F483316
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 847 | 337 | 841 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100010138|Ga0068868_1000101384 |
| Length | 385 |
| Sequence | MTMHVGVGESASRPISRFRHGFAACAGCCEPRRSSLAFSATGVPATKKAPKGKSDTGRQNGAAAAKPHRIDVHHHIVPPRYVTDMGLKWVNRHNAPLPLHGPLQWTPEQSIAEMDRNGVATAITSLSDPGVWSGDVARSRSVARYCNDYAAQLARDYPGRFGVFASLAPPDIEGSLREIEYAFDVLGADGIVLMTSYGDRWPGDAAFAPVFDELNRRKAVVYFHPTAAPCCEGLIPDVADAVVEFLFDTVRAVTSLLYSGTLSRCSDIRYIFSHAGSAVPLLAGRISRLARITEAVNPRLPNGAMHELKRLYYDVAQQASPEGLVPLMTLVSADQVLFGSDYPWAPPGMMAQTVAGLAAFGFQPDELQAIERGNALRLFPRFAQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.38 |
| Nodule | 0 |
| Rhizoplane | 6.26 |
| Rhizosphere | 86.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001600 | 3300003215 | Bacteria | 13420 |
| 2 | JGI25153J46596_10003919 | 3300003215 | Bacteria | 8164 |
| 3 | Ga0065715_10007812 | 3300005293 | Unclassified | 2592 |
| 4 | Ga0070658_10031050 | 3300005327 | Bacteria | 4290 |
| 5 | Ga0070676_10006719 | 3300005328 | Bacteria | 6163 |
| 6 | Ga0070683_100005567 | 3300005329 | Bacteria | 10516 |
| 7 | Ga0070683_100251336 | 3300005329 | Bacteria | 1681 |
| 8 | Ga0070690_100035776 | 3300005330 | Bacteria | 3118 |
| 9 | Ga0070690_100148028 | 3300005330 | Bacteria | 1599 |
| 10 | Ga0070670_100000360 | 3300005331 | Bacteria | 38098 |
| 11 | Ga0070670_100004292 | 3300005331 | Bacteria | 11933 |
| 12 | Ga0070670_100008155 | 3300005331 | Bacteria | 8918 |
| 13 | Ga0068869_100022698 | 3300005334 | Bacteria | 4327 |
| 14 | Ga0068869_100155068 | 3300005334 | Unclassified | 1779 |
| 15 | Ga0070666_10003141 | 3300005335 | Bacteria | 10030 |
| 16 | Ga0070680_100001073 | 3300005336 | Bacteria | 19625 |
| 17 | Ga0070680_100001601 | 3300005336 | Bacteria | 16529 |
| 18 | Ga0070680_100013675 | 3300005336 | Bacteria | 6327 |
| 19 | Ga0070680_100084397 | 3300005336 | Bacteria | 2623 |
| 20 | Ga0070680_100089716 | 3300005336 | Bacteria | 2544 |
| 21 | Ga0070680_100121819 | 3300005336 | Bacteria | 2178 |
| 22 | Ga0070680_100153483 | 3300005336 | Bacteria | 1934 |
| 23 | Ga0070680_100240301 | 3300005336 | Bacteria | 1531 |
| 24 | Ga0068868_100001821 | 3300005338 | Bacteria | 14654 |
| 25 | Ga0068868_100009212 | 3300005338 | Bacteria | 7094 |
| 26 | Ga0068868_100010138 | 3300005338 | Bacteria | 6809 |
| 27 | Ga0070660_100004998 | 3300005339 | Bacteria | 9169 |
| 28 | Ga0070660_100237426 | 3300005339 | Unclassified | 1484 |
| 29 | Ga0070689_100008822 | 3300005340 | Bacteria | 7121 |
| 30 | Ga0070689_100070073 | 3300005340 | Bacteria | 2736 |
| 31 | Ga0070689_100241615 | 3300005340 | Bacteria | 1487 |
| 32 | Ga0070691_10046989 | 3300005341 | Unclassified | 2052 |
| 33 | Ga0070687_100020116 | 3300005343 | Bacteria | 3116 |
| 34 | Ga0070687_100023314 | 3300005343 | Unclassified | 2941 |
| 35 | Ga0070661_100000772 | 3300005344 | Bacteria | 23116 |
| 36 | Ga0070661_100036427 | 3300005344 | Bacteria | 3576 |
| 37 | Ga0070661_100049114 | 3300005344 | Bacteria | 3089 |
| 38 | Ga0070661_100425122 | 3300005344 | Bacteria | 1054 |
| 39 | Ga0070692_10022678 | 3300005345 | Bacteria | 3069 |
| 40 | Ga0070668_100090479 | 3300005347 | Bacteria | 2411 |
| 41 | Ga0070668_100133205 | 3300005347 | Unclassified | 1996 |
| 42 | Ga0070668_100187874 | 3300005347 | Bacteria | 1691 |
| 43 | Ga0070675_100039312 | 3300005354 | Bacteria | 3860 |
| 44 | Ga0070675_100201549 | 3300005354 | Unclassified | 1727 |
| 45 | Ga0070671_100001024 | 3300005355 | Bacteria | 20538 |
| 46 | Ga0070671_100010061 | 3300005355 | Bacteria | 7596 |
| 47 | Ga0070671_100054636 | 3300005355 | Bacteria | 3321 |
| 48 | Ga0070671_100057104 | 3300005355 | Bacteria | 3247 |
| 49 | Ga0070674_100061668 | 3300005356 | Bacteria | 2618 |
| 50 | Ga0070674_100093025 | 3300005356 | Bacteria | 2181 |
| 51 | Ga0070673_100000234 | 3300005364 | Bacteria | 27814 |
| 52 | Ga0070673_100123210 | 3300005364 | Bacteria | 2166 |
| 53 | Ga0070673_100129972 | 3300005364 | Bacteria | 2112 |
| 54 | Ga0070673_100167049 | 3300005364 | Bacteria | 1876 |
| 55 | Ga0070688_100061740 | 3300005365 | Bacteria | 2370 |
| 56 | Ga0070688_100102529 | 3300005365 | Bacteria | 1889 |
| 57 | Ga0070688_100118618 | 3300005365 | Bacteria | 1769 |
| 58 | Ga0070688_100226817 | 3300005365 | Bacteria | 1319 |
| 59 | Ga0070659_100092341 | 3300005366 | Bacteria | 2427 |
| 60 | Ga0070659_100138977 | 3300005366 | Bacteria | 1977 |
| 61 | Ga0070667_100014038 | 3300005367 | Bacteria | 6621 |
| 62 | Ga0070667_100014411 | 3300005367 | Bacteria | 6533 |
| 63 | Ga0070667_100211413 | 3300005367 | Unclassified | 1724 |
| 64 | Ga0070709_10014066 | 3300005434 | Bacteria | 4517 |
| 65 | Ga0070714_100001344 | 3300005435 | Bacteria | 17780 |
| 66 | Ga0070714_100020981 | 3300005435 | Bacteria | 5341 |
| 67 | Ga0070714_100035257 | 3300005435 | Bacteria | 4193 |
| 68 | Ga0070713_100001547 | 3300005436 | Bacteria | 14707 |
| 69 | Ga0070713_100065329 | 3300005436 | Bacteria | 3056 |
| 70 | Ga0070713_100068666 | 3300005436 | Bacteria | 2987 |
| 71 | Ga0070713_100194615 | 3300005436 | Bacteria | 1828 |
| 72 | Ga0070701_10053981 | 3300005438 | Unclassified | 2094 |
| 73 | Ga0070711_100335680 | 3300005439 | Bacteria | 1211 |
| 74 | Ga0070700_100155415 | 3300005441 | Bacteria | 1569 |
| 75 | Ga0070694_100023040 | 3300005444 | Bacteria | 3998 |
| 76 | Ga0070694_100070229 | 3300005444 | Bacteria | 2411 |
| 77 | Ga0070663_100008942 | 3300005455 | Bacteria | 6186 |
| 78 | Ga0070678_100000029 | 3300005456 | Bacteria | 45879 |
| 79 | Ga0070678_100047842 | 3300005456 | Bacteria | 3076 |
| 80 | Ga0070678_100531369 | 3300005456 | Bacteria | 1042 |
| 81 | Ga0070662_100069230 | 3300005457 | Unclassified | 2596 |
| 82 | Ga0070681_10001127 | 3300005458 | Bacteria | 22938 |
| 83 | Ga0070681_10003861 | 3300005458 | Bacteria | 14104 |
| 84 | Ga0070681_10010586 | 3300005458 | Bacteria | 9111 |
| 85 | Ga0070681_10013126 | 3300005458 | Bacteria | 8229 |
| 86 | Ga0070681_10027003 | 3300005458 | Bacteria | 5772 |
| 87 | Ga0070681_10047532 | 3300005458 | Unclassified | 4290 |
| 88 | Ga0070681_10085053 | 3300005458 | Bacteria | 3116 |
| 89 | Ga0070681_10112684 | 3300005458 | Bacteria | 2660 |
| 90 | Ga0070681_10125886 | 3300005458 | Bacteria | 2495 |
| 91 | Ga0070681_10131109 | 3300005458 | Bacteria | 2439 |
| 92 | Ga0070681_10420970 | 3300005458 | Unclassified | 1248 |
| 93 | Ga0068867_100013424 | 3300005459 | Bacteria | 5803 |
| 94 | Ga0068867_100014340 | 3300005459 | Bacteria | 5614 |
| 95 | Ga0068867_100084333 | 3300005459 | Bacteria | 2400 |
| 96 | Ga0068867_100091715 | 3300005459 | Bacteria | 2307 |
| 97 | Ga0068867_100126649 | 3300005459 | Bacteria | 1980 |
| 98 | Ga0068867_100188936 | 3300005459 | Unclassified | 1642 |
| 99 | Ga0070685_10040207 | 3300005466 | Unclassified | 2660 |
| 100 | Ga0070685_10060997 | 3300005466 | Bacteria | 2207 |
| 101 | Ga0070699_100045216 | 3300005518 | Bacteria | 3811 |
| 102 | Ga0070679_100000747 | 3300005530 | Bacteria | 28132 |
| 103 | Ga0070679_100003445 | 3300005530 | Bacteria | 14489 |
| 104 | Ga0070679_100012721 | 3300005530 | Bacteria | 8048 |
| 105 | Ga0070679_100105672 | 3300005530 | Bacteria | 2801 |
| 106 | Ga0070679_100119144 | 3300005530 | Bacteria | 2624 |
| 107 | Ga0070679_100126401 | 3300005530 | Bacteria | 2539 |
| 108 | Ga0070679_100132597 | 3300005530 | Bacteria | 2472 |
| 109 | Ga0070679_100135881 | 3300005530 | Bacteria | 2440 |
| 110 | Ga0070679_100167854 | 3300005530 | Bacteria | 2168 |
| 111 | Ga0070679_100182842 | 3300005530 | Bacteria | 2068 |
| 112 | Ga0070684_100041950 | 3300005535 | Unclassified | 3948 |
| 113 | Ga0070684_100045575 | 3300005535 | Bacteria | 3797 |
| 114 | Ga0070684_100075718 | 3300005535 | Unclassified | 2969 |
| 115 | Ga0070684_100098494 | 3300005535 | Bacteria | 2608 |
| 116 | Ga0070684_100306894 | 3300005535 | Unclassified | 1457 |
| 117 | Ga0070684_100554897 | 3300005535 | Bacteria | 1066 |
| 118 | Ga0068853_100070760 | 3300005539 | Unclassified | 3037 |
| 119 | Ga0068853_100080699 | 3300005539 | Bacteria | 2847 |
| 120 | Ga0070672_100000952 | 3300005543 | Bacteria | 17440 |
| 121 | Ga0070672_100024538 | 3300005543 | Bacteria | 4459 |
| 122 | Ga0070672_100030395 | 3300005543 | Bacteria | 4057 |
| 123 | Ga0070672_100063647 | 3300005543 | Unclassified | 2913 |
| 124 | Ga0070695_100283595 | 3300005545 | Bacteria | 1218 |
| 125 | Ga0070696_100116697 | 3300005546 | Bacteria | 1928 |
| 126 | Ga0070665_100080630 | 3300005548 | Unclassified | 3260 |
| 127 | Ga0070665_100143329 | 3300005548 | Unclassified | 2392 |
| 128 | Ga0070704_100004501 | 3300005549 | Bacteria | 8048 |
| 129 | Ga0068855_100004131 | 3300005563 | Bacteria | 17708 |
| 130 | Ga0068855_100056524 | 3300005563 | Bacteria | 4604 |
| 131 | Ga0068855_100082843 | 3300005563 | Bacteria | 3717 |
| 132 | Ga0068855_100160584 | 3300005563 | Bacteria | 2551 |
| 133 | Ga0068855_100222282 | 3300005563 | Bacteria | 2117 |
| 134 | Ga0070664_100001531 | 3300005564 | Bacteria | 18459 |
| 135 | Ga0070664_100008176 | 3300005564 | Bacteria | 8456 |
| 136 | Ga0070664_100008202 | 3300005564 | Bacteria | 8448 |
| 137 | Ga0070664_100085893 | 3300005564 | Bacteria | 2718 |
| 138 | Ga0070664_100093464 | 3300005564 | Unclassified | 2606 |
| 139 | Ga0070664_100117409 | 3300005564 | Unclassified | 2327 |
| 140 | Ga0068857_100002292 | 3300005577 | Bacteria | 15564 |
| 141 | Ga0068857_100003096 | 3300005577 | Bacteria | 13761 |
| 142 | Ga0068857_100028101 | 3300005577 | Bacteria | 4961 |
| 143 | Ga0068857_100039051 | 3300005577 | Unclassified | 4204 |
| 144 | Ga0068857_100040629 | 3300005577 | Bacteria | 4125 |
| 145 | Ga0068857_100172853 | 3300005577 | Bacteria | 1964 |
| 146 | Ga0068857_100359503 | 3300005577 | Unclassified | 1349 |
| 147 | Ga0068854_100000507 | 3300005578 | Bacteria | 23751 |
| 148 | Ga0068854_100104443 | 3300005578 | Bacteria | 2128 |
| 149 | Ga0068856_100005189 | 3300005614 | Bacteria | 12860 |
| 150 | Ga0068856_100045474 | 3300005614 | Bacteria | 4323 |
| 151 | Ga0068856_100140700 | 3300005614 | Unclassified | 2420 |
| 152 | Ga0068856_100294430 | 3300005614 | Unclassified | 1640 |
| 153 | Ga0068856_100398118 | 3300005614 | Bacteria | 1397 |
| 154 | Ga0068852_100000304 | 3300005616 | Bacteria | 33142 |
| 155 | Ga0068852_100001579 | 3300005616 | Bacteria | 15484 |
| 156 | Ga0068852_100024490 | 3300005616 | Bacteria | 4879 |
| 157 | Ga0068859_100008832 | 3300005617 | Bacteria | 10175 |
| 158 | Ga0068859_100083699 | 3300005617 | Bacteria | 3234 |
| 159 | Ga0068859_100093499 | 3300005617 | Bacteria | 3058 |
| 160 | Ga0068859_100121663 | 3300005617 | Bacteria | 2677 |
| 161 | Ga0068859_100380404 | 3300005617 | Unclassified | 1507 |
| 162 | Ga0068864_100008517 | 3300005618 | Bacteria | 8461 |
| 163 | Ga0068864_100013302 | 3300005618 | Bacteria | 6815 |
| 164 | Ga0068864_100159953 | 3300005618 | Unclassified | 2047 |
| 165 | Ga0068864_100282554 | 3300005618 | Bacteria | 1549 |
| 166 | Ga0068866_10012323 | 3300005718 | Bacteria | 3724 |
| 167 | Ga0068866_10091640 | 3300005718 | Unclassified | 1656 |
| 168 | Ga0068861_100010480 | 3300005719 | Bacteria | 6433 |
| 169 | Ga0068851_10003179 | 3300005834 | Bacteria | 7280 |
| 170 | Ga0068851_10015788 | 3300005834 | Bacteria | 3604 |
| 171 | Ga0068870_10016862 | 3300005840 | Bacteria | 3501 |
| 172 | Ga0068870_10028970 | 3300005840 | Bacteria | 2785 |
| 173 | Ga0068863_100016598 | 3300005841 | Bacteria | 7066 |
| 174 | Ga0068863_100020579 | 3300005841 | Bacteria | 6306 |
| 175 | Ga0068863_100118268 | 3300005841 | Bacteria | 2526 |
| 176 | Ga0068863_100129941 | 3300005841 | Bacteria | 2404 |
| 177 | Ga0068863_100441823 | 3300005841 | Bacteria | 1276 |
| 178 | Ga0068863_100553194 | 3300005841 | Unclassified | 1136 |
| 179 | Ga0068858_100011311 | 3300005842 | Bacteria | 8431 |
| 180 | Ga0068858_100015894 | 3300005842 | Bacteria | 7073 |
| 181 | Ga0068858_100106780 | 3300005842 | Bacteria | 2613 |
| 182 | Ga0068858_100165648 | 3300005842 | Bacteria | 2083 |
| 183 | Ga0068858_100266687 | 3300005842 | Bacteria | 1629 |
| 184 | Ga0068860_100012074 | 3300005843 | Bacteria | 8505 |
| 185 | Ga0068860_100042971 | 3300005843 | Bacteria | 4313 |
| 186 | Ga0068860_100044476 | 3300005843 | Bacteria | 4232 |
| 187 | Ga0068860_100240848 | 3300005843 | Unclassified | 1759 |
| 188 | Ga0068860_100286267 | 3300005843 | Bacteria | 1611 |
| 189 | Ga0068860_100534885 | 3300005843 | Bacteria | 1173 |
| 190 | Ga0068862_100004017 | 3300005844 | Bacteria | 12473 |
| 191 | Ga0068862_100043818 | 3300005844 | Bacteria | 3815 |
| 192 | Ga0081539_10015961 | 3300005985 | Bacteria | 5409 |
| 193 | Ga0075365_10028321 | 3300006038 | Bacteria | 3573 |
| 194 | Ga0075365_10029767 | 3300006038 | Bacteria | 3493 |
| 195 | Ga0075365_10067402 | 3300006038 | Bacteria | 2403 |
| 196 | Ga0075365_10131461 | 3300006038 | Bacteria | 1732 |
| 197 | Ga0075368_10012864 | 3300006042 | Bacteria | 3064 |
| 198 | Ga0075363_100007008 | 3300006048 | Bacteria | 5153 |
| 199 | Ga0075363_100008158 | 3300006048 | Bacteria | 4862 |
| 200 | Ga0075363_100023423 | 3300006048 | Bacteria | 3129 |
| 201 | Ga0075364_10013177 | 3300006051 | Bacteria | 5075 |
| 202 | Ga0075364_10151058 | 3300006051 | Bacteria | 1565 |
| 203 | Ga0075364_10247121 | 3300006051 | Bacteria | 1212 |
| 204 | Ga0070715_10039124 | 3300006163 | Unclassified | 1973 |
| 205 | Ga0070716_100056741 | 3300006173 | Bacteria | 2247 |
| 206 | Ga0070712_100018454 | 3300006175 | Bacteria | 4532 |
| 207 | Ga0070712_100192442 | 3300006175 | Bacteria | 1597 |
| 208 | Ga0075362_10001351 | 3300006177 | Bacteria | 7761 |
| 209 | Ga0075362_10086549 | 3300006177 | Bacteria | 1450 |
| 210 | Ga0075367_10058435 | 3300006178 | Bacteria | 2295 |
| 211 | Ga0075367_10156001 | 3300006178 | Unclassified | 1418 |
| 212 | Ga0075366_10002637 | 3300006195 | Bacteria | 9235 |
| 213 | Ga0075366_10044936 | 3300006195 | Bacteria | 2618 |
| 214 | Ga0097621_100001892 | 3300006237 | Bacteria | 14292 |
| 215 | Ga0097621_100010583 | 3300006237 | Bacteria | 6756 |
| 216 | Ga0097621_100065103 | 3300006237 | Bacteria | 2999 |
| 217 | Ga0097621_100197938 | 3300006237 | Unclassified | 1743 |
| 218 | Ga0075370_10004386 | 3300006353 | Bacteria | 6843 |
| 219 | Ga0075370_10034735 | 3300006353 | Unclassified | 2827 |
| 220 | Ga0068871_100000178 | 3300006358 | Bacteria | 43025 |
| 221 | Ga0068871_100004850 | 3300006358 | Bacteria | 9399 |
| 222 | Ga0068871_100008039 | 3300006358 | Bacteria | 7571 |
| 223 | Ga0068871_100044859 | 3300006358 | Bacteria | 3556 |
| 224 | Ga0068871_100048242 | 3300006358 | Bacteria | 3437 |
| 225 | Ga0068871_100264253 | 3300006358 | Unclassified | 1502 |
| 226 | Ga0075428_100134776 | 3300006844 | Bacteria | 2686 |
| 227 | Ga0075430_100001709 | 3300006846 | Bacteria | 17898 |
| 228 | Ga0075431_100036195 | 3300006847 | Bacteria | 5084 |
| 229 | Ga0075431_100322754 | 3300006847 | Bacteria | 1557 |
| 230 | Ga0075433_10076716 | 3300006852 | Bacteria | 2943 |
| 231 | Ga0075433_10112496 | 3300006852 | Bacteria | 2415 |
| 232 | Ga0075433_10351968 | 3300006852 | Bacteria | 1302 |
| 233 | Ga0075434_100025232 | 3300006871 | Bacteria | 5816 |
| 234 | Ga0075434_100046742 | 3300006871 | Bacteria | 4295 |
| 235 | Ga0075434_100101966 | 3300006871 | Bacteria | 2877 |
| 236 | Ga0075429_100112864 | 3300006880 | Bacteria | 2375 |
| 237 | Ga0075429_100202630 | 3300006880 | Unclassified | 1739 |
| 238 | Ga0068865_100059948 | 3300006881 | Bacteria | 2663 |
| 239 | Ga0068865_100089042 | 3300006881 | Bacteria | 2234 |
| 240 | Ga0097620_100008832 | 3300006931 | Bacteria | 10175 |
| 241 | Ga0097620_100083695 | 3300006931 | Bacteria | 3234 |
| 242 | Ga0097620_100093498 | 3300006931 | Bacteria | 3058 |
| 243 | Ga0097620_100121665 | 3300006931 | Bacteria | 2677 |
| 244 | Ga0097620_100380398 | 3300006931 | Unclassified | 1507 |
| 245 | Ga0075435_100041209 | 3300007076 | Bacteria | 3691 |
| 246 | Ga0075435_100069115 | 3300007076 | Bacteria | 2879 |
| 247 | Ga0105240_10003088 | 3300009093 | Bacteria | 26186 |
| 248 | Ga0105240_10008709 | 3300009093 | Bacteria | 14473 |
| 249 | Ga0105240_10009948 | 3300009093 | Bacteria | 13407 |
| 250 | Ga0105240_10022713 | 3300009093 | Bacteria | 8310 |
| 251 | Ga0105240_10048700 | 3300009093 | Bacteria | 5354 |
| 252 | Ga0105240_10064259 | 3300009093 | Bacteria | 4561 |
| 253 | Ga0105240_10067874 | 3300009093 | Bacteria | 4419 |
| 254 | Ga0105240_10297110 | 3300009093 | Bacteria | 1849 |
| 255 | Ga0105240_10719551 | 3300009093 | Unclassified | 1088 |
| 256 | Ga0111539_10000966 | 3300009094 | Bacteria | 37738 |
| 257 | Ga0111539_10002463 | 3300009094 | Bacteria | 24585 |
| 258 | Ga0111539_10024789 | 3300009094 | Bacteria | 7357 |
| 259 | Ga0111539_10038682 | 3300009094 | Bacteria | 5756 |
| 260 | Ga0111539_10103464 | 3300009094 | Bacteria | 3342 |
| 261 | Ga0111539_10332176 | 3300009094 | Unclassified | 1769 |
| 262 | Ga0105245_10000873 | 3300009098 | Bacteria | 27322 |
| 263 | Ga0105245_10004551 | 3300009098 | Bacteria | 12237 |
| 264 | Ga0105245_10008605 | 3300009098 | Bacteria | 8903 |
| 265 | Ga0105245_10044451 | 3300009098 | Bacteria | 3964 |
| 266 | Ga0105245_10048198 | 3300009098 | Bacteria | 3811 |
| 267 | Ga0105247_10006463 | 3300009101 | Bacteria | 7259 |
| 268 | Ga0105247_10028032 | 3300009101 | Bacteria | 3406 |
| 269 | Ga0105247_10172965 | 3300009101 | Bacteria | 1437 |
| 270 | Ga0114129_10047462 | 3300009147 | Bacteria | 6033 |
| 271 | Ga0114129_10048772 | 3300009147 | Bacteria | 5952 |
| 272 | Ga0114129_10093819 | 3300009147 | Bacteria | 4157 |
| 273 | Ga0114129_10107522 | 3300009147 | Bacteria | 3852 |
| 274 | Ga0114129_10203432 | 3300009147 | Bacteria | 2680 |
| 275 | Ga0114129_10451088 | 3300009147 | Unclassified | 1687 |
| 276 | Ga0105243_10033245 | 3300009148 | Bacteria | 3988 |
| 277 | Ga0105243_10057455 | 3300009148 | Bacteria | 3098 |
| 278 | Ga0105243_10121583 | 3300009148 | Bacteria | 2202 |
| 279 | Ga0105241_10016750 | 3300009174 | Bacteria | 5378 |
| 280 | Ga0105241_10025688 | 3300009174 | Bacteria | 4378 |
| 281 | Ga0105241_10118040 | 3300009174 | Bacteria | 2132 |
| 282 | Ga0105241_10205732 | 3300009174 | Bacteria | 1647 |
| 283 | Ga0105242_10001175 | 3300009176 | Bacteria | 20607 |
| 284 | Ga0105242_10017298 | 3300009176 | Bacteria | 5615 |
| 285 | Ga0105242_10027010 | 3300009176 | Bacteria | 4553 |
| 286 | Ga0105242_10033080 | 3300009176 | Bacteria | 4138 |
| 287 | Ga0105242_10098912 | 3300009176 | Bacteria | 2468 |
| 288 | Ga0105242_10147209 | 3300009176 | Unclassified | 2050 |
| 289 | Ga0105242_10227682 | 3300009176 | Unclassified | 1669 |
| 290 | Ga0105248_10001047 | 3300009177 | Bacteria | 30629 |
| 291 | Ga0105248_10009284 | 3300009177 | Bacteria | 10829 |
| 292 | Ga0105248_10012888 | 3300009177 | Bacteria | 9219 |
| 293 | Ga0105248_10024707 | 3300009177 | Bacteria | 6682 |
| 294 | Ga0105248_10150427 | 3300009177 | Unclassified | 2626 |
| 295 | Ga0105248_10178959 | 3300009177 | Unclassified | 2390 |
| 296 | Ga0105237_10012575 | 3300009545 | Bacteria | 8915 |
| 297 | Ga0105237_10017735 | 3300009545 | Bacteria | 7380 |
| 298 | Ga0105237_10105768 | 3300009545 | Bacteria | 2805 |
| 299 | Ga0105237_10263944 | 3300009545 | Bacteria | 1725 |
| 300 | Ga0105238_10008593 | 3300009551 | Bacteria | 10218 |
| 301 | Ga0105238_10015546 | 3300009551 | Bacteria | 7706 |
| 302 | Ga0105238_10057321 | 3300009551 | Bacteria | 3906 |
| 303 | Ga0105249_10022737 | 3300009553 | Bacteria | 5619 |
| 304 | Ga0105249_10197939 | 3300009553 | Bacteria | 1965 |
| 305 | Ga0105239_10027842 | 3300010375 | Bacteria | 6218 |
| 306 | Ga0105239_10053275 | 3300010375 | Unclassified | 4438 |
| 307 | Ga0105239_10389467 | 3300010375 | Bacteria | 1576 |
| 308 | Ga0157373_10019856 | 3300013100 | Bacteria | 4888 |
| 309 | Ga0157370_10013826 | 3300013104 | Bacteria | 8291 |
| 310 | Ga0157370_10014113 | 3300013104 | Bacteria | 8194 |
| 311 | Ga0157370_10046152 | 3300013104 | Bacteria | 4177 |
| 312 | Ga0157370_10108970 | 3300013104 | Bacteria | 2589 |
| 313 | Ga0157370_10136615 | 3300013104 | Bacteria | 2285 |
| 314 | Ga0157369_10002769 | 3300013105 | Bacteria | 20942 |
| 315 | Ga0157369_10010521 | 3300013105 | Bacteria | 10531 |
| 316 | Ga0157369_10020431 | 3300013105 | Bacteria | 7402 |
| 317 | Ga0157369_10075019 | 3300013105 | Bacteria | 3626 |
| 318 | Ga0157369_10136917 | 3300013105 | Bacteria | 2592 |
| 319 | Ga0157369_10315166 | 3300013105 | Bacteria | 1626 |
| 320 | Ga0157369_10479294 | 3300013105 | Bacteria | 1288 |
| 321 | Ga0157374_10006530 | 3300013296 | Bacteria | 9904 |
| 322 | Ga0157374_10043040 | 3300013296 | Bacteria | 4169 |
| 323 | Ga0157374_10142908 | 3300013296 | Unclassified | 2323 |
| 324 | Ga0157374_10179311 | 3300013296 | Bacteria | 2069 |
| 325 | Ga0157378_10000669 | 3300013297 | Bacteria | 32263 |
| 326 | Ga0157378_10070930 | 3300013297 | Bacteria | 3128 |
| 327 | Ga0157378_10114911 | 3300013297 | Unclassified | 2473 |
| 328 | Ga0163162_10007098 | 3300013306 | Bacteria | 10872 |
| 329 | Ga0163162_10058159 | 3300013306 | Unclassified | 3895 |
| 330 | Ga0163162_10076918 | 3300013306 | Bacteria | 3400 |
| 331 | Ga0163162_10311329 | 3300013306 | Bacteria | 1707 |
| 332 | Ga0157372_10007514 | 3300013307 | Bacteria | 11592 |
| 333 | Ga0157372_10170372 | 3300013307 | Bacteria | 2519 |
| 334 | Ga0157372_10245451 | 3300013307 | Bacteria | 2078 |
| 335 | Ga0157372_10343095 | 3300013307 | Bacteria | 1740 |
| 336 | Ga0157372_10459096 | 3300013307 | Bacteria | 1485 |
| 337 | Ga0157372_10487366 | 3300013307 | Bacteria | 1437 |
| 338 | Ga0157375_10019135 | 3300013308 | Bacteria | 6220 |
| 339 | Ga0157375_10139469 | 3300013308 | Unclassified | 2550 |
| 340 | Ga0157375_10140829 | 3300013308 | Unclassified | 2539 |
| 341 | Ga0157375_10244923 | 3300013308 | Unclassified | 1953 |
| 342 | Ga0163163_10018204 | 3300014325 | Bacteria | 6570 |
| 343 | Ga0163163_10020236 | 3300014325 | Bacteria | 6264 |
| 344 | Ga0163163_10060723 | 3300014325 | Bacteria | 3744 |
| 345 | Ga0163163_10165626 | 3300014325 | Unclassified | 2256 |
| 346 | Ga0157380_10005881 | 3300014326 | Bacteria | 8581 |
| 347 | Ga0157380_10382003 | 3300014326 | Bacteria | 1329 |
| 348 | Ga0182008_10035495 | 3300014497 | Bacteria | 2497 |
| 349 | Ga0157377_10030701 | 3300014745 | Bacteria | 2913 |
| 350 | Ga0157379_10016182 | 3300014968 | Bacteria | 6562 |
| 351 | Ga0157379_10023564 | 3300014968 | Bacteria | 5463 |
| 352 | Ga0157379_10030492 | 3300014968 | Unclassified | 4801 |
| 353 | Ga0157376_10071446 | 3300014969 | Unclassified | 2950 |
| 354 | Ga0157376_10100530 | 3300014969 | Unclassified | 2525 |
| 355 | Ga0157376_10138791 | 3300014969 | Unclassified | 2178 |
| 356 | Ga0209758_1005734 | 3300025297 | Bacteria | 9358 |
| 357 | Ga0207697_10066972 | 3300025315 | Unclassified | 1501 |
| 358 | Ga0207656_10042183 | 3300025321 | Bacteria | 1940 |
| 359 | Ga0207682_10035721 | 3300025893 | Bacteria | 2008 |
| 360 | Ga0207710_10006028 | 3300025900 | Bacteria | 5195 |
| 361 | Ga0207688_10000663 | 3300025901 | Bacteria | 16993 |
| 362 | Ga0207688_10200083 | 3300025901 | Bacteria | 1197 |
| 363 | Ga0207680_10001550 | 3300025903 | Bacteria | 10828 |
| 364 | Ga0207680_10009786 | 3300025903 | Bacteria | 4770 |
| 365 | Ga0207647_10029447 | 3300025904 | Bacteria | 3554 |
| 366 | Ga0207699_10112757 | 3300025906 | Unclassified | 1745 |
| 367 | Ga0207699_10262773 | 3300025906 | Bacteria | 1194 |
| 368 | Ga0207645_10031160 | 3300025907 | Bacteria | 3433 |
| 369 | Ga0207645_10059680 | 3300025907 | Bacteria | 2436 |
| 370 | Ga0207645_10082106 | 3300025907 | Bacteria | 2066 |
| 371 | Ga0207645_10290694 | 3300025907 | Bacteria | 1087 |
| 372 | Ga0207643_10000808 | 3300025908 | Bacteria | 19021 |
| 373 | Ga0207643_10029129 | 3300025908 | Bacteria | 3071 |
| 374 | Ga0207705_10056046 | 3300025909 | Unclassified | 2841 |
| 375 | Ga0207654_10084100 | 3300025911 | Bacteria | 1923 |
| 376 | Ga0207707_10001661 | 3300025912 | Bacteria | 20543 |
| 377 | Ga0207707_10013041 | 3300025912 | Bacteria | 7238 |
| 378 | Ga0207707_10021068 | 3300025912 | Bacteria | 5696 |
| 379 | Ga0207707_10029072 | 3300025912 | Bacteria | 4830 |
| 380 | Ga0207707_10038987 | 3300025912 | Bacteria | 4153 |
| 381 | Ga0207707_10076906 | 3300025912 | Bacteria | 2913 |
| 382 | Ga0207707_10104809 | 3300025912 | Unclassified | 2471 |
| 383 | Ga0207707_10112399 | 3300025912 | Bacteria | 2381 |
| 384 | Ga0207707_10162473 | 3300025912 | Bacteria | 1953 |
| 385 | Ga0207707_10170460 | 3300025912 | Unclassified | 1902 |
| 386 | Ga0207695_10030460 | 3300025913 | Bacteria | 5938 |
| 387 | Ga0207695_10045477 | 3300025913 | Bacteria | 4659 |
| 388 | Ga0207695_10073689 | 3300025913 | Bacteria | 3478 |
| 389 | Ga0207695_10377743 | 3300025913 | Bacteria | 1303 |
| 390 | Ga0207671_10035879 | 3300025914 | Bacteria | 3676 |
| 391 | Ga0207693_10011631 | 3300025915 | Bacteria | 7121 |
| 392 | Ga0207663_10040483 | 3300025916 | Bacteria | 2833 |
| 393 | Ga0207663_10250140 | 3300025916 | Bacteria | 1304 |
| 394 | Ga0207660_10000876 | 3300025917 | Bacteria | 19858 |
| 395 | Ga0207660_10017996 | 3300025917 | Bacteria | 4706 |
| 396 | Ga0207660_10252796 | 3300025917 | Bacteria | 1391 |
| 397 | Ga0207660_10277032 | 3300025917 | Bacteria | 1330 |
| 398 | Ga0207660_10310820 | 3300025917 | Bacteria | 1257 |
| 399 | Ga0207662_10026192 | 3300025918 | Bacteria | 3362 |
| 400 | Ga0207662_10114617 | 3300025918 | Unclassified | 1684 |
| 401 | Ga0207657_10021585 | 3300025919 | Bacteria | 6055 |
| 402 | Ga0207657_10026429 | 3300025919 | Bacteria | 5336 |
| 403 | Ga0207657_10089547 | 3300025919 | Bacteria | 2570 |
| 404 | Ga0207649_10001851 | 3300025920 | Bacteria | 12091 |
| 405 | Ga0207649_10078376 | 3300025920 | Bacteria | 2132 |
| 406 | Ga0207652_10003186 | 3300025921 | Bacteria | 13631 |
| 407 | Ga0207652_10020148 | 3300025921 | Bacteria | 5491 |
| 408 | Ga0207652_10035135 | 3300025921 | Bacteria | 4229 |
| 409 | Ga0207652_10053056 | 3300025921 | Bacteria | 3482 |
| 410 | Ga0207652_10088894 | 3300025921 | Bacteria | 2711 |
| 411 | Ga0207681_10020177 | 3300025923 | Bacteria | 4220 |
| 412 | Ga0207681_10025247 | 3300025923 | Bacteria | 3821 |
| 413 | Ga0207694_10002315 | 3300025924 | Bacteria | 15573 |
| 414 | Ga0207694_10003094 | 3300025924 | Bacteria | 13309 |
| 415 | Ga0207694_10047761 | 3300025924 | Bacteria | 3311 |
| 416 | Ga0207650_10001556 | 3300025925 | Bacteria | 16428 |
| 417 | Ga0207650_10006782 | 3300025925 | Bacteria | 7808 |
| 418 | Ga0207650_10076521 | 3300025925 | Unclassified | 2528 |
| 419 | Ga0207659_10019877 | 3300025926 | Bacteria | 4429 |
| 420 | Ga0207687_10003422 | 3300025927 | Bacteria | 10694 |
| 421 | Ga0207687_10028032 | 3300025927 | Bacteria | 3782 |
| 422 | Ga0207687_10055874 | 3300025927 | Unclassified | 2767 |
| 423 | Ga0207687_10064734 | 3300025927 | Unclassified | 2594 |
| 424 | Ga0207700_10000711 | 3300025928 | Bacteria | 19257 |
| 425 | Ga0207700_10141430 | 3300025928 | Unclassified | 1978 |
| 426 | Ga0207700_10243096 | 3300025928 | Bacteria | 1535 |
| 427 | Ga0207664_10000996 | 3300025929 | Bacteria | 19036 |
| 428 | Ga0207644_10138354 | 3300025931 | Bacteria | 1872 |
| 429 | Ga0207690_10045660 | 3300025932 | Bacteria | 2896 |
| 430 | Ga0207690_10265153 | 3300025932 | Bacteria | 1332 |
| 431 | Ga0207690_10295464 | 3300025932 | Bacteria | 1266 |
| 432 | Ga0207706_10007308 | 3300025933 | Bacteria | 10214 |
| 433 | Ga0207706_10092504 | 3300025933 | Bacteria | 2659 |
| 434 | Ga0207706_10178490 | 3300025933 | Bacteria | 1865 |
| 435 | Ga0207686_10002714 | 3300025934 | Bacteria | 9602 |
| 436 | Ga0207686_10012270 | 3300025934 | Bacteria | 4708 |
| 437 | Ga0207686_10045010 | 3300025934 | Bacteria | 2713 |
| 438 | Ga0207686_10116638 | 3300025934 | Bacteria | 1810 |
| 439 | Ga0207686_10119173 | 3300025934 | Bacteria | 1793 |
| 440 | Ga0207686_10161083 | 3300025934 | Unclassified | 1572 |
| 441 | Ga0207709_10125083 | 3300025935 | Bacteria | 1742 |
| 442 | Ga0207670_10001103 | 3300025936 | Bacteria | 14203 |
| 443 | Ga0207670_10004513 | 3300025936 | Bacteria | 7503 |
| 444 | Ga0207669_10010994 | 3300025937 | Bacteria | 4383 |
| 445 | Ga0207669_10099697 | 3300025937 | Bacteria | 1916 |
| 446 | Ga0207704_10178173 | 3300025938 | Unclassified | 1533 |
| 447 | Ga0207691_10000487 | 3300025940 | Bacteria | 39347 |
| 448 | Ga0207691_10007977 | 3300025940 | Bacteria | 10186 |
| 449 | Ga0207691_10011566 | 3300025940 | Bacteria | 8473 |
| 450 | Ga0207691_10095988 | 3300025940 | Unclassified | 2651 |
| 451 | Ga0207691_10171199 | 3300025940 | Bacteria | 1902 |
| 452 | Ga0207691_10226751 | 3300025940 | Bacteria | 1619 |
| 453 | Ga0207711_10018915 | 3300025941 | Bacteria | 5729 |
| 454 | Ga0207711_10034011 | 3300025941 | Bacteria | 4315 |
| 455 | Ga0207711_10066338 | 3300025941 | Unclassified | 3121 |
| 456 | Ga0207711_10114093 | 3300025941 | Bacteria | 2406 |
| 457 | Ga0207711_10203539 | 3300025941 | Unclassified | 1807 |
| 458 | Ga0207689_10033065 | 3300025942 | Bacteria | 4298 |
| 459 | Ga0207689_10164215 | 3300025942 | Unclassified | 1830 |
| 460 | Ga0207661_10000791 | 3300025944 | Bacteria | 20647 |
| 461 | Ga0207679_10005265 | 3300025945 | Bacteria | 8108 |
| 462 | Ga0207679_10005698 | 3300025945 | Bacteria | 7810 |
| 463 | Ga0207679_10188185 | 3300025945 | Unclassified | 1714 |
| 464 | Ga0207679_10383770 | 3300025945 | Unclassified | 1232 |
| 465 | Ga0207667_10009675 | 3300025949 | Bacteria | 11339 |
| 466 | Ga0207667_10044627 | 3300025949 | Bacteria | 4696 |
| 467 | Ga0207667_10058405 | 3300025949 | Unclassified | 4046 |
| 468 | Ga0207667_10136510 | 3300025949 | Bacteria | 2526 |
| 469 | Ga0207667_10317198 | 3300025949 | Bacteria | 1592 |
| 470 | Ga0207667_10335599 | 3300025949 | Bacteria | 1543 |
| 471 | Ga0207651_10000522 | 3300025960 | Bacteria | 16155 |
| 472 | Ga0207651_10083250 | 3300025960 | Bacteria | 2313 |
| 473 | Ga0207712_10250665 | 3300025961 | Bacteria | 1431 |
| 474 | Ga0207640_10000864 | 3300025981 | Bacteria | 17199 |
| 475 | Ga0207658_10118664 | 3300025986 | Unclassified | 2105 |
| 476 | Ga0207677_10000909 | 3300026023 | Bacteria | 16582 |
| 477 | Ga0207677_10019201 | 3300026023 | Bacteria | 4123 |
| 478 | Ga0207677_10054923 | 3300026023 | Bacteria | 2721 |
| 479 | Ga0207677_10058062 | 3300026023 | Bacteria | 2662 |
| 480 | Ga0207677_10081831 | 3300026023 | Unclassified | 2318 |
| 481 | Ga0207703_10003230 | 3300026035 | Bacteria | 13705 |
| 482 | Ga0207703_10005264 | 3300026035 | Bacteria | 10434 |
| 483 | Ga0207703_10030728 | 3300026035 | Unclassified | 4244 |
| 484 | Ga0207639_10179460 | 3300026041 | Bacteria | 1800 |
| 485 | Ga0207678_10011629 | 3300026067 | Bacteria | 7731 |
| 486 | Ga0207678_10087745 | 3300026067 | Bacteria | 2658 |
| 487 | Ga0207678_10209985 | 3300026067 | Bacteria | 1665 |
| 488 | Ga0207708_10017098 | 3300026075 | Bacteria | 5459 |
| 489 | Ga0207708_10160293 | 3300026075 | Bacteria | 1776 |
| 490 | Ga0207702_10005560 | 3300026078 | Bacteria | 11008 |
| 491 | Ga0207702_10306829 | 3300026078 | Unclassified | 1508 |
| 492 | Ga0207641_10038856 | 3300026088 | Bacteria | 3980 |
| 493 | Ga0207641_10069108 | 3300026088 | Bacteria | 3031 |
| 494 | Ga0207641_10158636 | 3300026088 | Unclassified | 2055 |
| 495 | Ga0207641_10179724 | 3300026088 | Unclassified | 1937 |
| 496 | Ga0207641_10295741 | 3300026088 | Bacteria | 1528 |
| 497 | Ga0207641_10381836 | 3300026088 | Bacteria | 1349 |
| 498 | Ga0207648_10013950 | 3300026089 | Bacteria | 7449 |
| 499 | Ga0207648_10018557 | 3300026089 | Bacteria | 6295 |
| 500 | Ga0207648_10021939 | 3300026089 | Bacteria | 5737 |
| 501 | Ga0207648_10041396 | 3300026089 | Bacteria | 4045 |
| 502 | Ga0207648_10070878 | 3300026089 | Bacteria | 3038 |
| 503 | Ga0207648_10114088 | 3300026089 | Bacteria | 2374 |
| 504 | Ga0207676_10008300 | 3300026095 | Bacteria | 7382 |
| 505 | Ga0207676_10290116 | 3300026095 | Bacteria | 1489 |
| 506 | Ga0207674_10004206 | 3300026116 | Bacteria | 17371 |
| 507 | Ga0207674_10004223 | 3300026116 | Bacteria | 17334 |
| 508 | Ga0207674_10023513 | 3300026116 | Bacteria | 6599 |
| 509 | Ga0207674_10037457 | 3300026116 | Bacteria | 5044 |
| 510 | Ga0207674_10037894 | 3300026116 | Bacteria | 5009 |
| 511 | Ga0207674_10040678 | 3300026116 | Bacteria | 4814 |
| 512 | Ga0207674_10102958 | 3300026116 | Unclassified | 2835 |
| 513 | Ga0207675_100002040 | 3300026118 | Bacteria | 20146 |
| 514 | Ga0207675_100121015 | 3300026118 | Bacteria | 2476 |
| 515 | Ga0207675_100151299 | 3300026118 | Bacteria | 2209 |
| 516 | Ga0207683_10001359 | 3300026121 | Bacteria | 22123 |
| 517 | Ga0207683_10002624 | 3300026121 | Bacteria | 15706 |
| 518 | Ga0207683_10094760 | 3300026121 | Bacteria | 2661 |
| 519 | Ga0207683_10165451 | 3300026121 | Bacteria | 2001 |
| 520 | Ga0207683_10167454 | 3300026121 | Bacteria | 1989 |
| 521 | Ga0207698_10003982 | 3300026142 | Bacteria | 8959 |
| 522 | Ga0207698_10006663 | 3300026142 | Bacteria | 7220 |
| 523 | Ga0207698_10078798 | 3300026142 | Bacteria | 2647 |
| 524 | Ga0209813_10019704 | 3300027866 | Bacteria | 1878 |
| 525 | Ga0207428_10013971 | 3300027907 | Bacteria | 6993 |
| 526 | Ga0207428_10185877 | 3300027907 | Bacteria | 1568 |
| 527 | Ga0268266_10082106 | 3300028379 | Unclassified | 2811 |
| 528 | Ga0268266_10249683 | 3300028379 | Bacteria | 1641 |
| 529 | Ga0268266_10254026 | 3300028379 | Bacteria | 1627 |
| 530 | Ga0268266_10285439 | 3300028379 | Unclassified | 1536 |
| 531 | Ga0268265_10003753 | 3300028380 | Bacteria | 10798 |
| 532 | Ga0268265_10110274 | 3300028380 | Bacteria | 2245 |
| 533 | Ga0268265_10170677 | 3300028380 | Bacteria | 1859 |
| 534 | Ga0268264_10019097 | 3300028381 | Bacteria | 5604 |
| 535 | Ga0268264_10024308 | 3300028381 | Bacteria | 4947 |
| 536 | Ga0268264_10115629 | 3300028381 | Bacteria | 2357 |
| 537 | Ga0268264_10242333 | 3300028381 | Bacteria | 1671 |
| 538 | Ga0268264_10374045 | 3300028381 | Bacteria | 1363 |
| 539 | Ga0265319_1000609 | 3300028563 | Bacteria | 23663 |
| 540 | Ga0265319_1001589 | 3300028563 | Bacteria | 13285 |
| 541 | Ga0265318_10000413 | 3300028577 | Bacteria | 33039 |
| 542 | Ga0265318_10003429 | 3300028577 | Bacteria | 7963 |
| 543 | Ga0265332_10021346 | 3300031238 | Bacteria | 2861 |
| 544 | Ga0265328_10040237 | 3300031239 | Unclassified | 1723 |
| 545 | Ga0265320_10000126 | 3300031240 | Bacteria | 66933 |
| 546 | Ga0265325_10000300 | 3300031241 | Bacteria | 34777 |
| 547 | Ga0265325_10039612 | 3300031241 | Bacteria | 2480 |
| 548 | Ga0265325_10066760 | 3300031241 | Bacteria | 1813 |
| 549 | Ga0265329_10002177 | 3300031242 | Bacteria | 9067 |
| 550 | Ga0265329_10003421 | 3300031242 | Bacteria | 6919 |
| 551 | Ga0265340_10006776 | 3300031247 | Bacteria | 6270 |
| 552 | Ga0265340_10013459 | 3300031247 | Bacteria | 4295 |
| 553 | Ga0265339_10021805 | 3300031249 | Bacteria | 3720 |
| 554 | Ga0265339_10036466 | 3300031249 | Bacteria | 2752 |
| 555 | Ga0265339_10077022 | 3300031249 | Bacteria | 1768 |
| 556 | Ga0265331_10000025 | 3300031250 | Bacteria | 229346 |
| 557 | Ga0265316_10002023 | 3300031344 | Bacteria | 21346 |
| 558 | Ga0265316_10011066 | 3300031344 | Bacteria | 8173 |
| 559 | Ga0307513_10163172 | 3300031456 | Bacteria | 2117 |
| 560 | Ga0265313_10002717 | 3300031595 | Bacteria | 14978 |
| 561 | Ga0265313_10005119 | 3300031595 | Bacteria | 9766 |
| 562 | Ga0307508_10118987 | 3300031616 | Bacteria | 2243 |
| 563 | Ga0265314_10002211 | 3300031711 | Bacteria | 20286 |
| 564 | Ga0265314_10002925 | 3300031711 | Bacteria | 16946 |
| 565 | Ga0265314_10006180 | 3300031711 | Bacteria | 10637 |
| 566 | Ga0265314_10028254 | 3300031711 | Bacteria | 4184 |
| 567 | Ga0265342_10002273 | 3300031712 | Bacteria | 16798 |
| 568 | Ga0265342_10003553 | 3300031712 | Bacteria | 12759 |
| 569 | Ga0307410_10001555 | 3300031852 | Bacteria | 10470 |
| 570 | Ga0307409_100229207 | 3300031995 | Bacteria | 1683 |
| 571 | Ga0307411_10029466 | 3300032005 | Bacteria | 3352 |
| 572 | Ga0307411_10115651 | 3300032005 | Bacteria | 1930 |
| 573 | Ga0307507_10021651 | 3300033179 | Bacteria | 7141 |
| 574 | Ga0373958_0003514 | 3300034819 | Bacteria | 2264 |
| 575 | Ga0373926_0003746 | 3300035083 | Bacteria | 4950 |
| 576 | Ga0373923_0014926 | 3300035111 | Unclassified | 2925 |
| 577 | Ga0373939_0045084 | 3300035114 | Bacteria | 1344 |
| 578 | Ga0373943_0049954 | 3300035170 | Bacteria | 2054 |
| 579 | Ga0373961_0021220 | 3300035241 | Bacteria | 1725 |
| 580 | Ga0373931_0005266 | 3300035691 | Bacteria | 5965 |
| 581 | Ga0373931_0028508 | 3300035691 | Bacteria | 2859 |
| 582 | Ga0373935_0013406 | 3300035692 | Bacteria | 4945 |
| 583 | Ga0373935_0095845 | 3300035692 | Bacteria | 1949 |
| 584 | Ga0373927_0013237 | 3300035695 | Bacteria | 5485 |
| 585 | Ga0373927_0029586 | 3300035695 | Bacteria | 3571 |
| 586 | Ga0373933_0040617 | 3300035724 | Unclassified | 2742 |
| 587 | Ga0373933_0129976 | 3300035724 | Bacteria | 1583 |
| 588 | Ga0373933_0185573 | 3300035724 | Bacteria | 1327 |
| 589 | Ga0373947_0081263 | 3300035725 | Bacteria | 2006 |
| 590 | Ga0373947_0092281 | 3300035725 | Bacteria | 1891 |
| 591 | Ga0373937_0001624 | 3300036401 | Bacteria | 18901 |
| 592 | Ga0373937_0012218 | 3300036401 | Bacteria | 7540 |
| 593 | Ga0373937_0020394 | 3300036401 | Bacteria | 5944 |
| 594 | Ga0373937_0025752 | 3300036401 | Bacteria | 5312 |
| 595 | Ga0373937_0109331 | 3300036401 | Bacteria | 2570 |
| 596 | Ga0373937_0151708 | 3300036401 | Bacteria | 2171 |
| 597 | Ga0373937_0499211 | 3300036401 | Unclassified | 1156 |
| 598 | Ga0373925_0005806 | 3300037068 | Bacteria | 9168 |
| 599 | Ga0373925_0049808 | 3300037068 | Bacteria | 3123 |
| 600 | Ga0373925_0156901 | 3300037068 | Bacteria | 1790 |
| 601 | Ga0395899_0087951 | 3300037312 | Bacteria | 2254 |
| 602 | Ga0395900_0002747 | 3300037418 | Bacteria | 19217 |
| 603 | Ga0395900_0254251 | 3300037418 | Bacteria | 1757 |
| 604 | Ga0395898_0018984 | 3300037466 | Bacteria | 7002 |
| 605 | Ga0395905_0220132 | 3300037471 | Bacteria | 1777 |
| 606 | Ga0436364_1342640 | 3300037853 | Bacteria | 1997 |
| 607 | Ga0395901_0056051 | 3300038443 | Bacteria | 4100 |
| 608 | Ga0436361_0598168 | 3300039447 | Bacteria | 5635 |
| 609 | Ga0436363_1081739 | 3300039450 | Bacteria | 2145 |
| 610 | Ga0466958_0120408 | 3300045836 | Bacteria | 1643 |
| 611 | Ga0466967_0331005 | 3300045976 | Bacteria | 1471 |
| 612 | Ga0495627_009242 | 3300046453 | Bacteria | 3634 |
| 613 | Ga0495592_0060067 | 3300046454 | Bacteria | 2797 |
| 614 | Ga0495603_0116302 | 3300046455 | Bacteria | 1559 |
| 615 | Ga0495603_0202319 | 3300046455 | Bacteria | 1148 |
| 616 | Ga0495590_0060334 | 3300046457 | Bacteria | 1328 |
| 617 | Ga0495651_0003700 | 3300046462 | Bacteria | 11717 |
| 618 | Ga0495651_0017221 | 3300046462 | Bacteria | 5600 |
| 619 | Ga0495653_0005354 | 3300046463 | Bacteria | 10443 |
| 620 | Ga0495653_0022342 | 3300046463 | Bacteria | 5119 |
| 621 | Ga0495580_0008302 | 3300046472 | Bacteria | 8264 |
| 622 | Ga0495580_0151628 | 3300046472 | Bacteria | 1606 |
| 623 | Ga0495582_0045692 | 3300046473 | Bacteria | 2412 |
| 624 | Ga0495664_0021142 | 3300046477 | Bacteria | 3759 |
| 625 | Ga0495664_0022622 | 3300046477 | Bacteria | 3646 |
| 626 | Ga0495584_0232131 | 3300046491 | Bacteria | 938 |
| 627 | Ga0495585_0072556 | 3300046492 | Bacteria | 1875 |
| 628 | Ga0495608_0040750 | 3300046511 | Bacteria | 3111 |
| 629 | Ga0495608_0051857 | 3300046511 | Bacteria | 2717 |
| 630 | Ga0495616_0075573 | 3300046513 | Unclassified | 1621 |
| 631 | Ga0495620_0036941 | 3300046515 | Bacteria | 2180 |
| 632 | Ga0495628_0015347 | 3300046516 | Bacteria | 6397 |
| 633 | Ga0495628_0251985 | 3300046516 | Bacteria | 1318 |
| 634 | Ga0495630_0017063 | 3300046517 | Bacteria | 5314 |
| 635 | Ga0495630_0105400 | 3300046517 | Bacteria | 2135 |
| 636 | Ga0495630_0115118 | 3300046517 | Bacteria | 2038 |
| 637 | Ga0495644_0021615 | 3300046523 | Bacteria | 2454 |
| 638 | Ga0495652_0012012 | 3300046529 | Bacteria | 7827 |
| 639 | Ga0495652_0038611 | 3300046529 | Bacteria | 4135 |
| 640 | Ga0495665_0019038 | 3300046531 | Unclassified | 3690 |
| 641 | Ga0495587_0006972 | 3300046536 | Bacteria | 7338 |
| 642 | Ga0495587_0008300 | 3300046536 | Bacteria | 6687 |
| 643 | Ga0495598_0047802 | 3300046537 | Bacteria | 1277 |
| 644 | Ga0495621_0011285 | 3300046539 | Unclassified | 2759 |
| 645 | Ga0495621_0048496 | 3300046539 | Unclassified | 1513 |
| 646 | Ga0495645_0034846 | 3300046543 | Bacteria | 3670 |
| 647 | Ga0495645_0065843 | 3300046543 | Bacteria | 2621 |
| 648 | Ga0495622_0091214 | 3300046557 | Bacteria | 1400 |
| 649 | Ga0495633_0079489 | 3300046558 | Bacteria | 1527 |
| 650 | Ga0495633_0089526 | 3300046558 | Unclassified | 1431 |
| 651 | Ga0495667_0001766 | 3300046559 | Bacteria | 14358 |
| 652 | Ga0495667_0002726 | 3300046559 | Bacteria | 11798 |
| 653 | Ga0495656_0021736 | 3300046615 | Unclassified | 2502 |
| 654 | Ga0495656_0022552 | 3300046615 | Unclassified | 2467 |
| 655 | Ga0495668_0132149 | 3300046616 | Bacteria | 1366 |
| 656 | Ga0495625_0155211 | 3300046660 | Bacteria | 1536 |
| 657 | Ga0495635_0009050 | 3300046663 | Bacteria | 6949 |
| 658 | Ga0495635_0039202 | 3300046663 | Bacteria | 3278 |
| 659 | Ga0495659_0034039 | 3300046664 | Bacteria | 1790 |
| 660 | Ga0495661_0131790 | 3300046665 | Unclassified | 1369 |
| 661 | Ga0495588_0096308 | 3300046674 | Bacteria | 1552 |
| 662 | Ga0495657_0009531 | 3300046675 | Bacteria | 7356 |
| 663 | Ga0495657_0029527 | 3300046675 | Bacteria | 3845 |
| 664 | Ga0495599_0011681 | 3300046678 | Bacteria | 5399 |
| 665 | Ga0495646_0007578 | 3300046680 | Bacteria | 6898 |
| 666 | Ga0495658_0064913 | 3300046683 | Bacteria | 2105 |
| 667 | Ga0495613_0010679 | 3300046689 | Bacteria | 6810 |
| 668 | Ga0495613_0024298 | 3300046689 | Bacteria | 4514 |
| 669 | Ga0495624_0007500 | 3300046690 | Bacteria | 7651 |
| 670 | Ga0495624_0047148 | 3300046690 | Bacteria | 2738 |
| 671 | Ga0495624_0172749 | 3300046690 | Unclassified | 1318 |
| 672 | Ga0495670_0013224 | 3300046691 | Bacteria | 4060 |
| 673 | Ga0495670_0040088 | 3300046691 | Bacteria | 2336 |
| 674 | Ga0495671_0016342 | 3300046692 | Bacteria | 3963 |
| 675 | Ga0495589_0038877 | 3300046794 | Bacteria | 2380 |
| 676 | Ga0495589_0051868 | 3300046794 | Unclassified | 2027 |
| 677 | Ga0495600_0001469 | 3300046809 | Bacteria | 13065 |
| 678 | Ga0495600_0014002 | 3300046809 | Bacteria | 5054 |
| 679 | Ga0495604_0001664 | 3300047317 | Bacteria | 18292 |
| 680 | Ga0495604_0007416 | 3300047317 | Bacteria | 8687 |
| 681 | Ga0495604_0018395 | 3300047317 | Bacteria | 5595 |
| 682 | Ga0495604_0247359 | 3300047317 | Bacteria | 1217 |
| 683 | Ga0495674_0029342 | 3300047319 | Bacteria | 5011 |
| 684 | Ga0495674_0037720 | 3300047319 | Bacteria | 4342 |
| 685 | Ga0495674_0053620 | 3300047319 | Unclassified | 3543 |
| 686 | Ga0495674_0140076 | 3300047319 | Bacteria | 2034 |
| 687 | Ga0495674_0309214 | 3300047319 | Bacteria | 1290 |
| 688 | Ga0495680_0000648 | 3300047322 | Bacteria | 39027 |
| 689 | Ga0495680_0020176 | 3300047322 | Bacteria | 5613 |
| 690 | Ga0495675_0000643 | 3300047444 | Bacteria | 22174 |
| 691 | Ga0495675_0026266 | 3300047444 | Unclassified | 3713 |
| 692 | Ga0495675_0027252 | 3300047444 | Bacteria | 3641 |
| 693 | Ga0495675_0168246 | 3300047444 | Unclassified | 1347 |
| 694 | Ga0495684_0001017 | 3300047471 | Bacteria | 22849 |
| 695 | Ga0495684_0002508 | 3300047471 | Bacteria | 14627 |
| 696 | Ga0495684_0345533 | 3300047471 | Unclassified | 1058 |
| 697 | Ga0495593_0007923 | 3300047673 | Bacteria | 6189 |
| 698 | Ga0495602_0028473 | 3300048088 | Bacteria | 5345 |
| 699 | Ga0495602_0096714 | 3300048088 | Bacteria | 2434 |
| 700 | Ga0495602_0197203 | 3300048088 | Unclassified | 1539 |
| 701 | Ga0496100_0042248 | 3300048903 | Bacteria | 2911 |
| 702 | Ga0496100_0126255 | 3300048903 | Bacteria | 1796 |
| 703 | Ga0496100_0189952 | 3300048903 | Bacteria | 1491 |
| 704 | Ga0496100_0386280 | 3300048903 | Bacteria | 1064 |
| 705 | Ga0496101_0044456 | 3300048904 | Bacteria | 3178 |
| 706 | Ga0496101_0047499 | 3300048904 | Bacteria | 3082 |
| 707 | Ga0496102_0202408 | 3300048905 | Bacteria | 1871 |
| 708 | Ga0496102_0352009 | 3300048905 | Bacteria | 1387 |
| 709 | Ga0496103_0009597 | 3300048906 | Bacteria | 5729 |
| 710 | Ga0496104_0000629 | 3300048907 | Bacteria | 30223 |
| 711 | Ga0496104_0034040 | 3300048907 | Bacteria | 4748 |
| 712 | Ga0496105_0019396 | 3300048908 | Bacteria | 5485 |
| 713 | Ga0496105_0019467 | 3300048908 | Bacteria | 5474 |
| 714 | Ga0496105_0051517 | 3300048908 | Bacteria | 3401 |
| 715 | Ga0496105_0055817 | 3300048908 | Bacteria | 3261 |
| 716 | Ga0496105_0309860 | 3300048908 | Bacteria | 1268 |
| 717 | Ga0496106_0061353 | 3300048909 | Unclassified | 2852 |
| 718 | Ga0496106_0352882 | 3300048909 | Bacteria | 1181 |
| 719 | Ga0496107_0015140 | 3300048910 | Bacteria | 5403 |
| 720 | Ga0496108_0003956 | 3300048911 | Bacteria | 11902 |
| 721 | Ga0496108_0008275 | 3300048911 | Bacteria | 8437 |
| 722 | Ga0496108_0039962 | 3300048911 | Bacteria | 3909 |
| 723 | Ga0496108_0065021 | 3300048911 | Bacteria | 3074 |
| 724 | Ga0496109_0000766 | 3300048912 | Bacteria | 26715 |
| 725 | Ga0496109_0017476 | 3300048912 | Bacteria | 6290 |
| 726 | Ga0496109_0025633 | 3300048912 | Bacteria | 5255 |
| 727 | Ga0496109_0061682 | 3300048912 | Bacteria | 3428 |
| 728 | Ga0496109_0077486 | 3300048912 | Bacteria | 3059 |
| 729 | Ga0496109_0161631 | 3300048912 | Bacteria | 2098 |
| 730 | Ga0496109_0179131 | 3300048912 | Bacteria | 1990 |
| 731 | Ga0496109_0292355 | 3300048912 | Bacteria | 1536 |
| 732 | Ga0496110_0000354 | 3300048913 | Bacteria | 30708 |
| 733 | Ga0496110_0002398 | 3300048913 | Bacteria | 14041 |
| 734 | Ga0496110_0013610 | 3300048913 | Bacteria | 6734 |
| 735 | Ga0496111_0011549 | 3300048914 | Bacteria | 5956 |
| 736 | Ga0496111_0020931 | 3300048914 | Bacteria | 4560 |
| 737 | Ga0496111_0164779 | 3300048914 | Bacteria | 1646 |
| 738 | Ga0496111_0352688 | 3300048914 | Bacteria | 1089 |
| 739 | Ga0496112_0001055 | 3300048915 | Bacteria | 20328 |
| 740 | Ga0496112_0009411 | 3300048915 | Bacteria | 8801 |
| 741 | Ga0496112_0031686 | 3300048915 | Bacteria | 5128 |
| 742 | Ga0496112_0090177 | 3300048915 | Bacteria | 3035 |
| 743 | Ga0496112_0467858 | 3300048915 | Bacteria | 1198 |
| 744 | Ga0496113_0000323 | 3300048916 | Bacteria | 22774 |
| 745 | Ga0496113_0022159 | 3300048916 | Bacteria | 4488 |
| 746 | Ga0496113_0103915 | 3300048916 | Bacteria | 2204 |
| 747 | Ga0496113_0207089 | 3300048916 | Bacteria | 1560 |
| 748 | Ga0496114_0079340 | 3300048917 | Bacteria | 2770 |
| 749 | Ga0496114_0199376 | 3300048917 | Bacteria | 1753 |
| 750 | Ga0496115_0016209 | 3300048918 | Bacteria | 5670 |
| 751 | Ga0496115_0019361 | 3300048918 | Bacteria | 5236 |
| 752 | Ga0496115_0159256 | 3300048918 | Bacteria | 1865 |
| 753 | Ga0496115_0433097 | 3300048918 | Bacteria | 1064 |
| 754 | Ga0501032_0078449 | 3300049569 | Bacteria | 2198 |
| 755 | Ga0501033_0012886 | 3300049570 | Bacteria | 6377 |
| 756 | Ga0501033_0122020 | 3300049570 | Bacteria | 1890 |
| 757 | Ga0501034_0018046 | 3300049571 | Bacteria | 7239 |
| 758 | Ga0501034_0175476 | 3300049571 | Bacteria | 2109 |
| 759 | Ga0501036_0004687 | 3300049572 | Bacteria | 11040 |
| 760 | Ga0501037_0005982 | 3300049573 | Bacteria | 8887 |
| 761 | Ga0501039_0001438 | 3300049575 | Bacteria | 17522 |
| 762 | Ga0501042_0272635 | 3300049578 | Bacteria | 1222 |
| 763 | Ga0501046_0010334 | 3300049580 | Bacteria | 8025 |
| 764 | Ga0501047_0111201 | 3300049581 | Bacteria | 2622 |
| 765 | Ga0501047_0135237 | 3300049581 | Bacteria | 2346 |
| 766 | Ga0501047_0624976 | 3300049581 | Bacteria | 898 |
| 767 | Ga0501048_0004490 | 3300049582 | Bacteria | 10621 |
| 768 | Ga0501068_0011406 | 3300049584 | Bacteria | 5019 |
| 769 | Ga0501069_0006487 | 3300049585 | Bacteria | 6116 |
| 770 | Ga0501070_0014496 | 3300049586 | Bacteria | 6632 |
| 771 | Ga0501070_0054165 | 3300049586 | Bacteria | 3326 |
| 772 | Ga0501070_0091316 | 3300049586 | Bacteria | 2520 |
| 773 | Ga0501071_0023104 | 3300049587 | Bacteria | 4340 |
| 774 | Ga0501074_0124226 | 3300049590 | Bacteria | 1846 |
| 775 | Ga0501076_0420531 | 3300049592 | Bacteria | 1100 |
| 776 | Ga0501080_0082175 | 3300049742 | Bacteria | 2993 |
| 777 | Ga0501080_0150883 | 3300049742 | Bacteria | 2148 |
| 778 | Ga0501080_0206837 | 3300049742 | Bacteria | 1800 |
| 779 | Ga0501080_0220472 | 3300049742 | Bacteria | 1736 |
| 780 | Ga0501035_0014526 | 3300049822 | Bacteria | 7268 |
| 781 | Ga0501035_0085017 | 3300049822 | Bacteria | 2790 |
| 782 | Ga0501044_0000193 | 3300049823 | Bacteria | 76794 |
| 783 | Ga0501044_0000458 | 3300049823 | Bacteria | 49695 |
| 784 | Ga0501044_0026928 | 3300049823 | Bacteria | 6083 |
| 785 | Ga0501044_0224672 | 3300049823 | Bacteria | 1827 |
| 786 | Ga0501044_0251692 | 3300049823 | Bacteria | 1707 |
| 787 | Ga0501045_0024198 | 3300049824 | Bacteria | 4358 |
| 788 | nmdc:mga03683_14758_c1 | 3300050489 | Bacteria | 2898 |
| 789 | nmdc:mga03683_16132_c1 | 3300050489 | Bacteria | 2800 |
| 790 | nmdc:mga03683_363_c1 | 3300050489 | Bacteria | 3039 |
| 791 | nmdc:mga03683_363_c2 | 3300050489 | Bacteria | 10016 |
| 792 | nmdc:mga03n38_79608_c1 | 3300050490 | Bacteria | 1537 |
| 793 | nmdc:mga00v17_7692_c1 | 3300050491 | Bacteria | 5764 |
| 794 | nmdc:mga0yw44_158908_c1 | 3300050492 | Bacteria | 1479 |
| 795 | nmdc:mga0yw44_62387_c1 | 3300050492 | Bacteria | 2289 |
| 796 | nmdc:mga0yw44_76447_c1 | 3300050492 | Bacteria | 1484 |
| 797 | nmdc:mga0yw44_9242_c1 | 3300050492 | Unclassified | 4964 |
| 798 | nmdc:mga0k408_15679_c1 | 3300050493 | Bacteria | 4194 |
| 799 | nmdc:mga0k408_176154_c1 | 3300050493 | Bacteria | 1275 |
| 800 | nmdc:mga0k408_28442_c1 | 3300050493 | Bacteria | 3178 |
| 801 | nmdc:mga06z11_160112_c1 | 3300050494 | Bacteria | 1286 |
| 802 | nmdc:mga06z11_57436_c1 | 3300050494 | Bacteria | 2016 |
| 803 | nmdc:mga04h51_100902_c1 | 3300050495 | Bacteria | 1051 |
| 804 | nmdc:mga07m45_14539_c2 | 3300050496 | Bacteria | 3009 |
| 805 | nmdc:mga07m45_41932_c1 | 3300050496 | Bacteria | 2564 |
| 806 | nmdc:mga07m45_43094_c1 | 3300050496 | Bacteria | 2530 |
| 807 | nmdc:mga07m45_7395_c1 | 3300050496 | Bacteria | 5612 |
| 808 | nmdc:mga05p37_11335_c1 | 3300050507 | Bacteria | 10605 |
| 809 | nmdc:mga05p37_533843_c1 | 3300050507 | Bacteria | 1339 |
| 810 | nmdc:mga05p37_71294_c1 | 3300050507 | Bacteria | 4274 |
| 811 | nmdc:mga05p37_75490_c1 | 3300050507 | Bacteria | 4149 |
| 812 | nmdc:mga0qj67_41_c1 | 3300050509 | Bacteria | 89688 |
| 813 | nmdc:mga06r32_103740_c1 | 3300050510 | Bacteria | 2792 |
| 814 | nmdc:mga08y16_25452_c1 | 3300050511 | Bacteria | 6241 |
| 815 | nmdc:mga08y16_33436_c1 | 3300050511 | Bacteria | 5401 |
| 816 | nmdc:mga0n895_13231_c1 | 3300050512 | Bacteria | 7435 |
| 817 | nmdc:mga0n895_33930_c1 | 3300050512 | Bacteria | 4908 |
| 818 | nmdc:mga0n895_81049_c1 | 3300050512 | Bacteria | 3234 |
| 819 | nmdc:mga0rr50_24140_c1 | 3300050513 | Bacteria | 4207 |
| 820 | nmdc:mga0rr50_50807_c1 | 3300050513 | Bacteria | 3073 |
| 821 | nmdc:mga0a205_132545_c1 | 3300050515 | Bacteria | 2392 |
| 822 | nmdc:mga0a205_66695_c1 | 3300050515 | Unclassified | 3477 |
| 823 | nmdc:mga0a205_93763_c1 | 3300050515 | Bacteria | 2900 |
| 824 | Ga0495601_0029040 | 3300053077 | Bacteria | 3428 |
| 825 | Ga0495601_0074252 | 3300053077 | Bacteria | 2175 |
| 826 | Ga0495601_0106854 | 3300053077 | Unclassified | 1810 |
| 827 | Ga0495612_0002024 | 3300053078 | Bacteria | 8355 |
| 828 | Ga0500610_0001956 | 3300053079 | Bacteria | 7336 |
| 829 | Ga0500610_0002763 | 3300053079 | Bacteria | 6563 |
| 830 | Ga0500644_0116885 | 3300053088 | Bacteria | 1035 |
| 831 | Ga0500566_0136186 | 3300053094 | Bacteria | 1308 |
| 832 | Ga0500641_0127855 | 3300053096 | Bacteria | 1096 |
| 833 | Ga0500593_000167 | 3300053117 | Bacteria | 26501 |
| 834 | Ga0500595_008487 | 3300053119 | Bacteria | 4193 |
| 835 | Ga0500616_0098680 | 3300053153 | Bacteria | 1432 |
| 836 | Ga0500627_0000617 | 3300053158 | Bacteria | 9484 |
| 837 | Ga0500634_0094881 | 3300053161 | Unclassified | 1505 |
| 838 | Ga0500596_023070 | 3300053735 | Bacteria | 942 |
| 839 | Ga0501084_0212319 | 3300054114 | Bacteria | 1633 |
| 840 | Ga0501082_0006937 | 3300060353 | Bacteria | 9790 |
| 841 | Ga0501082_0100515 | 3300060353 | Bacteria | 2502 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046457 | Ga0495590_0060334 | Ga0495590_0060334_544_1296 | 250 |
| 2 | 3300026035 | Ga0207703_10003230 | Ga0207703_100032303 | 254 |
| 3 | 3300036401 | Ga0373937_0499211 | Ga0373937_0499211_13_846 | 259 |
| 4 | 3300048905 | Ga0496102_0202408 | Ga0496102_0202408_20_994 | 260 |
| 5 | 3300048914 | Ga0496111_0011549 | Ga0496111_0011549_3819_4793 | 260 |
| 6 | 3300046491 | Ga0495584_0232131 | Ga0495584_0232131_113_916 | 267 |
| 7 | 3300050489 | nmdc:mga03683_363_c1 | nmdc:mga03683_363_c1_77_898 | 268 |
| 8 | 3300049581 | Ga0501047_0624976 | Ga0501047_0624976_50_877 | 272 |
| 9 | 3300007076 | Ga0075435_100041209 | Ga0075435_1000412092 | 274 |
| 10 | 3300009094 | Ga0111539_10000966 | Ga0111539_1000096619 | 284 |
| 11 | 3300049570 | Ga0501033_0122020 | Ga0501033_0122020_161_1123 | 286 |
| 12 | 3300049581 | Ga0501047_0111201 | Ga0501047_0111201_352_1314 | 286 |
| 13 | 3300049586 | Ga0501070_0054165 | Ga0501070_0054165_279_1241 | 286 |
| 14 | 3300049822 | Ga0501035_0085017 | Ga0501035_0085017_1712_2674 | 286 |
| 15 | 3300049823 | Ga0501044_0224672 | Ga0501044_0224672_558_1517 | 286 |
| 16 | 3300005347 | Ga0070668_100090479 | Ga0070668_1000904791 | 287 |
| 17 | 3300009553 | Ga0105249_10197939 | Ga0105249_101979392 | 287 |
| 18 | 3300005577 | Ga0068857_100359503 | Ga0068857_1003595032 | 290 |
| 19 | 3300006358 | Ga0068871_100264253 | Ga0068871_1002642532 | 290 |
| 20 | 3300009177 | Ga0105248_10178959 | Ga0105248_101789593 | 290 |
| 21 | 3300014968 | Ga0157379_10030492 | Ga0157379_100304922 | 290 |
| 22 | 3300026116 | Ga0207674_10037457 | Ga0207674_100374572 | 290 |
| 23 | 3300049742 | Ga0501080_0206837 | Ga0501080_0206837_368_1330 | 290 |
| 24 | 3300053735 | Ga0500596_023070 | Ga0500596_023070_15_908 | 290 |
| 25 | 3300048912 | Ga0496109_0017476 | Ga0496109_0017476_95_979 | 291 |
| 26 | 3300005336 | Ga0070680_100240301 | Ga0070680_1002403012 | 293 |
| 27 | 3300005340 | Ga0070689_100008822 | Ga0070689_1000088223 | 293 |
| 28 | 3300005343 | Ga0070687_100023314 | Ga0070687_1000233142 | 293 |
| 29 | 3300005345 | Ga0070692_10022678 | Ga0070692_100226781 | 293 |
| 30 | 3300005355 | Ga0070671_100010061 | Ga0070671_1000100614 | 293 |
| 31 | 3300005365 | Ga0070688_100102529 | Ga0070688_1001025292 | 293 |
| 32 | 3300005438 | Ga0070701_10053981 | Ga0070701_100539812 | 293 |
| 33 | 3300005444 | Ga0070694_100023040 | Ga0070694_1000230402 | 293 |
| 34 | 3300005459 | Ga0068867_100013424 | Ga0068867_1000134243 | 293 |
| 35 | 3300005543 | Ga0070672_100063647 | Ga0070672_1000636472 | 293 |
| 36 | 3300005549 | Ga0070704_100004501 | Ga0070704_1000045013 | 293 |
| 37 | 3300005564 | Ga0070664_100117409 | Ga0070664_1001174092 | 293 |
| 38 | 3300005577 | Ga0068857_100028101 | Ga0068857_1000281013 | 293 |
| 39 | 3300005577 | Ga0068857_100039051 | Ga0068857_1000390513 | 293 |
| 40 | 3300005617 | Ga0068859_100008832 | Ga0068859_1000088323 | 293 |
| 41 | 3300005618 | Ga0068864_100159953 | Ga0068864_1001599533 | 293 |
| 42 | 3300005719 | Ga0068861_100010480 | Ga0068861_1000104802 | 293 |
| 43 | 3300005840 | Ga0068870_10016862 | Ga0068870_100168622 | 293 |
| 44 | 3300005841 | Ga0068863_100118268 | Ga0068863_1001182683 | 293 |
| 45 | 3300005843 | Ga0068860_100240848 | Ga0068860_1002408482 | 293 |
| 46 | 3300005844 | Ga0068862_100004017 | Ga0068862_1000040174 | 293 |
| 47 | 3300006880 | Ga0075429_100202630 | Ga0075429_1002026302 | 293 |
| 48 | 3300006931 | Ga0097620_100008832 | Ga0097620_1000088324 | 293 |
| 49 | 3300009094 | Ga0111539_10038682 | Ga0111539_100386823 | 293 |
| 50 | 3300009147 | Ga0114129_10451088 | Ga0114129_104510882 | 293 |
| 51 | 3300009176 | Ga0105242_10147209 | Ga0105242_101472092 | 293 |
| 52 | 3300009176 | Ga0105242_10227682 | Ga0105242_102276822 | 293 |
| 53 | 3300009553 | Ga0105249_10022737 | Ga0105249_100227372 | 293 |
| 54 | 3300013297 | Ga0157378_10070930 | Ga0157378_100709302 | 293 |
| 55 | 3300013306 | Ga0163162_10058159 | Ga0163162_100581593 | 293 |
| 56 | 3300013308 | Ga0157375_10139469 | Ga0157375_101394692 | 293 |
| 57 | 3300025315 | Ga0207697_10066972 | Ga0207697_100669722 | 293 |
| 58 | 3300025907 | Ga0207645_10059680 | Ga0207645_100596802 | 293 |
| 59 | 3300025908 | Ga0207643_10029129 | Ga0207643_100291292 | 293 |
| 60 | 3300025918 | Ga0207662_10114617 | Ga0207662_101146172 | 293 |
| 61 | 3300025925 | Ga0207650_10076521 | Ga0207650_100765212 | 293 |
| 62 | 3300025926 | Ga0207659_10019877 | Ga0207659_100198772 | 293 |
| 63 | 3300025931 | Ga0207644_10138354 | Ga0207644_101383542 | 293 |
| 64 | 3300025933 | Ga0207706_10092504 | Ga0207706_100925042 | 293 |
| 65 | 3300025933 | Ga0207706_10178490 | Ga0207706_101784902 | 293 |
| 66 | 3300025936 | Ga0207670_10004513 | Ga0207670_100045133 | 293 |
| 67 | 3300025940 | Ga0207691_10095988 | Ga0207691_100959882 | 293 |
| 68 | 3300025945 | Ga0207679_10188185 | Ga0207679_101881852 | 293 |
| 69 | 3300025961 | Ga0207712_10250665 | Ga0207712_102506651 | 293 |
| 70 | 3300026088 | Ga0207641_10381836 | Ga0207641_103818361 | 293 |
| 71 | 3300026089 | Ga0207648_10018557 | Ga0207648_100185572 | 293 |
| 72 | 3300026116 | Ga0207674_10023513 | Ga0207674_100235133 | 293 |
| 73 | 3300026116 | Ga0207674_10037894 | Ga0207674_100378942 | 293 |
| 74 | 3300026118 | Ga0207675_100002040 | Ga0207675_10000204014 | 293 |
| 75 | 3300027907 | Ga0207428_10013971 | Ga0207428_100139713 | 293 |
| 76 | 3300028380 | Ga0268265_10003753 | Ga0268265_100037533 | 293 |
| 77 | 3300037418 | Ga0395900_0002747 | Ga0395900_0002747_13118_14236 | 293 |
| 78 | 3300037466 | Ga0395898_0018984 | Ga0395898_0018984_133_1251 | 293 |
| 79 | 3300046539 | Ga0495621_0011285 | Ga0495621_0011285_660_1742 | 293 |
| 80 | 3300050511 | nmdc:mga08y16_33436_c1 | nmdc:mga08y16_33436_c1_73_1155 | 293 |
| 81 | 3300050513 | nmdc:mga0rr50_24140_c1 | nmdc:mga0rr50_24140_c1_496_1533 | 293 |
| 82 | 3300006852 | Ga0075433_10076716 | Ga0075433_100767162 | 294 |
| 83 | 3300006871 | Ga0075434_100101966 | Ga0075434_1001019662 | 294 |
| 84 | 3300009147 | Ga0114129_10048772 | Ga0114129_100487724 | 294 |
| 85 | 3300050507 | nmdc:mga05p37_71294_c1 | nmdc:mga05p37_71294_c1_1580_2539 | 294 |
| 86 | 3300050512 | nmdc:mga0n895_13231_c1 | nmdc:mga0n895_13231_c1_5490_6449 | 294 |
| 87 | 3300050515 | nmdc:mga0a205_66695_c1 | nmdc:mga0a205_66695_c1_928_1887 | 294 |
| 88 | 3300025916 | Ga0207663_10250140 | Ga0207663_102501401 | 295 |
| 89 | 3300005336 | Ga0070680_100153483 | Ga0070680_1001534832 | 297 |
| 90 | 3300053077 | Ga0495601_0106854 | Ga0495601_0106854_517_1479 | 297 |
| 91 | 3300009093 | Ga0105240_10719551 | Ga0105240_107195511 | 298 |
| 92 | 3300049586 | Ga0501070_0014496 | Ga0501070_0014496_1590_2489 | 298 |
| 93 | 3300006852 | Ga0075433_10351968 | Ga0075433_103519681 | 299 |
| 94 | 3300006871 | Ga0075434_100025232 | Ga0075434_1000252323 | 299 |
| 95 | 3300007076 | Ga0075435_100069115 | Ga0075435_1000691152 | 299 |
| 96 | 3300050512 | nmdc:mga0n895_81049_c1 | nmdc:mga0n895_81049_c1_844_1830 | 299 |
| 97 | 3300050513 | nmdc:mga0rr50_50807_c1 | nmdc:mga0rr50_50807_c1_754_1740 | 299 |
| 98 | 3300050515 | nmdc:mga0a205_132545_c1 | nmdc:mga0a205_132545_c1_1328_2314 | 299 |
| 99 | 3300005435 | Ga0070714_100001344 | Ga0070714_1000013442 | 300 |
| 100 | 3300009093 | Ga0105240_10297110 | Ga0105240_102971103 | 300 |
| 101 | 3300025929 | Ga0207664_10000996 | Ga0207664_1000099614 | 300 |
| 102 | 3300028563 | Ga0265319_1000609 | Ga0265319_100060910 | 300 |
| 103 | 3300028577 | Ga0265318_10000413 | Ga0265318_1000041315 | 300 |
| 104 | 3300031239 | Ga0265328_10040237 | Ga0265328_100402372 | 300 |
| 105 | 3300031240 | Ga0265320_10000126 | Ga0265320_1000012648 | 300 |
| 106 | 3300031241 | Ga0265325_10039612 | Ga0265325_100396122 | 300 |
| 107 | 3300031242 | Ga0265329_10003421 | Ga0265329_100034213 | 300 |
| 108 | 3300031247 | Ga0265340_10006776 | Ga0265340_100067763 | 300 |
| 109 | 3300031249 | Ga0265339_10036466 | Ga0265339_100364662 | 300 |
| 110 | 3300031250 | Ga0265331_10000025 | Ga0265331_10000025192 | 300 |
| 111 | 3300031344 | Ga0265316_10002023 | Ga0265316_100020238 | 300 |
| 112 | 3300031595 | Ga0265313_10002717 | Ga0265313_100027177 | 300 |
| 113 | 3300031711 | Ga0265314_10028254 | Ga0265314_100282542 | 300 |
| 114 | 3300031712 | Ga0265342_10003553 | Ga0265342_100035533 | 300 |
| 115 | 3300046615 | Ga0495656_0021736 | Ga0495656_0021736_687_1634 | 300 |
| 116 | 3300006846 | Ga0075430_100001709 | Ga0075430_1000017095 | 301 |
| 117 | 3300009101 | Ga0105247_10172965 | Ga0105247_101729652 | 301 |
| 118 | 3300025934 | Ga0207686_10119173 | Ga0207686_101191732 | 301 |
| 119 | 3300046513 | Ga0495616_0075573 | Ga0495616_0075573_662_1570 | 301 |
| 120 | 3300046615 | Ga0495656_0022552 | Ga0495656_0022552_67_975 | 301 |
| 121 | 3300046616 | Ga0495668_0132149 | Ga0495668_0132149_37_945 | 301 |
| 122 | 3300046689 | Ga0495613_0010679 | Ga0495613_0010679_3837_4895 | 301 |
| 123 | 3300046690 | Ga0495624_0172749 | Ga0495624_0172749_106_1014 | 301 |
| 124 | 3300046794 | Ga0495589_0051868 | Ga0495589_0051868_181_1089 | 301 |
| 125 | 3300047319 | Ga0495674_0029342 | Ga0495674_0029342_1699_2607 | 301 |
| 126 | 3300047471 | Ga0495684_0345533 | Ga0495684_0345533_105_1013 | 301 |
| 127 | 3300048903 | Ga0496100_0189952 | Ga0496100_0189952_547_1455 | 301 |
| 128 | 3300048908 | Ga0496105_0309860 | Ga0496105_0309860_130_1038 | 301 |
| 129 | 3300050509 | nmdc:mga0qj67_41_c1 | nmdc:mga0qj67_41_c1_87197_88291 | 301 |
| 130 | 3300005334 | Ga0068869_100022698 | Ga0068869_1000226984 | 302 |
| 131 | 3300005335 | Ga0070666_10003141 | Ga0070666_100031415 | 302 |
| 132 | 3300005336 | Ga0070680_100013675 | Ga0070680_1000136756 | 302 |
| 133 | 3300005336 | Ga0070680_100089716 | Ga0070680_1000897161 | 302 |
| 134 | 3300005338 | Ga0068868_100009212 | Ga0068868_1000092126 | 302 |
| 135 | 3300005341 | Ga0070691_10046989 | Ga0070691_100469891 | 302 |
| 136 | 3300005364 | Ga0070673_100167049 | Ga0070673_1001670492 | 302 |
| 137 | 3300005435 | Ga0070714_100001344 | Ga0070714_1000013443 | 302 |
| 138 | 3300005458 | Ga0070681_10001127 | Ga0070681_1000112720 | 302 |
| 139 | 3300005530 | Ga0070679_100012721 | Ga0070679_1000127216 | 302 |
| 140 | 3300005535 | Ga0070684_100306894 | Ga0070684_1003068942 | 302 |
| 141 | 3300005563 | Ga0068855_100222282 | Ga0068855_1002222822 | 302 |
| 142 | 3300005617 | Ga0068859_100083699 | Ga0068859_1000836993 | 302 |
| 143 | 3300005842 | Ga0068858_100011311 | Ga0068858_1000113114 | 302 |
| 144 | 3300005843 | Ga0068860_100012074 | Ga0068860_1000120747 | 302 |
| 145 | 3300006237 | Ga0097621_100010583 | Ga0097621_1000105835 | 302 |
| 146 | 3300006931 | Ga0097620_100083695 | Ga0097620_1000836953 | 302 |
| 147 | 3300009093 | Ga0105240_10064259 | Ga0105240_100642593 | 302 |
| 148 | 3300009098 | Ga0105245_10000873 | Ga0105245_1000087316 | 302 |
| 149 | 3300009098 | Ga0105245_10008605 | Ga0105245_100086055 | 302 |
| 150 | 3300009174 | Ga0105241_10205732 | Ga0105241_102057321 | 302 |
| 151 | 3300009176 | Ga0105242_10098912 | Ga0105242_100989123 | 302 |
| 152 | 3300009177 | Ga0105248_10001047 | Ga0105248_100010479 | 302 |
| 153 | 3300009545 | Ga0105237_10263944 | Ga0105237_102639442 | 302 |
| 154 | 3300009551 | Ga0105238_10057321 | Ga0105238_100573211 | 302 |
| 155 | 3300010375 | Ga0105239_10389467 | Ga0105239_103894671 | 302 |
| 156 | 3300013104 | Ga0157370_10013826 | Ga0157370_100138269 | 302 |
| 157 | 3300013105 | Ga0157369_10002769 | Ga0157369_1000276922 | 302 |
| 158 | 3300014325 | Ga0163163_10020236 | Ga0163163_100202365 | 302 |
| 159 | 3300014968 | Ga0157379_10023564 | Ga0157379_100235645 | 302 |
| 160 | 3300025903 | Ga0207680_10001550 | Ga0207680_100015504 | 302 |
| 161 | 3300025912 | Ga0207707_10038987 | Ga0207707_100389872 | 302 |
| 162 | 3300025912 | Ga0207707_10104809 | Ga0207707_101048092 | 302 |
| 163 | 3300025913 | Ga0207695_10377743 | Ga0207695_103777431 | 302 |
| 164 | 3300025917 | Ga0207660_10017996 | Ga0207660_100179964 | 302 |
| 165 | 3300025921 | Ga0207652_10020148 | Ga0207652_100201481 | 302 |
| 166 | 3300025924 | Ga0207694_10047761 | Ga0207694_100477611 | 302 |
| 167 | 3300025927 | Ga0207687_10003422 | Ga0207687_100034229 | 302 |
| 168 | 3300025929 | Ga0207664_10000996 | Ga0207664_1000099613 | 302 |
| 169 | 3300025932 | Ga0207690_10045660 | Ga0207690_100456603 | 302 |
| 170 | 3300025941 | Ga0207711_10018915 | Ga0207711_100189155 | 302 |
| 171 | 3300025942 | Ga0207689_10033065 | Ga0207689_100330653 | 302 |
| 172 | 3300026023 | Ga0207677_10019201 | Ga0207677_100192013 | 302 |
| 173 | 3300026035 | Ga0207703_10005264 | Ga0207703_100052645 | 302 |
| 174 | 3300026088 | Ga0207641_10069108 | Ga0207641_100691084 | 302 |
| 175 | 3300026095 | Ga0207676_10290116 | Ga0207676_102901162 | 302 |
| 176 | 3300028381 | Ga0268264_10019097 | Ga0268264_100190973 | 302 |
| 177 | 3300031711 | Ga0265314_10002211 | Ga0265314_100022117 | 302 |
| 178 | 3300036401 | Ga0373937_0012218 | Ga0373937_0012218_2359_3282 | 302 |
| 179 | 3300037312 | Ga0395899_0087951 | Ga0395899_0087951_1081_2169 | 302 |
| 180 | 3300037418 | Ga0395900_0002747 | Ga0395900_0002747_14344_15450 | 302 |
| 181 | 3300037466 | Ga0395898_0018984 | Ga0395898_0018984_1359_2465 | 302 |
| 182 | 3300045836 | Ga0466958_0120408 | Ga0466958_0120408_58_981 | 302 |
| 183 | 3300048918 | Ga0496115_0433097 | Ga0496115_0433097_88_1011 | 302 |
| 184 | 3300005458 | Ga0070681_10013126 | Ga0070681_100131262 | 303 |
| 185 | 3300005530 | Ga0070679_100132597 | Ga0070679_1001325973 | 303 |
| 186 | 3300005535 | Ga0070684_100075718 | Ga0070684_1000757183 | 303 |
| 187 | 3300005539 | Ga0068853_100070760 | Ga0068853_1000707602 | 303 |
| 188 | 3300005548 | Ga0070665_100143329 | Ga0070665_1001433293 | 303 |
| 189 | 3300005563 | Ga0068855_100082843 | Ga0068855_1000828432 | 303 |
| 190 | 3300005563 | Ga0068855_100160584 | Ga0068855_1001605842 | 303 |
| 191 | 3300005564 | Ga0070664_100093464 | Ga0070664_1000934642 | 303 |
| 192 | 3300005577 | Ga0068857_100003096 | Ga0068857_1000030969 | 303 |
| 193 | 3300005614 | Ga0068856_100140700 | Ga0068856_1001407002 | 303 |
| 194 | 3300006852 | Ga0075433_10112496 | Ga0075433_101124962 | 303 |
| 195 | 3300009093 | Ga0105240_10009948 | Ga0105240_100099483 | 303 |
| 196 | 3300009094 | Ga0111539_10103464 | Ga0111539_101034642 | 303 |
| 197 | 3300009176 | Ga0105242_10027010 | Ga0105242_100270102 | 303 |
| 198 | 3300009177 | Ga0105248_10150427 | Ga0105248_101504272 | 303 |
| 199 | 3300009545 | Ga0105237_10017735 | Ga0105237_100177352 | 303 |
| 200 | 3300010375 | Ga0105239_10027842 | Ga0105239_100278426 | 303 |
| 201 | 3300010375 | Ga0105239_10053275 | Ga0105239_100532752 | 303 |
| 202 | 3300013104 | Ga0157370_10136615 | Ga0157370_101366152 | 303 |
| 203 | 3300013105 | Ga0157369_10315166 | Ga0157369_103151661 | 303 |
| 204 | 3300013297 | Ga0157378_10114911 | Ga0157378_101149112 | 303 |
| 205 | 3300013306 | Ga0163162_10311329 | Ga0163162_103113292 | 303 |
| 206 | 3300013307 | Ga0157372_10487366 | Ga0157372_104873662 | 303 |
| 207 | 3300013308 | Ga0157375_10140829 | Ga0157375_101408292 | 303 |
| 208 | 3300014325 | Ga0163163_10018204 | Ga0163163_100182042 | 303 |
| 209 | 3300025906 | Ga0207699_10262773 | Ga0207699_102627731 | 303 |
| 210 | 3300025912 | Ga0207707_10013041 | Ga0207707_100130411 | 303 |
| 211 | 3300025913 | Ga0207695_10045477 | Ga0207695_100454773 | 303 |
| 212 | 3300025927 | Ga0207687_10064734 | Ga0207687_100647341 | 303 |
| 213 | 3300025934 | Ga0207686_10012270 | Ga0207686_100122704 | 303 |
| 214 | 3300025941 | Ga0207711_10203539 | Ga0207711_102035392 | 303 |
| 215 | 3300025949 | Ga0207667_10136510 | Ga0207667_101365102 | 303 |
| 216 | 3300025949 | Ga0207667_10335599 | Ga0207667_103355992 | 303 |
| 217 | 3300026023 | Ga0207677_10081831 | Ga0207677_100818312 | 303 |
| 218 | 3300028379 | Ga0268266_10082106 | Ga0268266_100821062 | 303 |
| 219 | 3300050515 | nmdc:mga0a205_93763_c1 | nmdc:mga0a205_93763_c1_1200_2255 | 303 |
| 220 | 3300005436 | Ga0070713_100068666 | Ga0070713_1000686662 | 304 |
| 221 | 3300005436 | Ga0070713_100194615 | Ga0070713_1001946152 | 304 |
| 222 | 3300005455 | Ga0070663_100008942 | Ga0070663_1000089423 | 304 |
| 223 | 3300005458 | Ga0070681_10420970 | Ga0070681_104209701 | 304 |
| 224 | 3300005614 | Ga0068856_100294430 | Ga0068856_1002944302 | 304 |
| 225 | 3300006048 | Ga0075363_100007008 | Ga0075363_1000070083 | 304 |
| 226 | 3300006051 | Ga0075364_10013177 | Ga0075364_100131772 | 304 |
| 227 | 3300006177 | Ga0075362_10086549 | Ga0075362_100865491 | 304 |
| 228 | 3300006847 | Ga0075431_100322754 | Ga0075431_1003227542 | 304 |
| 229 | 3300009094 | Ga0111539_10002463 | Ga0111539_1000246318 | 304 |
| 230 | 3300009147 | Ga0114129_10107522 | Ga0114129_101075223 | 304 |
| 231 | 3300013105 | Ga0157369_10136917 | Ga0157369_101369173 | 304 |
| 232 | 3300013307 | Ga0157372_10459096 | Ga0157372_104590961 | 304 |
| 233 | 3300025928 | Ga0207700_10141430 | Ga0207700_101414302 | 304 |
| 234 | 3300025928 | Ga0207700_10243096 | Ga0207700_102430962 | 304 |
| 235 | 3300026067 | Ga0207678_10011629 | Ga0207678_100116293 | 304 |
| 236 | 3300026078 | Ga0207702_10306829 | Ga0207702_103068292 | 304 |
| 237 | 3300032005 | Ga0307411_10115651 | Ga0307411_101156512 | 304 |
| 238 | 3300035724 | Ga0373933_0129976 | Ga0373933_0129976_188_1123 | 304 |
| 239 | 3300036401 | Ga0373937_0001624 | Ga0373937_0001624_14119_15054 | 304 |
| 240 | 3300039447 | Ga0436361_0598168 | Ga0436361_0598168_4066_5097 | 304 |
| 241 | 3300049581 | Ga0501047_0135237 | Ga0501047_0135237_1364_2329 | 304 |
| 242 | 3300049823 | Ga0501044_0000458 | Ga0501044_0000458_30781_31821 | 304 |
| 243 | 3300050489 | nmdc:mga03683_14758_c1 | nmdc:mga03683_14758_c1_631_1584 | 304 |
| 244 | 3300050489 | nmdc:mga03683_16132_c1 | nmdc:mga03683_16132_c1_1008_1961 | 304 |
| 245 | 3300050489 | nmdc:mga03683_363_c2 | nmdc:mga03683_363_c2_8487_9413 | 304 |
| 246 | 3300050491 | nmdc:mga00v17_7692_c1 | nmdc:mga00v17_7692_c1_1615_2541 | 304 |
| 247 | 3300050492 | nmdc:mga0yw44_158908_c1 | nmdc:mga0yw44_158908_c1_344_1297 | 304 |
| 248 | 3300050493 | nmdc:mga0k408_15679_c1 | nmdc:mga0k408_15679_c1_2599_3717 | 304 |
| 249 | 3300050494 | nmdc:mga06z11_160112_c1 | nmdc:mga06z11_160112_c1_58_1113 | 304 |
| 250 | 3300050496 | nmdc:mga07m45_43094_c1 | nmdc:mga07m45_43094_c1_280_1206 | 304 |
| 251 | 3300050511 | nmdc:mga08y16_25452_c1 | nmdc:mga08y16_25452_c1_38_1141 | 304 |
| 252 | 3300053094 | Ga0500566_0136186 | Ga0500566_0136186_160_1251 | 304 |
| 253 | 3300005293 | Ga0065715_10007812 | Ga0065715_100078122 | 305 |
| 254 | 3300005330 | Ga0070690_100035776 | Ga0070690_1000357762 | 305 |
| 255 | 3300005331 | Ga0070670_100004292 | Ga0070670_10000429210 | 305 |
| 256 | 3300005343 | Ga0070687_100020116 | Ga0070687_1000201163 | 305 |
| 257 | 3300005344 | Ga0070661_100049114 | Ga0070661_1000491143 | 305 |
| 258 | 3300005354 | Ga0070675_100201549 | Ga0070675_1002015492 | 305 |
| 259 | 3300005364 | Ga0070673_100129972 | Ga0070673_1001299721 | 305 |
| 260 | 3300005365 | Ga0070688_100061740 | Ga0070688_1000617402 | 305 |
| 261 | 3300005366 | Ga0070659_100138977 | Ga0070659_1001389772 | 305 |
| 262 | 3300005444 | Ga0070694_100070229 | Ga0070694_1000702292 | 305 |
| 263 | 3300005458 | Ga0070681_10085053 | Ga0070681_100850533 | 305 |
| 264 | 3300005466 | Ga0070685_10040207 | Ga0070685_100402073 | 305 |
| 265 | 3300005543 | Ga0070672_100030395 | Ga0070672_1000303953 | 305 |
| 266 | 3300005545 | Ga0070695_100283595 | Ga0070695_1002835951 | 305 |
| 267 | 3300005564 | Ga0070664_100008176 | Ga0070664_1000081763 | 305 |
| 268 | 3300005577 | Ga0068857_100040629 | Ga0068857_1000406293 | 305 |
| 269 | 3300005577 | Ga0068857_100172853 | Ga0068857_1001728531 | 305 |
| 270 | 3300005618 | Ga0068864_100013302 | Ga0068864_1000133024 | 305 |
| 271 | 3300005843 | Ga0068860_100286267 | Ga0068860_1002862671 | 305 |
| 272 | 3300005844 | Ga0068862_100043818 | Ga0068862_1000438182 | 305 |
| 273 | 3300006038 | Ga0075365_10028321 | Ga0075365_100283213 | 305 |
| 274 | 3300006038 | Ga0075365_10067402 | Ga0075365_100674023 | 305 |
| 275 | 3300006048 | Ga0075363_100008158 | Ga0075363_1000081585 | 305 |
| 276 | 3300013105 | Ga0157369_10075019 | Ga0157369_100750191 | 305 |
| 277 | 3300014325 | Ga0163163_10165626 | Ga0163163_101656261 | 305 |
| 278 | 3300014745 | Ga0157377_10030701 | Ga0157377_100307013 | 305 |
| 279 | 3300025912 | Ga0207707_10112399 | Ga0207707_101123992 | 305 |
| 280 | 3300025918 | Ga0207662_10026192 | Ga0207662_100261923 | 305 |
| 281 | 3300025923 | Ga0207681_10025247 | Ga0207681_100252473 | 305 |
| 282 | 3300025925 | Ga0207650_10006782 | Ga0207650_100067825 | 305 |
| 283 | 3300025940 | Ga0207691_10007977 | Ga0207691_100079776 | 305 |
| 284 | 3300025945 | Ga0207679_10383770 | Ga0207679_103837702 | 305 |
| 285 | 3300026067 | Ga0207678_10087745 | Ga0207678_100877453 | 305 |
| 286 | 3300026088 | Ga0207641_10158636 | Ga0207641_101586361 | 305 |
| 287 | 3300026116 | Ga0207674_10102958 | Ga0207674_101029582 | 305 |
| 288 | 3300026118 | Ga0207675_100121015 | Ga0207675_1001210151 | 305 |
| 289 | 3300028379 | Ga0268266_10254026 | Ga0268266_102540262 | 305 |
| 290 | 3300028380 | Ga0268265_10110274 | Ga0268265_101102742 | 305 |
| 291 | 3300028381 | Ga0268264_10242333 | Ga0268264_102423331 | 305 |
| 292 | 3300045976 | Ga0466967_0331005 | Ga0466967_0331005_90_1115 | 305 |
| 293 | 3300046691 | Ga0495670_0040088 | Ga0495670_0040088_1000_2040 | 305 |
| 294 | 3300050492 | nmdc:mga0yw44_62387_c1 | nmdc:mga0yw44_62387_c1_669_1595 | 305 |
| 295 | 3300050492 | nmdc:mga0yw44_9242_c1 | nmdc:mga0yw44_9242_c1_328_1254 | 305 |
| 296 | 3300050494 | nmdc:mga06z11_57436_c1 | nmdc:mga06z11_57436_c1_594_1520 | 305 |
| 297 | 3300005365 | Ga0070688_100226817 | Ga0070688_1002268172 | 306 |
| 298 | 3300005456 | Ga0070678_100047842 | Ga0070678_1000478422 | 306 |
| 299 | 3300005458 | Ga0070681_10125886 | Ga0070681_101258862 | 306 |
| 300 | 3300005459 | Ga0068867_100084333 | Ga0068867_1000843332 | 306 |
| 301 | 3300005530 | Ga0070679_100167854 | Ga0070679_1001678542 | 306 |
| 302 | 3300005535 | Ga0070684_100554897 | Ga0070684_1005548971 | 306 |
| 303 | 3300005842 | Ga0068858_100165648 | Ga0068858_1001656481 | 306 |
| 304 | 3300006195 | Ga0075366_10044936 | Ga0075366_100449364 | 306 |
| 305 | 3300006237 | Ga0097621_100065103 | Ga0097621_1000651032 | 306 |
| 306 | 3300006358 | Ga0068871_100008039 | Ga0068871_1000080392 | 306 |
| 307 | 3300009098 | Ga0105245_10044451 | Ga0105245_100444515 | 306 |
| 308 | 3300009148 | Ga0105243_10057455 | Ga0105243_100574551 | 306 |
| 309 | 3300013296 | Ga0157374_10179311 | Ga0157374_101793111 | 306 |
| 310 | 3300025912 | Ga0207707_10076906 | Ga0207707_100769062 | 306 |
| 311 | 3300025927 | Ga0207687_10028032 | Ga0207687_100280325 | 306 |
| 312 | 3300025935 | Ga0207709_10125083 | Ga0207709_101250831 | 306 |
| 313 | 3300026089 | Ga0207648_10070878 | Ga0207648_100708783 | 306 |
| 314 | 3300026121 | Ga0207683_10167454 | Ga0207683_101674542 | 306 |
| 315 | 3300032005 | Ga0307411_10029466 | Ga0307411_100294662 | 306 |
| 316 | 3300035695 | Ga0373927_0029586 | Ga0373927_0029586_1367_2416 | 306 |
| 317 | 3300035724 | Ga0373933_0185573 | Ga0373933_0185573_374_1315 | 306 |
| 318 | 3300036401 | Ga0373937_0109331 | Ga0373937_0109331_1400_2341 | 306 |
| 319 | 3300037068 | Ga0373925_0005806 | Ga0373925_0005806_1112_2161 | 306 |
| 320 | 3300046453 | Ga0495627_009242 | Ga0495627_009242_1545_2570 | 306 |
| 321 | 3300046515 | Ga0495620_0036941 | Ga0495620_0036941_936_1961 | 306 |
| 322 | 3300046660 | Ga0495625_0155211 | Ga0495625_0155211_101_1126 | 306 |
| 323 | 3300046674 | Ga0495588_0096308 | Ga0495588_0096308_235_1260 | 306 |
| 324 | 3300046683 | Ga0495658_0064913 | Ga0495658_0064913_771_1820 | 306 |
| 325 | 3300046691 | Ga0495670_0013224 | Ga0495670_0013224_2834_3859 | 306 |
| 326 | 3300046692 | Ga0495671_0016342 | Ga0495671_0016342_2714_3739 | 306 |
| 327 | 3300049742 | Ga0501080_0082175 | Ga0501080_0082175_1640_2734 | 306 |
| 328 | 3300053079 | Ga0500610_0001956 | Ga0500610_0001956_575_1654 | 306 |
| 329 | 3300053079 | Ga0500610_0002763 | Ga0500610_0002763_1321_2346 | 306 |
| 330 | 3300053117 | Ga0500593_000167 | Ga0500593_000167_2614_3639 | 306 |
| 331 | 3300053158 | Ga0500627_0000617 | Ga0500627_0000617_2864_3889 | 306 |
| 332 | 3300053161 | Ga0500634_0094881 | Ga0500634_0094881_338_1363 | 306 |
| 333 | 3300005518 | Ga0070699_100045216 | Ga0070699_1000452162 | 307 |
| 334 | 3300006177 | Ga0075362_10001351 | Ga0075362_100013512 | 307 |
| 335 | 3300006353 | Ga0075370_10034735 | Ga0075370_100347351 | 307 |
| 336 | 3300006847 | Ga0075431_100036195 | Ga0075431_1000361952 | 307 |
| 337 | 3300009147 | Ga0114129_10047462 | Ga0114129_100474625 | 307 |
| 338 | 3300028563 | Ga0265319_1001589 | Ga0265319_10015895 | 307 |
| 339 | 3300028577 | Ga0265318_10003429 | Ga0265318_100034295 | 307 |
| 340 | 3300031238 | Ga0265332_10021346 | Ga0265332_100213462 | 307 |
| 341 | 3300031240 | Ga0265320_10000126 | Ga0265320_1000012660 | 307 |
| 342 | 3300031242 | Ga0265329_10002177 | Ga0265329_100021772 | 307 |
| 343 | 3300031249 | Ga0265339_10021805 | Ga0265339_100218052 | 307 |
| 344 | 3300031250 | Ga0265331_10000025 | Ga0265331_10000025204 | 307 |
| 345 | 3300031344 | Ga0265316_10011066 | Ga0265316_100110663 | 307 |
| 346 | 3300031595 | Ga0265313_10005119 | Ga0265313_100051194 | 307 |
| 347 | 3300031711 | Ga0265314_10006180 | Ga0265314_100061807 | 307 |
| 348 | 3300031712 | Ga0265342_10002273 | Ga0265342_100022738 | 307 |
| 349 | 3300049742 | Ga0501080_0220472 | Ga0501080_0220472_733_1722 | 307 |
| 350 | 3300050507 | nmdc:mga05p37_11335_c1 | nmdc:mga05p37_11335_c1_4370_5371 | 307 |
| 351 | 3300050510 | nmdc:mga06r32_103740_c1 | nmdc:mga06r32_103740_c1_166_1167 | 307 |
| 352 | 3300005329 | Ga0070683_100005567 | Ga0070683_1000055677 | 308 |
| 353 | 3300005331 | Ga0070670_100000360 | Ga0070670_1000003605 | 308 |
| 354 | 3300005334 | Ga0068869_100155068 | Ga0068869_1001550682 | 308 |
| 355 | 3300005336 | Ga0070680_100001073 | Ga0070680_1000010739 | 308 |
| 356 | 3300005336 | Ga0070680_100084397 | Ga0070680_1000843972 | 308 |
| 357 | 3300005336 | Ga0070680_100121819 | Ga0070680_1001218192 | 308 |
| 358 | 3300005338 | Ga0068868_100001821 | Ga0068868_1000018219 | 308 |
| 359 | 3300005339 | Ga0070660_100237426 | Ga0070660_1002374261 | 308 |
| 360 | 3300005344 | Ga0070661_100000772 | Ga0070661_10000077213 | 308 |
| 361 | 3300005355 | Ga0070671_100001024 | Ga0070671_10000102414 | 308 |
| 362 | 3300005364 | Ga0070673_100000234 | Ga0070673_10000023415 | 308 |
| 363 | 3300005366 | Ga0070659_100092341 | Ga0070659_1000923411 | 308 |
| 364 | 3300005367 | Ga0070667_100014038 | Ga0070667_1000140389 | 308 |
| 365 | 3300005367 | Ga0070667_100014411 | Ga0070667_1000144113 | 308 |
| 366 | 3300005434 | Ga0070709_10014066 | Ga0070709_100140663 | 308 |
| 367 | 3300005439 | Ga0070711_100335680 | Ga0070711_1003356801 | 308 |
| 368 | 3300005456 | Ga0070678_100000029 | Ga0070678_10000002914 | 308 |
| 369 | 3300005457 | Ga0070662_100069230 | Ga0070662_1000692302 | 308 |
| 370 | 3300005458 | Ga0070681_10003861 | Ga0070681_100038619 | 308 |
| 371 | 3300005458 | Ga0070681_10027003 | Ga0070681_100270032 | 308 |
| 372 | 3300005458 | Ga0070681_10047532 | Ga0070681_100475322 | 308 |
| 373 | 3300005458 | Ga0070681_10112684 | Ga0070681_101126842 | 308 |
| 374 | 3300005459 | Ga0068867_100014340 | Ga0068867_1000143403 | 308 |
| 375 | 3300005459 | Ga0068867_100126649 | Ga0068867_1001266492 | 308 |
| 376 | 3300005530 | Ga0070679_100000747 | Ga0070679_10000074714 | 308 |
| 377 | 3300005530 | Ga0070679_100105672 | Ga0070679_1001056721 | 308 |
| 378 | 3300005530 | Ga0070679_100119144 | Ga0070679_1001191442 | 308 |
| 379 | 3300005530 | Ga0070679_100182842 | Ga0070679_1001828422 | 308 |
| 380 | 3300005535 | Ga0070684_100041950 | Ga0070684_1000419502 | 308 |
| 381 | 3300005535 | Ga0070684_100045575 | Ga0070684_1000455751 | 308 |
| 382 | 3300005543 | Ga0070672_100000952 | Ga0070672_10000095211 | 308 |
| 383 | 3300005546 | Ga0070696_100116697 | Ga0070696_1001166971 | 308 |
| 384 | 3300005548 | Ga0070665_100080630 | Ga0070665_1000806303 | 308 |
| 385 | 3300005563 | Ga0068855_100056524 | Ga0068855_1000565244 | 308 |
| 386 | 3300005564 | Ga0070664_100001531 | Ga0070664_10000153114 | 308 |
| 387 | 3300005578 | Ga0068854_100000507 | Ga0068854_10000050712 | 308 |
| 388 | 3300005614 | Ga0068856_100045474 | Ga0068856_1000454745 | 308 |
| 389 | 3300005616 | Ga0068852_100000304 | Ga0068852_1000003045 | 308 |
| 390 | 3300005617 | Ga0068859_100380404 | Ga0068859_1003804042 | 308 |
| 391 | 3300005618 | Ga0068864_100008517 | Ga0068864_1000085174 | 308 |
| 392 | 3300005718 | Ga0068866_10012323 | Ga0068866_100123234 | 308 |
| 393 | 3300005834 | Ga0068851_10003179 | Ga0068851_100031797 | 308 |
| 394 | 3300005841 | Ga0068863_100016598 | Ga0068863_1000165986 | 308 |
| 395 | 3300005841 | Ga0068863_100553194 | Ga0068863_1005531941 | 308 |
| 396 | 3300005842 | Ga0068858_100015894 | Ga0068858_1000158949 | 308 |
| 397 | 3300005843 | Ga0068860_100044476 | Ga0068860_1000444761 | 308 |
| 398 | 3300006163 | Ga0070715_10039124 | Ga0070715_100391242 | 308 |
| 399 | 3300006237 | Ga0097621_100001892 | Ga0097621_10000189210 | 308 |
| 400 | 3300006237 | Ga0097621_100197938 | Ga0097621_1001979382 | 308 |
| 401 | 3300006358 | Ga0068871_100000178 | Ga0068871_10000017838 | 308 |
| 402 | 3300006358 | Ga0068871_100004850 | Ga0068871_1000048502 | 308 |
| 403 | 3300006358 | Ga0068871_100044859 | Ga0068871_1000448592 | 308 |
| 404 | 3300006358 | Ga0068871_100048242 | Ga0068871_1000482423 | 308 |
| 405 | 3300006881 | Ga0068865_100059948 | Ga0068865_1000599481 | 308 |
| 406 | 3300006931 | Ga0097620_100380398 | Ga0097620_1003803982 | 308 |
| 407 | 3300009093 | Ga0105240_10008709 | Ga0105240_100087092 | 308 |
| 408 | 3300009093 | Ga0105240_10022713 | Ga0105240_100227134 | 308 |
| 409 | 3300009093 | Ga0105240_10048700 | Ga0105240_100487003 | 308 |
| 410 | 3300009098 | Ga0105245_10004551 | Ga0105245_100045511 | 308 |
| 411 | 3300009101 | Ga0105247_10028032 | Ga0105247_100280321 | 308 |
| 412 | 3300009148 | Ga0105243_10033245 | Ga0105243_100332454 | 308 |
| 413 | 3300009174 | Ga0105241_10016750 | Ga0105241_100167501 | 308 |
| 414 | 3300009174 | Ga0105241_10118040 | Ga0105241_101180402 | 308 |
| 415 | 3300009176 | Ga0105242_10001175 | Ga0105242_1000117516 | 308 |
| 416 | 3300009176 | Ga0105242_10017298 | Ga0105242_100172984 | 308 |
| 417 | 3300009177 | Ga0105248_10009284 | Ga0105248_100092842 | 308 |
| 418 | 3300009177 | Ga0105248_10012888 | Ga0105248_100128882 | 308 |
| 419 | 3300009545 | Ga0105237_10012575 | Ga0105237_100125752 | 308 |
| 420 | 3300009551 | Ga0105238_10015546 | Ga0105238_100155465 | 308 |
| 421 | 3300013104 | Ga0157370_10046152 | Ga0157370_100461524 | 308 |
| 422 | 3300013105 | Ga0157369_10010521 | Ga0157369_100105217 | 308 |
| 423 | 3300013296 | Ga0157374_10006530 | Ga0157374_100065305 | 308 |
| 424 | 3300013296 | Ga0157374_10043040 | Ga0157374_100430403 | 308 |
| 425 | 3300013296 | Ga0157374_10142908 | Ga0157374_101429082 | 308 |
| 426 | 3300013297 | Ga0157378_10000669 | Ga0157378_1000066924 | 308 |
| 427 | 3300013306 | Ga0163162_10007098 | Ga0163162_100070989 | 308 |
| 428 | 3300013307 | Ga0157372_10170372 | Ga0157372_101703722 | 308 |
| 429 | 3300013307 | Ga0157372_10343095 | Ga0157372_103430952 | 308 |
| 430 | 3300013308 | Ga0157375_10019135 | Ga0157375_100191353 | 308 |
| 431 | 3300014325 | Ga0163163_10060723 | Ga0163163_100607231 | 308 |
| 432 | 3300014497 | Ga0182008_10035495 | Ga0182008_100354952 | 308 |
| 433 | 3300014968 | Ga0157379_10016182 | Ga0157379_100161822 | 308 |
| 434 | 3300014969 | Ga0157376_10071446 | Ga0157376_100714463 | 308 |
| 435 | 3300014969 | Ga0157376_10100530 | Ga0157376_101005302 | 308 |
| 436 | 3300025321 | Ga0207656_10042183 | Ga0207656_100421831 | 308 |
| 437 | 3300025903 | Ga0207680_10009786 | Ga0207680_100097864 | 308 |
| 438 | 3300025906 | Ga0207699_10112757 | Ga0207699_101127571 | 308 |
| 439 | 3300025912 | Ga0207707_10001661 | Ga0207707_1000166113 | 308 |
| 440 | 3300025912 | Ga0207707_10029072 | Ga0207707_100290722 | 308 |
| 441 | 3300025912 | Ga0207707_10162473 | Ga0207707_101624732 | 308 |
| 442 | 3300025912 | Ga0207707_10170460 | Ga0207707_101704602 | 308 |
| 443 | 3300025913 | Ga0207695_10030460 | Ga0207695_100304606 | 308 |
| 444 | 3300025914 | Ga0207671_10035879 | Ga0207671_100358793 | 308 |
| 445 | 3300025917 | Ga0207660_10000876 | Ga0207660_100008769 | 308 |
| 446 | 3300025921 | Ga0207652_10003186 | Ga0207652_100031862 | 308 |
| 447 | 3300025921 | Ga0207652_10035135 | Ga0207652_100351353 | 308 |
| 448 | 3300025924 | Ga0207694_10002315 | Ga0207694_1000231514 | 308 |
| 449 | 3300025925 | Ga0207650_10001556 | Ga0207650_100015569 | 308 |
| 450 | 3300025927 | Ga0207687_10055874 | Ga0207687_100558742 | 308 |
| 451 | 3300025932 | Ga0207690_10295464 | Ga0207690_102954641 | 308 |
| 452 | 3300025934 | Ga0207686_10002714 | Ga0207686_100027146 | 308 |
| 453 | 3300025934 | Ga0207686_10116638 | Ga0207686_101166382 | 308 |
| 454 | 3300025934 | Ga0207686_10161083 | Ga0207686_101610832 | 308 |
| 455 | 3300025938 | Ga0207704_10178173 | Ga0207704_101781731 | 308 |
| 456 | 3300025940 | Ga0207691_10000487 | Ga0207691_1000048724 | 308 |
| 457 | 3300025941 | Ga0207711_10066338 | Ga0207711_100663383 | 308 |
| 458 | 3300025941 | Ga0207711_10114093 | Ga0207711_101140931 | 308 |
| 459 | 3300025942 | Ga0207689_10164215 | Ga0207689_101642151 | 308 |
| 460 | 3300025944 | Ga0207661_10000791 | Ga0207661_1000079117 | 308 |
| 461 | 3300025945 | Ga0207679_10005265 | Ga0207679_100052657 | 308 |
| 462 | 3300025949 | Ga0207667_10044627 | Ga0207667_100446272 | 308 |
| 463 | 3300025949 | Ga0207667_10058405 | Ga0207667_100584054 | 308 |
| 464 | 3300025949 | Ga0207667_10317198 | Ga0207667_103171982 | 308 |
| 465 | 3300025960 | Ga0207651_10000522 | Ga0207651_1000052214 | 308 |
| 466 | 3300025981 | Ga0207640_10000864 | Ga0207640_100008649 | 308 |
| 467 | 3300025986 | Ga0207658_10118664 | Ga0207658_101186642 | 308 |
| 468 | 3300026023 | Ga0207677_10000909 | Ga0207677_100009097 | 308 |
| 469 | 3300026023 | Ga0207677_10058062 | Ga0207677_100580624 | 308 |
| 470 | 3300026035 | Ga0207703_10030728 | Ga0207703_100307282 | 308 |
| 471 | 3300026088 | Ga0207641_10038856 | Ga0207641_100388564 | 308 |
| 472 | 3300026088 | Ga0207641_10179724 | Ga0207641_101797242 | 308 |
| 473 | 3300026089 | Ga0207648_10013950 | Ga0207648_100139504 | 308 |
| 474 | 3300026089 | Ga0207648_10114088 | Ga0207648_101140882 | 308 |
| 475 | 3300026095 | Ga0207676_10008300 | Ga0207676_100083004 | 308 |
| 476 | 3300026116 | Ga0207674_10004223 | Ga0207674_100042239 | 308 |
| 477 | 3300026116 | Ga0207674_10040678 | Ga0207674_100406782 | 308 |
| 478 | 3300026121 | Ga0207683_10001359 | Ga0207683_100013594 | 308 |
| 479 | 3300026121 | Ga0207683_10165451 | Ga0207683_101654512 | 308 |
| 480 | 3300026142 | Ga0207698_10003982 | Ga0207698_100039825 | 308 |
| 481 | 3300028379 | Ga0268266_10285439 | Ga0268266_102854392 | 308 |
| 482 | 3300031711 | Ga0265314_10002925 | Ga0265314_100029253 | 308 |
| 483 | 3300036401 | Ga0373937_0025752 | Ga0373937_0025752_384_1316 | 308 |
| 484 | 3300039450 | Ga0436363_1081739 | Ga0436363_1081739_599_1690 | 308 |
| 485 | 3300046472 | Ga0495580_0151628 | Ga0495580_0151628_293_1354 | 308 |
| 486 | 3300048903 | Ga0496100_0126255 | Ga0496100_0126255_393_1376 | 308 |
| 487 | 3300048905 | Ga0496102_0352009 | Ga0496102_0352009_393_1376 | 308 |
| 488 | 3300048909 | Ga0496106_0061353 | Ga0496106_0061353_1389_2480 | 308 |
| 489 | 3300048911 | Ga0496108_0003956 | Ga0496108_0003956_3394_4485 | 308 |
| 490 | 3300048913 | Ga0496110_0000354 | Ga0496110_0000354_2538_3629 | 308 |
| 491 | 3300005327 | Ga0070658_10031050 | Ga0070658_100310503 | 309 |
| 492 | 3300005329 | Ga0070683_100251336 | Ga0070683_1002513362 | 309 |
| 493 | 3300005339 | Ga0070660_100004998 | Ga0070660_10000499810 | 309 |
| 494 | 3300005340 | Ga0070689_100070073 | Ga0070689_1000700731 | 309 |
| 495 | 3300005344 | Ga0070661_100036427 | Ga0070661_1000364272 | 309 |
| 496 | 3300005344 | Ga0070661_100425122 | Ga0070661_1004251221 | 309 |
| 497 | 3300005367 | Ga0070667_100211413 | Ga0070667_1002114132 | 309 |
| 498 | 3300005435 | Ga0070714_100020981 | Ga0070714_1000209814 | 309 |
| 499 | 3300005435 | Ga0070714_100035257 | Ga0070714_1000352572 | 309 |
| 500 | 3300005436 | Ga0070713_100001547 | Ga0070713_1000015479 | 309 |
| 501 | 3300005436 | Ga0070713_100065329 | Ga0070713_1000653293 | 309 |
| 502 | 3300005458 | Ga0070681_10131109 | Ga0070681_101311092 | 309 |
| 503 | 3300005530 | Ga0070679_100126401 | Ga0070679_1001264013 | 309 |
| 504 | 3300005539 | Ga0068853_100080699 | Ga0068853_1000806993 | 309 |
| 505 | 3300005563 | Ga0068855_100004131 | Ga0068855_10000413111 | 309 |
| 506 | 3300005564 | Ga0070664_100008202 | Ga0070664_1000082029 | 309 |
| 507 | 3300005564 | Ga0070664_100085893 | Ga0070664_1000858932 | 309 |
| 508 | 3300005577 | Ga0068857_100002292 | Ga0068857_10000229212 | 309 |
| 509 | 3300005614 | Ga0068856_100005189 | Ga0068856_10000518910 | 309 |
| 510 | 3300005614 | Ga0068856_100398118 | Ga0068856_1003981182 | 309 |
| 511 | 3300005616 | Ga0068852_100001579 | Ga0068852_1000015792 | 309 |
| 512 | 3300005834 | Ga0068851_10015788 | Ga0068851_100157882 | 309 |
| 513 | 3300005841 | Ga0068863_100129941 | Ga0068863_1001299412 | 309 |
| 514 | 3300005841 | Ga0068863_100441823 | Ga0068863_1004418232 | 309 |
| 515 | 3300005842 | Ga0068858_100266687 | Ga0068858_1002666872 | 309 |
| 516 | 3300006038 | Ga0075365_10029767 | Ga0075365_100297672 | 309 |
| 517 | 3300009093 | Ga0105240_10003088 | Ga0105240_100030889 | 309 |
| 518 | 3300009093 | Ga0105240_10067874 | Ga0105240_100678742 | 309 |
| 519 | 3300009174 | Ga0105241_10025688 | Ga0105241_100256882 | 309 |
| 520 | 3300009545 | Ga0105237_10105768 | Ga0105237_101057683 | 309 |
| 521 | 3300009551 | Ga0105238_10008593 | Ga0105238_100085935 | 309 |
| 522 | 3300013100 | Ga0157373_10019856 | Ga0157373_100198566 | 309 |
| 523 | 3300013104 | Ga0157370_10014113 | Ga0157370_100141135 | 309 |
| 524 | 3300013105 | Ga0157369_10020431 | Ga0157369_100204318 | 309 |
| 525 | 3300013105 | Ga0157369_10479294 | Ga0157369_104792942 | 309 |
| 526 | 3300013307 | Ga0157372_10007514 | Ga0157372_100075144 | 309 |
| 527 | 3300013307 | Ga0157372_10245451 | Ga0157372_102454512 | 309 |
| 528 | 3300014969 | Ga0157376_10138791 | Ga0157376_101387914 | 309 |
| 529 | 3300025907 | Ga0207645_10082106 | Ga0207645_100821062 | 309 |
| 530 | 3300025909 | Ga0207705_10056046 | Ga0207705_100560462 | 309 |
| 531 | 3300025911 | Ga0207654_10084100 | Ga0207654_100841002 | 309 |
| 532 | 3300025913 | Ga0207695_10073689 | Ga0207695_100736892 | 309 |
| 533 | 3300025917 | Ga0207660_10310820 | Ga0207660_103108202 | 309 |
| 534 | 3300025919 | Ga0207657_10026429 | Ga0207657_100264293 | 309 |
| 535 | 3300025919 | Ga0207657_10089547 | Ga0207657_100895472 | 309 |
| 536 | 3300025920 | Ga0207649_10001851 | Ga0207649_100018519 | 309 |
| 537 | 3300025920 | Ga0207649_10078376 | Ga0207649_100783762 | 309 |
| 538 | 3300025924 | Ga0207694_10003094 | Ga0207694_100030942 | 309 |
| 539 | 3300025928 | Ga0207700_10000711 | Ga0207700_1000071114 | 309 |
| 540 | 3300025932 | Ga0207690_10265153 | Ga0207690_102651532 | 309 |
| 541 | 3300025945 | Ga0207679_10005698 | Ga0207679_100056988 | 309 |
| 542 | 3300025949 | Ga0207667_10009675 | Ga0207667_100096758 | 309 |
| 543 | 3300026041 | Ga0207639_10179460 | Ga0207639_101794601 | 309 |
| 544 | 3300026078 | Ga0207702_10005560 | Ga0207702_1000556012 | 309 |
| 545 | 3300026088 | Ga0207641_10295741 | Ga0207641_102957412 | 309 |
| 546 | 3300026116 | Ga0207674_10004206 | Ga0207674_1000420612 | 309 |
| 547 | 3300026118 | Ga0207675_100151299 | Ga0207675_1001512992 | 309 |
| 548 | 3300026142 | Ga0207698_10006663 | Ga0207698_100066639 | 309 |
| 549 | 3300028380 | Ga0268265_10170677 | Ga0268265_101706772 | 309 |
| 550 | 3300028381 | Ga0268264_10374045 | Ga0268264_103740452 | 309 |
| 551 | 3300031456 | Ga0307513_10163172 | Ga0307513_101631722 | 309 |
| 552 | 3300031852 | Ga0307410_10001555 | Ga0307410_100015558 | 309 |
| 553 | 3300031995 | Ga0307409_100229207 | Ga0307409_1002292072 | 309 |
| 554 | 3300037418 | Ga0395900_0254251 | Ga0395900_0254251_102_1226 | 309 |
| 555 | 3300037471 | Ga0395905_0220132 | Ga0395905_0220132_385_1509 | 309 |
| 556 | 3300037853 | Ga0436364_1342640 | Ga0436364_1342640_671_1795 | 309 |
| 557 | 3300038443 | Ga0395901_0056051 | Ga0395901_0056051_627_1751 | 309 |
| 558 | 3300046511 | Ga0495608_0040750 | Ga0495608_0040750_929_1918 | 309 |
| 559 | 3300046516 | Ga0495628_0015347 | Ga0495628_0015347_2817_3806 | 309 |
| 560 | 3300046517 | Ga0495630_0105400 | Ga0495630_0105400_1080_2069 | 309 |
| 561 | 3300046675 | Ga0495657_0029527 | Ga0495657_0029527_1613_2602 | 309 |
| 562 | 3300047317 | Ga0495604_0007416 | Ga0495604_0007416_3210_4199 | 309 |
| 563 | 3300047444 | Ga0495675_0168246 | Ga0495675_0168246_323_1312 | 309 |
| 564 | 3300047471 | Ga0495684_0001017 | Ga0495684_0001017_12509_13498 | 309 |
| 565 | 3300048912 | Ga0496109_0161631 | Ga0496109_0161631_846_1823 | 309 |
| 566 | 3300048912 | Ga0496109_0179131 | Ga0496109_0179131_203_1147 | 309 |
| 567 | 3300048914 | Ga0496111_0164779 | Ga0496111_0164779_670_1614 | 309 |
| 568 | 3300048915 | Ga0496112_0009411 | Ga0496112_0009411_1568_2545 | 309 |
| 569 | 3300048915 | Ga0496112_0467858 | Ga0496112_0467858_52_996 | 309 |
| 570 | 3300048916 | Ga0496113_0103915 | Ga0496113_0103915_569_1546 | 309 |
| 571 | 3300005530 | Ga0070679_100135881 | Ga0070679_1001358812 | 310 |
| 572 | 3300025921 | Ga0207652_10053056 | Ga0207652_100530562 | 310 |
| 573 | 3300048907 | Ga0496104_0000629 | Ga0496104_0000629_12970_13923 | 310 |
| 574 | 3300048908 | Ga0496105_0051517 | Ga0496105_0051517_1031_1984 | 310 |
| 575 | 3300048908 | Ga0496105_0055817 | Ga0496105_0055817_196_1152 | 310 |
| 576 | 3300048912 | Ga0496109_0292355 | Ga0496109_0292355_311_1267 | 310 |
| 577 | 3300048916 | Ga0496113_0207089 | Ga0496113_0207089_37_990 | 310 |
| 578 | 3300048917 | Ga0496114_0199376 | Ga0496114_0199376_185_1141 | 310 |
| 579 | 3300048918 | Ga0496115_0019361 | Ga0496115_0019361_3006_3962 | 310 |
| 580 | 3300050493 | nmdc:mga0k408_176154_c1 | nmdc:mga0k408_176154_c1_81_1034 | 310 |
| 581 | 3300006173 | Ga0070716_100056741 | Ga0070716_1000567411 | 311 |
| 582 | 3300006175 | Ga0070712_100018454 | Ga0070712_1000184542 | 311 |
| 583 | 3300025915 | Ga0207693_10011631 | Ga0207693_100116311 | 311 |
| 584 | 3300035170 | Ga0373943_0049954 | Ga0373943_0049954_244_1425 | 311 |
| 585 | 3300046473 | Ga0495582_0045692 | Ga0495582_0045692_537_1718 | 311 |
| 586 | 3300049742 | Ga0501080_0150883 | Ga0501080_0150883_350_1285 | 311 |
| 587 | 3300005340 | Ga0070689_100241615 | Ga0070689_1002416152 | 312 |
| 588 | 3300005356 | Ga0070674_100061668 | Ga0070674_1000616682 | 312 |
| 589 | 3300006051 | Ga0075364_10151058 | Ga0075364_101510581 | 312 |
| 590 | 3300025937 | Ga0207669_10010994 | Ga0207669_100109942 | 312 |
| 591 | 3300027866 | Ga0209813_10019704 | Ga0209813_100197042 | 312 |
| 592 | 3300031616 | Ga0307508_10118987 | Ga0307508_101189872 | 312 |
| 593 | 3300033179 | Ga0307507_10021651 | Ga0307507_100216514 | 312 |
| 594 | 3300035083 | Ga0373926_0003746 | Ga0373926_0003746_1298_2287 | 312 |
| 595 | 3300035111 | Ga0373923_0014926 | Ga0373923_0014926_1294_2283 | 312 |
| 596 | 3300035692 | Ga0373935_0013406 | Ga0373935_0013406_1406_2395 | 312 |
| 597 | 3300035695 | Ga0373927_0013237 | Ga0373927_0013237_1187_2176 | 312 |
| 598 | 3300035724 | Ga0373933_0040617 | Ga0373933_0040617_678_1667 | 312 |
| 599 | 3300035725 | Ga0373947_0081263 | Ga0373947_0081263_892_1881 | 312 |
| 600 | 3300035725 | Ga0373947_0092281 | Ga0373947_0092281_752_1840 | 312 |
| 601 | 3300036401 | Ga0373937_0020394 | Ga0373937_0020394_71_1060 | 312 |
| 602 | 3300046454 | Ga0495592_0060067 | Ga0495592_0060067_1646_2764 | 312 |
| 603 | 3300046462 | Ga0495651_0003700 | Ga0495651_0003700_95_1090 | 312 |
| 604 | 3300046462 | Ga0495651_0017221 | Ga0495651_0017221_1286_2275 | 312 |
| 605 | 3300046463 | Ga0495653_0005354 | Ga0495653_0005354_8867_9985 | 312 |
| 606 | 3300046463 | Ga0495653_0022342 | Ga0495653_0022342_774_1763 | 312 |
| 607 | 3300046472 | Ga0495580_0008302 | Ga0495580_0008302_357_1346 | 312 |
| 608 | 3300046477 | Ga0495664_0021142 | Ga0495664_0021142_1874_2992 | 312 |
| 609 | 3300046477 | Ga0495664_0022622 | Ga0495664_0022622_890_1879 | 312 |
| 610 | 3300046511 | Ga0495608_0051857 | Ga0495608_0051857_772_1761 | 312 |
| 611 | 3300046517 | Ga0495630_0017063 | Ga0495630_0017063_261_1250 | 312 |
| 612 | 3300046529 | Ga0495652_0012012 | Ga0495652_0012012_52_1170 | 312 |
| 613 | 3300046529 | Ga0495652_0038611 | Ga0495652_0038611_1411_2400 | 312 |
| 614 | 3300046531 | Ga0495665_0019038 | Ga0495665_0019038_861_1850 | 312 |
| 615 | 3300046536 | Ga0495587_0006972 | Ga0495587_0006972_2496_3614 | 312 |
| 616 | 3300046536 | Ga0495587_0008300 | Ga0495587_0008300_3130_4119 | 312 |
| 617 | 3300046543 | Ga0495645_0034846 | Ga0495645_0034846_953_1942 | 312 |
| 618 | 3300046543 | Ga0495645_0065843 | Ga0495645_0065843_1191_2309 | 312 |
| 619 | 3300046559 | Ga0495667_0001766 | Ga0495667_0001766_5041_6012 | 312 |
| 620 | 3300046559 | Ga0495667_0002726 | Ga0495667_0002726_9322_10440 | 312 |
| 621 | 3300046663 | Ga0495635_0009050 | Ga0495635_0009050_4352_5341 | 312 |
| 622 | 3300046663 | Ga0495635_0039202 | Ga0495635_0039202_1023_2141 | 312 |
| 623 | 3300046675 | Ga0495657_0009531 | Ga0495657_0009531_2618_3736 | 312 |
| 624 | 3300046678 | Ga0495599_0011681 | Ga0495599_0011681_4265_5383 | 312 |
| 625 | 3300046680 | Ga0495646_0007578 | Ga0495646_0007578_4504_5493 | 312 |
| 626 | 3300046689 | Ga0495613_0024298 | Ga0495613_0024298_772_1761 | 312 |
| 627 | 3300046690 | Ga0495624_0007500 | Ga0495624_0007500_3436_4425 | 312 |
| 628 | 3300046809 | Ga0495600_0001469 | Ga0495600_0001469_8916_10034 | 312 |
| 629 | 3300046809 | Ga0495600_0014002 | Ga0495600_0014002_1234_2205 | 312 |
| 630 | 3300047317 | Ga0495604_0001664 | Ga0495604_0001664_2668_3786 | 312 |
| 631 | 3300047317 | Ga0495604_0018395 | Ga0495604_0018395_1171_2160 | 312 |
| 632 | 3300047317 | Ga0495604_0247359 | Ga0495604_0247359_121_1092 | 312 |
| 633 | 3300047319 | Ga0495674_0037720 | Ga0495674_0037720_446_1564 | 312 |
| 634 | 3300047319 | Ga0495674_0053620 | Ga0495674_0053620_946_1935 | 312 |
| 635 | 3300047322 | Ga0495680_0000648 | Ga0495680_0000648_24253_25224 | 312 |
| 636 | 3300047322 | Ga0495680_0020176 | Ga0495680_0020176_4542_5537 | 312 |
| 637 | 3300047444 | Ga0495675_0000643 | Ga0495675_0000643_17917_19035 | 312 |
| 638 | 3300047444 | Ga0495675_0026266 | Ga0495675_0026266_807_1796 | 312 |
| 639 | 3300047444 | Ga0495675_0027252 | Ga0495675_0027252_293_1264 | 312 |
| 640 | 3300047471 | Ga0495684_0002508 | Ga0495684_0002508_614_1732 | 312 |
| 641 | 3300047673 | Ga0495593_0007923 | Ga0495593_0007923_748_1737 | 312 |
| 642 | 3300048088 | Ga0495602_0028473 | Ga0495602_0028473_1518_2636 | 312 |
| 643 | 3300048088 | Ga0495602_0096714 | Ga0495602_0096714_1147_2136 | 312 |
| 644 | 3300048088 | Ga0495602_0197203 | Ga0495602_0197203_29_1018 | 312 |
| 645 | 3300050496 | nmdc:mga07m45_41932_c1 | nmdc:mga07m45_41932_c1_1318_2280 | 312 |
| 646 | 3300053078 | Ga0495612_0002024 | Ga0495612_0002024_2496_3485 | 312 |
| 647 | 3300013104 | Ga0157370_10108970 | Ga0157370_101089702 | 313 |
| 648 | 3300025917 | Ga0207660_10277032 | Ga0207660_102770322 | 313 |
| 649 | 3300049586 | Ga0501070_0091316 | Ga0501070_0091316_245_1201 | 313 |
| 650 | 3300049590 | Ga0501074_0124226 | Ga0501074_0124226_563_1519 | 313 |
| 651 | 3300003215 | JGI25153J46596_10001600 | JGI25153J46596_1000160011 | 315 |
| 652 | 3300003215 | JGI25153J46596_10003919 | JGI25153J46596_100039198 | 315 |
| 653 | 3300005328 | Ga0070676_10006719 | Ga0070676_100067195 | 315 |
| 654 | 3300005330 | Ga0070690_100148028 | Ga0070690_1001480282 | 315 |
| 655 | 3300005331 | Ga0070670_100008155 | Ga0070670_1000081553 | 315 |
| 656 | 3300005336 | Ga0070680_100001601 | Ga0070680_1000016017 | 315 |
| 657 | 3300005338 | Ga0068868_100010138 | Ga0068868_1000101384 | 315 |
| 658 | 3300005347 | Ga0070668_100133205 | Ga0070668_1001332051 | 315 |
| 659 | 3300005347 | Ga0070668_100187874 | Ga0070668_1001878742 | 315 |
| 660 | 3300005354 | Ga0070675_100039312 | Ga0070675_1000393123 | 315 |
| 661 | 3300005355 | Ga0070671_100054636 | Ga0070671_1000546362 | 315 |
| 662 | 3300005355 | Ga0070671_100057104 | Ga0070671_1000571043 | 315 |
| 663 | 3300005356 | Ga0070674_100093025 | Ga0070674_1000930252 | 315 |
| 664 | 3300005364 | Ga0070673_100123210 | Ga0070673_1001232102 | 315 |
| 665 | 3300005365 | Ga0070688_100118618 | Ga0070688_1001186182 | 315 |
| 666 | 3300005441 | Ga0070700_100155415 | Ga0070700_1001554151 | 315 |
| 667 | 3300005456 | Ga0070678_100531369 | Ga0070678_1005313691 | 315 |
| 668 | 3300005458 | Ga0070681_10010586 | Ga0070681_100105866 | 315 |
| 669 | 3300005459 | Ga0068867_100091715 | Ga0068867_1000917152 | 315 |
| 670 | 3300005459 | Ga0068867_100188936 | Ga0068867_1001889362 | 315 |
| 671 | 3300005466 | Ga0070685_10060997 | Ga0070685_100609972 | 315 |
| 672 | 3300005530 | Ga0070679_100003445 | Ga0070679_10000344511 | 315 |
| 673 | 3300005535 | Ga0070684_100098494 | Ga0070684_1000984942 | 315 |
| 674 | 3300005543 | Ga0070672_100024538 | Ga0070672_1000245382 | 315 |
| 675 | 3300005578 | Ga0068854_100104443 | Ga0068854_1001044432 | 315 |
| 676 | 3300005616 | Ga0068852_100024490 | Ga0068852_1000244904 | 315 |
| 677 | 3300005617 | Ga0068859_100093499 | Ga0068859_1000934992 | 315 |
| 678 | 3300005617 | Ga0068859_100121663 | Ga0068859_1001216633 | 315 |
| 679 | 3300005618 | Ga0068864_100282554 | Ga0068864_1002825541 | 315 |
| 680 | 3300005718 | Ga0068866_10091640 | Ga0068866_100916401 | 315 |
| 681 | 3300005840 | Ga0068870_10028970 | Ga0068870_100289702 | 315 |
| 682 | 3300005841 | Ga0068863_100020579 | Ga0068863_1000205792 | 315 |
| 683 | 3300005842 | Ga0068858_100106780 | Ga0068858_1001067802 | 315 |
| 684 | 3300005843 | Ga0068860_100042971 | Ga0068860_1000429712 | 315 |
| 685 | 3300005843 | Ga0068860_100534885 | Ga0068860_1005348852 | 315 |
| 686 | 3300005985 | Ga0081539_10015961 | Ga0081539_100159612 | 315 |
| 687 | 3300006038 | Ga0075365_10131461 | Ga0075365_101314612 | 315 |
| 688 | 3300006042 | Ga0075368_10012864 | Ga0075368_100128642 | 315 |
| 689 | 3300006048 | Ga0075363_100023423 | Ga0075363_1000234232 | 315 |
| 690 | 3300006051 | Ga0075364_10247121 | Ga0075364_102471211 | 315 |
| 691 | 3300006175 | Ga0070712_100192442 | Ga0070712_1001924422 | 315 |
| 692 | 3300006178 | Ga0075367_10058435 | Ga0075367_100584353 | 315 |
| 693 | 3300006178 | Ga0075367_10156001 | Ga0075367_101560012 | 315 |
| 694 | 3300006195 | Ga0075366_10002637 | Ga0075366_1000263712 | 315 |
| 695 | 3300006353 | Ga0075370_10004386 | Ga0075370_100043867 | 315 |
| 696 | 3300006844 | Ga0075428_100134776 | Ga0075428_1001347761 | 315 |
| 697 | 3300006871 | Ga0075434_100046742 | Ga0075434_1000467423 | 315 |
| 698 | 3300006880 | Ga0075429_100112864 | Ga0075429_1001128642 | 315 |
| 699 | 3300006881 | Ga0068865_100089042 | Ga0068865_1000890422 | 315 |
| 700 | 3300006931 | Ga0097620_100093498 | Ga0097620_1000934982 | 315 |
| 701 | 3300006931 | Ga0097620_100121665 | Ga0097620_1001216652 | 315 |
| 702 | 3300009094 | Ga0111539_10024789 | Ga0111539_100247896 | 315 |
| 703 | 3300009094 | Ga0111539_10332176 | Ga0111539_103321761 | 315 |
| 704 | 3300009098 | Ga0105245_10048198 | Ga0105245_100481983 | 315 |
| 705 | 3300009101 | Ga0105247_10006463 | Ga0105247_100064631 | 315 |
| 706 | 3300009147 | Ga0114129_10093819 | Ga0114129_100938193 | 315 |
| 707 | 3300009147 | Ga0114129_10203432 | Ga0114129_102034322 | 315 |
| 708 | 3300009148 | Ga0105243_10121583 | Ga0105243_101215832 | 315 |
| 709 | 3300009176 | Ga0105242_10033080 | Ga0105242_100330803 | 315 |
| 710 | 3300009177 | Ga0105248_10024707 | Ga0105248_100247074 | 315 |
| 711 | 3300013306 | Ga0163162_10076918 | Ga0163162_100769183 | 315 |
| 712 | 3300013308 | Ga0157375_10244923 | Ga0157375_102449232 | 315 |
| 713 | 3300014326 | Ga0157380_10005881 | Ga0157380_100058814 | 315 |
| 714 | 3300014326 | Ga0157380_10382003 | Ga0157380_103820031 | 315 |
| 715 | 3300025297 | Ga0209758_1005734 | Ga0209758_10057342 | 315 |
| 716 | 3300025893 | Ga0207682_10035721 | Ga0207682_100357212 | 315 |
| 717 | 3300025900 | Ga0207710_10006028 | Ga0207710_100060282 | 315 |
| 718 | 3300025901 | Ga0207688_10000663 | Ga0207688_100006634 | 315 |
| 719 | 3300025901 | Ga0207688_10200083 | Ga0207688_102000831 | 315 |
| 720 | 3300025904 | Ga0207647_10029447 | Ga0207647_100294472 | 315 |
| 721 | 3300025907 | Ga0207645_10031160 | Ga0207645_100311603 | 315 |
| 722 | 3300025907 | Ga0207645_10290694 | Ga0207645_102906941 | 315 |
| 723 | 3300025908 | Ga0207643_10000808 | Ga0207643_100008085 | 315 |
| 724 | 3300025912 | Ga0207707_10021068 | Ga0207707_100210683 | 315 |
| 725 | 3300025916 | Ga0207663_10040483 | Ga0207663_100404832 | 315 |
| 726 | 3300025917 | Ga0207660_10252796 | Ga0207660_102527962 | 315 |
| 727 | 3300025919 | Ga0207657_10021585 | Ga0207657_100215853 | 315 |
| 728 | 3300025921 | Ga0207652_10088894 | Ga0207652_100888942 | 315 |
| 729 | 3300025923 | Ga0207681_10020177 | Ga0207681_100201772 | 315 |
| 730 | 3300025933 | Ga0207706_10007308 | Ga0207706_100073089 | 315 |
| 731 | 3300025934 | Ga0207686_10045010 | Ga0207686_100450102 | 315 |
| 732 | 3300025936 | Ga0207670_10001103 | Ga0207670_1000110310 | 315 |
| 733 | 3300025937 | Ga0207669_10099697 | Ga0207669_100996972 | 315 |
| 734 | 3300025940 | Ga0207691_10011566 | Ga0207691_100115665 | 315 |
| 735 | 3300025940 | Ga0207691_10171199 | Ga0207691_101711992 | 315 |
| 736 | 3300025940 | Ga0207691_10226751 | Ga0207691_102267512 | 315 |
| 737 | 3300025941 | Ga0207711_10034011 | Ga0207711_100340113 | 315 |
| 738 | 3300025960 | Ga0207651_10083250 | Ga0207651_100832502 | 315 |
| 739 | 3300026023 | Ga0207677_10054923 | Ga0207677_100549234 | 315 |
| 740 | 3300026067 | Ga0207678_10209985 | Ga0207678_102099852 | 315 |
| 741 | 3300026075 | Ga0207708_10017098 | Ga0207708_100170984 | 315 |
| 742 | 3300026075 | Ga0207708_10160293 | Ga0207708_101602932 | 315 |
| 743 | 3300026089 | Ga0207648_10021939 | Ga0207648_100219392 | 315 |
| 744 | 3300026089 | Ga0207648_10041396 | Ga0207648_100413964 | 315 |
| 745 | 3300026121 | Ga0207683_10002624 | Ga0207683_1000262412 | 315 |
| 746 | 3300026121 | Ga0207683_10094760 | Ga0207683_100947604 | 315 |
| 747 | 3300026142 | Ga0207698_10078798 | Ga0207698_100787983 | 315 |
| 748 | 3300027907 | Ga0207428_10185877 | Ga0207428_101858772 | 315 |
| 749 | 3300028379 | Ga0268266_10249683 | Ga0268266_102496832 | 315 |
| 750 | 3300028381 | Ga0268264_10024308 | Ga0268264_100243082 | 315 |
| 751 | 3300028381 | Ga0268264_10115629 | Ga0268264_101156292 | 315 |
| 752 | 3300031241 | Ga0265325_10000300 | Ga0265325_1000030027 | 315 |
| 753 | 3300031241 | Ga0265325_10066760 | Ga0265325_100667602 | 315 |
| 754 | 3300031247 | Ga0265340_10013459 | Ga0265340_100134594 | 315 |
| 755 | 3300031249 | Ga0265339_10077022 | Ga0265339_100770222 | 315 |
| 756 | 3300034819 | Ga0373958_0003514 | Ga0373958_0003514_20_967 | 315 |
| 757 | 3300035114 | Ga0373939_0045084 | Ga0373939_0045084_179_1126 | 315 |
| 758 | 3300035241 | Ga0373961_0021220 | Ga0373961_0021220_690_1637 | 315 |
| 759 | 3300035691 | Ga0373931_0005266 | Ga0373931_0005266_1201_2148 | 315 |
| 760 | 3300035691 | Ga0373931_0028508 | Ga0373931_0028508_487_1434 | 315 |
| 761 | 3300035692 | Ga0373935_0095845 | Ga0373935_0095845_426_1373 | 315 |
| 762 | 3300036401 | Ga0373937_0151708 | Ga0373937_0151708_229_1176 | 315 |
| 763 | 3300037068 | Ga0373925_0049808 | Ga0373925_0049808_1015_1962 | 315 |
| 764 | 3300037068 | Ga0373925_0156901 | Ga0373925_0156901_294_1442 | 315 |
| 765 | 3300046455 | Ga0495603_0116302 | Ga0495603_0116302_395_1543 | 315 |
| 766 | 3300046455 | Ga0495603_0202319 | Ga0495603_0202319_152_1099 | 315 |
| 767 | 3300046492 | Ga0495585_0072556 | Ga0495585_0072556_97_1245 | 315 |
| 768 | 3300046516 | Ga0495628_0251985 | Ga0495628_0251985_20_967 | 315 |
| 769 | 3300046517 | Ga0495630_0115118 | Ga0495630_0115118_104_1249 | 315 |
| 770 | 3300046523 | Ga0495644_0021615 | Ga0495644_0021615_358_1410 | 315 |
| 771 | 3300046537 | Ga0495598_0047802 | Ga0495598_0047802_161_1213 | 315 |
| 772 | 3300046539 | Ga0495621_0048496 | Ga0495621_0048496_98_1150 | 315 |
| 773 | 3300046557 | Ga0495622_0091214 | Ga0495622_0091214_95_1123 | 315 |
| 774 | 3300046558 | Ga0495633_0079489 | Ga0495633_0079489_198_1250 | 315 |
| 775 | 3300046558 | Ga0495633_0089526 | Ga0495633_0089526_252_1403 | 315 |
| 776 | 3300046664 | Ga0495659_0034039 | Ga0495659_0034039_500_1519 | 315 |
| 777 | 3300046665 | Ga0495661_0131790 | Ga0495661_0131790_155_1207 | 315 |
| 778 | 3300046690 | Ga0495624_0047148 | Ga0495624_0047148_1422_2570 | 315 |
| 779 | 3300046794 | Ga0495589_0038877 | Ga0495589_0038877_528_1580 | 315 |
| 780 | 3300047319 | Ga0495674_0140076 | Ga0495674_0140076_891_1838 | 315 |
| 781 | 3300047319 | Ga0495674_0309214 | Ga0495674_0309214_123_1175 | 315 |
| 782 | 3300048903 | Ga0496100_0042248 | Ga0496100_0042248_813_1760 | 315 |
| 783 | 3300048903 | Ga0496100_0386280 | Ga0496100_0386280_31_978 | 315 |
| 784 | 3300048904 | Ga0496101_0044456 | Ga0496101_0044456_286_1317 | 315 |
| 785 | 3300048904 | Ga0496101_0047499 | Ga0496101_0047499_913_1860 | 315 |
| 786 | 3300048906 | Ga0496103_0009597 | Ga0496103_0009597_732_1784 | 315 |
| 787 | 3300048907 | Ga0496104_0034040 | Ga0496104_0034040_448_1500 | 315 |
| 788 | 3300048908 | Ga0496105_0019396 | Ga0496105_0019396_3718_4749 | 315 |
| 789 | 3300048908 | Ga0496105_0019467 | Ga0496105_0019467_1461_2513 | 315 |
| 790 | 3300048909 | Ga0496106_0352882 | Ga0496106_0352882_100_1131 | 315 |
| 791 | 3300048910 | Ga0496107_0015140 | Ga0496107_0015140_536_1588 | 315 |
| 792 | 3300048911 | Ga0496108_0008275 | Ga0496108_0008275_3824_4855 | 315 |
| 793 | 3300048911 | Ga0496108_0039962 | Ga0496108_0039962_2189_3136 | 315 |
| 794 | 3300048911 | Ga0496108_0065021 | Ga0496108_0065021_1342_2394 | 315 |
| 795 | 3300048912 | Ga0496109_0000766 | Ga0496109_0000766_9105_10136 | 315 |
| 796 | 3300048912 | Ga0496109_0025633 | Ga0496109_0025633_3970_5022 | 315 |
| 797 | 3300048912 | Ga0496109_0061682 | Ga0496109_0061682_25_972 | 315 |
| 798 | 3300048912 | Ga0496109_0077486 | Ga0496109_0077486_623_1570 | 315 |
| 799 | 3300048913 | Ga0496110_0002398 | Ga0496110_0002398_737_1768 | 315 |
| 800 | 3300048913 | Ga0496110_0013610 | Ga0496110_0013610_1826_2878 | 315 |
| 801 | 3300048914 | Ga0496111_0020931 | Ga0496111_0020931_1288_2340 | 315 |
| 802 | 3300048914 | Ga0496111_0352688 | Ga0496111_0352688_57_1004 | 315 |
| 803 | 3300048915 | Ga0496112_0001055 | Ga0496112_0001055_12500_13531 | 315 |
| 804 | 3300048915 | Ga0496112_0031686 | Ga0496112_0031686_1406_2458 | 315 |
| 805 | 3300048915 | Ga0496112_0090177 | Ga0496112_0090177_1500_2447 | 315 |
| 806 | 3300048916 | Ga0496113_0000323 | Ga0496113_0000323_9845_10876 | 315 |
| 807 | 3300048916 | Ga0496113_0022159 | Ga0496113_0022159_2216_3268 | 315 |
| 808 | 3300048917 | Ga0496114_0079340 | Ga0496114_0079340_1058_2110 | 315 |
| 809 | 3300048918 | Ga0496115_0016209 | Ga0496115_0016209_3376_4428 | 315 |
| 810 | 3300048918 | Ga0496115_0159256 | Ga0496115_0159256_503_1654 | 315 |
| 811 | 3300049569 | Ga0501032_0078449 | Ga0501032_0078449_374_1324 | 315 |
| 812 | 3300049570 | Ga0501033_0012886 | Ga0501033_0012886_4852_5802 | 315 |
| 813 | 3300049571 | Ga0501034_0018046 | Ga0501034_0018046_1919_2869 | 315 |
| 814 | 3300049571 | Ga0501034_0175476 | Ga0501034_0175476_490_1440 | 315 |
| 815 | 3300049572 | Ga0501036_0004687 | Ga0501036_0004687_9864_10814 | 315 |
| 816 | 3300049573 | Ga0501037_0005982 | Ga0501037_0005982_656_1606 | 315 |
| 817 | 3300049575 | Ga0501039_0001438 | Ga0501039_0001438_2907_3857 | 315 |
| 818 | 3300049578 | Ga0501042_0272635 | Ga0501042_0272635_227_1177 | 315 |
| 819 | 3300049580 | Ga0501046_0010334 | Ga0501046_0010334_2259_3209 | 315 |
| 820 | 3300049582 | Ga0501048_0004490 | Ga0501048_0004490_6099_7049 | 315 |
| 821 | 3300049584 | Ga0501068_0011406 | Ga0501068_0011406_1909_2859 | 315 |
| 822 | 3300049585 | Ga0501069_0006487 | Ga0501069_0006487_352_1302 | 315 |
| 823 | 3300049587 | Ga0501071_0023104 | Ga0501071_0023104_1848_2798 | 315 |
| 824 | 3300049592 | Ga0501076_0420531 | Ga0501076_0420531_16_966 | 315 |
| 825 | 3300049822 | Ga0501035_0014526 | Ga0501035_0014526_6132_7082 | 315 |
| 826 | 3300049823 | Ga0501044_0000193 | Ga0501044_0000193_25094_26044 | 315 |
| 827 | 3300049823 | Ga0501044_0026928 | Ga0501044_0026928_662_1612 | 315 |
| 828 | 3300049823 | Ga0501044_0251692 | Ga0501044_0251692_156_1106 | 315 |
| 829 | 3300049824 | Ga0501045_0024198 | Ga0501045_0024198_3387_4337 | 315 |
| 830 | 3300050490 | nmdc:mga03n38_79608_c1 | nmdc:mga03n38_79608_c1_551_1498 | 315 |
| 831 | 3300050492 | nmdc:mga0yw44_76447_c1 | nmdc:mga0yw44_76447_c1_208_1155 | 315 |
| 832 | 3300050493 | nmdc:mga0k408_28442_c1 | nmdc:mga0k408_28442_c1_153_1154 | 315 |
| 833 | 3300050495 | nmdc:mga04h51_100902_c1 | nmdc:mga04h51_100902_c1_21_1040 | 315 |
| 834 | 3300050496 | nmdc:mga07m45_14539_c2 | nmdc:mga07m45_14539_c2_132_1133 | 315 |
| 835 | 3300050496 | nmdc:mga07m45_7395_c1 | nmdc:mga07m45_7395_c1_3389_4390 | 315 |
| 836 | 3300050507 | nmdc:mga05p37_533843_c1 | nmdc:mga05p37_533843_c1_377_1324 | 315 |
| 837 | 3300050507 | nmdc:mga05p37_75490_c1 | nmdc:mga05p37_75490_c1_1027_2058 | 315 |
| 838 | 3300050512 | nmdc:mga0n895_33930_c1 | nmdc:mga0n895_33930_c1_1934_2965 | 315 |
| 839 | 3300053077 | Ga0495601_0029040 | Ga0495601_0029040_350_1402 | 315 |
| 840 | 3300053077 | Ga0495601_0074252 | Ga0495601_0074252_513_1460 | 315 |
| 841 | 3300053088 | Ga0500644_0116885 | Ga0500644_0116885_46_993 | 315 |
| 842 | 3300053096 | Ga0500641_0127855 | Ga0500641_0127855_131_1078 | 315 |
| 843 | 3300053119 | Ga0500595_008487 | Ga0500595_008487_744_1691 | 315 |
| 844 | 3300053153 | Ga0500616_0098680 | Ga0500616_0098680_383_1330 | 315 |
| 845 | 3300054114 | Ga0501084_0212319 | Ga0501084_0212319_372_1319 | 315 |
| 846 | 3300060353 | Ga0501082_0006937 | Ga0501082_0006937_2445_3395 | 315 |
| 847 | 3300060353 | Ga0501082_0100515 | Ga0501082_0100515_465_1412 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4icm-assembly3.cif.gz_C | crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis | 0.9009 | 2 | 311 |
| 2f6k-assembly1.cif.gz_A | crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 | 0.8963 | 5 | 312 |
| 2f6k-assembly1.cif.gz_A | crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 | 0.8906 | 5 | 312 |
| 4icm-assembly3.cif.gz_C | crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis | 0.8848 | 2 | 311 |
| 2dvt-assembly1.cif.gz_C | crystal structure of 2,6-dihydroxybenzoate decarboxylase from rhizobium | 0.8775 | 1 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f6kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8961 | 5 | 312 | 3.20.20.140 |
| 2f6kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8904 | 5 | 312 | 3.20.20.140 |
| 4infC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8661 | 5 | 311 | 3.20.20.140 |
| 4ofcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8543 | 5 | 311 | 3.20.20.140 |
| 4lalD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8535 | 5 | 311 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A127EPW6-F1-model_v4 | Metal-dependent hydrolase | 0.9993 | 1 | 315 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A3P4B6C2-F1-model_v4 | Amidohydrolase | 0.9872 | 1 | 313 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A844Z3T8-F1-model_v4 | Amidohydrolase family protein | 0.9822 | 5 | 313 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A552UF10-F1-model_v4 | Amidohydrolase | 0.981 | 5 | 311 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A3P4B6C2-F1-model_v4 | Amidohydrolase | 0.9748 | 1 | 313 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar