F483316

General Info

Members Datasets Scaffolds Average Seq Length
847 337 841 337

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100010138|Ga0068868_1000101384
Length 385
Sequence MTMHVGVGESASRPISRFRHGFAACAGCCEPRRSSLAFSATGVPATKKAPKGKSDTGRQNGAAAAKPHRIDVHHHIVPPRYVTDMGLKWVNRHNAPLPLHGPLQWTPEQSIAEMDRNGVATAITSLSDPGVWSGDVARSRSVARYCNDYAAQLARDYPGRFGVFASLAPPDIEGSLREIEYAFDVLGADGIVLMTSYGDRWPGDAAFAPVFDELNRRKAVVYFHPTAAPCCEGLIPDVADAVVEFLFDTVRAVTSLLYSGTLSRCSDIRYIFSHAGSAVPLLAGRISRLARITEAVNPRLPNGAMHELKRLYYDVAQQASPEGLVPLMTLVSADQVLFGSDYPWAPPGMMAQTVAGLAAFGFQPDELQAIERGNALRLFPRFAQP

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
327 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0
Rhizoplane 6.26
Rhizosphere 86.78
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001600 3300003215 Bacteria 13420
2 JGI25153J46596_10003919 3300003215 Bacteria 8164
3 Ga0065715_10007812 3300005293 Unclassified 2592
4 Ga0070658_10031050 3300005327 Bacteria 4290
5 Ga0070676_10006719 3300005328 Bacteria 6163
6 Ga0070683_100005567 3300005329 Bacteria 10516
7 Ga0070683_100251336 3300005329 Bacteria 1681
8 Ga0070690_100035776 3300005330 Bacteria 3118
9 Ga0070690_100148028 3300005330 Bacteria 1599
10 Ga0070670_100000360 3300005331 Bacteria 38098
11 Ga0070670_100004292 3300005331 Bacteria 11933
12 Ga0070670_100008155 3300005331 Bacteria 8918
13 Ga0068869_100022698 3300005334 Bacteria 4327
14 Ga0068869_100155068 3300005334 Unclassified 1779
15 Ga0070666_10003141 3300005335 Bacteria 10030
16 Ga0070680_100001073 3300005336 Bacteria 19625
17 Ga0070680_100001601 3300005336 Bacteria 16529
18 Ga0070680_100013675 3300005336 Bacteria 6327
19 Ga0070680_100084397 3300005336 Bacteria 2623
20 Ga0070680_100089716 3300005336 Bacteria 2544
21 Ga0070680_100121819 3300005336 Bacteria 2178
22 Ga0070680_100153483 3300005336 Bacteria 1934
23 Ga0070680_100240301 3300005336 Bacteria 1531
24 Ga0068868_100001821 3300005338 Bacteria 14654
25 Ga0068868_100009212 3300005338 Bacteria 7094
26 Ga0068868_100010138 3300005338 Bacteria 6809
27 Ga0070660_100004998 3300005339 Bacteria 9169
28 Ga0070660_100237426 3300005339 Unclassified 1484
29 Ga0070689_100008822 3300005340 Bacteria 7121
30 Ga0070689_100070073 3300005340 Bacteria 2736
31 Ga0070689_100241615 3300005340 Bacteria 1487
32 Ga0070691_10046989 3300005341 Unclassified 2052
33 Ga0070687_100020116 3300005343 Bacteria 3116
34 Ga0070687_100023314 3300005343 Unclassified 2941
35 Ga0070661_100000772 3300005344 Bacteria 23116
36 Ga0070661_100036427 3300005344 Bacteria 3576
37 Ga0070661_100049114 3300005344 Bacteria 3089
38 Ga0070661_100425122 3300005344 Bacteria 1054
39 Ga0070692_10022678 3300005345 Bacteria 3069
40 Ga0070668_100090479 3300005347 Bacteria 2411
41 Ga0070668_100133205 3300005347 Unclassified 1996
42 Ga0070668_100187874 3300005347 Bacteria 1691
43 Ga0070675_100039312 3300005354 Bacteria 3860
44 Ga0070675_100201549 3300005354 Unclassified 1727
45 Ga0070671_100001024 3300005355 Bacteria 20538
46 Ga0070671_100010061 3300005355 Bacteria 7596
47 Ga0070671_100054636 3300005355 Bacteria 3321
48 Ga0070671_100057104 3300005355 Bacteria 3247
49 Ga0070674_100061668 3300005356 Bacteria 2618
50 Ga0070674_100093025 3300005356 Bacteria 2181
51 Ga0070673_100000234 3300005364 Bacteria 27814
52 Ga0070673_100123210 3300005364 Bacteria 2166
53 Ga0070673_100129972 3300005364 Bacteria 2112
54 Ga0070673_100167049 3300005364 Bacteria 1876
55 Ga0070688_100061740 3300005365 Bacteria 2370
56 Ga0070688_100102529 3300005365 Bacteria 1889
57 Ga0070688_100118618 3300005365 Bacteria 1769
58 Ga0070688_100226817 3300005365 Bacteria 1319
59 Ga0070659_100092341 3300005366 Bacteria 2427
60 Ga0070659_100138977 3300005366 Bacteria 1977
61 Ga0070667_100014038 3300005367 Bacteria 6621
62 Ga0070667_100014411 3300005367 Bacteria 6533
63 Ga0070667_100211413 3300005367 Unclassified 1724
64 Ga0070709_10014066 3300005434 Bacteria 4517
65 Ga0070714_100001344 3300005435 Bacteria 17780
66 Ga0070714_100020981 3300005435 Bacteria 5341
67 Ga0070714_100035257 3300005435 Bacteria 4193
68 Ga0070713_100001547 3300005436 Bacteria 14707
69 Ga0070713_100065329 3300005436 Bacteria 3056
70 Ga0070713_100068666 3300005436 Bacteria 2987
71 Ga0070713_100194615 3300005436 Bacteria 1828
72 Ga0070701_10053981 3300005438 Unclassified 2094
73 Ga0070711_100335680 3300005439 Bacteria 1211
74 Ga0070700_100155415 3300005441 Bacteria 1569
75 Ga0070694_100023040 3300005444 Bacteria 3998
76 Ga0070694_100070229 3300005444 Bacteria 2411
77 Ga0070663_100008942 3300005455 Bacteria 6186
78 Ga0070678_100000029 3300005456 Bacteria 45879
79 Ga0070678_100047842 3300005456 Bacteria 3076
80 Ga0070678_100531369 3300005456 Bacteria 1042
81 Ga0070662_100069230 3300005457 Unclassified 2596
82 Ga0070681_10001127 3300005458 Bacteria 22938
83 Ga0070681_10003861 3300005458 Bacteria 14104
84 Ga0070681_10010586 3300005458 Bacteria 9111
85 Ga0070681_10013126 3300005458 Bacteria 8229
86 Ga0070681_10027003 3300005458 Bacteria 5772
87 Ga0070681_10047532 3300005458 Unclassified 4290
88 Ga0070681_10085053 3300005458 Bacteria 3116
89 Ga0070681_10112684 3300005458 Bacteria 2660
90 Ga0070681_10125886 3300005458 Bacteria 2495
91 Ga0070681_10131109 3300005458 Bacteria 2439
92 Ga0070681_10420970 3300005458 Unclassified 1248
93 Ga0068867_100013424 3300005459 Bacteria 5803
94 Ga0068867_100014340 3300005459 Bacteria 5614
95 Ga0068867_100084333 3300005459 Bacteria 2400
96 Ga0068867_100091715 3300005459 Bacteria 2307
97 Ga0068867_100126649 3300005459 Bacteria 1980
98 Ga0068867_100188936 3300005459 Unclassified 1642
99 Ga0070685_10040207 3300005466 Unclassified 2660
100 Ga0070685_10060997 3300005466 Bacteria 2207
101 Ga0070699_100045216 3300005518 Bacteria 3811
102 Ga0070679_100000747 3300005530 Bacteria 28132
103 Ga0070679_100003445 3300005530 Bacteria 14489
104 Ga0070679_100012721 3300005530 Bacteria 8048
105 Ga0070679_100105672 3300005530 Bacteria 2801
106 Ga0070679_100119144 3300005530 Bacteria 2624
107 Ga0070679_100126401 3300005530 Bacteria 2539
108 Ga0070679_100132597 3300005530 Bacteria 2472
109 Ga0070679_100135881 3300005530 Bacteria 2440
110 Ga0070679_100167854 3300005530 Bacteria 2168
111 Ga0070679_100182842 3300005530 Bacteria 2068
112 Ga0070684_100041950 3300005535 Unclassified 3948
113 Ga0070684_100045575 3300005535 Bacteria 3797
114 Ga0070684_100075718 3300005535 Unclassified 2969
115 Ga0070684_100098494 3300005535 Bacteria 2608
116 Ga0070684_100306894 3300005535 Unclassified 1457
117 Ga0070684_100554897 3300005535 Bacteria 1066
118 Ga0068853_100070760 3300005539 Unclassified 3037
119 Ga0068853_100080699 3300005539 Bacteria 2847
120 Ga0070672_100000952 3300005543 Bacteria 17440
121 Ga0070672_100024538 3300005543 Bacteria 4459
122 Ga0070672_100030395 3300005543 Bacteria 4057
123 Ga0070672_100063647 3300005543 Unclassified 2913
124 Ga0070695_100283595 3300005545 Bacteria 1218
125 Ga0070696_100116697 3300005546 Bacteria 1928
126 Ga0070665_100080630 3300005548 Unclassified 3260
127 Ga0070665_100143329 3300005548 Unclassified 2392
128 Ga0070704_100004501 3300005549 Bacteria 8048
129 Ga0068855_100004131 3300005563 Bacteria 17708
130 Ga0068855_100056524 3300005563 Bacteria 4604
131 Ga0068855_100082843 3300005563 Bacteria 3717
132 Ga0068855_100160584 3300005563 Bacteria 2551
133 Ga0068855_100222282 3300005563 Bacteria 2117
134 Ga0070664_100001531 3300005564 Bacteria 18459
135 Ga0070664_100008176 3300005564 Bacteria 8456
136 Ga0070664_100008202 3300005564 Bacteria 8448
137 Ga0070664_100085893 3300005564 Bacteria 2718
138 Ga0070664_100093464 3300005564 Unclassified 2606
139 Ga0070664_100117409 3300005564 Unclassified 2327
140 Ga0068857_100002292 3300005577 Bacteria 15564
141 Ga0068857_100003096 3300005577 Bacteria 13761
142 Ga0068857_100028101 3300005577 Bacteria 4961
143 Ga0068857_100039051 3300005577 Unclassified 4204
144 Ga0068857_100040629 3300005577 Bacteria 4125
145 Ga0068857_100172853 3300005577 Bacteria 1964
146 Ga0068857_100359503 3300005577 Unclassified 1349
147 Ga0068854_100000507 3300005578 Bacteria 23751
148 Ga0068854_100104443 3300005578 Bacteria 2128
149 Ga0068856_100005189 3300005614 Bacteria 12860
150 Ga0068856_100045474 3300005614 Bacteria 4323
151 Ga0068856_100140700 3300005614 Unclassified 2420
152 Ga0068856_100294430 3300005614 Unclassified 1640
153 Ga0068856_100398118 3300005614 Bacteria 1397
154 Ga0068852_100000304 3300005616 Bacteria 33142
155 Ga0068852_100001579 3300005616 Bacteria 15484
156 Ga0068852_100024490 3300005616 Bacteria 4879
157 Ga0068859_100008832 3300005617 Bacteria 10175
158 Ga0068859_100083699 3300005617 Bacteria 3234
159 Ga0068859_100093499 3300005617 Bacteria 3058
160 Ga0068859_100121663 3300005617 Bacteria 2677
161 Ga0068859_100380404 3300005617 Unclassified 1507
162 Ga0068864_100008517 3300005618 Bacteria 8461
163 Ga0068864_100013302 3300005618 Bacteria 6815
164 Ga0068864_100159953 3300005618 Unclassified 2047
165 Ga0068864_100282554 3300005618 Bacteria 1549
166 Ga0068866_10012323 3300005718 Bacteria 3724
167 Ga0068866_10091640 3300005718 Unclassified 1656
168 Ga0068861_100010480 3300005719 Bacteria 6433
169 Ga0068851_10003179 3300005834 Bacteria 7280
170 Ga0068851_10015788 3300005834 Bacteria 3604
171 Ga0068870_10016862 3300005840 Bacteria 3501
172 Ga0068870_10028970 3300005840 Bacteria 2785
173 Ga0068863_100016598 3300005841 Bacteria 7066
174 Ga0068863_100020579 3300005841 Bacteria 6306
175 Ga0068863_100118268 3300005841 Bacteria 2526
176 Ga0068863_100129941 3300005841 Bacteria 2404
177 Ga0068863_100441823 3300005841 Bacteria 1276
178 Ga0068863_100553194 3300005841 Unclassified 1136
179 Ga0068858_100011311 3300005842 Bacteria 8431
180 Ga0068858_100015894 3300005842 Bacteria 7073
181 Ga0068858_100106780 3300005842 Bacteria 2613
182 Ga0068858_100165648 3300005842 Bacteria 2083
183 Ga0068858_100266687 3300005842 Bacteria 1629
184 Ga0068860_100012074 3300005843 Bacteria 8505
185 Ga0068860_100042971 3300005843 Bacteria 4313
186 Ga0068860_100044476 3300005843 Bacteria 4232
187 Ga0068860_100240848 3300005843 Unclassified 1759
188 Ga0068860_100286267 3300005843 Bacteria 1611
189 Ga0068860_100534885 3300005843 Bacteria 1173
190 Ga0068862_100004017 3300005844 Bacteria 12473
191 Ga0068862_100043818 3300005844 Bacteria 3815
192 Ga0081539_10015961 3300005985 Bacteria 5409
193 Ga0075365_10028321 3300006038 Bacteria 3573
194 Ga0075365_10029767 3300006038 Bacteria 3493
195 Ga0075365_10067402 3300006038 Bacteria 2403
196 Ga0075365_10131461 3300006038 Bacteria 1732
197 Ga0075368_10012864 3300006042 Bacteria 3064
198 Ga0075363_100007008 3300006048 Bacteria 5153
199 Ga0075363_100008158 3300006048 Bacteria 4862
200 Ga0075363_100023423 3300006048 Bacteria 3129
201 Ga0075364_10013177 3300006051 Bacteria 5075
202 Ga0075364_10151058 3300006051 Bacteria 1565
203 Ga0075364_10247121 3300006051 Bacteria 1212
204 Ga0070715_10039124 3300006163 Unclassified 1973
205 Ga0070716_100056741 3300006173 Bacteria 2247
206 Ga0070712_100018454 3300006175 Bacteria 4532
207 Ga0070712_100192442 3300006175 Bacteria 1597
208 Ga0075362_10001351 3300006177 Bacteria 7761
209 Ga0075362_10086549 3300006177 Bacteria 1450
210 Ga0075367_10058435 3300006178 Bacteria 2295
211 Ga0075367_10156001 3300006178 Unclassified 1418
212 Ga0075366_10002637 3300006195 Bacteria 9235
213 Ga0075366_10044936 3300006195 Bacteria 2618
214 Ga0097621_100001892 3300006237 Bacteria 14292
215 Ga0097621_100010583 3300006237 Bacteria 6756
216 Ga0097621_100065103 3300006237 Bacteria 2999
217 Ga0097621_100197938 3300006237 Unclassified 1743
218 Ga0075370_10004386 3300006353 Bacteria 6843
219 Ga0075370_10034735 3300006353 Unclassified 2827
220 Ga0068871_100000178 3300006358 Bacteria 43025
221 Ga0068871_100004850 3300006358 Bacteria 9399
222 Ga0068871_100008039 3300006358 Bacteria 7571
223 Ga0068871_100044859 3300006358 Bacteria 3556
224 Ga0068871_100048242 3300006358 Bacteria 3437
225 Ga0068871_100264253 3300006358 Unclassified 1502
226 Ga0075428_100134776 3300006844 Bacteria 2686
227 Ga0075430_100001709 3300006846 Bacteria 17898
228 Ga0075431_100036195 3300006847 Bacteria 5084
229 Ga0075431_100322754 3300006847 Bacteria 1557
230 Ga0075433_10076716 3300006852 Bacteria 2943
231 Ga0075433_10112496 3300006852 Bacteria 2415
232 Ga0075433_10351968 3300006852 Bacteria 1302
233 Ga0075434_100025232 3300006871 Bacteria 5816
234 Ga0075434_100046742 3300006871 Bacteria 4295
235 Ga0075434_100101966 3300006871 Bacteria 2877
236 Ga0075429_100112864 3300006880 Bacteria 2375
237 Ga0075429_100202630 3300006880 Unclassified 1739
238 Ga0068865_100059948 3300006881 Bacteria 2663
239 Ga0068865_100089042 3300006881 Bacteria 2234
240 Ga0097620_100008832 3300006931 Bacteria 10175
241 Ga0097620_100083695 3300006931 Bacteria 3234
242 Ga0097620_100093498 3300006931 Bacteria 3058
243 Ga0097620_100121665 3300006931 Bacteria 2677
244 Ga0097620_100380398 3300006931 Unclassified 1507
245 Ga0075435_100041209 3300007076 Bacteria 3691
246 Ga0075435_100069115 3300007076 Bacteria 2879
247 Ga0105240_10003088 3300009093 Bacteria 26186
248 Ga0105240_10008709 3300009093 Bacteria 14473
249 Ga0105240_10009948 3300009093 Bacteria 13407
250 Ga0105240_10022713 3300009093 Bacteria 8310
251 Ga0105240_10048700 3300009093 Bacteria 5354
252 Ga0105240_10064259 3300009093 Bacteria 4561
253 Ga0105240_10067874 3300009093 Bacteria 4419
254 Ga0105240_10297110 3300009093 Bacteria 1849
255 Ga0105240_10719551 3300009093 Unclassified 1088
256 Ga0111539_10000966 3300009094 Bacteria 37738
257 Ga0111539_10002463 3300009094 Bacteria 24585
258 Ga0111539_10024789 3300009094 Bacteria 7357
259 Ga0111539_10038682 3300009094 Bacteria 5756
260 Ga0111539_10103464 3300009094 Bacteria 3342
261 Ga0111539_10332176 3300009094 Unclassified 1769
262 Ga0105245_10000873 3300009098 Bacteria 27322
263 Ga0105245_10004551 3300009098 Bacteria 12237
264 Ga0105245_10008605 3300009098 Bacteria 8903
265 Ga0105245_10044451 3300009098 Bacteria 3964
266 Ga0105245_10048198 3300009098 Bacteria 3811
267 Ga0105247_10006463 3300009101 Bacteria 7259
268 Ga0105247_10028032 3300009101 Bacteria 3406
269 Ga0105247_10172965 3300009101 Bacteria 1437
270 Ga0114129_10047462 3300009147 Bacteria 6033
271 Ga0114129_10048772 3300009147 Bacteria 5952
272 Ga0114129_10093819 3300009147 Bacteria 4157
273 Ga0114129_10107522 3300009147 Bacteria 3852
274 Ga0114129_10203432 3300009147 Bacteria 2680
275 Ga0114129_10451088 3300009147 Unclassified 1687
276 Ga0105243_10033245 3300009148 Bacteria 3988
277 Ga0105243_10057455 3300009148 Bacteria 3098
278 Ga0105243_10121583 3300009148 Bacteria 2202
279 Ga0105241_10016750 3300009174 Bacteria 5378
280 Ga0105241_10025688 3300009174 Bacteria 4378
281 Ga0105241_10118040 3300009174 Bacteria 2132
282 Ga0105241_10205732 3300009174 Bacteria 1647
283 Ga0105242_10001175 3300009176 Bacteria 20607
284 Ga0105242_10017298 3300009176 Bacteria 5615
285 Ga0105242_10027010 3300009176 Bacteria 4553
286 Ga0105242_10033080 3300009176 Bacteria 4138
287 Ga0105242_10098912 3300009176 Bacteria 2468
288 Ga0105242_10147209 3300009176 Unclassified 2050
289 Ga0105242_10227682 3300009176 Unclassified 1669
290 Ga0105248_10001047 3300009177 Bacteria 30629
291 Ga0105248_10009284 3300009177 Bacteria 10829
292 Ga0105248_10012888 3300009177 Bacteria 9219
293 Ga0105248_10024707 3300009177 Bacteria 6682
294 Ga0105248_10150427 3300009177 Unclassified 2626
295 Ga0105248_10178959 3300009177 Unclassified 2390
296 Ga0105237_10012575 3300009545 Bacteria 8915
297 Ga0105237_10017735 3300009545 Bacteria 7380
298 Ga0105237_10105768 3300009545 Bacteria 2805
299 Ga0105237_10263944 3300009545 Bacteria 1725
300 Ga0105238_10008593 3300009551 Bacteria 10218
301 Ga0105238_10015546 3300009551 Bacteria 7706
302 Ga0105238_10057321 3300009551 Bacteria 3906
303 Ga0105249_10022737 3300009553 Bacteria 5619
304 Ga0105249_10197939 3300009553 Bacteria 1965
305 Ga0105239_10027842 3300010375 Bacteria 6218
306 Ga0105239_10053275 3300010375 Unclassified 4438
307 Ga0105239_10389467 3300010375 Bacteria 1576
308 Ga0157373_10019856 3300013100 Bacteria 4888
309 Ga0157370_10013826 3300013104 Bacteria 8291
310 Ga0157370_10014113 3300013104 Bacteria 8194
311 Ga0157370_10046152 3300013104 Bacteria 4177
312 Ga0157370_10108970 3300013104 Bacteria 2589
313 Ga0157370_10136615 3300013104 Bacteria 2285
314 Ga0157369_10002769 3300013105 Bacteria 20942
315 Ga0157369_10010521 3300013105 Bacteria 10531
316 Ga0157369_10020431 3300013105 Bacteria 7402
317 Ga0157369_10075019 3300013105 Bacteria 3626
318 Ga0157369_10136917 3300013105 Bacteria 2592
319 Ga0157369_10315166 3300013105 Bacteria 1626
320 Ga0157369_10479294 3300013105 Bacteria 1288
321 Ga0157374_10006530 3300013296 Bacteria 9904
322 Ga0157374_10043040 3300013296 Bacteria 4169
323 Ga0157374_10142908 3300013296 Unclassified 2323
324 Ga0157374_10179311 3300013296 Bacteria 2069
325 Ga0157378_10000669 3300013297 Bacteria 32263
326 Ga0157378_10070930 3300013297 Bacteria 3128
327 Ga0157378_10114911 3300013297 Unclassified 2473
328 Ga0163162_10007098 3300013306 Bacteria 10872
329 Ga0163162_10058159 3300013306 Unclassified 3895
330 Ga0163162_10076918 3300013306 Bacteria 3400
331 Ga0163162_10311329 3300013306 Bacteria 1707
332 Ga0157372_10007514 3300013307 Bacteria 11592
333 Ga0157372_10170372 3300013307 Bacteria 2519
334 Ga0157372_10245451 3300013307 Bacteria 2078
335 Ga0157372_10343095 3300013307 Bacteria 1740
336 Ga0157372_10459096 3300013307 Bacteria 1485
337 Ga0157372_10487366 3300013307 Bacteria 1437
338 Ga0157375_10019135 3300013308 Bacteria 6220
339 Ga0157375_10139469 3300013308 Unclassified 2550
340 Ga0157375_10140829 3300013308 Unclassified 2539
341 Ga0157375_10244923 3300013308 Unclassified 1953
342 Ga0163163_10018204 3300014325 Bacteria 6570
343 Ga0163163_10020236 3300014325 Bacteria 6264
344 Ga0163163_10060723 3300014325 Bacteria 3744
345 Ga0163163_10165626 3300014325 Unclassified 2256
346 Ga0157380_10005881 3300014326 Bacteria 8581
347 Ga0157380_10382003 3300014326 Bacteria 1329
348 Ga0182008_10035495 3300014497 Bacteria 2497
349 Ga0157377_10030701 3300014745 Bacteria 2913
350 Ga0157379_10016182 3300014968 Bacteria 6562
351 Ga0157379_10023564 3300014968 Bacteria 5463
352 Ga0157379_10030492 3300014968 Unclassified 4801
353 Ga0157376_10071446 3300014969 Unclassified 2950
354 Ga0157376_10100530 3300014969 Unclassified 2525
355 Ga0157376_10138791 3300014969 Unclassified 2178
356 Ga0209758_1005734 3300025297 Bacteria 9358
357 Ga0207697_10066972 3300025315 Unclassified 1501
358 Ga0207656_10042183 3300025321 Bacteria 1940
359 Ga0207682_10035721 3300025893 Bacteria 2008
360 Ga0207710_10006028 3300025900 Bacteria 5195
361 Ga0207688_10000663 3300025901 Bacteria 16993
362 Ga0207688_10200083 3300025901 Bacteria 1197
363 Ga0207680_10001550 3300025903 Bacteria 10828
364 Ga0207680_10009786 3300025903 Bacteria 4770
365 Ga0207647_10029447 3300025904 Bacteria 3554
366 Ga0207699_10112757 3300025906 Unclassified 1745
367 Ga0207699_10262773 3300025906 Bacteria 1194
368 Ga0207645_10031160 3300025907 Bacteria 3433
369 Ga0207645_10059680 3300025907 Bacteria 2436
370 Ga0207645_10082106 3300025907 Bacteria 2066
371 Ga0207645_10290694 3300025907 Bacteria 1087
372 Ga0207643_10000808 3300025908 Bacteria 19021
373 Ga0207643_10029129 3300025908 Bacteria 3071
374 Ga0207705_10056046 3300025909 Unclassified 2841
375 Ga0207654_10084100 3300025911 Bacteria 1923
376 Ga0207707_10001661 3300025912 Bacteria 20543
377 Ga0207707_10013041 3300025912 Bacteria 7238
378 Ga0207707_10021068 3300025912 Bacteria 5696
379 Ga0207707_10029072 3300025912 Bacteria 4830
380 Ga0207707_10038987 3300025912 Bacteria 4153
381 Ga0207707_10076906 3300025912 Bacteria 2913
382 Ga0207707_10104809 3300025912 Unclassified 2471
383 Ga0207707_10112399 3300025912 Bacteria 2381
384 Ga0207707_10162473 3300025912 Bacteria 1953
385 Ga0207707_10170460 3300025912 Unclassified 1902
386 Ga0207695_10030460 3300025913 Bacteria 5938
387 Ga0207695_10045477 3300025913 Bacteria 4659
388 Ga0207695_10073689 3300025913 Bacteria 3478
389 Ga0207695_10377743 3300025913 Bacteria 1303
390 Ga0207671_10035879 3300025914 Bacteria 3676
391 Ga0207693_10011631 3300025915 Bacteria 7121
392 Ga0207663_10040483 3300025916 Bacteria 2833
393 Ga0207663_10250140 3300025916 Bacteria 1304
394 Ga0207660_10000876 3300025917 Bacteria 19858
395 Ga0207660_10017996 3300025917 Bacteria 4706
396 Ga0207660_10252796 3300025917 Bacteria 1391
397 Ga0207660_10277032 3300025917 Bacteria 1330
398 Ga0207660_10310820 3300025917 Bacteria 1257
399 Ga0207662_10026192 3300025918 Bacteria 3362
400 Ga0207662_10114617 3300025918 Unclassified 1684
401 Ga0207657_10021585 3300025919 Bacteria 6055
402 Ga0207657_10026429 3300025919 Bacteria 5336
403 Ga0207657_10089547 3300025919 Bacteria 2570
404 Ga0207649_10001851 3300025920 Bacteria 12091
405 Ga0207649_10078376 3300025920 Bacteria 2132
406 Ga0207652_10003186 3300025921 Bacteria 13631
407 Ga0207652_10020148 3300025921 Bacteria 5491
408 Ga0207652_10035135 3300025921 Bacteria 4229
409 Ga0207652_10053056 3300025921 Bacteria 3482
410 Ga0207652_10088894 3300025921 Bacteria 2711
411 Ga0207681_10020177 3300025923 Bacteria 4220
412 Ga0207681_10025247 3300025923 Bacteria 3821
413 Ga0207694_10002315 3300025924 Bacteria 15573
414 Ga0207694_10003094 3300025924 Bacteria 13309
415 Ga0207694_10047761 3300025924 Bacteria 3311
416 Ga0207650_10001556 3300025925 Bacteria 16428
417 Ga0207650_10006782 3300025925 Bacteria 7808
418 Ga0207650_10076521 3300025925 Unclassified 2528
419 Ga0207659_10019877 3300025926 Bacteria 4429
420 Ga0207687_10003422 3300025927 Bacteria 10694
421 Ga0207687_10028032 3300025927 Bacteria 3782
422 Ga0207687_10055874 3300025927 Unclassified 2767
423 Ga0207687_10064734 3300025927 Unclassified 2594
424 Ga0207700_10000711 3300025928 Bacteria 19257
425 Ga0207700_10141430 3300025928 Unclassified 1978
426 Ga0207700_10243096 3300025928 Bacteria 1535
427 Ga0207664_10000996 3300025929 Bacteria 19036
428 Ga0207644_10138354 3300025931 Bacteria 1872
429 Ga0207690_10045660 3300025932 Bacteria 2896
430 Ga0207690_10265153 3300025932 Bacteria 1332
431 Ga0207690_10295464 3300025932 Bacteria 1266
432 Ga0207706_10007308 3300025933 Bacteria 10214
433 Ga0207706_10092504 3300025933 Bacteria 2659
434 Ga0207706_10178490 3300025933 Bacteria 1865
435 Ga0207686_10002714 3300025934 Bacteria 9602
436 Ga0207686_10012270 3300025934 Bacteria 4708
437 Ga0207686_10045010 3300025934 Bacteria 2713
438 Ga0207686_10116638 3300025934 Bacteria 1810
439 Ga0207686_10119173 3300025934 Bacteria 1793
440 Ga0207686_10161083 3300025934 Unclassified 1572
441 Ga0207709_10125083 3300025935 Bacteria 1742
442 Ga0207670_10001103 3300025936 Bacteria 14203
443 Ga0207670_10004513 3300025936 Bacteria 7503
444 Ga0207669_10010994 3300025937 Bacteria 4383
445 Ga0207669_10099697 3300025937 Bacteria 1916
446 Ga0207704_10178173 3300025938 Unclassified 1533
447 Ga0207691_10000487 3300025940 Bacteria 39347
448 Ga0207691_10007977 3300025940 Bacteria 10186
449 Ga0207691_10011566 3300025940 Bacteria 8473
450 Ga0207691_10095988 3300025940 Unclassified 2651
451 Ga0207691_10171199 3300025940 Bacteria 1902
452 Ga0207691_10226751 3300025940 Bacteria 1619
453 Ga0207711_10018915 3300025941 Bacteria 5729
454 Ga0207711_10034011 3300025941 Bacteria 4315
455 Ga0207711_10066338 3300025941 Unclassified 3121
456 Ga0207711_10114093 3300025941 Bacteria 2406
457 Ga0207711_10203539 3300025941 Unclassified 1807
458 Ga0207689_10033065 3300025942 Bacteria 4298
459 Ga0207689_10164215 3300025942 Unclassified 1830
460 Ga0207661_10000791 3300025944 Bacteria 20647
461 Ga0207679_10005265 3300025945 Bacteria 8108
462 Ga0207679_10005698 3300025945 Bacteria 7810
463 Ga0207679_10188185 3300025945 Unclassified 1714
464 Ga0207679_10383770 3300025945 Unclassified 1232
465 Ga0207667_10009675 3300025949 Bacteria 11339
466 Ga0207667_10044627 3300025949 Bacteria 4696
467 Ga0207667_10058405 3300025949 Unclassified 4046
468 Ga0207667_10136510 3300025949 Bacteria 2526
469 Ga0207667_10317198 3300025949 Bacteria 1592
470 Ga0207667_10335599 3300025949 Bacteria 1543
471 Ga0207651_10000522 3300025960 Bacteria 16155
472 Ga0207651_10083250 3300025960 Bacteria 2313
473 Ga0207712_10250665 3300025961 Bacteria 1431
474 Ga0207640_10000864 3300025981 Bacteria 17199
475 Ga0207658_10118664 3300025986 Unclassified 2105
476 Ga0207677_10000909 3300026023 Bacteria 16582
477 Ga0207677_10019201 3300026023 Bacteria 4123
478 Ga0207677_10054923 3300026023 Bacteria 2721
479 Ga0207677_10058062 3300026023 Bacteria 2662
480 Ga0207677_10081831 3300026023 Unclassified 2318
481 Ga0207703_10003230 3300026035 Bacteria 13705
482 Ga0207703_10005264 3300026035 Bacteria 10434
483 Ga0207703_10030728 3300026035 Unclassified 4244
484 Ga0207639_10179460 3300026041 Bacteria 1800
485 Ga0207678_10011629 3300026067 Bacteria 7731
486 Ga0207678_10087745 3300026067 Bacteria 2658
487 Ga0207678_10209985 3300026067 Bacteria 1665
488 Ga0207708_10017098 3300026075 Bacteria 5459
489 Ga0207708_10160293 3300026075 Bacteria 1776
490 Ga0207702_10005560 3300026078 Bacteria 11008
491 Ga0207702_10306829 3300026078 Unclassified 1508
492 Ga0207641_10038856 3300026088 Bacteria 3980
493 Ga0207641_10069108 3300026088 Bacteria 3031
494 Ga0207641_10158636 3300026088 Unclassified 2055
495 Ga0207641_10179724 3300026088 Unclassified 1937
496 Ga0207641_10295741 3300026088 Bacteria 1528
497 Ga0207641_10381836 3300026088 Bacteria 1349
498 Ga0207648_10013950 3300026089 Bacteria 7449
499 Ga0207648_10018557 3300026089 Bacteria 6295
500 Ga0207648_10021939 3300026089 Bacteria 5737
501 Ga0207648_10041396 3300026089 Bacteria 4045
502 Ga0207648_10070878 3300026089 Bacteria 3038
503 Ga0207648_10114088 3300026089 Bacteria 2374
504 Ga0207676_10008300 3300026095 Bacteria 7382
505 Ga0207676_10290116 3300026095 Bacteria 1489
506 Ga0207674_10004206 3300026116 Bacteria 17371
507 Ga0207674_10004223 3300026116 Bacteria 17334
508 Ga0207674_10023513 3300026116 Bacteria 6599
509 Ga0207674_10037457 3300026116 Bacteria 5044
510 Ga0207674_10037894 3300026116 Bacteria 5009
511 Ga0207674_10040678 3300026116 Bacteria 4814
512 Ga0207674_10102958 3300026116 Unclassified 2835
513 Ga0207675_100002040 3300026118 Bacteria 20146
514 Ga0207675_100121015 3300026118 Bacteria 2476
515 Ga0207675_100151299 3300026118 Bacteria 2209
516 Ga0207683_10001359 3300026121 Bacteria 22123
517 Ga0207683_10002624 3300026121 Bacteria 15706
518 Ga0207683_10094760 3300026121 Bacteria 2661
519 Ga0207683_10165451 3300026121 Bacteria 2001
520 Ga0207683_10167454 3300026121 Bacteria 1989
521 Ga0207698_10003982 3300026142 Bacteria 8959
522 Ga0207698_10006663 3300026142 Bacteria 7220
523 Ga0207698_10078798 3300026142 Bacteria 2647
524 Ga0209813_10019704 3300027866 Bacteria 1878
525 Ga0207428_10013971 3300027907 Bacteria 6993
526 Ga0207428_10185877 3300027907 Bacteria 1568
527 Ga0268266_10082106 3300028379 Unclassified 2811
528 Ga0268266_10249683 3300028379 Bacteria 1641
529 Ga0268266_10254026 3300028379 Bacteria 1627
530 Ga0268266_10285439 3300028379 Unclassified 1536
531 Ga0268265_10003753 3300028380 Bacteria 10798
532 Ga0268265_10110274 3300028380 Bacteria 2245
533 Ga0268265_10170677 3300028380 Bacteria 1859
534 Ga0268264_10019097 3300028381 Bacteria 5604
535 Ga0268264_10024308 3300028381 Bacteria 4947
536 Ga0268264_10115629 3300028381 Bacteria 2357
537 Ga0268264_10242333 3300028381 Bacteria 1671
538 Ga0268264_10374045 3300028381 Bacteria 1363
539 Ga0265319_1000609 3300028563 Bacteria 23663
540 Ga0265319_1001589 3300028563 Bacteria 13285
541 Ga0265318_10000413 3300028577 Bacteria 33039
542 Ga0265318_10003429 3300028577 Bacteria 7963
543 Ga0265332_10021346 3300031238 Bacteria 2861
544 Ga0265328_10040237 3300031239 Unclassified 1723
545 Ga0265320_10000126 3300031240 Bacteria 66933
546 Ga0265325_10000300 3300031241 Bacteria 34777
547 Ga0265325_10039612 3300031241 Bacteria 2480
548 Ga0265325_10066760 3300031241 Bacteria 1813
549 Ga0265329_10002177 3300031242 Bacteria 9067
550 Ga0265329_10003421 3300031242 Bacteria 6919
551 Ga0265340_10006776 3300031247 Bacteria 6270
552 Ga0265340_10013459 3300031247 Bacteria 4295
553 Ga0265339_10021805 3300031249 Bacteria 3720
554 Ga0265339_10036466 3300031249 Bacteria 2752
555 Ga0265339_10077022 3300031249 Bacteria 1768
556 Ga0265331_10000025 3300031250 Bacteria 229346
557 Ga0265316_10002023 3300031344 Bacteria 21346
558 Ga0265316_10011066 3300031344 Bacteria 8173
559 Ga0307513_10163172 3300031456 Bacteria 2117
560 Ga0265313_10002717 3300031595 Bacteria 14978
561 Ga0265313_10005119 3300031595 Bacteria 9766
562 Ga0307508_10118987 3300031616 Bacteria 2243
563 Ga0265314_10002211 3300031711 Bacteria 20286
564 Ga0265314_10002925 3300031711 Bacteria 16946
565 Ga0265314_10006180 3300031711 Bacteria 10637
566 Ga0265314_10028254 3300031711 Bacteria 4184
567 Ga0265342_10002273 3300031712 Bacteria 16798
568 Ga0265342_10003553 3300031712 Bacteria 12759
569 Ga0307410_10001555 3300031852 Bacteria 10470
570 Ga0307409_100229207 3300031995 Bacteria 1683
571 Ga0307411_10029466 3300032005 Bacteria 3352
572 Ga0307411_10115651 3300032005 Bacteria 1930
573 Ga0307507_10021651 3300033179 Bacteria 7141
574 Ga0373958_0003514 3300034819 Bacteria 2264
575 Ga0373926_0003746 3300035083 Bacteria 4950
576 Ga0373923_0014926 3300035111 Unclassified 2925
577 Ga0373939_0045084 3300035114 Bacteria 1344
578 Ga0373943_0049954 3300035170 Bacteria 2054
579 Ga0373961_0021220 3300035241 Bacteria 1725
580 Ga0373931_0005266 3300035691 Bacteria 5965
581 Ga0373931_0028508 3300035691 Bacteria 2859
582 Ga0373935_0013406 3300035692 Bacteria 4945
583 Ga0373935_0095845 3300035692 Bacteria 1949
584 Ga0373927_0013237 3300035695 Bacteria 5485
585 Ga0373927_0029586 3300035695 Bacteria 3571
586 Ga0373933_0040617 3300035724 Unclassified 2742
587 Ga0373933_0129976 3300035724 Bacteria 1583
588 Ga0373933_0185573 3300035724 Bacteria 1327
589 Ga0373947_0081263 3300035725 Bacteria 2006
590 Ga0373947_0092281 3300035725 Bacteria 1891
591 Ga0373937_0001624 3300036401 Bacteria 18901
592 Ga0373937_0012218 3300036401 Bacteria 7540
593 Ga0373937_0020394 3300036401 Bacteria 5944
594 Ga0373937_0025752 3300036401 Bacteria 5312
595 Ga0373937_0109331 3300036401 Bacteria 2570
596 Ga0373937_0151708 3300036401 Bacteria 2171
597 Ga0373937_0499211 3300036401 Unclassified 1156
598 Ga0373925_0005806 3300037068 Bacteria 9168
599 Ga0373925_0049808 3300037068 Bacteria 3123
600 Ga0373925_0156901 3300037068 Bacteria 1790
601 Ga0395899_0087951 3300037312 Bacteria 2254
602 Ga0395900_0002747 3300037418 Bacteria 19217
603 Ga0395900_0254251 3300037418 Bacteria 1757
604 Ga0395898_0018984 3300037466 Bacteria 7002
605 Ga0395905_0220132 3300037471 Bacteria 1777
606 Ga0436364_1342640 3300037853 Bacteria 1997
607 Ga0395901_0056051 3300038443 Bacteria 4100
608 Ga0436361_0598168 3300039447 Bacteria 5635
609 Ga0436363_1081739 3300039450 Bacteria 2145
610 Ga0466958_0120408 3300045836 Bacteria 1643
611 Ga0466967_0331005 3300045976 Bacteria 1471
612 Ga0495627_009242 3300046453 Bacteria 3634
613 Ga0495592_0060067 3300046454 Bacteria 2797
614 Ga0495603_0116302 3300046455 Bacteria 1559
615 Ga0495603_0202319 3300046455 Bacteria 1148
616 Ga0495590_0060334 3300046457 Bacteria 1328
617 Ga0495651_0003700 3300046462 Bacteria 11717
618 Ga0495651_0017221 3300046462 Bacteria 5600
619 Ga0495653_0005354 3300046463 Bacteria 10443
620 Ga0495653_0022342 3300046463 Bacteria 5119
621 Ga0495580_0008302 3300046472 Bacteria 8264
622 Ga0495580_0151628 3300046472 Bacteria 1606
623 Ga0495582_0045692 3300046473 Bacteria 2412
624 Ga0495664_0021142 3300046477 Bacteria 3759
625 Ga0495664_0022622 3300046477 Bacteria 3646
626 Ga0495584_0232131 3300046491 Bacteria 938
627 Ga0495585_0072556 3300046492 Bacteria 1875
628 Ga0495608_0040750 3300046511 Bacteria 3111
629 Ga0495608_0051857 3300046511 Bacteria 2717
630 Ga0495616_0075573 3300046513 Unclassified 1621
631 Ga0495620_0036941 3300046515 Bacteria 2180
632 Ga0495628_0015347 3300046516 Bacteria 6397
633 Ga0495628_0251985 3300046516 Bacteria 1318
634 Ga0495630_0017063 3300046517 Bacteria 5314
635 Ga0495630_0105400 3300046517 Bacteria 2135
636 Ga0495630_0115118 3300046517 Bacteria 2038
637 Ga0495644_0021615 3300046523 Bacteria 2454
638 Ga0495652_0012012 3300046529 Bacteria 7827
639 Ga0495652_0038611 3300046529 Bacteria 4135
640 Ga0495665_0019038 3300046531 Unclassified 3690
641 Ga0495587_0006972 3300046536 Bacteria 7338
642 Ga0495587_0008300 3300046536 Bacteria 6687
643 Ga0495598_0047802 3300046537 Bacteria 1277
644 Ga0495621_0011285 3300046539 Unclassified 2759
645 Ga0495621_0048496 3300046539 Unclassified 1513
646 Ga0495645_0034846 3300046543 Bacteria 3670
647 Ga0495645_0065843 3300046543 Bacteria 2621
648 Ga0495622_0091214 3300046557 Bacteria 1400
649 Ga0495633_0079489 3300046558 Bacteria 1527
650 Ga0495633_0089526 3300046558 Unclassified 1431
651 Ga0495667_0001766 3300046559 Bacteria 14358
652 Ga0495667_0002726 3300046559 Bacteria 11798
653 Ga0495656_0021736 3300046615 Unclassified 2502
654 Ga0495656_0022552 3300046615 Unclassified 2467
655 Ga0495668_0132149 3300046616 Bacteria 1366
656 Ga0495625_0155211 3300046660 Bacteria 1536
657 Ga0495635_0009050 3300046663 Bacteria 6949
658 Ga0495635_0039202 3300046663 Bacteria 3278
659 Ga0495659_0034039 3300046664 Bacteria 1790
660 Ga0495661_0131790 3300046665 Unclassified 1369
661 Ga0495588_0096308 3300046674 Bacteria 1552
662 Ga0495657_0009531 3300046675 Bacteria 7356
663 Ga0495657_0029527 3300046675 Bacteria 3845
664 Ga0495599_0011681 3300046678 Bacteria 5399
665 Ga0495646_0007578 3300046680 Bacteria 6898
666 Ga0495658_0064913 3300046683 Bacteria 2105
667 Ga0495613_0010679 3300046689 Bacteria 6810
668 Ga0495613_0024298 3300046689 Bacteria 4514
669 Ga0495624_0007500 3300046690 Bacteria 7651
670 Ga0495624_0047148 3300046690 Bacteria 2738
671 Ga0495624_0172749 3300046690 Unclassified 1318
672 Ga0495670_0013224 3300046691 Bacteria 4060
673 Ga0495670_0040088 3300046691 Bacteria 2336
674 Ga0495671_0016342 3300046692 Bacteria 3963
675 Ga0495589_0038877 3300046794 Bacteria 2380
676 Ga0495589_0051868 3300046794 Unclassified 2027
677 Ga0495600_0001469 3300046809 Bacteria 13065
678 Ga0495600_0014002 3300046809 Bacteria 5054
679 Ga0495604_0001664 3300047317 Bacteria 18292
680 Ga0495604_0007416 3300047317 Bacteria 8687
681 Ga0495604_0018395 3300047317 Bacteria 5595
682 Ga0495604_0247359 3300047317 Bacteria 1217
683 Ga0495674_0029342 3300047319 Bacteria 5011
684 Ga0495674_0037720 3300047319 Bacteria 4342
685 Ga0495674_0053620 3300047319 Unclassified 3543
686 Ga0495674_0140076 3300047319 Bacteria 2034
687 Ga0495674_0309214 3300047319 Bacteria 1290
688 Ga0495680_0000648 3300047322 Bacteria 39027
689 Ga0495680_0020176 3300047322 Bacteria 5613
690 Ga0495675_0000643 3300047444 Bacteria 22174
691 Ga0495675_0026266 3300047444 Unclassified 3713
692 Ga0495675_0027252 3300047444 Bacteria 3641
693 Ga0495675_0168246 3300047444 Unclassified 1347
694 Ga0495684_0001017 3300047471 Bacteria 22849
695 Ga0495684_0002508 3300047471 Bacteria 14627
696 Ga0495684_0345533 3300047471 Unclassified 1058
697 Ga0495593_0007923 3300047673 Bacteria 6189
698 Ga0495602_0028473 3300048088 Bacteria 5345
699 Ga0495602_0096714 3300048088 Bacteria 2434
700 Ga0495602_0197203 3300048088 Unclassified 1539
701 Ga0496100_0042248 3300048903 Bacteria 2911
702 Ga0496100_0126255 3300048903 Bacteria 1796
703 Ga0496100_0189952 3300048903 Bacteria 1491
704 Ga0496100_0386280 3300048903 Bacteria 1064
705 Ga0496101_0044456 3300048904 Bacteria 3178
706 Ga0496101_0047499 3300048904 Bacteria 3082
707 Ga0496102_0202408 3300048905 Bacteria 1871
708 Ga0496102_0352009 3300048905 Bacteria 1387
709 Ga0496103_0009597 3300048906 Bacteria 5729
710 Ga0496104_0000629 3300048907 Bacteria 30223
711 Ga0496104_0034040 3300048907 Bacteria 4748
712 Ga0496105_0019396 3300048908 Bacteria 5485
713 Ga0496105_0019467 3300048908 Bacteria 5474
714 Ga0496105_0051517 3300048908 Bacteria 3401
715 Ga0496105_0055817 3300048908 Bacteria 3261
716 Ga0496105_0309860 3300048908 Bacteria 1268
717 Ga0496106_0061353 3300048909 Unclassified 2852
718 Ga0496106_0352882 3300048909 Bacteria 1181
719 Ga0496107_0015140 3300048910 Bacteria 5403
720 Ga0496108_0003956 3300048911 Bacteria 11902
721 Ga0496108_0008275 3300048911 Bacteria 8437
722 Ga0496108_0039962 3300048911 Bacteria 3909
723 Ga0496108_0065021 3300048911 Bacteria 3074
724 Ga0496109_0000766 3300048912 Bacteria 26715
725 Ga0496109_0017476 3300048912 Bacteria 6290
726 Ga0496109_0025633 3300048912 Bacteria 5255
727 Ga0496109_0061682 3300048912 Bacteria 3428
728 Ga0496109_0077486 3300048912 Bacteria 3059
729 Ga0496109_0161631 3300048912 Bacteria 2098
730 Ga0496109_0179131 3300048912 Bacteria 1990
731 Ga0496109_0292355 3300048912 Bacteria 1536
732 Ga0496110_0000354 3300048913 Bacteria 30708
733 Ga0496110_0002398 3300048913 Bacteria 14041
734 Ga0496110_0013610 3300048913 Bacteria 6734
735 Ga0496111_0011549 3300048914 Bacteria 5956
736 Ga0496111_0020931 3300048914 Bacteria 4560
737 Ga0496111_0164779 3300048914 Bacteria 1646
738 Ga0496111_0352688 3300048914 Bacteria 1089
739 Ga0496112_0001055 3300048915 Bacteria 20328
740 Ga0496112_0009411 3300048915 Bacteria 8801
741 Ga0496112_0031686 3300048915 Bacteria 5128
742 Ga0496112_0090177 3300048915 Bacteria 3035
743 Ga0496112_0467858 3300048915 Bacteria 1198
744 Ga0496113_0000323 3300048916 Bacteria 22774
745 Ga0496113_0022159 3300048916 Bacteria 4488
746 Ga0496113_0103915 3300048916 Bacteria 2204
747 Ga0496113_0207089 3300048916 Bacteria 1560
748 Ga0496114_0079340 3300048917 Bacteria 2770
749 Ga0496114_0199376 3300048917 Bacteria 1753
750 Ga0496115_0016209 3300048918 Bacteria 5670
751 Ga0496115_0019361 3300048918 Bacteria 5236
752 Ga0496115_0159256 3300048918 Bacteria 1865
753 Ga0496115_0433097 3300048918 Bacteria 1064
754 Ga0501032_0078449 3300049569 Bacteria 2198
755 Ga0501033_0012886 3300049570 Bacteria 6377
756 Ga0501033_0122020 3300049570 Bacteria 1890
757 Ga0501034_0018046 3300049571 Bacteria 7239
758 Ga0501034_0175476 3300049571 Bacteria 2109
759 Ga0501036_0004687 3300049572 Bacteria 11040
760 Ga0501037_0005982 3300049573 Bacteria 8887
761 Ga0501039_0001438 3300049575 Bacteria 17522
762 Ga0501042_0272635 3300049578 Bacteria 1222
763 Ga0501046_0010334 3300049580 Bacteria 8025
764 Ga0501047_0111201 3300049581 Bacteria 2622
765 Ga0501047_0135237 3300049581 Bacteria 2346
766 Ga0501047_0624976 3300049581 Bacteria 898
767 Ga0501048_0004490 3300049582 Bacteria 10621
768 Ga0501068_0011406 3300049584 Bacteria 5019
769 Ga0501069_0006487 3300049585 Bacteria 6116
770 Ga0501070_0014496 3300049586 Bacteria 6632
771 Ga0501070_0054165 3300049586 Bacteria 3326
772 Ga0501070_0091316 3300049586 Bacteria 2520
773 Ga0501071_0023104 3300049587 Bacteria 4340
774 Ga0501074_0124226 3300049590 Bacteria 1846
775 Ga0501076_0420531 3300049592 Bacteria 1100
776 Ga0501080_0082175 3300049742 Bacteria 2993
777 Ga0501080_0150883 3300049742 Bacteria 2148
778 Ga0501080_0206837 3300049742 Bacteria 1800
779 Ga0501080_0220472 3300049742 Bacteria 1736
780 Ga0501035_0014526 3300049822 Bacteria 7268
781 Ga0501035_0085017 3300049822 Bacteria 2790
782 Ga0501044_0000193 3300049823 Bacteria 76794
783 Ga0501044_0000458 3300049823 Bacteria 49695
784 Ga0501044_0026928 3300049823 Bacteria 6083
785 Ga0501044_0224672 3300049823 Bacteria 1827
786 Ga0501044_0251692 3300049823 Bacteria 1707
787 Ga0501045_0024198 3300049824 Bacteria 4358
788 nmdc:mga03683_14758_c1 3300050489 Bacteria 2898
789 nmdc:mga03683_16132_c1 3300050489 Bacteria 2800
790 nmdc:mga03683_363_c1 3300050489 Bacteria 3039
791 nmdc:mga03683_363_c2 3300050489 Bacteria 10016
792 nmdc:mga03n38_79608_c1 3300050490 Bacteria 1537
793 nmdc:mga00v17_7692_c1 3300050491 Bacteria 5764
794 nmdc:mga0yw44_158908_c1 3300050492 Bacteria 1479
795 nmdc:mga0yw44_62387_c1 3300050492 Bacteria 2289
796 nmdc:mga0yw44_76447_c1 3300050492 Bacteria 1484
797 nmdc:mga0yw44_9242_c1 3300050492 Unclassified 4964
798 nmdc:mga0k408_15679_c1 3300050493 Bacteria 4194
799 nmdc:mga0k408_176154_c1 3300050493 Bacteria 1275
800 nmdc:mga0k408_28442_c1 3300050493 Bacteria 3178
801 nmdc:mga06z11_160112_c1 3300050494 Bacteria 1286
802 nmdc:mga06z11_57436_c1 3300050494 Bacteria 2016
803 nmdc:mga04h51_100902_c1 3300050495 Bacteria 1051
804 nmdc:mga07m45_14539_c2 3300050496 Bacteria 3009
805 nmdc:mga07m45_41932_c1 3300050496 Bacteria 2564
806 nmdc:mga07m45_43094_c1 3300050496 Bacteria 2530
807 nmdc:mga07m45_7395_c1 3300050496 Bacteria 5612
808 nmdc:mga05p37_11335_c1 3300050507 Bacteria 10605
809 nmdc:mga05p37_533843_c1 3300050507 Bacteria 1339
810 nmdc:mga05p37_71294_c1 3300050507 Bacteria 4274
811 nmdc:mga05p37_75490_c1 3300050507 Bacteria 4149
812 nmdc:mga0qj67_41_c1 3300050509 Bacteria 89688
813 nmdc:mga06r32_103740_c1 3300050510 Bacteria 2792
814 nmdc:mga08y16_25452_c1 3300050511 Bacteria 6241
815 nmdc:mga08y16_33436_c1 3300050511 Bacteria 5401
816 nmdc:mga0n895_13231_c1 3300050512 Bacteria 7435
817 nmdc:mga0n895_33930_c1 3300050512 Bacteria 4908
818 nmdc:mga0n895_81049_c1 3300050512 Bacteria 3234
819 nmdc:mga0rr50_24140_c1 3300050513 Bacteria 4207
820 nmdc:mga0rr50_50807_c1 3300050513 Bacteria 3073
821 nmdc:mga0a205_132545_c1 3300050515 Bacteria 2392
822 nmdc:mga0a205_66695_c1 3300050515 Unclassified 3477
823 nmdc:mga0a205_93763_c1 3300050515 Bacteria 2900
824 Ga0495601_0029040 3300053077 Bacteria 3428
825 Ga0495601_0074252 3300053077 Bacteria 2175
826 Ga0495601_0106854 3300053077 Unclassified 1810
827 Ga0495612_0002024 3300053078 Bacteria 8355
828 Ga0500610_0001956 3300053079 Bacteria 7336
829 Ga0500610_0002763 3300053079 Bacteria 6563
830 Ga0500644_0116885 3300053088 Bacteria 1035
831 Ga0500566_0136186 3300053094 Bacteria 1308
832 Ga0500641_0127855 3300053096 Bacteria 1096
833 Ga0500593_000167 3300053117 Bacteria 26501
834 Ga0500595_008487 3300053119 Bacteria 4193
835 Ga0500616_0098680 3300053153 Bacteria 1432
836 Ga0500627_0000617 3300053158 Bacteria 9484
837 Ga0500634_0094881 3300053161 Unclassified 1505
838 Ga0500596_023070 3300053735 Bacteria 942
839 Ga0501084_0212319 3300054114 Bacteria 1633
840 Ga0501082_0006937 3300060353 Bacteria 9790
841 Ga0501082_0100515 3300060353 Bacteria 2502

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0060334 Ga0495590_0060334_544_1296 250
2 3300026035 Ga0207703_10003230 Ga0207703_100032303 254
3 3300036401 Ga0373937_0499211 Ga0373937_0499211_13_846 259
4 3300048905 Ga0496102_0202408 Ga0496102_0202408_20_994 260
5 3300048914 Ga0496111_0011549 Ga0496111_0011549_3819_4793 260
6 3300046491 Ga0495584_0232131 Ga0495584_0232131_113_916 267
7 3300050489 nmdc:mga03683_363_c1 nmdc:mga03683_363_c1_77_898 268
8 3300049581 Ga0501047_0624976 Ga0501047_0624976_50_877 272
9 3300007076 Ga0075435_100041209 Ga0075435_1000412092 274
10 3300009094 Ga0111539_10000966 Ga0111539_1000096619 284
11 3300049570 Ga0501033_0122020 Ga0501033_0122020_161_1123 286
12 3300049581 Ga0501047_0111201 Ga0501047_0111201_352_1314 286
13 3300049586 Ga0501070_0054165 Ga0501070_0054165_279_1241 286
14 3300049822 Ga0501035_0085017 Ga0501035_0085017_1712_2674 286
15 3300049823 Ga0501044_0224672 Ga0501044_0224672_558_1517 286
16 3300005347 Ga0070668_100090479 Ga0070668_1000904791 287
17 3300009553 Ga0105249_10197939 Ga0105249_101979392 287
18 3300005577 Ga0068857_100359503 Ga0068857_1003595032 290
19 3300006358 Ga0068871_100264253 Ga0068871_1002642532 290
20 3300009177 Ga0105248_10178959 Ga0105248_101789593 290
21 3300014968 Ga0157379_10030492 Ga0157379_100304922 290
22 3300026116 Ga0207674_10037457 Ga0207674_100374572 290
23 3300049742 Ga0501080_0206837 Ga0501080_0206837_368_1330 290
24 3300053735 Ga0500596_023070 Ga0500596_023070_15_908 290
25 3300048912 Ga0496109_0017476 Ga0496109_0017476_95_979 291
26 3300005336 Ga0070680_100240301 Ga0070680_1002403012 293
27 3300005340 Ga0070689_100008822 Ga0070689_1000088223 293
28 3300005343 Ga0070687_100023314 Ga0070687_1000233142 293
29 3300005345 Ga0070692_10022678 Ga0070692_100226781 293
30 3300005355 Ga0070671_100010061 Ga0070671_1000100614 293
31 3300005365 Ga0070688_100102529 Ga0070688_1001025292 293
32 3300005438 Ga0070701_10053981 Ga0070701_100539812 293
33 3300005444 Ga0070694_100023040 Ga0070694_1000230402 293
34 3300005459 Ga0068867_100013424 Ga0068867_1000134243 293
35 3300005543 Ga0070672_100063647 Ga0070672_1000636472 293
36 3300005549 Ga0070704_100004501 Ga0070704_1000045013 293
37 3300005564 Ga0070664_100117409 Ga0070664_1001174092 293
38 3300005577 Ga0068857_100028101 Ga0068857_1000281013 293
39 3300005577 Ga0068857_100039051 Ga0068857_1000390513 293
40 3300005617 Ga0068859_100008832 Ga0068859_1000088323 293
41 3300005618 Ga0068864_100159953 Ga0068864_1001599533 293
42 3300005719 Ga0068861_100010480 Ga0068861_1000104802 293
43 3300005840 Ga0068870_10016862 Ga0068870_100168622 293
44 3300005841 Ga0068863_100118268 Ga0068863_1001182683 293
45 3300005843 Ga0068860_100240848 Ga0068860_1002408482 293
46 3300005844 Ga0068862_100004017 Ga0068862_1000040174 293
47 3300006880 Ga0075429_100202630 Ga0075429_1002026302 293
48 3300006931 Ga0097620_100008832 Ga0097620_1000088324 293
49 3300009094 Ga0111539_10038682 Ga0111539_100386823 293
50 3300009147 Ga0114129_10451088 Ga0114129_104510882 293
51 3300009176 Ga0105242_10147209 Ga0105242_101472092 293
52 3300009176 Ga0105242_10227682 Ga0105242_102276822 293
53 3300009553 Ga0105249_10022737 Ga0105249_100227372 293
54 3300013297 Ga0157378_10070930 Ga0157378_100709302 293
55 3300013306 Ga0163162_10058159 Ga0163162_100581593 293
56 3300013308 Ga0157375_10139469 Ga0157375_101394692 293
57 3300025315 Ga0207697_10066972 Ga0207697_100669722 293
58 3300025907 Ga0207645_10059680 Ga0207645_100596802 293
59 3300025908 Ga0207643_10029129 Ga0207643_100291292 293
60 3300025918 Ga0207662_10114617 Ga0207662_101146172 293
61 3300025925 Ga0207650_10076521 Ga0207650_100765212 293
62 3300025926 Ga0207659_10019877 Ga0207659_100198772 293
63 3300025931 Ga0207644_10138354 Ga0207644_101383542 293
64 3300025933 Ga0207706_10092504 Ga0207706_100925042 293
65 3300025933 Ga0207706_10178490 Ga0207706_101784902 293
66 3300025936 Ga0207670_10004513 Ga0207670_100045133 293
67 3300025940 Ga0207691_10095988 Ga0207691_100959882 293
68 3300025945 Ga0207679_10188185 Ga0207679_101881852 293
69 3300025961 Ga0207712_10250665 Ga0207712_102506651 293
70 3300026088 Ga0207641_10381836 Ga0207641_103818361 293
71 3300026089 Ga0207648_10018557 Ga0207648_100185572 293
72 3300026116 Ga0207674_10023513 Ga0207674_100235133 293
73 3300026116 Ga0207674_10037894 Ga0207674_100378942 293
74 3300026118 Ga0207675_100002040 Ga0207675_10000204014 293
75 3300027907 Ga0207428_10013971 Ga0207428_100139713 293
76 3300028380 Ga0268265_10003753 Ga0268265_100037533 293
77 3300037418 Ga0395900_0002747 Ga0395900_0002747_13118_14236 293
78 3300037466 Ga0395898_0018984 Ga0395898_0018984_133_1251 293
79 3300046539 Ga0495621_0011285 Ga0495621_0011285_660_1742 293
80 3300050511 nmdc:mga08y16_33436_c1 nmdc:mga08y16_33436_c1_73_1155 293
81 3300050513 nmdc:mga0rr50_24140_c1 nmdc:mga0rr50_24140_c1_496_1533 293
82 3300006852 Ga0075433_10076716 Ga0075433_100767162 294
83 3300006871 Ga0075434_100101966 Ga0075434_1001019662 294
84 3300009147 Ga0114129_10048772 Ga0114129_100487724 294
85 3300050507 nmdc:mga05p37_71294_c1 nmdc:mga05p37_71294_c1_1580_2539 294
86 3300050512 nmdc:mga0n895_13231_c1 nmdc:mga0n895_13231_c1_5490_6449 294
87 3300050515 nmdc:mga0a205_66695_c1 nmdc:mga0a205_66695_c1_928_1887 294
88 3300025916 Ga0207663_10250140 Ga0207663_102501401 295
89 3300005336 Ga0070680_100153483 Ga0070680_1001534832 297
90 3300053077 Ga0495601_0106854 Ga0495601_0106854_517_1479 297
91 3300009093 Ga0105240_10719551 Ga0105240_107195511 298
92 3300049586 Ga0501070_0014496 Ga0501070_0014496_1590_2489 298
93 3300006852 Ga0075433_10351968 Ga0075433_103519681 299
94 3300006871 Ga0075434_100025232 Ga0075434_1000252323 299
95 3300007076 Ga0075435_100069115 Ga0075435_1000691152 299
96 3300050512 nmdc:mga0n895_81049_c1 nmdc:mga0n895_81049_c1_844_1830 299
97 3300050513 nmdc:mga0rr50_50807_c1 nmdc:mga0rr50_50807_c1_754_1740 299
98 3300050515 nmdc:mga0a205_132545_c1 nmdc:mga0a205_132545_c1_1328_2314 299
99 3300005435 Ga0070714_100001344 Ga0070714_1000013442 300
100 3300009093 Ga0105240_10297110 Ga0105240_102971103 300
101 3300025929 Ga0207664_10000996 Ga0207664_1000099614 300
102 3300028563 Ga0265319_1000609 Ga0265319_100060910 300
103 3300028577 Ga0265318_10000413 Ga0265318_1000041315 300
104 3300031239 Ga0265328_10040237 Ga0265328_100402372 300
105 3300031240 Ga0265320_10000126 Ga0265320_1000012648 300
106 3300031241 Ga0265325_10039612 Ga0265325_100396122 300
107 3300031242 Ga0265329_10003421 Ga0265329_100034213 300
108 3300031247 Ga0265340_10006776 Ga0265340_100067763 300
109 3300031249 Ga0265339_10036466 Ga0265339_100364662 300
110 3300031250 Ga0265331_10000025 Ga0265331_10000025192 300
111 3300031344 Ga0265316_10002023 Ga0265316_100020238 300
112 3300031595 Ga0265313_10002717 Ga0265313_100027177 300
113 3300031711 Ga0265314_10028254 Ga0265314_100282542 300
114 3300031712 Ga0265342_10003553 Ga0265342_100035533 300
115 3300046615 Ga0495656_0021736 Ga0495656_0021736_687_1634 300
116 3300006846 Ga0075430_100001709 Ga0075430_1000017095 301
117 3300009101 Ga0105247_10172965 Ga0105247_101729652 301
118 3300025934 Ga0207686_10119173 Ga0207686_101191732 301
119 3300046513 Ga0495616_0075573 Ga0495616_0075573_662_1570 301
120 3300046615 Ga0495656_0022552 Ga0495656_0022552_67_975 301
121 3300046616 Ga0495668_0132149 Ga0495668_0132149_37_945 301
122 3300046689 Ga0495613_0010679 Ga0495613_0010679_3837_4895 301
123 3300046690 Ga0495624_0172749 Ga0495624_0172749_106_1014 301
124 3300046794 Ga0495589_0051868 Ga0495589_0051868_181_1089 301
125 3300047319 Ga0495674_0029342 Ga0495674_0029342_1699_2607 301
126 3300047471 Ga0495684_0345533 Ga0495684_0345533_105_1013 301
127 3300048903 Ga0496100_0189952 Ga0496100_0189952_547_1455 301
128 3300048908 Ga0496105_0309860 Ga0496105_0309860_130_1038 301
129 3300050509 nmdc:mga0qj67_41_c1 nmdc:mga0qj67_41_c1_87197_88291 301
130 3300005334 Ga0068869_100022698 Ga0068869_1000226984 302
131 3300005335 Ga0070666_10003141 Ga0070666_100031415 302
132 3300005336 Ga0070680_100013675 Ga0070680_1000136756 302
133 3300005336 Ga0070680_100089716 Ga0070680_1000897161 302
134 3300005338 Ga0068868_100009212 Ga0068868_1000092126 302
135 3300005341 Ga0070691_10046989 Ga0070691_100469891 302
136 3300005364 Ga0070673_100167049 Ga0070673_1001670492 302
137 3300005435 Ga0070714_100001344 Ga0070714_1000013443 302
138 3300005458 Ga0070681_10001127 Ga0070681_1000112720 302
139 3300005530 Ga0070679_100012721 Ga0070679_1000127216 302
140 3300005535 Ga0070684_100306894 Ga0070684_1003068942 302
141 3300005563 Ga0068855_100222282 Ga0068855_1002222822 302
142 3300005617 Ga0068859_100083699 Ga0068859_1000836993 302
143 3300005842 Ga0068858_100011311 Ga0068858_1000113114 302
144 3300005843 Ga0068860_100012074 Ga0068860_1000120747 302
145 3300006237 Ga0097621_100010583 Ga0097621_1000105835 302
146 3300006931 Ga0097620_100083695 Ga0097620_1000836953 302
147 3300009093 Ga0105240_10064259 Ga0105240_100642593 302
148 3300009098 Ga0105245_10000873 Ga0105245_1000087316 302
149 3300009098 Ga0105245_10008605 Ga0105245_100086055 302
150 3300009174 Ga0105241_10205732 Ga0105241_102057321 302
151 3300009176 Ga0105242_10098912 Ga0105242_100989123 302
152 3300009177 Ga0105248_10001047 Ga0105248_100010479 302
153 3300009545 Ga0105237_10263944 Ga0105237_102639442 302
154 3300009551 Ga0105238_10057321 Ga0105238_100573211 302
155 3300010375 Ga0105239_10389467 Ga0105239_103894671 302
156 3300013104 Ga0157370_10013826 Ga0157370_100138269 302
157 3300013105 Ga0157369_10002769 Ga0157369_1000276922 302
158 3300014325 Ga0163163_10020236 Ga0163163_100202365 302
159 3300014968 Ga0157379_10023564 Ga0157379_100235645 302
160 3300025903 Ga0207680_10001550 Ga0207680_100015504 302
161 3300025912 Ga0207707_10038987 Ga0207707_100389872 302
162 3300025912 Ga0207707_10104809 Ga0207707_101048092 302
163 3300025913 Ga0207695_10377743 Ga0207695_103777431 302
164 3300025917 Ga0207660_10017996 Ga0207660_100179964 302
165 3300025921 Ga0207652_10020148 Ga0207652_100201481 302
166 3300025924 Ga0207694_10047761 Ga0207694_100477611 302
167 3300025927 Ga0207687_10003422 Ga0207687_100034229 302
168 3300025929 Ga0207664_10000996 Ga0207664_1000099613 302
169 3300025932 Ga0207690_10045660 Ga0207690_100456603 302
170 3300025941 Ga0207711_10018915 Ga0207711_100189155 302
171 3300025942 Ga0207689_10033065 Ga0207689_100330653 302
172 3300026023 Ga0207677_10019201 Ga0207677_100192013 302
173 3300026035 Ga0207703_10005264 Ga0207703_100052645 302
174 3300026088 Ga0207641_10069108 Ga0207641_100691084 302
175 3300026095 Ga0207676_10290116 Ga0207676_102901162 302
176 3300028381 Ga0268264_10019097 Ga0268264_100190973 302
177 3300031711 Ga0265314_10002211 Ga0265314_100022117 302
178 3300036401 Ga0373937_0012218 Ga0373937_0012218_2359_3282 302
179 3300037312 Ga0395899_0087951 Ga0395899_0087951_1081_2169 302
180 3300037418 Ga0395900_0002747 Ga0395900_0002747_14344_15450 302
181 3300037466 Ga0395898_0018984 Ga0395898_0018984_1359_2465 302
182 3300045836 Ga0466958_0120408 Ga0466958_0120408_58_981 302
183 3300048918 Ga0496115_0433097 Ga0496115_0433097_88_1011 302
184 3300005458 Ga0070681_10013126 Ga0070681_100131262 303
185 3300005530 Ga0070679_100132597 Ga0070679_1001325973 303
186 3300005535 Ga0070684_100075718 Ga0070684_1000757183 303
187 3300005539 Ga0068853_100070760 Ga0068853_1000707602 303
188 3300005548 Ga0070665_100143329 Ga0070665_1001433293 303
189 3300005563 Ga0068855_100082843 Ga0068855_1000828432 303
190 3300005563 Ga0068855_100160584 Ga0068855_1001605842 303
191 3300005564 Ga0070664_100093464 Ga0070664_1000934642 303
192 3300005577 Ga0068857_100003096 Ga0068857_1000030969 303
193 3300005614 Ga0068856_100140700 Ga0068856_1001407002 303
194 3300006852 Ga0075433_10112496 Ga0075433_101124962 303
195 3300009093 Ga0105240_10009948 Ga0105240_100099483 303
196 3300009094 Ga0111539_10103464 Ga0111539_101034642 303
197 3300009176 Ga0105242_10027010 Ga0105242_100270102 303
198 3300009177 Ga0105248_10150427 Ga0105248_101504272 303
199 3300009545 Ga0105237_10017735 Ga0105237_100177352 303
200 3300010375 Ga0105239_10027842 Ga0105239_100278426 303
201 3300010375 Ga0105239_10053275 Ga0105239_100532752 303
202 3300013104 Ga0157370_10136615 Ga0157370_101366152 303
203 3300013105 Ga0157369_10315166 Ga0157369_103151661 303
204 3300013297 Ga0157378_10114911 Ga0157378_101149112 303
205 3300013306 Ga0163162_10311329 Ga0163162_103113292 303
206 3300013307 Ga0157372_10487366 Ga0157372_104873662 303
207 3300013308 Ga0157375_10140829 Ga0157375_101408292 303
208 3300014325 Ga0163163_10018204 Ga0163163_100182042 303
209 3300025906 Ga0207699_10262773 Ga0207699_102627731 303
210 3300025912 Ga0207707_10013041 Ga0207707_100130411 303
211 3300025913 Ga0207695_10045477 Ga0207695_100454773 303
212 3300025927 Ga0207687_10064734 Ga0207687_100647341 303
213 3300025934 Ga0207686_10012270 Ga0207686_100122704 303
214 3300025941 Ga0207711_10203539 Ga0207711_102035392 303
215 3300025949 Ga0207667_10136510 Ga0207667_101365102 303
216 3300025949 Ga0207667_10335599 Ga0207667_103355992 303
217 3300026023 Ga0207677_10081831 Ga0207677_100818312 303
218 3300028379 Ga0268266_10082106 Ga0268266_100821062 303
219 3300050515 nmdc:mga0a205_93763_c1 nmdc:mga0a205_93763_c1_1200_2255 303
220 3300005436 Ga0070713_100068666 Ga0070713_1000686662 304
221 3300005436 Ga0070713_100194615 Ga0070713_1001946152 304
222 3300005455 Ga0070663_100008942 Ga0070663_1000089423 304
223 3300005458 Ga0070681_10420970 Ga0070681_104209701 304
224 3300005614 Ga0068856_100294430 Ga0068856_1002944302 304
225 3300006048 Ga0075363_100007008 Ga0075363_1000070083 304
226 3300006051 Ga0075364_10013177 Ga0075364_100131772 304
227 3300006177 Ga0075362_10086549 Ga0075362_100865491 304
228 3300006847 Ga0075431_100322754 Ga0075431_1003227542 304
229 3300009094 Ga0111539_10002463 Ga0111539_1000246318 304
230 3300009147 Ga0114129_10107522 Ga0114129_101075223 304
231 3300013105 Ga0157369_10136917 Ga0157369_101369173 304
232 3300013307 Ga0157372_10459096 Ga0157372_104590961 304
233 3300025928 Ga0207700_10141430 Ga0207700_101414302 304
234 3300025928 Ga0207700_10243096 Ga0207700_102430962 304
235 3300026067 Ga0207678_10011629 Ga0207678_100116293 304
236 3300026078 Ga0207702_10306829 Ga0207702_103068292 304
237 3300032005 Ga0307411_10115651 Ga0307411_101156512 304
238 3300035724 Ga0373933_0129976 Ga0373933_0129976_188_1123 304
239 3300036401 Ga0373937_0001624 Ga0373937_0001624_14119_15054 304
240 3300039447 Ga0436361_0598168 Ga0436361_0598168_4066_5097 304
241 3300049581 Ga0501047_0135237 Ga0501047_0135237_1364_2329 304
242 3300049823 Ga0501044_0000458 Ga0501044_0000458_30781_31821 304
243 3300050489 nmdc:mga03683_14758_c1 nmdc:mga03683_14758_c1_631_1584 304
244 3300050489 nmdc:mga03683_16132_c1 nmdc:mga03683_16132_c1_1008_1961 304
245 3300050489 nmdc:mga03683_363_c2 nmdc:mga03683_363_c2_8487_9413 304
246 3300050491 nmdc:mga00v17_7692_c1 nmdc:mga00v17_7692_c1_1615_2541 304
247 3300050492 nmdc:mga0yw44_158908_c1 nmdc:mga0yw44_158908_c1_344_1297 304
248 3300050493 nmdc:mga0k408_15679_c1 nmdc:mga0k408_15679_c1_2599_3717 304
249 3300050494 nmdc:mga06z11_160112_c1 nmdc:mga06z11_160112_c1_58_1113 304
250 3300050496 nmdc:mga07m45_43094_c1 nmdc:mga07m45_43094_c1_280_1206 304
251 3300050511 nmdc:mga08y16_25452_c1 nmdc:mga08y16_25452_c1_38_1141 304
252 3300053094 Ga0500566_0136186 Ga0500566_0136186_160_1251 304
253 3300005293 Ga0065715_10007812 Ga0065715_100078122 305
254 3300005330 Ga0070690_100035776 Ga0070690_1000357762 305
255 3300005331 Ga0070670_100004292 Ga0070670_10000429210 305
256 3300005343 Ga0070687_100020116 Ga0070687_1000201163 305
257 3300005344 Ga0070661_100049114 Ga0070661_1000491143 305
258 3300005354 Ga0070675_100201549 Ga0070675_1002015492 305
259 3300005364 Ga0070673_100129972 Ga0070673_1001299721 305
260 3300005365 Ga0070688_100061740 Ga0070688_1000617402 305
261 3300005366 Ga0070659_100138977 Ga0070659_1001389772 305
262 3300005444 Ga0070694_100070229 Ga0070694_1000702292 305
263 3300005458 Ga0070681_10085053 Ga0070681_100850533 305
264 3300005466 Ga0070685_10040207 Ga0070685_100402073 305
265 3300005543 Ga0070672_100030395 Ga0070672_1000303953 305
266 3300005545 Ga0070695_100283595 Ga0070695_1002835951 305
267 3300005564 Ga0070664_100008176 Ga0070664_1000081763 305
268 3300005577 Ga0068857_100040629 Ga0068857_1000406293 305
269 3300005577 Ga0068857_100172853 Ga0068857_1001728531 305
270 3300005618 Ga0068864_100013302 Ga0068864_1000133024 305
271 3300005843 Ga0068860_100286267 Ga0068860_1002862671 305
272 3300005844 Ga0068862_100043818 Ga0068862_1000438182 305
273 3300006038 Ga0075365_10028321 Ga0075365_100283213 305
274 3300006038 Ga0075365_10067402 Ga0075365_100674023 305
275 3300006048 Ga0075363_100008158 Ga0075363_1000081585 305
276 3300013105 Ga0157369_10075019 Ga0157369_100750191 305
277 3300014325 Ga0163163_10165626 Ga0163163_101656261 305
278 3300014745 Ga0157377_10030701 Ga0157377_100307013 305
279 3300025912 Ga0207707_10112399 Ga0207707_101123992 305
280 3300025918 Ga0207662_10026192 Ga0207662_100261923 305
281 3300025923 Ga0207681_10025247 Ga0207681_100252473 305
282 3300025925 Ga0207650_10006782 Ga0207650_100067825 305
283 3300025940 Ga0207691_10007977 Ga0207691_100079776 305
284 3300025945 Ga0207679_10383770 Ga0207679_103837702 305
285 3300026067 Ga0207678_10087745 Ga0207678_100877453 305
286 3300026088 Ga0207641_10158636 Ga0207641_101586361 305
287 3300026116 Ga0207674_10102958 Ga0207674_101029582 305
288 3300026118 Ga0207675_100121015 Ga0207675_1001210151 305
289 3300028379 Ga0268266_10254026 Ga0268266_102540262 305
290 3300028380 Ga0268265_10110274 Ga0268265_101102742 305
291 3300028381 Ga0268264_10242333 Ga0268264_102423331 305
292 3300045976 Ga0466967_0331005 Ga0466967_0331005_90_1115 305
293 3300046691 Ga0495670_0040088 Ga0495670_0040088_1000_2040 305
294 3300050492 nmdc:mga0yw44_62387_c1 nmdc:mga0yw44_62387_c1_669_1595 305
295 3300050492 nmdc:mga0yw44_9242_c1 nmdc:mga0yw44_9242_c1_328_1254 305
296 3300050494 nmdc:mga06z11_57436_c1 nmdc:mga06z11_57436_c1_594_1520 305
297 3300005365 Ga0070688_100226817 Ga0070688_1002268172 306
298 3300005456 Ga0070678_100047842 Ga0070678_1000478422 306
299 3300005458 Ga0070681_10125886 Ga0070681_101258862 306
300 3300005459 Ga0068867_100084333 Ga0068867_1000843332 306
301 3300005530 Ga0070679_100167854 Ga0070679_1001678542 306
302 3300005535 Ga0070684_100554897 Ga0070684_1005548971 306
303 3300005842 Ga0068858_100165648 Ga0068858_1001656481 306
304 3300006195 Ga0075366_10044936 Ga0075366_100449364 306
305 3300006237 Ga0097621_100065103 Ga0097621_1000651032 306
306 3300006358 Ga0068871_100008039 Ga0068871_1000080392 306
307 3300009098 Ga0105245_10044451 Ga0105245_100444515 306
308 3300009148 Ga0105243_10057455 Ga0105243_100574551 306
309 3300013296 Ga0157374_10179311 Ga0157374_101793111 306
310 3300025912 Ga0207707_10076906 Ga0207707_100769062 306
311 3300025927 Ga0207687_10028032 Ga0207687_100280325 306
312 3300025935 Ga0207709_10125083 Ga0207709_101250831 306
313 3300026089 Ga0207648_10070878 Ga0207648_100708783 306
314 3300026121 Ga0207683_10167454 Ga0207683_101674542 306
315 3300032005 Ga0307411_10029466 Ga0307411_100294662 306
316 3300035695 Ga0373927_0029586 Ga0373927_0029586_1367_2416 306
317 3300035724 Ga0373933_0185573 Ga0373933_0185573_374_1315 306
318 3300036401 Ga0373937_0109331 Ga0373937_0109331_1400_2341 306
319 3300037068 Ga0373925_0005806 Ga0373925_0005806_1112_2161 306
320 3300046453 Ga0495627_009242 Ga0495627_009242_1545_2570 306
321 3300046515 Ga0495620_0036941 Ga0495620_0036941_936_1961 306
322 3300046660 Ga0495625_0155211 Ga0495625_0155211_101_1126 306
323 3300046674 Ga0495588_0096308 Ga0495588_0096308_235_1260 306
324 3300046683 Ga0495658_0064913 Ga0495658_0064913_771_1820 306
325 3300046691 Ga0495670_0013224 Ga0495670_0013224_2834_3859 306
326 3300046692 Ga0495671_0016342 Ga0495671_0016342_2714_3739 306
327 3300049742 Ga0501080_0082175 Ga0501080_0082175_1640_2734 306
328 3300053079 Ga0500610_0001956 Ga0500610_0001956_575_1654 306
329 3300053079 Ga0500610_0002763 Ga0500610_0002763_1321_2346 306
330 3300053117 Ga0500593_000167 Ga0500593_000167_2614_3639 306
331 3300053158 Ga0500627_0000617 Ga0500627_0000617_2864_3889 306
332 3300053161 Ga0500634_0094881 Ga0500634_0094881_338_1363 306
333 3300005518 Ga0070699_100045216 Ga0070699_1000452162 307
334 3300006177 Ga0075362_10001351 Ga0075362_100013512 307
335 3300006353 Ga0075370_10034735 Ga0075370_100347351 307
336 3300006847 Ga0075431_100036195 Ga0075431_1000361952 307
337 3300009147 Ga0114129_10047462 Ga0114129_100474625 307
338 3300028563 Ga0265319_1001589 Ga0265319_10015895 307
339 3300028577 Ga0265318_10003429 Ga0265318_100034295 307
340 3300031238 Ga0265332_10021346 Ga0265332_100213462 307
341 3300031240 Ga0265320_10000126 Ga0265320_1000012660 307
342 3300031242 Ga0265329_10002177 Ga0265329_100021772 307
343 3300031249 Ga0265339_10021805 Ga0265339_100218052 307
344 3300031250 Ga0265331_10000025 Ga0265331_10000025204 307
345 3300031344 Ga0265316_10011066 Ga0265316_100110663 307
346 3300031595 Ga0265313_10005119 Ga0265313_100051194 307
347 3300031711 Ga0265314_10006180 Ga0265314_100061807 307
348 3300031712 Ga0265342_10002273 Ga0265342_100022738 307
349 3300049742 Ga0501080_0220472 Ga0501080_0220472_733_1722 307
350 3300050507 nmdc:mga05p37_11335_c1 nmdc:mga05p37_11335_c1_4370_5371 307
351 3300050510 nmdc:mga06r32_103740_c1 nmdc:mga06r32_103740_c1_166_1167 307
352 3300005329 Ga0070683_100005567 Ga0070683_1000055677 308
353 3300005331 Ga0070670_100000360 Ga0070670_1000003605 308
354 3300005334 Ga0068869_100155068 Ga0068869_1001550682 308
355 3300005336 Ga0070680_100001073 Ga0070680_1000010739 308
356 3300005336 Ga0070680_100084397 Ga0070680_1000843972 308
357 3300005336 Ga0070680_100121819 Ga0070680_1001218192 308
358 3300005338 Ga0068868_100001821 Ga0068868_1000018219 308
359 3300005339 Ga0070660_100237426 Ga0070660_1002374261 308
360 3300005344 Ga0070661_100000772 Ga0070661_10000077213 308
361 3300005355 Ga0070671_100001024 Ga0070671_10000102414 308
362 3300005364 Ga0070673_100000234 Ga0070673_10000023415 308
363 3300005366 Ga0070659_100092341 Ga0070659_1000923411 308
364 3300005367 Ga0070667_100014038 Ga0070667_1000140389 308
365 3300005367 Ga0070667_100014411 Ga0070667_1000144113 308
366 3300005434 Ga0070709_10014066 Ga0070709_100140663 308
367 3300005439 Ga0070711_100335680 Ga0070711_1003356801 308
368 3300005456 Ga0070678_100000029 Ga0070678_10000002914 308
369 3300005457 Ga0070662_100069230 Ga0070662_1000692302 308
370 3300005458 Ga0070681_10003861 Ga0070681_100038619 308
371 3300005458 Ga0070681_10027003 Ga0070681_100270032 308
372 3300005458 Ga0070681_10047532 Ga0070681_100475322 308
373 3300005458 Ga0070681_10112684 Ga0070681_101126842 308
374 3300005459 Ga0068867_100014340 Ga0068867_1000143403 308
375 3300005459 Ga0068867_100126649 Ga0068867_1001266492 308
376 3300005530 Ga0070679_100000747 Ga0070679_10000074714 308
377 3300005530 Ga0070679_100105672 Ga0070679_1001056721 308
378 3300005530 Ga0070679_100119144 Ga0070679_1001191442 308
379 3300005530 Ga0070679_100182842 Ga0070679_1001828422 308
380 3300005535 Ga0070684_100041950 Ga0070684_1000419502 308
381 3300005535 Ga0070684_100045575 Ga0070684_1000455751 308
382 3300005543 Ga0070672_100000952 Ga0070672_10000095211 308
383 3300005546 Ga0070696_100116697 Ga0070696_1001166971 308
384 3300005548 Ga0070665_100080630 Ga0070665_1000806303 308
385 3300005563 Ga0068855_100056524 Ga0068855_1000565244 308
386 3300005564 Ga0070664_100001531 Ga0070664_10000153114 308
387 3300005578 Ga0068854_100000507 Ga0068854_10000050712 308
388 3300005614 Ga0068856_100045474 Ga0068856_1000454745 308
389 3300005616 Ga0068852_100000304 Ga0068852_1000003045 308
390 3300005617 Ga0068859_100380404 Ga0068859_1003804042 308
391 3300005618 Ga0068864_100008517 Ga0068864_1000085174 308
392 3300005718 Ga0068866_10012323 Ga0068866_100123234 308
393 3300005834 Ga0068851_10003179 Ga0068851_100031797 308
394 3300005841 Ga0068863_100016598 Ga0068863_1000165986 308
395 3300005841 Ga0068863_100553194 Ga0068863_1005531941 308
396 3300005842 Ga0068858_100015894 Ga0068858_1000158949 308
397 3300005843 Ga0068860_100044476 Ga0068860_1000444761 308
398 3300006163 Ga0070715_10039124 Ga0070715_100391242 308
399 3300006237 Ga0097621_100001892 Ga0097621_10000189210 308
400 3300006237 Ga0097621_100197938 Ga0097621_1001979382 308
401 3300006358 Ga0068871_100000178 Ga0068871_10000017838 308
402 3300006358 Ga0068871_100004850 Ga0068871_1000048502 308
403 3300006358 Ga0068871_100044859 Ga0068871_1000448592 308
404 3300006358 Ga0068871_100048242 Ga0068871_1000482423 308
405 3300006881 Ga0068865_100059948 Ga0068865_1000599481 308
406 3300006931 Ga0097620_100380398 Ga0097620_1003803982 308
407 3300009093 Ga0105240_10008709 Ga0105240_100087092 308
408 3300009093 Ga0105240_10022713 Ga0105240_100227134 308
409 3300009093 Ga0105240_10048700 Ga0105240_100487003 308
410 3300009098 Ga0105245_10004551 Ga0105245_100045511 308
411 3300009101 Ga0105247_10028032 Ga0105247_100280321 308
412 3300009148 Ga0105243_10033245 Ga0105243_100332454 308
413 3300009174 Ga0105241_10016750 Ga0105241_100167501 308
414 3300009174 Ga0105241_10118040 Ga0105241_101180402 308
415 3300009176 Ga0105242_10001175 Ga0105242_1000117516 308
416 3300009176 Ga0105242_10017298 Ga0105242_100172984 308
417 3300009177 Ga0105248_10009284 Ga0105248_100092842 308
418 3300009177 Ga0105248_10012888 Ga0105248_100128882 308
419 3300009545 Ga0105237_10012575 Ga0105237_100125752 308
420 3300009551 Ga0105238_10015546 Ga0105238_100155465 308
421 3300013104 Ga0157370_10046152 Ga0157370_100461524 308
422 3300013105 Ga0157369_10010521 Ga0157369_100105217 308
423 3300013296 Ga0157374_10006530 Ga0157374_100065305 308
424 3300013296 Ga0157374_10043040 Ga0157374_100430403 308
425 3300013296 Ga0157374_10142908 Ga0157374_101429082 308
426 3300013297 Ga0157378_10000669 Ga0157378_1000066924 308
427 3300013306 Ga0163162_10007098 Ga0163162_100070989 308
428 3300013307 Ga0157372_10170372 Ga0157372_101703722 308
429 3300013307 Ga0157372_10343095 Ga0157372_103430952 308
430 3300013308 Ga0157375_10019135 Ga0157375_100191353 308
431 3300014325 Ga0163163_10060723 Ga0163163_100607231 308
432 3300014497 Ga0182008_10035495 Ga0182008_100354952 308
433 3300014968 Ga0157379_10016182 Ga0157379_100161822 308
434 3300014969 Ga0157376_10071446 Ga0157376_100714463 308
435 3300014969 Ga0157376_10100530 Ga0157376_101005302 308
436 3300025321 Ga0207656_10042183 Ga0207656_100421831 308
437 3300025903 Ga0207680_10009786 Ga0207680_100097864 308
438 3300025906 Ga0207699_10112757 Ga0207699_101127571 308
439 3300025912 Ga0207707_10001661 Ga0207707_1000166113 308
440 3300025912 Ga0207707_10029072 Ga0207707_100290722 308
441 3300025912 Ga0207707_10162473 Ga0207707_101624732 308
442 3300025912 Ga0207707_10170460 Ga0207707_101704602 308
443 3300025913 Ga0207695_10030460 Ga0207695_100304606 308
444 3300025914 Ga0207671_10035879 Ga0207671_100358793 308
445 3300025917 Ga0207660_10000876 Ga0207660_100008769 308
446 3300025921 Ga0207652_10003186 Ga0207652_100031862 308
447 3300025921 Ga0207652_10035135 Ga0207652_100351353 308
448 3300025924 Ga0207694_10002315 Ga0207694_1000231514 308
449 3300025925 Ga0207650_10001556 Ga0207650_100015569 308
450 3300025927 Ga0207687_10055874 Ga0207687_100558742 308
451 3300025932 Ga0207690_10295464 Ga0207690_102954641 308
452 3300025934 Ga0207686_10002714 Ga0207686_100027146 308
453 3300025934 Ga0207686_10116638 Ga0207686_101166382 308
454 3300025934 Ga0207686_10161083 Ga0207686_101610832 308
455 3300025938 Ga0207704_10178173 Ga0207704_101781731 308
456 3300025940 Ga0207691_10000487 Ga0207691_1000048724 308
457 3300025941 Ga0207711_10066338 Ga0207711_100663383 308
458 3300025941 Ga0207711_10114093 Ga0207711_101140931 308
459 3300025942 Ga0207689_10164215 Ga0207689_101642151 308
460 3300025944 Ga0207661_10000791 Ga0207661_1000079117 308
461 3300025945 Ga0207679_10005265 Ga0207679_100052657 308
462 3300025949 Ga0207667_10044627 Ga0207667_100446272 308
463 3300025949 Ga0207667_10058405 Ga0207667_100584054 308
464 3300025949 Ga0207667_10317198 Ga0207667_103171982 308
465 3300025960 Ga0207651_10000522 Ga0207651_1000052214 308
466 3300025981 Ga0207640_10000864 Ga0207640_100008649 308
467 3300025986 Ga0207658_10118664 Ga0207658_101186642 308
468 3300026023 Ga0207677_10000909 Ga0207677_100009097 308
469 3300026023 Ga0207677_10058062 Ga0207677_100580624 308
470 3300026035 Ga0207703_10030728 Ga0207703_100307282 308
471 3300026088 Ga0207641_10038856 Ga0207641_100388564 308
472 3300026088 Ga0207641_10179724 Ga0207641_101797242 308
473 3300026089 Ga0207648_10013950 Ga0207648_100139504 308
474 3300026089 Ga0207648_10114088 Ga0207648_101140882 308
475 3300026095 Ga0207676_10008300 Ga0207676_100083004 308
476 3300026116 Ga0207674_10004223 Ga0207674_100042239 308
477 3300026116 Ga0207674_10040678 Ga0207674_100406782 308
478 3300026121 Ga0207683_10001359 Ga0207683_100013594 308
479 3300026121 Ga0207683_10165451 Ga0207683_101654512 308
480 3300026142 Ga0207698_10003982 Ga0207698_100039825 308
481 3300028379 Ga0268266_10285439 Ga0268266_102854392 308
482 3300031711 Ga0265314_10002925 Ga0265314_100029253 308
483 3300036401 Ga0373937_0025752 Ga0373937_0025752_384_1316 308
484 3300039450 Ga0436363_1081739 Ga0436363_1081739_599_1690 308
485 3300046472 Ga0495580_0151628 Ga0495580_0151628_293_1354 308
486 3300048903 Ga0496100_0126255 Ga0496100_0126255_393_1376 308
487 3300048905 Ga0496102_0352009 Ga0496102_0352009_393_1376 308
488 3300048909 Ga0496106_0061353 Ga0496106_0061353_1389_2480 308
489 3300048911 Ga0496108_0003956 Ga0496108_0003956_3394_4485 308
490 3300048913 Ga0496110_0000354 Ga0496110_0000354_2538_3629 308
491 3300005327 Ga0070658_10031050 Ga0070658_100310503 309
492 3300005329 Ga0070683_100251336 Ga0070683_1002513362 309
493 3300005339 Ga0070660_100004998 Ga0070660_10000499810 309
494 3300005340 Ga0070689_100070073 Ga0070689_1000700731 309
495 3300005344 Ga0070661_100036427 Ga0070661_1000364272 309
496 3300005344 Ga0070661_100425122 Ga0070661_1004251221 309
497 3300005367 Ga0070667_100211413 Ga0070667_1002114132 309
498 3300005435 Ga0070714_100020981 Ga0070714_1000209814 309
499 3300005435 Ga0070714_100035257 Ga0070714_1000352572 309
500 3300005436 Ga0070713_100001547 Ga0070713_1000015479 309
501 3300005436 Ga0070713_100065329 Ga0070713_1000653293 309
502 3300005458 Ga0070681_10131109 Ga0070681_101311092 309
503 3300005530 Ga0070679_100126401 Ga0070679_1001264013 309
504 3300005539 Ga0068853_100080699 Ga0068853_1000806993 309
505 3300005563 Ga0068855_100004131 Ga0068855_10000413111 309
506 3300005564 Ga0070664_100008202 Ga0070664_1000082029 309
507 3300005564 Ga0070664_100085893 Ga0070664_1000858932 309
508 3300005577 Ga0068857_100002292 Ga0068857_10000229212 309
509 3300005614 Ga0068856_100005189 Ga0068856_10000518910 309
510 3300005614 Ga0068856_100398118 Ga0068856_1003981182 309
511 3300005616 Ga0068852_100001579 Ga0068852_1000015792 309
512 3300005834 Ga0068851_10015788 Ga0068851_100157882 309
513 3300005841 Ga0068863_100129941 Ga0068863_1001299412 309
514 3300005841 Ga0068863_100441823 Ga0068863_1004418232 309
515 3300005842 Ga0068858_100266687 Ga0068858_1002666872 309
516 3300006038 Ga0075365_10029767 Ga0075365_100297672 309
517 3300009093 Ga0105240_10003088 Ga0105240_100030889 309
518 3300009093 Ga0105240_10067874 Ga0105240_100678742 309
519 3300009174 Ga0105241_10025688 Ga0105241_100256882 309
520 3300009545 Ga0105237_10105768 Ga0105237_101057683 309
521 3300009551 Ga0105238_10008593 Ga0105238_100085935 309
522 3300013100 Ga0157373_10019856 Ga0157373_100198566 309
523 3300013104 Ga0157370_10014113 Ga0157370_100141135 309
524 3300013105 Ga0157369_10020431 Ga0157369_100204318 309
525 3300013105 Ga0157369_10479294 Ga0157369_104792942 309
526 3300013307 Ga0157372_10007514 Ga0157372_100075144 309
527 3300013307 Ga0157372_10245451 Ga0157372_102454512 309
528 3300014969 Ga0157376_10138791 Ga0157376_101387914 309
529 3300025907 Ga0207645_10082106 Ga0207645_100821062 309
530 3300025909 Ga0207705_10056046 Ga0207705_100560462 309
531 3300025911 Ga0207654_10084100 Ga0207654_100841002 309
532 3300025913 Ga0207695_10073689 Ga0207695_100736892 309
533 3300025917 Ga0207660_10310820 Ga0207660_103108202 309
534 3300025919 Ga0207657_10026429 Ga0207657_100264293 309
535 3300025919 Ga0207657_10089547 Ga0207657_100895472 309
536 3300025920 Ga0207649_10001851 Ga0207649_100018519 309
537 3300025920 Ga0207649_10078376 Ga0207649_100783762 309
538 3300025924 Ga0207694_10003094 Ga0207694_100030942 309
539 3300025928 Ga0207700_10000711 Ga0207700_1000071114 309
540 3300025932 Ga0207690_10265153 Ga0207690_102651532 309
541 3300025945 Ga0207679_10005698 Ga0207679_100056988 309
542 3300025949 Ga0207667_10009675 Ga0207667_100096758 309
543 3300026041 Ga0207639_10179460 Ga0207639_101794601 309
544 3300026078 Ga0207702_10005560 Ga0207702_1000556012 309
545 3300026088 Ga0207641_10295741 Ga0207641_102957412 309
546 3300026116 Ga0207674_10004206 Ga0207674_1000420612 309
547 3300026118 Ga0207675_100151299 Ga0207675_1001512992 309
548 3300026142 Ga0207698_10006663 Ga0207698_100066639 309
549 3300028380 Ga0268265_10170677 Ga0268265_101706772 309
550 3300028381 Ga0268264_10374045 Ga0268264_103740452 309
551 3300031456 Ga0307513_10163172 Ga0307513_101631722 309
552 3300031852 Ga0307410_10001555 Ga0307410_100015558 309
553 3300031995 Ga0307409_100229207 Ga0307409_1002292072 309
554 3300037418 Ga0395900_0254251 Ga0395900_0254251_102_1226 309
555 3300037471 Ga0395905_0220132 Ga0395905_0220132_385_1509 309
556 3300037853 Ga0436364_1342640 Ga0436364_1342640_671_1795 309
557 3300038443 Ga0395901_0056051 Ga0395901_0056051_627_1751 309
558 3300046511 Ga0495608_0040750 Ga0495608_0040750_929_1918 309
559 3300046516 Ga0495628_0015347 Ga0495628_0015347_2817_3806 309
560 3300046517 Ga0495630_0105400 Ga0495630_0105400_1080_2069 309
561 3300046675 Ga0495657_0029527 Ga0495657_0029527_1613_2602 309
562 3300047317 Ga0495604_0007416 Ga0495604_0007416_3210_4199 309
563 3300047444 Ga0495675_0168246 Ga0495675_0168246_323_1312 309
564 3300047471 Ga0495684_0001017 Ga0495684_0001017_12509_13498 309
565 3300048912 Ga0496109_0161631 Ga0496109_0161631_846_1823 309
566 3300048912 Ga0496109_0179131 Ga0496109_0179131_203_1147 309
567 3300048914 Ga0496111_0164779 Ga0496111_0164779_670_1614 309
568 3300048915 Ga0496112_0009411 Ga0496112_0009411_1568_2545 309
569 3300048915 Ga0496112_0467858 Ga0496112_0467858_52_996 309
570 3300048916 Ga0496113_0103915 Ga0496113_0103915_569_1546 309
571 3300005530 Ga0070679_100135881 Ga0070679_1001358812 310
572 3300025921 Ga0207652_10053056 Ga0207652_100530562 310
573 3300048907 Ga0496104_0000629 Ga0496104_0000629_12970_13923 310
574 3300048908 Ga0496105_0051517 Ga0496105_0051517_1031_1984 310
575 3300048908 Ga0496105_0055817 Ga0496105_0055817_196_1152 310
576 3300048912 Ga0496109_0292355 Ga0496109_0292355_311_1267 310
577 3300048916 Ga0496113_0207089 Ga0496113_0207089_37_990 310
578 3300048917 Ga0496114_0199376 Ga0496114_0199376_185_1141 310
579 3300048918 Ga0496115_0019361 Ga0496115_0019361_3006_3962 310
580 3300050493 nmdc:mga0k408_176154_c1 nmdc:mga0k408_176154_c1_81_1034 310
581 3300006173 Ga0070716_100056741 Ga0070716_1000567411 311
582 3300006175 Ga0070712_100018454 Ga0070712_1000184542 311
583 3300025915 Ga0207693_10011631 Ga0207693_100116311 311
584 3300035170 Ga0373943_0049954 Ga0373943_0049954_244_1425 311
585 3300046473 Ga0495582_0045692 Ga0495582_0045692_537_1718 311
586 3300049742 Ga0501080_0150883 Ga0501080_0150883_350_1285 311
587 3300005340 Ga0070689_100241615 Ga0070689_1002416152 312
588 3300005356 Ga0070674_100061668 Ga0070674_1000616682 312
589 3300006051 Ga0075364_10151058 Ga0075364_101510581 312
590 3300025937 Ga0207669_10010994 Ga0207669_100109942 312
591 3300027866 Ga0209813_10019704 Ga0209813_100197042 312
592 3300031616 Ga0307508_10118987 Ga0307508_101189872 312
593 3300033179 Ga0307507_10021651 Ga0307507_100216514 312
594 3300035083 Ga0373926_0003746 Ga0373926_0003746_1298_2287 312
595 3300035111 Ga0373923_0014926 Ga0373923_0014926_1294_2283 312
596 3300035692 Ga0373935_0013406 Ga0373935_0013406_1406_2395 312
597 3300035695 Ga0373927_0013237 Ga0373927_0013237_1187_2176 312
598 3300035724 Ga0373933_0040617 Ga0373933_0040617_678_1667 312
599 3300035725 Ga0373947_0081263 Ga0373947_0081263_892_1881 312
600 3300035725 Ga0373947_0092281 Ga0373947_0092281_752_1840 312
601 3300036401 Ga0373937_0020394 Ga0373937_0020394_71_1060 312
602 3300046454 Ga0495592_0060067 Ga0495592_0060067_1646_2764 312
603 3300046462 Ga0495651_0003700 Ga0495651_0003700_95_1090 312
604 3300046462 Ga0495651_0017221 Ga0495651_0017221_1286_2275 312
605 3300046463 Ga0495653_0005354 Ga0495653_0005354_8867_9985 312
606 3300046463 Ga0495653_0022342 Ga0495653_0022342_774_1763 312
607 3300046472 Ga0495580_0008302 Ga0495580_0008302_357_1346 312
608 3300046477 Ga0495664_0021142 Ga0495664_0021142_1874_2992 312
609 3300046477 Ga0495664_0022622 Ga0495664_0022622_890_1879 312
610 3300046511 Ga0495608_0051857 Ga0495608_0051857_772_1761 312
611 3300046517 Ga0495630_0017063 Ga0495630_0017063_261_1250 312
612 3300046529 Ga0495652_0012012 Ga0495652_0012012_52_1170 312
613 3300046529 Ga0495652_0038611 Ga0495652_0038611_1411_2400 312
614 3300046531 Ga0495665_0019038 Ga0495665_0019038_861_1850 312
615 3300046536 Ga0495587_0006972 Ga0495587_0006972_2496_3614 312
616 3300046536 Ga0495587_0008300 Ga0495587_0008300_3130_4119 312
617 3300046543 Ga0495645_0034846 Ga0495645_0034846_953_1942 312
618 3300046543 Ga0495645_0065843 Ga0495645_0065843_1191_2309 312
619 3300046559 Ga0495667_0001766 Ga0495667_0001766_5041_6012 312
620 3300046559 Ga0495667_0002726 Ga0495667_0002726_9322_10440 312
621 3300046663 Ga0495635_0009050 Ga0495635_0009050_4352_5341 312
622 3300046663 Ga0495635_0039202 Ga0495635_0039202_1023_2141 312
623 3300046675 Ga0495657_0009531 Ga0495657_0009531_2618_3736 312
624 3300046678 Ga0495599_0011681 Ga0495599_0011681_4265_5383 312
625 3300046680 Ga0495646_0007578 Ga0495646_0007578_4504_5493 312
626 3300046689 Ga0495613_0024298 Ga0495613_0024298_772_1761 312
627 3300046690 Ga0495624_0007500 Ga0495624_0007500_3436_4425 312
628 3300046809 Ga0495600_0001469 Ga0495600_0001469_8916_10034 312
629 3300046809 Ga0495600_0014002 Ga0495600_0014002_1234_2205 312
630 3300047317 Ga0495604_0001664 Ga0495604_0001664_2668_3786 312
631 3300047317 Ga0495604_0018395 Ga0495604_0018395_1171_2160 312
632 3300047317 Ga0495604_0247359 Ga0495604_0247359_121_1092 312
633 3300047319 Ga0495674_0037720 Ga0495674_0037720_446_1564 312
634 3300047319 Ga0495674_0053620 Ga0495674_0053620_946_1935 312
635 3300047322 Ga0495680_0000648 Ga0495680_0000648_24253_25224 312
636 3300047322 Ga0495680_0020176 Ga0495680_0020176_4542_5537 312
637 3300047444 Ga0495675_0000643 Ga0495675_0000643_17917_19035 312
638 3300047444 Ga0495675_0026266 Ga0495675_0026266_807_1796 312
639 3300047444 Ga0495675_0027252 Ga0495675_0027252_293_1264 312
640 3300047471 Ga0495684_0002508 Ga0495684_0002508_614_1732 312
641 3300047673 Ga0495593_0007923 Ga0495593_0007923_748_1737 312
642 3300048088 Ga0495602_0028473 Ga0495602_0028473_1518_2636 312
643 3300048088 Ga0495602_0096714 Ga0495602_0096714_1147_2136 312
644 3300048088 Ga0495602_0197203 Ga0495602_0197203_29_1018 312
645 3300050496 nmdc:mga07m45_41932_c1 nmdc:mga07m45_41932_c1_1318_2280 312
646 3300053078 Ga0495612_0002024 Ga0495612_0002024_2496_3485 312
647 3300013104 Ga0157370_10108970 Ga0157370_101089702 313
648 3300025917 Ga0207660_10277032 Ga0207660_102770322 313
649 3300049586 Ga0501070_0091316 Ga0501070_0091316_245_1201 313
650 3300049590 Ga0501074_0124226 Ga0501074_0124226_563_1519 313
651 3300003215 JGI25153J46596_10001600 JGI25153J46596_1000160011 315
652 3300003215 JGI25153J46596_10003919 JGI25153J46596_100039198 315
653 3300005328 Ga0070676_10006719 Ga0070676_100067195 315
654 3300005330 Ga0070690_100148028 Ga0070690_1001480282 315
655 3300005331 Ga0070670_100008155 Ga0070670_1000081553 315
656 3300005336 Ga0070680_100001601 Ga0070680_1000016017 315
657 3300005338 Ga0068868_100010138 Ga0068868_1000101384 315
658 3300005347 Ga0070668_100133205 Ga0070668_1001332051 315
659 3300005347 Ga0070668_100187874 Ga0070668_1001878742 315
660 3300005354 Ga0070675_100039312 Ga0070675_1000393123 315
661 3300005355 Ga0070671_100054636 Ga0070671_1000546362 315
662 3300005355 Ga0070671_100057104 Ga0070671_1000571043 315
663 3300005356 Ga0070674_100093025 Ga0070674_1000930252 315
664 3300005364 Ga0070673_100123210 Ga0070673_1001232102 315
665 3300005365 Ga0070688_100118618 Ga0070688_1001186182 315
666 3300005441 Ga0070700_100155415 Ga0070700_1001554151 315
667 3300005456 Ga0070678_100531369 Ga0070678_1005313691 315
668 3300005458 Ga0070681_10010586 Ga0070681_100105866 315
669 3300005459 Ga0068867_100091715 Ga0068867_1000917152 315
670 3300005459 Ga0068867_100188936 Ga0068867_1001889362 315
671 3300005466 Ga0070685_10060997 Ga0070685_100609972 315
672 3300005530 Ga0070679_100003445 Ga0070679_10000344511 315
673 3300005535 Ga0070684_100098494 Ga0070684_1000984942 315
674 3300005543 Ga0070672_100024538 Ga0070672_1000245382 315
675 3300005578 Ga0068854_100104443 Ga0068854_1001044432 315
676 3300005616 Ga0068852_100024490 Ga0068852_1000244904 315
677 3300005617 Ga0068859_100093499 Ga0068859_1000934992 315
678 3300005617 Ga0068859_100121663 Ga0068859_1001216633 315
679 3300005618 Ga0068864_100282554 Ga0068864_1002825541 315
680 3300005718 Ga0068866_10091640 Ga0068866_100916401 315
681 3300005840 Ga0068870_10028970 Ga0068870_100289702 315
682 3300005841 Ga0068863_100020579 Ga0068863_1000205792 315
683 3300005842 Ga0068858_100106780 Ga0068858_1001067802 315
684 3300005843 Ga0068860_100042971 Ga0068860_1000429712 315
685 3300005843 Ga0068860_100534885 Ga0068860_1005348852 315
686 3300005985 Ga0081539_10015961 Ga0081539_100159612 315
687 3300006038 Ga0075365_10131461 Ga0075365_101314612 315
688 3300006042 Ga0075368_10012864 Ga0075368_100128642 315
689 3300006048 Ga0075363_100023423 Ga0075363_1000234232 315
690 3300006051 Ga0075364_10247121 Ga0075364_102471211 315
691 3300006175 Ga0070712_100192442 Ga0070712_1001924422 315
692 3300006178 Ga0075367_10058435 Ga0075367_100584353 315
693 3300006178 Ga0075367_10156001 Ga0075367_101560012 315
694 3300006195 Ga0075366_10002637 Ga0075366_1000263712 315
695 3300006353 Ga0075370_10004386 Ga0075370_100043867 315
696 3300006844 Ga0075428_100134776 Ga0075428_1001347761 315
697 3300006871 Ga0075434_100046742 Ga0075434_1000467423 315
698 3300006880 Ga0075429_100112864 Ga0075429_1001128642 315
699 3300006881 Ga0068865_100089042 Ga0068865_1000890422 315
700 3300006931 Ga0097620_100093498 Ga0097620_1000934982 315
701 3300006931 Ga0097620_100121665 Ga0097620_1001216652 315
702 3300009094 Ga0111539_10024789 Ga0111539_100247896 315
703 3300009094 Ga0111539_10332176 Ga0111539_103321761 315
704 3300009098 Ga0105245_10048198 Ga0105245_100481983 315
705 3300009101 Ga0105247_10006463 Ga0105247_100064631 315
706 3300009147 Ga0114129_10093819 Ga0114129_100938193 315
707 3300009147 Ga0114129_10203432 Ga0114129_102034322 315
708 3300009148 Ga0105243_10121583 Ga0105243_101215832 315
709 3300009176 Ga0105242_10033080 Ga0105242_100330803 315
710 3300009177 Ga0105248_10024707 Ga0105248_100247074 315
711 3300013306 Ga0163162_10076918 Ga0163162_100769183 315
712 3300013308 Ga0157375_10244923 Ga0157375_102449232 315
713 3300014326 Ga0157380_10005881 Ga0157380_100058814 315
714 3300014326 Ga0157380_10382003 Ga0157380_103820031 315
715 3300025297 Ga0209758_1005734 Ga0209758_10057342 315
716 3300025893 Ga0207682_10035721 Ga0207682_100357212 315
717 3300025900 Ga0207710_10006028 Ga0207710_100060282 315
718 3300025901 Ga0207688_10000663 Ga0207688_100006634 315
719 3300025901 Ga0207688_10200083 Ga0207688_102000831 315
720 3300025904 Ga0207647_10029447 Ga0207647_100294472 315
721 3300025907 Ga0207645_10031160 Ga0207645_100311603 315
722 3300025907 Ga0207645_10290694 Ga0207645_102906941 315
723 3300025908 Ga0207643_10000808 Ga0207643_100008085 315
724 3300025912 Ga0207707_10021068 Ga0207707_100210683 315
725 3300025916 Ga0207663_10040483 Ga0207663_100404832 315
726 3300025917 Ga0207660_10252796 Ga0207660_102527962 315
727 3300025919 Ga0207657_10021585 Ga0207657_100215853 315
728 3300025921 Ga0207652_10088894 Ga0207652_100888942 315
729 3300025923 Ga0207681_10020177 Ga0207681_100201772 315
730 3300025933 Ga0207706_10007308 Ga0207706_100073089 315
731 3300025934 Ga0207686_10045010 Ga0207686_100450102 315
732 3300025936 Ga0207670_10001103 Ga0207670_1000110310 315
733 3300025937 Ga0207669_10099697 Ga0207669_100996972 315
734 3300025940 Ga0207691_10011566 Ga0207691_100115665 315
735 3300025940 Ga0207691_10171199 Ga0207691_101711992 315
736 3300025940 Ga0207691_10226751 Ga0207691_102267512 315
737 3300025941 Ga0207711_10034011 Ga0207711_100340113 315
738 3300025960 Ga0207651_10083250 Ga0207651_100832502 315
739 3300026023 Ga0207677_10054923 Ga0207677_100549234 315
740 3300026067 Ga0207678_10209985 Ga0207678_102099852 315
741 3300026075 Ga0207708_10017098 Ga0207708_100170984 315
742 3300026075 Ga0207708_10160293 Ga0207708_101602932 315
743 3300026089 Ga0207648_10021939 Ga0207648_100219392 315
744 3300026089 Ga0207648_10041396 Ga0207648_100413964 315
745 3300026121 Ga0207683_10002624 Ga0207683_1000262412 315
746 3300026121 Ga0207683_10094760 Ga0207683_100947604 315
747 3300026142 Ga0207698_10078798 Ga0207698_100787983 315
748 3300027907 Ga0207428_10185877 Ga0207428_101858772 315
749 3300028379 Ga0268266_10249683 Ga0268266_102496832 315
750 3300028381 Ga0268264_10024308 Ga0268264_100243082 315
751 3300028381 Ga0268264_10115629 Ga0268264_101156292 315
752 3300031241 Ga0265325_10000300 Ga0265325_1000030027 315
753 3300031241 Ga0265325_10066760 Ga0265325_100667602 315
754 3300031247 Ga0265340_10013459 Ga0265340_100134594 315
755 3300031249 Ga0265339_10077022 Ga0265339_100770222 315
756 3300034819 Ga0373958_0003514 Ga0373958_0003514_20_967 315
757 3300035114 Ga0373939_0045084 Ga0373939_0045084_179_1126 315
758 3300035241 Ga0373961_0021220 Ga0373961_0021220_690_1637 315
759 3300035691 Ga0373931_0005266 Ga0373931_0005266_1201_2148 315
760 3300035691 Ga0373931_0028508 Ga0373931_0028508_487_1434 315
761 3300035692 Ga0373935_0095845 Ga0373935_0095845_426_1373 315
762 3300036401 Ga0373937_0151708 Ga0373937_0151708_229_1176 315
763 3300037068 Ga0373925_0049808 Ga0373925_0049808_1015_1962 315
764 3300037068 Ga0373925_0156901 Ga0373925_0156901_294_1442 315
765 3300046455 Ga0495603_0116302 Ga0495603_0116302_395_1543 315
766 3300046455 Ga0495603_0202319 Ga0495603_0202319_152_1099 315
767 3300046492 Ga0495585_0072556 Ga0495585_0072556_97_1245 315
768 3300046516 Ga0495628_0251985 Ga0495628_0251985_20_967 315
769 3300046517 Ga0495630_0115118 Ga0495630_0115118_104_1249 315
770 3300046523 Ga0495644_0021615 Ga0495644_0021615_358_1410 315
771 3300046537 Ga0495598_0047802 Ga0495598_0047802_161_1213 315
772 3300046539 Ga0495621_0048496 Ga0495621_0048496_98_1150 315
773 3300046557 Ga0495622_0091214 Ga0495622_0091214_95_1123 315
774 3300046558 Ga0495633_0079489 Ga0495633_0079489_198_1250 315
775 3300046558 Ga0495633_0089526 Ga0495633_0089526_252_1403 315
776 3300046664 Ga0495659_0034039 Ga0495659_0034039_500_1519 315
777 3300046665 Ga0495661_0131790 Ga0495661_0131790_155_1207 315
778 3300046690 Ga0495624_0047148 Ga0495624_0047148_1422_2570 315
779 3300046794 Ga0495589_0038877 Ga0495589_0038877_528_1580 315
780 3300047319 Ga0495674_0140076 Ga0495674_0140076_891_1838 315
781 3300047319 Ga0495674_0309214 Ga0495674_0309214_123_1175 315
782 3300048903 Ga0496100_0042248 Ga0496100_0042248_813_1760 315
783 3300048903 Ga0496100_0386280 Ga0496100_0386280_31_978 315
784 3300048904 Ga0496101_0044456 Ga0496101_0044456_286_1317 315
785 3300048904 Ga0496101_0047499 Ga0496101_0047499_913_1860 315
786 3300048906 Ga0496103_0009597 Ga0496103_0009597_732_1784 315
787 3300048907 Ga0496104_0034040 Ga0496104_0034040_448_1500 315
788 3300048908 Ga0496105_0019396 Ga0496105_0019396_3718_4749 315
789 3300048908 Ga0496105_0019467 Ga0496105_0019467_1461_2513 315
790 3300048909 Ga0496106_0352882 Ga0496106_0352882_100_1131 315
791 3300048910 Ga0496107_0015140 Ga0496107_0015140_536_1588 315
792 3300048911 Ga0496108_0008275 Ga0496108_0008275_3824_4855 315
793 3300048911 Ga0496108_0039962 Ga0496108_0039962_2189_3136 315
794 3300048911 Ga0496108_0065021 Ga0496108_0065021_1342_2394 315
795 3300048912 Ga0496109_0000766 Ga0496109_0000766_9105_10136 315
796 3300048912 Ga0496109_0025633 Ga0496109_0025633_3970_5022 315
797 3300048912 Ga0496109_0061682 Ga0496109_0061682_25_972 315
798 3300048912 Ga0496109_0077486 Ga0496109_0077486_623_1570 315
799 3300048913 Ga0496110_0002398 Ga0496110_0002398_737_1768 315
800 3300048913 Ga0496110_0013610 Ga0496110_0013610_1826_2878 315
801 3300048914 Ga0496111_0020931 Ga0496111_0020931_1288_2340 315
802 3300048914 Ga0496111_0352688 Ga0496111_0352688_57_1004 315
803 3300048915 Ga0496112_0001055 Ga0496112_0001055_12500_13531 315
804 3300048915 Ga0496112_0031686 Ga0496112_0031686_1406_2458 315
805 3300048915 Ga0496112_0090177 Ga0496112_0090177_1500_2447 315
806 3300048916 Ga0496113_0000323 Ga0496113_0000323_9845_10876 315
807 3300048916 Ga0496113_0022159 Ga0496113_0022159_2216_3268 315
808 3300048917 Ga0496114_0079340 Ga0496114_0079340_1058_2110 315
809 3300048918 Ga0496115_0016209 Ga0496115_0016209_3376_4428 315
810 3300048918 Ga0496115_0159256 Ga0496115_0159256_503_1654 315
811 3300049569 Ga0501032_0078449 Ga0501032_0078449_374_1324 315
812 3300049570 Ga0501033_0012886 Ga0501033_0012886_4852_5802 315
813 3300049571 Ga0501034_0018046 Ga0501034_0018046_1919_2869 315
814 3300049571 Ga0501034_0175476 Ga0501034_0175476_490_1440 315
815 3300049572 Ga0501036_0004687 Ga0501036_0004687_9864_10814 315
816 3300049573 Ga0501037_0005982 Ga0501037_0005982_656_1606 315
817 3300049575 Ga0501039_0001438 Ga0501039_0001438_2907_3857 315
818 3300049578 Ga0501042_0272635 Ga0501042_0272635_227_1177 315
819 3300049580 Ga0501046_0010334 Ga0501046_0010334_2259_3209 315
820 3300049582 Ga0501048_0004490 Ga0501048_0004490_6099_7049 315
821 3300049584 Ga0501068_0011406 Ga0501068_0011406_1909_2859 315
822 3300049585 Ga0501069_0006487 Ga0501069_0006487_352_1302 315
823 3300049587 Ga0501071_0023104 Ga0501071_0023104_1848_2798 315
824 3300049592 Ga0501076_0420531 Ga0501076_0420531_16_966 315
825 3300049822 Ga0501035_0014526 Ga0501035_0014526_6132_7082 315
826 3300049823 Ga0501044_0000193 Ga0501044_0000193_25094_26044 315
827 3300049823 Ga0501044_0026928 Ga0501044_0026928_662_1612 315
828 3300049823 Ga0501044_0251692 Ga0501044_0251692_156_1106 315
829 3300049824 Ga0501045_0024198 Ga0501045_0024198_3387_4337 315
830 3300050490 nmdc:mga03n38_79608_c1 nmdc:mga03n38_79608_c1_551_1498 315
831 3300050492 nmdc:mga0yw44_76447_c1 nmdc:mga0yw44_76447_c1_208_1155 315
832 3300050493 nmdc:mga0k408_28442_c1 nmdc:mga0k408_28442_c1_153_1154 315
833 3300050495 nmdc:mga04h51_100902_c1 nmdc:mga04h51_100902_c1_21_1040 315
834 3300050496 nmdc:mga07m45_14539_c2 nmdc:mga07m45_14539_c2_132_1133 315
835 3300050496 nmdc:mga07m45_7395_c1 nmdc:mga07m45_7395_c1_3389_4390 315
836 3300050507 nmdc:mga05p37_533843_c1 nmdc:mga05p37_533843_c1_377_1324 315
837 3300050507 nmdc:mga05p37_75490_c1 nmdc:mga05p37_75490_c1_1027_2058 315
838 3300050512 nmdc:mga0n895_33930_c1 nmdc:mga0n895_33930_c1_1934_2965 315
839 3300053077 Ga0495601_0029040 Ga0495601_0029040_350_1402 315
840 3300053077 Ga0495601_0074252 Ga0495601_0074252_513_1460 315
841 3300053088 Ga0500644_0116885 Ga0500644_0116885_46_993 315
842 3300053096 Ga0500641_0127855 Ga0500641_0127855_131_1078 315
843 3300053119 Ga0500595_008487 Ga0500595_008487_744_1691 315
844 3300053153 Ga0500616_0098680 Ga0500616_0098680_383_1330 315
845 3300054114 Ga0501084_0212319 Ga0501084_0212319_372_1319 315
846 3300060353 Ga0501082_0006937 Ga0501082_0006937_2445_3395 315
847 3300060353 Ga0501082_0100515 Ga0501082_0100515_465_1412 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

70

381

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.9009 2 311
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.8963 5 312
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.8906 5 312
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.8848 2 311
2dvt-assembly1.cif.gz_C crystal structure of 2,6-dihydroxybenzoate decarboxylase from rhizobium 0.8775 1 311
ID Description Score Start End Superfamily
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8961 5 312 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8904 5 312 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8661 5 311 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8543 5 311 3.20.20.140
4lalD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8535 5 311 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A127EPW6-F1-model_v4 Metal-dependent hydrolase 0.9993 1 315 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3P4B6C2-F1-model_v4 Amidohydrolase 0.9872 1 313 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A844Z3T8-F1-model_v4 Amidohydrolase family protein 0.9822 5 313 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A552UF10-F1-model_v4 Amidohydrolase 0.981 5 311 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3P4B6C2-F1-model_v4 Amidohydrolase 0.9748 1 313 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
95.12 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map