2601720238 | 2600255303 | Bacteria | 5219315 |
| 737 | 2601725959 | 2600255304 | Bacteria | 5283973 |
| 738 | 2601730502 | 2600255305 | Bacteria | 5282329 |
| 739 | 2601735518 | 2600255306 | Bacteria | 5281613 |
| 740 | 2601740216 | 2600255307 | Bacteria | 5439064 |
| 741 | 2601750705 | 2600255309 | Bacteria | 5431045 |
| 742 | 2601756143 | 2600255310 | Bacteria | 5600903 |
| 743 | 2601763376 | 2600255311 | Bacteria | 5598766 |
| 744 | 2602017958 | 2600255392 | Bacteria | 5437392 |
| 745 | 2603637710 | 2602042046 | Bacteria | 5483348 |
| 746 | 2603642386 | 2602042047 | Bacteria | 4697674 |
| 747 | 2603659622 | 2602042052 | Bacteria | 5215873 |
| 748 | 2603664898 | 2602042053 | Bacteria | 5214361 |
| 749 | 2603698501 | 2602042066 | Bacteria | 4423871 |
| 750 | 2603702990 | 2602042067 | Bacteria | 4863713 |
| 751 | 2603837891 | 2602042103 | Bacteria | 5284714 |
| 752 | 2603842968 | 2602042104 | Bacteria | 5281639 |
| 753 | 2603848042 | 2602042105 | Bacteria | 5282303 |
| 754 | 2603853113 | 2602042106 | Bacteria | 5282744 |
| 755 | 2603865354 | 2602042109 | Bacteria | 5152801 |
| 756 | 2603867052 | 2602042109 | Bacteria | 5152801 |
| 757 | 2603871167 | 2602042110 | Bacteria | 5283285 |
| 758 | 2603876081 | 2602042111 | Bacteria | 5212080 |
| 759 | 2606048360 | 2603880178 | Bacteria | 5283018 |
| 760 | 2606069325 | 2603880184 | Bacteria | 5217896 |
| 761 | 2606145134 | 2603880202 | Bacteria | 5284684 |
| 762 | 2606175762 | 2603880211 | Bacteria | 5284226 |
| 763 | 2608382643 | 2606217733 | Bacteria | 6360972 |
| 764 | 2609912340 | 2609459761 | Bacteria | 5513740 |
| 765 | 2637225013 | 2636415599 | Bacteria | 5718434 |
| 766 | 2671102900 | 2667528172 | Bacteria | 5170840 |
| 767 | 2671109924 | 2667528173 | Bacteria | 5375747 |
| 768 | 2671584691 | 2671180115 | Bacteria | 5353919 |
| 769 | 2671585732 | 2671180115 | Bacteria | 5353919 |
| 770 | 2676406250 | 2675903046 | Bacteria | 5451247 |
| 771 | 2681997314 | 2681812866 | Bacteria | 4552357 |
| 772 | 2682005384 | 2681812869 | Bacteria | 5014465 |
| 773 | 2712469905 | 2711768156 | Bacteria | 4471618 |
| 774 | 2753855983 | 2751185917 | Bacteria | 4551186 |
| 775 | 2765585998 | 2765235841 | Bacteria | 6137024 |
| 776 | 2765588954 | 2765235842 | Bacteria | 4799256 |
| 777 | 2775539003 | 2775506706 | Bacteria | 4873073 |
| 778 | 2777023346 | 2775507074 | Bacteria | 5532402 |
| 779 | 2792313126 | 2791355010 | Bacteria | 4864581 |
| 780 | 2793405463 | 2791355275 | Bacteria | 4429597 |
| 781 | 2813728748 | 2811995292 | Bacteria | 5303342 |
| 782 | 2814696271 | 2814123068 | Bacteria | 5687681 |
| 783 | 2821119814 | 2821118458 | Bacteria | 4714306 |
| 784 | 2821124004 | 2821123053 | Bacteria | 7836056 |
| 785 | 2823374746 | 2823373977 | Bacteria | 4779415 |
| 786 | 2838738966 | 2838736955 | Bacteria | 5760694 |
| 787 | 2841842864 | 2841840854 | Bacteria | 5761912 |
| 788 | 2842142645 | 2842140634 | Bacteria | 5759631 |
| 789 | 2842738580 | 2842733646 | Bacteria | 5716726 |
| 790 | 2844427526 | 2844425489 | Bacteria | 4854065 |
| 791 | 2846036374 | 2846033681 | Bacteria | 4377894 |
| 792 | 2846038211 | 2846037992 | Bacteria | 4526407 |
| 793 | 2854921761 | 2854916844 | Bacteria | 5725939 |
| 794 | 2857531566 | 2857531043 | Bacteria | 6754041 |
| 795 | 2884088657 | 2884086401 | Bacteria | 5005459 |
| 796 | 2885268772 | 2885266251 | Bacteria | 4796748 |
| 797 | 2886851554 | 2886848708 | Bacteria | 5632523 |
| 798 | 2891670887 | 2891670763 | Bacteria | 4967099 |
| 799 | 2891674600 | 2891670763 | Bacteria | 4967099 |
| 800 | 2894024787 | 2894023352 | Bacteria | 5167372 |
| 801 | 2894414380 | 2894414249 | Bacteria | 4405451 |
| 802 | 2904477244 | 2904474040 | Bacteria | 5504324 |
| 803 | 2904514100 | 2904513164 | Bacteria | 5476410 |
| 804 | 2919109296 | 2919108558 | Bacteria | 5897419 |
| 805 | 2919153411 | 2919150387 | Bacteria | 5500879 |
| 806 | 2919171691 | 2919171160 | Bacteria | 6499771 |
| 807 | 2923527106 | 2923525760 | Bacteria | 4472324 |
| 808 | 2923634854 | 2923634449 | Bacteria | 4753480 |
| 809 | 2927144037 | 2927143783 | Bacteria | 5504251 |
| 810 | 2927834093 | 2927833300 | Bacteria | 4923934 |
| 811 | 2928060728 | 2928058823 | Bacteria | 5520022 |
| 812 | 2935626556 | 2935625433 | Bacteria | 5042964 |
| 813 | 2937541662 | 2937539931 | Bacteria | 4639830 |
| 814 | 2939569129 | 2939568625 | Bacteria | 4542555 |
| 815 | 2939573546 | 2939573065 | Bacteria | 4926053 |
| 816 | 2939576248 | 2939573065 | Bacteria | 4926053 |
| 817 | 2939611108 | 2939607340 | Bacteria | 4719256 |
| 818 | 2939621223 | 2939617950 | Bacteria | 4820956 |
| 819 | 2939643825 | 2939642701 | Bacteria | 4475280 |
| 820 | 2945877820 | 2945874760 | Bacteria | 5527237 |
| 821 | 2969082003 | 2969079654 | Bacteria | 5439582 |
| 822 | 2971823855 | 2971820967 | Bacteria | 5823634 |
| 823 | 2974312120 | 2974310843 | Bacteria | 4947816 |
| 824 | 2974438534 | 2974435778 | Bacteria | 4876478 |
| 825 | 2984564437 | 2984559226 | Bacteria | 5683096 |
| 826 | 2984597169 | 2984595703 | Bacteria | 5682994 |
| 827 | 2998347102 | 2998344455 | Bacteria | 4222996 |
| 828 | 3000379194 | 3000376612 | Bacteria | 4705565 |
| 829 | 8001524877 | 8001522603 | Bacteria | 4726425 |
| 830 | 8018223433 | 8018221730 | Bacteria | 4616064 |
| 831 | 8018407783 | 8018405270 | Bacteria | 4978981 |
| 832 | 8018408533 | 8018405270 | Bacteria | 4978981 |
| 833 | 8019507928 | 8019504834 | Bacteria | 4819156 |
| 834 | 8021623370 | 8021622325 | Bacteria | 4844743 |
| 835 | 8021626697 | 8021626552 | Bacteria | 4665214 |
| 836 | 8021650654 | 8021648035 | Bacteria | 4772378 |
| 837 | 8052495434 | 8052494512 | Bacteria | 5765634 |
| 838 | 8054845875 | 8054844752 | Bacteria | 4450330 |
| 839 | 8054853210 | 8054849141 | Bacteria | 5232694 |
| 840 | 8054932789 | 8054929484 | Bacteria | 5599761 |
| 841 | 8055089298 | 8055087960 | Bacteria | 4784273 |
| 842 | 8055092646 | 8055092621 | Bacteria | 4873875 |
| 843 | 8055098949 | 8055097453 | Bacteria | 4865496 |
| 844 | 8055695692 | 8055693939 | Bacteria | 4772047 |
| 845 | 8057309361 | 8057304971 | Bacteria | 4649742 |
| 846 | Ga0436361_0215157 | |||
| 847 | SwRhRL2b_contig_126825 | |||
| 848 | SwRhRL2b_contig_1451602 | |||
| 849 | SwRhRL2b_contig_2947596 | |||
| 850 | SwRhRL2b_contig_3517994 | |||
| 851 | SwRhRL2b_contig_372564 | |||
| 852 | JGI24741J21665_1000832 | |||
| 853 | JGI24740J21852_10000282 | |||
| 854 | JGI24740J21852_10000391 | |||
| 855 | JGI24742J22300_10056359 | |||
| 856 | JGI25156J39149_1002231 | |||
| 857 | JGI25156J39149_1022518 | |||
| 858 | JGI25156J39149_1034333 | |||
| 859 | JGI25162J39368_1000009 | |||
| 860 | JGI25154J39366_1003436 | |||
| 861 | JGI25163J39215_1000150 | |||
| 862 | JGI25164J39214_1000002 | |||
| 863 | JGI25152J39213_1000878 | |||
| 864 | JGI25152J39213_1005507 | |||
| 865 | JGI25150J39212_1009220 | |||
| 866 | JGI25153J46596_10001192 | |||
| 867 | rootH2_10055337 | |||
| 868 | rootL2_10039490 | |||
| 869 | rootH1_10139962 | |||
| 870 | Ga0006562J51391_1101642 | |||
| 871 | Ga0055538_1000015 | |||
| 872 | Ga0055538_1006716 | |||
| 873 | Ga0055538_1006820 | |||
| 874 | Ga0055539_1000009 | |||
| 875 | Ga0055539_1000231 | |||
| 876 | Ga0055533_1000012 | |||
| 877 | Ga0055533_1002682 | |||
| 878 | Ga0055533_1010696 | |||
| 879 | Ga0055533_1011907 | |||
| 880 | Ga0055532_1000040 | |||
| 881 | Ga0055525_1000014 | |||
| 882 | Ga0055525_1000161 | |||
| 883 | Ga0055525_1000412 | |||
| 884 | Ga0055527_1003918 | |||
| 885 | Ga0055535_1000029 | |||
| 886 | Ga0055542_1000896 | |||
| 887 | Ga0055542_1017797 | |||
| 888 | Ga0055529_1000055 | |||
| 889 | Ga0055529_1000358 | |||
| 890 | Ga0055526_1000392 | |||
| 891 | Ga0055537_1000099 | |||
| 892 | Ga0055524_1000106 | |||
| 893 | Ga0055524_1000720 | |||
| 894 | Ga0055524_1003256 | |||
| 895 | Ga0055536_1025590 | |||
| 896 | Ga0055536_1051273 | |||
| 897 | Ga0055534_1000023 | |||
| 898 | Ga0055528_1000030 | |||
| 899 | Ga0055530_10001128 | |||
| 900 | Ga0055530_10057085 | |||
| 901 | Ga0055540_1000110 | |||
| 902 | Ga0055540_1023871 | |||
| 903 | Ga0055540_1043757 | |||
| 904 | Ga0055531_10006208 | |||
| 905 | Ga0055531_10012991 | |||
| 906 | Ga0055531_10014883 | |||
| 907 | Ga0055541_1000006 | |||
| 908 | Ga0055541_1000930 | |||
| 909 | Ga0055541_1011058 | |||
| 910 | Ga0055541_1026099 | |||
| 911 | Ga0058692_1000113 | |||
| 912 | Ga0058692_1000602 | |||
| 913 | Ga0058692_1000693 | |||
| 914 | Ga0058692_1004633 | |||
| 915 | Ga0058692_1006711 | |||
| 916 | Ga0058692_1035184 | |||
| 917 | Ga0065165_1000087 | |||
| 918 | Ga0065704_10000330 | |||
| 919 | Ga0065704_10000780 | |||
| 920 | Ga0065704_10000959 | |||
| 921 | Ga0065704_10002644 | |||
| 922 | Ga0065704_10004459 | |||
| 923 | Ga0065704_10075146 | |||
| 924 | Ga0065704_10235622 | |||
| 925 | Ga0065704_10488540 | |||
| 926 | Ga0070658_10044744 | |||
| 927 | Ga0070658_10906998 | |||
| 928 | Ga0070658_11624685 | |||
| 929 | Ga0070676_10115665 | |||
| 930 | Ga0070683_100369963 | |||
| 931 | Ga0070670_100605951 | |||
| 932 | Ga0070677_10032659 | |||
| 933 | Ga0070666_10006517 | |||
| 934 | Ga0070682_100079964 | |||
| 935 | Ga0068868_100142618 | |||
| 936 | Ga0070661_100000037 | |||
| 937 | Ga0070661_100301568 | |||
| 938 | Ga0070668_100192959 | |||
| 939 | Ga0070675_100039642 | |||
| 940 | Ga0070674_100027072 | |||
| 941 | Ga0070673_100083429 | |||
| 942 | Ga0070688_100838368 | |||
| 943 | Ga0070659_100048378 | |||
| 944 | Ga0070667_100282219 | |||
| 945 | Ga0070667_101888182 | |||
| 946 | Ga0070663_100000001 | |||
| 947 | Ga0070663_100076870 | |||
| 948 | Ga0070678_100001501 | |||
| 949 | Ga0070662_100684936 | |||
| 950 | Ga0068867_100125519 | |||
| 951 | Ga0070699_100166688 | |||
| 952 | Ga0070672_100000254 | |||
| 953 | Ga0070665_100010108 | |||
| 954 | Ga0070665_101356378 | |||
| 955 | Ga0070664_100000006 | |||
| 956 | Ga0070664_100035207 | |||
| 957 | Ga0068857_100015730 | |||
| 958 | Ga0068857_100016805 | |||
| 959 | Ga0068854_100000048 | |||
| 960 | Ga0068854_101870349 | |||
| 961 | Ga0068856_100001024 | |||
| 962 | Ga0068852_100015788 | |||
| 963 | Ga0068860_100323014 | |||
| 964 | Ga0075364_10007807 | |||
| 965 | Ga0075364_10020788 | |||
| 966 | Ga0075364_10083933 | |||
| 967 | Ga0075369_10366777 | |||
| 968 | Ga0075366_10164832 | |||
| 969 | Ga0097621_100079914 | |||
| 970 | Ga0075370_10092920 | |||
| 971 | Ga0068871_100017779 | |||
| 972 | Ga0068865_100428289 | |||
| 973 | Ga0099823_1000188 | |||
| 974 | Ga0099823_1023592 | |||
| 975 | Ga0099823_1046333 | |||
| 976 | Ga0079104_1000021 | |||
| 977 | Ga0079104_1000030 | |||
| 978 | Ga0079104_1000074 | |||
| 979 | Ga0079104_1000233 | |||
| 980 | Ga0079104_1000304 | |||
| 981 | Ga0079104_1000379 | |||
| 982 | Ga0079104_1000614 | |||
| 983 | Ga0079104_1001907 | |||
| 984 | Ga0079104_1001912 | |||
| 985 | Ga0079104_1003263 | |||
| 986 | Ga0079104_1003310 | |||
| 987 | Ga0079104_1027699 | |||
| 988 | Ga0099826_10314074 | |||
| 989 | Ga0105251_10000116 | |||
| 990 | Ga0105251_10000391 | |||
| 991 | Ga0105251_10000402 | |||
| 992 | Ga0105251_10001684 | |||
| 993 | Ga0105251_10001933 | |||
| 994 | Ga0105251_10007995 | |||
| 995 | Ga0105251_10047940 | |||
| 996 | Ga0105251_10140078 | |||
| 997 | Ga0105251_10189782 | |||
| 998 | Ga0105251_10419148 | |||
| 999 | Ga0105244_10000014 | |||
| 1000 | Ga0105244_10000037 | |||
| 1001 | Ga0105244_10000441 | |||
| 1002 | Ga0105244_10001143 | |||
| 1003 | Ga0105244_10002103 | |||
| 1004 | Ga0105244_10003362 | |||
| 1005 | Ga0105244_10004018 | |||
| 1006 | Ga0105244_10004186 | |||
| 1007 | Ga0105244_10016508 | |||
| 1008 | Ga0105244_10039965 | |||
| 1009 | Ga0105244_10044840 | |||
| 1010 | Ga0105244_10180488 | |||
| 1011 | Ga0105244_10224961 | |||
| 1012 | Ga0105250_10000059 | |||
| 1013 | Ga0105250_10000095 | |||
| 1014 | Ga0105250_10000114 | |||
| 1015 | Ga0105250_10000314 | |||
| 1016 | Ga0105250_10001759 | |||
| 1017 | Ga0105250_10003658 | |||
| 1018 | Ga0105250_10007459 | |||
| 1019 | Ga0105250_10029457 | |||
| 1020 | Ga0105250_10056063 | |||
| 1021 | Ga0105250_10158913 | |||
| 1022 | Ga0105250_10166296 | |||
| 1023 | Ga0105250_10371351 | |||
| 1024 | Ga0105240_10065701 | |||
| 1025 | Ga0105240_11229364 | |||
| 1026 | Ga0105243_10092171 | |||
| 1027 | Ga0105243_10390862 | |||
| 1028 | Ga0105242_11770245 | |||
| 1029 | Ga0105248_10371889 | |||
| 1030 | Ga0105248_11417259 | |||
| 1031 | Ga0105035_102206 | |||
| 1032 | Ga0157319_1000004 | |||
| 1033 | Ga0157373_10027127 | |||
| 1034 | Ga0157373_10705675 | |||
| 1035 | Ga0157371_10000080 | |||
| 1036 | Ga0157371_10004407 | |||
| 1037 | Ga0157371_10010046 | |||
| 1038 | Ga0157371_10027367 | |||
| 1039 | Ga0157370_10000032 | |||
| 1040 | Ga0157370_10013528 | |||
| 1041 | Ga0157370_11337536 | |||
| 1042 | Ga0157369_10004887 | |||
| 1043 | Ga0157369_10012746 | |||
| 1044 | Ga0157374_10001918 | |||
| 1045 | Ga0157378_10002043 | |||
| 1046 | Ga0163162_10202467 | |||
| 1047 | Ga0163162_11279187 | |||
| 1048 | Ga0157372_10000235 | |||
| 1049 | Ga0157372_10042246 | |||
| 1050 | Ga0157372_11150297 | |||
| 1051 | Ga0157375_10228889 | |||
| 1052 | Ga0182008_10020234 | |||
| 1053 | Ga0157379_11779471 | |||
| 1054 | Ga0182006_1000051 | |||
| 1055 | Ga0182006_1008993 | |||
| 1056 | Ga0182006_1101162 | |||
| 1057 | Ga0182006_1161344 | |||
| 1058 | Ga0182007_10013207 | |||
| 1059 | Ga0183366_1001 | |||
| 1060 | Ga0183370_1001 | |||
| 1061 | Ga0183369_1001 | |||
| 1062 | Ga0183368_1001 | |||
| 1063 | Ga0183361_15589 | |||
| 1064 | Ga0163161_10039031 | |||
| 1065 | Ga0163161_10043096 | |||
| 1066 | Ga0163161_10154321 | |||
| 1067 | Ga0206351_10514496 | |||
| 1068 | Ga0154015_1601999 | |||
| 1069 | Ga0213872_10000007 | |||
| 1070 | Ga0213872_10000101 | |||
| 1071 | Ga0213872_10000114 | |||
| 1072 | Ga0213872_10023478 | |||
| 1073 | Ga0213872_10036776 | |||
| 1074 | Ga0213872_10045189 | |||
| 1075 | Ga0213872_10083600 | |||
| 1076 | Ga0213876_10000069 | |||
| 1077 | Ga0209760_100051 | |||
| 1078 | Ga0209784_100001 | |||
| 1079 | Ga0209784_100006 | |||
| 1080 | Ga0209784_100177 | |||
| 1081 | Ga0209784_100373 | |||
| 1082 | Ga0209784_104707 | |||
| 1083 | Ga0209566_100001 | |||
| 1084 | Ga0209566_100002 | |||
| 1085 | Ga0209566_100615 | |||
| 1086 | Ga0209566_102391 | |||
| 1087 | Ga0209674_100002 | |||
| 1088 | Ga0209674_100010 | |||
| 1089 | Ga0209674_100060 | |||
| 1090 | Ga0209674_100076 | |||
| 1091 | Ga0209674_111246 | |||
| 1092 | Ga0209674_115881 | |||
| 1093 | Ga0209672_100231 | |||
| 1094 | Ga0209147_100018 | |||
| 1095 | Ga0209563_100002 | |||
| 1096 | Ga0209563_100041 | |||
| 1097 | Ga0209563_100088 | |||
| 1098 | Ga0209563_109598 | |||
| 1099 | Ga0209563_112646 | |||
| 1100 | Ga0209563_128624 | |||
| 1101 | Ga0207427_100020 | |||
| 1102 | Ga0209437_100001 | |||
| 1103 | Ga0209258_100028 | |||
| 1104 | Ga0207425_1000851 | |||
| 1105 | Ga0207425_1007356 | |||
| 1106 | Ga0209646_1000043 | |||
| 1107 | Ga0209026_1008003 | |||
| 1108 | Ga0209677_100002 | |||
| 1109 | Ga0209677_100007 | |||
| 1110 | Ga0209148_1000265 | |||
| 1111 | Ga0209148_1003982 | |||
| 1112 | Ga0209759_1001678 | |||
| 1113 | Ga0209759_1006235 | |||
| 1114 | Ga0209759_1007283 | |||
| 1115 | Ga0209759_1025248 | |||
| 1116 | Ga0209129_1000004 | |||
| 1117 | Ga0209129_1000095 | |||
| 1118 | Ga0209565_1000003 | |||
| 1119 | Ga0209565_1013066 | |||
| 1120 | Ga0209565_1065433 | |||
| 1121 | Ga0209455_1000065 | |||
| 1122 | Ga0209673_1000003 | |||
| 1123 | Ga0209675_1000003 | |||
| 1124 | Ga0209675_1033427 | |||
| 1125 | Ga0209676_1004975 | |||
| 1126 | Ga0209676_1021713 | |||
| 1127 | Ga0209564_1000012 | |||
| 1128 | Ga0209564_1000062 | |||
| 1129 | Ga0209758_1000072 | |||
| 1130 | Ga0209758_1000121 | |||
| 1131 | Ga0209050_1000596 | |||
| 1132 | Ga0209050_1008139 | |||
| 1133 | Ga0209256_1000225 | |||
| 1134 | Ga0209256_1000235 | |||
| 1135 | Ga0209256_1000570 | |||
| 1136 | Ga0209051_1000148 | |||
| 1137 | Ga0209257_1000380 | |||
| 1138 | Ga0209257_1000973 | |||
| 1139 | Ga0209257_1144702 | |||
| 1140 | Ga0207696_1000005 | |||
| 1141 | Ga0207696_1000024 | |||
| 1142 | Ga0207696_1000038 | |||
| 1143 | Ga0207696_1000088 | |||
| 1144 | Ga0207696_1000876 | |||
| 1145 | Ga0207696_1001588 | |||
| 1146 | Ga0207696_1003787 | |||
| 1147 | Ga0207696_1009538 | |||
| 1148 | Ga0207696_1011547 | |||
| 1149 | Ga0207696_1022646 | |||
| 1150 | Ga0207696_1047875 | |||
| 1151 | Ga0207655_1000001 | |||
| 1152 | Ga0207655_1000009 | |||
| 1153 | Ga0207655_1000063 | |||
| 1154 | Ga0207655_1000117 | |||
| 1155 | Ga0207655_1000247 | |||
| 1156 | Ga0207655_1000413 | |||
| 1157 | Ga0207655_1007341 | |||
| 1158 | Ga0207655_1011857 | |||
| 1159 | Ga0207655_1037020 | |||
| 1160 | Ga0207655_1039934 | |||
| 1161 | Ga0207655_1073796 | |||
| 1162 | Ga0207655_1153162 | |||
| 1163 | Ga0207655_1240663 | |||
| 1164 | Ga0207713_1000002 | |||
| 1165 | Ga0207713_1000003 | |||
| 1166 | Ga0207713_1000029 | |||
| 1167 | Ga0207713_1001125 | |||
| 1168 | Ga0207713_1001486 | |||
| 1169 | Ga0207713_1001919 | |||
| 1170 | Ga0207713_1003804 | |||
| 1171 | Ga0207713_1040624 | |||
| 1172 | Ga0207713_1059498 | |||
| 1173 | Ga0207713_1073884 | |||
| 1174 | Ga0207713_1098300 | |||
| 1175 | Ga0207680_10017223 | |||
| 1176 | Ga0207645_10120582 | |||
| 1177 | Ga0207705_10904618 | |||
| 1178 | Ga0207705_11174230 | |||
| 1179 | Ga0207684_10923533 | |||
| 1180 | Ga0207695_10001905 | |||
| 1181 | Ga0207649_10000622 | |||
| 1182 | Ga0207649_10255087 | |||
| 1183 | Ga0207650_10499866 | |||
| 1184 | Ga0207659_10069391 | |||
| 1185 | Ga0207644_10046235 | |||
| 1186 | Ga0207706_10693556 | |||
| 1187 | Ga0207686_10622463 | |||
| 1188 | Ga0207709_10238524 | |||
| 1189 | Ga0207709_10279130 | |||
| 1190 | Ga0207669_10057947 | |||
| 1191 | Ga0207704_10590550 | |||
| 1192 | Ga0207691_10000218 | |||
| 1193 | Ga0207711_10803426 | |||
| 1194 | Ga0207679_10000012 | |||
| 1195 | Ga0207679_11238541 | |||
| 1196 | Ga0207651_10055698 | |||
| 1197 | Ga0207640_10000055 | |||
| 1198 | Ga0207658_10226035 | |||
| 1199 | Ga0207658_11601086 | |||
| 1200 | Ga0207677_10110953 | |||
| 1201 | Ga0207678_10000243 | |||
| 1202 | Ga0207678_10105618 | |||
| 1203 | Ga0207702_10000028 | |||
| 1204 | Ga0207674_10012817 | |||
| 1205 | Ga0207674_10093516 | |||
| 1206 | Ga0207675_102443981 | |||
| 1207 | Ga0207683_10001508 | |||
| 1208 | Ga0207698_10014504 | |||
| 1209 | Ga0209281_1000001 | |||
| 1210 | Ga0209281_1000004 | |||
| 1211 | Ga0209281_1000006 | |||
| 1212 | Ga0209281_1000012 | |||
| 1213 | Ga0209281_1000024 | |||
| 1214 | Ga0209281_1000066 | |||
| 1215 | Ga0209281_1000076 | |||
| 1216 | Ga0209281_1000078 | |||
| 1217 | Ga0209281_1000143 | |||
| 1218 | Ga0209281_1000441 | |||
| 1219 | Ga0209281_1000495 | |||
| 1220 | Ga0209281_1001539 | |||
| 1221 | Ga0209281_1001686 | |||
| 1222 | Ga0209389_1000002 | |||
| 1223 | Ga0209389_1062744 | |||
| 1224 | Ga0209371_1000001 | |||
| 1225 | Ga0209371_1000002 | |||
| 1226 | Ga0209371_1000060 | |||
| 1227 | Ga0209371_1000409 | |||
| 1228 | Ga0209371_1000461 | |||
| 1229 | Ga0209371_1002127 | |||
| 1230 | Ga0209371_1003406 | |||
| 1231 | Ga0209371_1010149 | |||
| 1232 | Ga0209371_1014177 | |||
| 1233 | Ga0209371_1016332 | |||
| 1234 | Ga0209371_1020821 | |||
| 1235 | Ga0209371_1021744 | |||
| 1236 | Ga0209371_1032234 | |||
| 1237 | Ga0209371_1046621 | |||
| 1238 | Ga0209981_1018028 | |||
| 1239 | Ga0209984_1027163 | |||
| 1240 | Ga0209982_1002637 | |||
| 1241 | Ga0209983_1002692 | |||
| 1242 | Ga0209971_1001469 | |||
| 1243 | Ga0268266_10004753 | |||
| 1244 | Ga0268266_10325382 | |||
| 1245 | Ga0265318_10094615 | |||
| 1246 | Ga0268256_1000001 | |||
| 1247 | Ga0268256_1000002 | |||
| 1248 | Ga0268256_1000084 | |||
| 1249 | Ga0268256_1000204 | |||
| 1250 | Ga0268256_1000350 | |||
| 1251 | Ga0268256_1001863 | |||
| 1252 | Ga0268256_1003174 | |||
| 1253 | Ga0268256_1005705 | |||
| 1254 | Ga0268256_1008045 | |||
| 1255 | Ga0268256_1013096 | |||
| 1256 | Ga0268256_1015719 | |||
| 1257 | Ga0268256_1018151 | |||
| 1258 | Ga0268256_1023345 | |||
| 1259 | Ga0268256_1036660 | |||
| 1260 | Ga0268256_1052522 | |||
| 1261 | Ga0265327_10000082 | |||
| 1262 | Ga0265327_10019345 | |||
| 1263 | Ga0307408_100000132 | |||
| 1264 | Ga0307408_100054074 | |||
| 1265 | Ga0307408_100592827 | |||
| 1266 | Ga0307514_10001593 | |||
| 1267 | Ga0316576_10029059 | |||
| 1268 | Ga0316578_10009605 | |||
| 1269 | Ga0307405_10200390 | |||
| 1270 | Ga0307406_10021259 | |||
| 1271 | Ga0373937_1707707 | |||
| 1272 | Ga0395899_0347015 | |||
| 1273 | Ga0395900_0005028 | |||
| 1274 | Ga0395900_1002697 | |||
| 1275 | Ga0395905_0211363 | |||
| 1276 | Ga0436365_0368505 | |||
| 1277 | Ga0436361_0163583 | |||
| 1278 | Ga0436361_0213400 | |||
| 1279 | Ga0436361_0383736 | |||
| 1280 | Ga0436361_0470793 | |||
| 1281 | Ga0436361_0900730 | |||
| 1282 | Ga0436361_0947981 | |||
| 1283 | Ga0436361_1016242 | |||
| 1284 | Ga0436361_1029236 | |||
| 1285 | Ga0436361_1157107 | |||
| 1286 | Ga0439438_038487 | |||
| 1287 | Ga0451791_0647974 | |||
| 1288 | Ga0451807_0601058 | |||
| 1289 | Ga0451837_0103931 | |||
| 1290 | Ga0451853_0649462 | |||
| 1291 | Ga0451853_1040831 | |||
| 1292 | Ga0439432_002855 | |||
| 1293 | Ga0439432_066336 | |||
| 1294 | Ga0439452_000002 | |||
| 1295 | Ga0439452_000014 | |||
| 1296 | Ga0439452_000016 | |||
| 1297 | Ga0439452_000175 | |||
| 1298 | Ga0450890_003582 | |||
| 1299 | Ga0450900_002594 | |||
| 1300 | Ga0450900_015129 | |||
| 1301 | Ga0450902_045051 | |||
| 1302 | Ga0439459_0001664 | |||
| 1303 | Ga0439464_0106781 | |||
| 1304 | Ga0451577_0012119 | |||
| 1305 | Ga0466986_0012345 | |||
| 1306 | Ga0466969_0026952 | |||
| 1307 | Ga0466969_0440708 | |||
| 1308 | Ga0466969_0465759 | |||
| 1309 | Ga0466972_0004818 | |||
| 1310 | Ga0466981_0000010 | |||
| 1311 | Ga0466978_0027080 | |||
| 1312 | Ga0466982_0006994 | |||
| 1313 | Ga0453683_0760638 | |||
| 1314 | Ga0466965_0008065 | |||
| 1315 | Ga0466965_0070097 | |||
| 1316 | Ga0466966_0045072 | |||
| 1317 | Ga0466966_0114479 | |||
| 1318 | Ga0466961_0000995 | |||
| 1319 | Ga0466961_0005576 | |||
| 1320 | Ga0466963_0109955 | |||
| 1321 | Ga0466963_0274098 | |||
| 1322 | Ga0466964_0025662 | |||
| 1323 | Ga0466964_0096091 | |||
| 1324 | Ga0453684_0763665 | |||
| 1325 | Ga0466971_0010314 | |||
| 1326 | Ga0466970_0003254 | |||
| 1327 | Ga0466957_0044066 | |||
| 1328 | Ga0466960_0018919 | |||
| 1329 | Ga0466959_0007774 | |||
| 1330 | Ga0466959_0055576 | |||
| 1331 | Ga0451576_0005011 | |||
| 1332 | Ga0466958_1009096 | |||
| 1333 | Ga0466967_0076032 | |||
| 1334 | Ga0466967_0086004 | |||
| 1335 | Ga0495591_020952 | |||
| 1336 | Ga0495638_0021272 | |||
| 1337 | Ga0495651_0137910 | |||
| 1338 | Ga0495653_0637304 | |||
| 1339 | Ga0495650_0000005 | |||
| 1340 | Ga0495650_0000043 | |||
| 1341 | Ga0495650_0008788 | |||
| 1342 | Ga0495650_0071835 | |||
| 1343 | Ga0495582_0219873 | |||
| 1344 | Ga0495616_0312196 | |||
| 1345 | Ga0495620_0214757 | |||
| 1346 | Ga0495628_0810451 | |||
| 1347 | Ga0495637_0088113 | |||
| 1348 | Ga0495648_0148793 | |||
| 1349 | Ga0495642_0123996 | |||
| 1350 | Ga0495654_0000223 | |||
| 1351 | Ga0495654_0040481 | |||
| 1352 | Ga0495654_0397735 | |||
| 1353 | Ga0495609_0237918 | |||
| 1354 | Ga0495597_0000632 | |||
| 1355 | Ga0495597_0005786 | |||
| 1356 | Ga0495645_0707312 | |||
| 1357 | Ga0495625_0000662 | |||
| 1358 | Ga0495588_0037160 | |||
| 1359 | Ga0495623_0302316 | |||
| 1360 | Ga0495624_0508079 | |||
| 1361 | Ga0495649_0001472 | |||
| 1362 | Ga0495649_0040716 | |||
| 1363 | Ga0495660_0000012 | |||
| 1364 | Ga0495672_0000034 | |||
| 1365 | Ga0495672_0000036 | |||
| 1366 | Ga0495680_0547774 | |||
| 1367 | Ga0495675_0037724 | |||
| 1368 | Ga0495675_0138223 | |||
| 1369 | Ga0495675_0323718 | |||
| 1370 | Ga0495679_029788 | |||
| 1371 | Ga0495679_039542 | |||
| 1372 | Ga0495679_056463 | |||
| 1373 | Ga0495679_171935 | |||
| 1374 | Ga0495673_0000007 | |||
| 1375 | Ga0495684_0194989 | |||
| 1376 | Ga0496100_0014438 | |||
| 1377 | Ga0496100_0041571 | |||
| 1378 | Ga0496100_0680463 | |||
| 1379 | Ga0496101_0303289 | |||
| 1380 | Ga0496101_1335683 | |||
| 1381 | Ga0496104_0000043 | |||
| 1382 | Ga0496104_0001633 | |||
| 1383 | Ga0496104_0011028 | |||
| 1384 | Ga0496104_0039938 | |||
| 1385 | Ga0496104_0233549 | |||
| 1386 | Ga0496104_1313605 | |||
| 1387 | Ga0496105_0008843 | |||
| 1388 | Ga0496105_0902545 | |||
| 1389 | Ga0496107_1042305 | |||
| 1390 | Ga0496108_0236379 | |||
| 1391 | Ga0496108_0408826 | |||
| 1392 | Ga0496109_0086533 | |||
| 1393 | Ga0496109_0120028 | |||
| 1394 | Ga0496109_0417172 | |||
| 1395 | Ga0496110_0081513 | |||
| 1396 | Ga0496110_0095437 | |||
| 1397 | Ga0496110_0230681 | |||
| 1398 | Ga0496111_0157304 | |||
| 1399 | Ga0496113_0471996 | |||
| 1400 | Ga0496114_0004699 | |||
| 1401 | Ga0496114_0174075 | |||
| 1402 | Ga0496114_0896757 | |||
| 1403 | Ga0496115_0440301 | |||
| 1404 | Ga0496116_0000066 | |||
| 1405 | Ga0496116_0000870 | |||
| 1406 | Ga0496116_0006527 | |||
| 1407 | Ga0496116_0077663 | |||
| 1408 | Ga0496116_0094773 | |||
| 1409 | Ga0496117_0000020 | |||
| 1410 | Ga0496117_0001276 | |||
| 1411 | Ga0496117_0003356 | |||
| 1412 | Ga0496117_0003520 | |||
| 1413 | Ga0496117_0008312 | |||
| 1414 | Ga0496117_0010307 | |||
| 1415 | Ga0496117_0014895 | |||
| 1416 | Ga0496117_0023798 | |||
| 1417 | Ga0496117_0106419 | |||
| 1418 | Ga0496118_0000015 | |||
| 1419 | Ga0496118_0001324 | |||
| 1420 | Ga0496118_0001862 | |||
| 1421 | Ga0496118_0004771 | |||
| 1422 | Ga0496118_0013175 | |||
| 1423 | Ga0496118_0024247 | |||
| 1424 | Ga0496118_0024879 | |||
| 1425 | Ga0496118_0294103 | |||
| 1426 | Ga0496119_0000001 | |||
| 1427 | Ga0496119_0000157 | |||
| 1428 | Ga0496119_0000230 | |||
| 1429 | Ga0496119_0001866 | |||
| 1430 | Ga0496119_0012016 | |||
| 1431 | Ga0496119_0016595 | |||
| 1432 | Ga0496119_0018063 | |||
| 1433 | Ga0496120_0000237 | |||
| 1434 | Ga0496120_0000324 | |||
| 1435 | Ga0496120_0004284 | |||
| 1436 | Ga0496120_0013419 | |||
| 1437 | Ga0496120_0015493 | |||
| 1438 | Ga0496120_0052113 | |||
| 1439 | Ga0496121_0000160 | |||
| 1440 | Ga0496121_0000415 | |||
| 1441 | Ga0496121_0001137 | |||
| 1442 | Ga0496121_0001182 | |||
| 1443 | Ga0496121_0001228 | |||
| 1444 | Ga0496121_0001573 | |||
| 1445 | Ga0496121_0010366 | |||
| 1446 | Ga0496121_0015722 | |||
| 1447 | Ga0496121_0136003 | |||
| 1448 | Ga0496121_0169499 | |||
| 1449 | Ga0496122_0000110 | |||
| 1450 | Ga0496122_0000265 | |||
| 1451 | Ga0496122_0002210 | |||
| 1452 | Ga0496122_0003353 | |||
| 1453 | Ga0496122_0013774 | |||
| 1454 | Ga0496122_0014483 | |||
| 1455 | Ga0496122_0018211 | |||
| 1456 | Ga0496122_0029788 | |||
| 1457 | Ga0496122_0030520 | |||
| 1458 | Ga0496122_0048913 | |||
| 1459 | Ga0496122_0069357 | |||
| 1460 | Ga0496122_0071347 | |||
| 1461 | Ga0496122_0137985 | |||
| 1462 | Ga0496122_0264419 | |||
| 1463 | Ga0496122_0383982 | |||
| 1464 | Ga0496122_0464532 | |||
| 1465 | Ga0496123_0000014 | |||
| 1466 | Ga0496123_0000081 | |||
| 1467 | Ga0496123_0000836 | |||
| 1468 | Ga0496123_0002902 | |||
| 1469 | Ga0496123_0004375 | |||
| 1470 | Ga0496123_0009244 | |||
| 1471 | Ga0496123_0018392 | |||
| 1472 | Ga0496123_0020602 | |||
| 1473 | Ga0496123_0022982 | |||
| 1474 | Ga0496123_0072065 | |||
| 1475 | Ga0496123_0125578 | |||
| 1476 | Ga0496123_0155295 | |||
| 1477 | Ga0496123_0156102 | |||
| 1478 | Ga0496123_0208454 | |||
| 1479 | Ga0496123_0507797 | |||
| 1480 | Ga0496124_0000425 | |||
| 1481 | Ga0496124_0000530 | |||
| 1482 | Ga0496124_0002230 | |||
| 1483 | Ga0496124_0007334 | |||
| 1484 | Ga0496124_0007785 | |||
| 1485 | Ga0496124_0020587 | |||
| 1486 | Ga0496124_0022612 | |||
| 1487 | Ga0496124_0038214 | |||
| 1488 | Ga0496124_0046466 | |||
| 1489 | Ga0496124_0052569 | |||
| 1490 | Ga0496124_0064702 | |||
| 1491 | Ga0496124_0386554 | |||
| 1492 | Ga0496124_0857130 | |||
| 1493 | Ga0496125_0000009 | |||
| 1494 | Ga0496125_0000033 | |||
| 1495 | Ga0496125_0000081 | |||
| 1496 | Ga0496125_0000485 | |||
| 1497 | Ga0496125_0000500 | |||
| 1498 | Ga0496125_0001753 | |||
| 1499 | Ga0496125_0011561 | |||
| 1500 | Ga0496125_0012612 | |||
| 1501 | Ga0496125_0021460 | |||
| 1502 | Ga0496125_0031255 | |||
| 1503 | Ga0496125_0158093 | |||
| 1504 | Ga0496125_0299173 | |||
| 1505 | Ga0496126_0000125 | |||
| 1506 | Ga0496126_0000142 | |||
| 1507 | Ga0496126_0001066 | |||
| 1508 | Ga0496126_0011764 | |||
| 1509 | Ga0496126_0015085 | |||
| 1510 | Ga0496126_0070970 | |||
| 1511 | Ga0496126_0072656 | |||
| 1512 | Ga0496126_0123048 | |||
| 1513 | Ga0496126_0271622 | |||
| 1514 | Ga0496126_0353454 | |||
| 1515 | Ga0496126_0544862 | |||
| 1516 | Ga0496126_0595563 | |||
| 1517 | Ga0496126_0615915 | |||
| 1518 | Ga0496126_1078239 | |||
| 1519 | Ga0496126_1199688 | |||
| 1520 | Ga0496126_1320864 | |||
| 1521 | Ga0495682_0326167 | |||
| 1522 | Ga0501043_0000010 | |||
| 1523 | Ga0501046_0000097 | |||
| 1524 | Ga0501046_0221889 | |||
| 1525 | Ga0501047_0000026 | |||
| 1526 | Ga0501048_0001099 | |||
| 1527 | Ga0501209_284628 | |||
| 1528 | Ga0501241_020201 | |||
| 1529 | Ga0501035_1034296 | |||
| 1530 | Ga0501044_0248561 | |||
| 1531 | Ga0501044_0349284 | |||
| 1532 | Ga0501044_0471667 | |||
| 1533 | Ga0501044_0508542 | |||
| 1534 | Ga0501044_1065913 | |||
| 1535 | Ga0501045_0014425 | |||
| 1536 | nmdc:mga00v17_265436_c1 | |||
| 1537 | nmdc:mga00v17_461224_c1 | |||
| 1538 | nmdc:mga0k408_61882_c1 | |||
| 1539 | nmdc:mga07m45_51893_c1 | |||
| 1540 | Ga0495655_0240109 | |||
| 1541 | Ga0500651_0000354 | |||
| 1542 | Ga0500651_0024668 | |||
| 1543 | Ga0500607_061665 | |||
| 1544 | Ga0500618_000007 | |||
| 1545 | Ga0500559_0555969 | |||
| 1546 | Ga0500564_373155 | |||
| 1547 | Ga0500573_0005353 | |||
| 1548 | Ga0500627_0187982 | |||
| 1549 | Ga0500634_0000356 | |||
| 1550 | Ga0500636_0000081 | |||
| 1551 | Ga0466962_0004792 | |||
| 1552 | 2511168992 | |||
| 1553 | 2547695908 | |||
| 1554 | 2554816430 | |||
| 1555 | 2555245629 | |||
| 1556 | 2555258054 | |||
| 1557 | 2562462593 | |||
| 1558 | 2585829481 | |||
| 1559 | 2585834846 | |||
| 1560 | 2585994865 | |||
| 1561 | 2585999405 | |||
| 1562 | 2597029415 | |||
| 1563 | 2599409108 | |||
| 1564 | 2599447353 | |||
| 1565 | 2601522385 | |||
| 1566 | 2601527411 | |||
| 1567 | 2601532831 | |||
| 1568 | 2601538201 | |||
| 1569 | 2601614241 | |||
| 1570 | 2601618963 | |||
| 1571 | 2601642433 | |||
| 1572 | 2601647280 | |||
| 1573 | 2601652389 | |||
| 1574 | 2601657716 | |||
| 1575 | 2601662254 | |||
| 1576 | 2601695211 | |||
| 1577 | 2601699886 | |||
| 1578 | 2601705513 | |||
| 1579 | 2601710541 | |||
| 1580 | 2601715554 | |||
| 1581 | 2601720238 | |||
| 1582 | 2601725959 | |||
| 1583 | 2601730502 | |||
| 1584 | 2601735518 | |||
| 1585 | 2601740216 | |||
| 1586 | 2601750705 | |||
| 1587 | 2601756143 | |||
| 1588 | 2601763376 | |||
| 1589 | 2602017958 | |||
| 1590 | 2603637710 | |||
| 1591 | 2603642386 | |||
| 1592 | 2603659622 | |||
| 1593 | 2603664898 | |||
| 1594 | 2603698501 | |||
| 1595 | 2603702990 | |||
| 1596 | 2603837891 | |||
| 1597 | 2603842968 | |||
| 1598 | 2603848042 | |||
| 1599 | 2603853113 | |||
| 1600 | 2603865354 | |||
| 1601 | 2603867052 | |||
| 1602 | 2603871167 | |||
| 1603 | 2603876081 | |||
| 1604 | 2606048360 | |||
| 1605 | 2606069325 | |||
| 1606 | 2606145134 | |||
| 1607 | 2606175762 | |||
| 1608 | 2608382643 | |||
| 1609 | 2609912340 | |||
| 1610 | 2637225013 | |||
| 1611 | 2671102900 | |||
| 1612 | 2671109924 | |||
| 1613 | 2671584691 | |||
| 1614 | 2671585732 | |||
| 1615 | 2676406250 | |||
| 1616 | 2681997314 | |||
| 1617 | 2682005384 | |||
| 1618 | 2712469905 | |||
| 1619 | 2753855983 | |||
| 1620 | 2765585998 | |||
| 1621 | 2765588954 | |||
| 1622 | 2775539003 | |||
| 1623 | 2777023346 | |||
| 1624 | 2792313126 | |||
| 1625 | 2793405463 | |||
| 1626 | 2813728748 | |||
| 1627 | 2814696271 | |||
| 1628 | 2821119814 | |||
| 1629 | 2821124004 | |||
| 1630 | 2823374746 | |||
| 1631 | 2838738966 | |||
| 1632 | 2841842864 | |||
| 1633 | 2842142645 | |||
| 1634 | 2842738580 | |||
| 1635 | 2844427526 | |||
| 1636 | 2846036374 | |||
| 1637 | 2846038211 | |||
| 1638 | 2854921761 | |||
| 1639 | 2857531566 | |||
| 1640 | 2884088657 | |||
| 1641 | 2885268772 | |||
| 1642 | 2886851554 | |||
| 1643 | 2891670887 | |||
| 1644 | 2891674600 | |||
| 1645 | 2894024787 | |||
| 1646 | 2894414380 | |||
| 1647 | 2904477244 | |||
| 1648 | 2904514100 | |||
| 1649 | 2919109296 | |||
| 1650 | 2919153411 | |||
| 1651 | 2919171691 | |||
| 1652 | 2923527106 | |||
| 1653 | 2923634854 | |||
| 1654 | 2927144037 | |||
| 1655 | 2927834093 | |||
| 1656 | 2928060728 | |||
| 1657 | 2935626556 | |||
| 1658 | 2937541662 | |||
| 1659 | 2939569129 | |||
| 1660 | 2939573546 | |||
| 1661 | 2939576248 | |||
| 1662 | 2939611108 | |||
| 1663 | 2939621223 | |||
| 1664 | 2939643825 | |||
| 1665 | 2945877820 | |||
| 1666 | 2969082003 | |||
| 1667 | 2971823855 | |||
| 1668 | 2974312120 | |||
| 1669 | 2974438534 | |||
| 1670 | 2984564437 | |||
| 1671 | 2984597169 | |||
| 1672 | 2998347102 | |||
| 1673 | 3000379194 | |||
| 1674 | 8001524877 | |||
| 1675 | 8018223433 | |||
| 1676 | 8018407783 | |||
| 1677 | 8018408533 | |||
| 1678 | 8019507928 | |||
| 1679 | 8021623370 | |||
| 1680 | 8021626697 | |||
| 1681 | 8021650654 | |||
| 1682 | 8052495434 | |||
| 1683 | 8054845875 | |||
| 1684 | 8054853210 | |||
| 1685 | 8054932789 | |||
| 1686 | 8055089298 | |||
| 1687 | 8055092646 | |||
| 1688 | 8055098949 | |||
| 1689 | 8055695692 | |||
| 1690 | 8057309361 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8enk-assembly1.cif.gz_E | crystal structure of uap56 in complex with tho1, the yeast homolog of human sarnp | 0.9763 | 14 | 50 |
| 6ahx-assembly1.cif.gz_A-2 | copper-sensing operon regulator protein (csorgz) | 0.9563 | 9 | 63 |
| 6y07-assembly1.cif.gz_A | designing a granulopoietic protein by topological rescaffolding 1: sohair | 0.9347 | 6 | 59 |
| 8cwy-assembly1.cif.gz_B | accurate computational design of genetically encoded 3d protein crystals | 0.9274 | 6 | 60 |
| 5lcy-assembly1.cif.gz_C | formaldehyde-responsive regulator frmr e64h variant from salmonella enterica serovar typhimurium | 0.9257 | 2 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cqzA01 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;RNA polymerase II, clamp domain | 0.9618 | 12 | 51 | 4.10.860.120 |
| 5lcyB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer | 0.9261 | 2 | 89 | 1.20.58.1000 |
| 5lcyA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer | 0.9258 | 2 | 89 | 1.20.58.1000 |
| 5lcyC00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer | 0.9257 | 2 | 89 | 1.20.58.1000 |
| 5lcyD00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer | 0.9255 | 2 | 89 | 1.20.58.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1XHB0-F1-model_v4 | deleted | 0.9764 | 1 | 91 |
|
| AF-A0A6D0EJ32-F1-model_v4 | deleted | 0.9753 | 1 | 77 |
|
| AF-A0A3N1PEW1-F1-model_v4 | DNA-binding FrmR family transcriptional regulator | 0.9736 | 4 | 89 |
GO:0003677
GO:0045892 GO:0046872 |
| AF-A0A0G0AWL3-F1-model_v4 | Copper-sensing transcriptional repressor CsoR | 0.9711 | 2 | 61 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
| AF-A0A4R0DHJ8-F1-model_v4 | Metal/formaldehyde-sensitive transcriptional repressor | 0.9693 | 1 | 91 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |