F483323

General Info

Members Datasets Scaffolds Average Seq Length
847 562 651 304

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100096498|Ga0075363_1000964982
Length 314
Sequence MRFLVVGAGALGGYFGGRLLQAGQDVHFLLRPRRAAQLAANGLVIKSPAGNAHIPAPPHVLSDDIDAPFDVVIVGCKAYDLAQTIDSFAAAVGPDTAVIPLLNGMQHLDALAERFGRERVLGGLCLISAVLDDAGTVLHLNDMHALNFGELDGGRSVRVDEIAAAFASANFSSAASDSILQAMWEKWMFIATLAGITTLMRSCVGDIVSAGGKDLALALLDECAAIATHNGFAPSAAALERGRAMVSAPASPLTASMFKDIERGAPTEADHILGDLLSRGAQALQPDRSVLRIAYAHLKTYEARRTREEAARAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355199
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
30 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
31 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
32 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
36 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
39 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
40 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
41 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
42 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
43 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
44 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
45 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
46 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
47 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
48 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
49 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
50 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
51 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
52 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
53 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
54 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
55 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
56 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
57 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
58 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
59 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
60 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
61 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
62 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
63 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
64 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
67 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
68 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
69 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
70 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
71 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
72 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
73 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
74 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
75 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
76 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
77 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
78 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
79 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
80 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
81 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
82 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
83 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
84 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
85 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
86 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
87 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
88 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
89 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
90 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
91 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
92 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
93 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
94 2922368715
95 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
96 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
97 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
98 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
99 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
100 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
101 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
104 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
110 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
111 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
112 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
113 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
114 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
115 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
123 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
124 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
125 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
126 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
127 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
130 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
131 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
132 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
133 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
134 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
135 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
136 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
137 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
138 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
139 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
140 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
141 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
142 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
143 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
144 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
145 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
146 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
147 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
148 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
149 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
150 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
151 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
152 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
153 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
154 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
155 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
156 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
157 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
158 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
159 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
160 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
161 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
162 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
163 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
164 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
165 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
166 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
169 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
170 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
173 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
178 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
179 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
180 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
183 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
184 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
185 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
186 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
187 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
188 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
189 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
190 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
191 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
192 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
193 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
194 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
195 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
196 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
197 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
198 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
199 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
200 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
201 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
202 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
203 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
204 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
205 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
206 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
207 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
208 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
209 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
210 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
211 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
212 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
213 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
214 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
215 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
216 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
217 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
218 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
219 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
220 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
221 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
222 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
223 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
224 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
225 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
226 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
227 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
228 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
229 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
230 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
231 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
232 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
233 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
234 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
235 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
236 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
237 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
238 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
239 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
240 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
241 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
242 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
243 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
244 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
245 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
246 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
247 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
248 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
249 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
250 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
252 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
255 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
258 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
260 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
306 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
307 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
308 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
309 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
311 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
312 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
316 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
317 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
318 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
319 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
320 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
321 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
322 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
323 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
324 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
325 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
326 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
327 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
328 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
329 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
330 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
331 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
332 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
333 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
334 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
335 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
336 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
337 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
338 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
341 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
342 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
343 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
344 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
345 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
346 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
347 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
348 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
349 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
350 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
351 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
352 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
353 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
354 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
355 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
356 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
357 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
358 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
359 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
360 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
361 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
362 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
363 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
364 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
365 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
366 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
367 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
368 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
369 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
370 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
371 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
372 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
373 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
374 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
375 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
376 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
377 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
378 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
379 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
380 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
381 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
382 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
383 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
384 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
385 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
386 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
387 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
388 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
393 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
394 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
395 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
396 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
397 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
398 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
399 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
400 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
405 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
406 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
407 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
408 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
409 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
410 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
411 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
412 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
413 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
414 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
415 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
416 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
417 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
418 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
419 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
420 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
421 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
422 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
423 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
424 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
425 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
426 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
427 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
428 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
429 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
432 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
433 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
434 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
435 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
436 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
437 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
438 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
439 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
440 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
441 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
442 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
443 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
444 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
445 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
446 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
447 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
448 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
449 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
450 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
451 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
452 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
453 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
454 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
455 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
456 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
457 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
458 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
459 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
460 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
465 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
466 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
467 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
468 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
469 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
470 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
471 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
472 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
473 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
474 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
475 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
476 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
477 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
478 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
481 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
482 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
483 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
486 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
487 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
488 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
489 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
490 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
491 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
492 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
493 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
494 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
495 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
496 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
497 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
498 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
499 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
500 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
501 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
502 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
503 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
504 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
505 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
506 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
507 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
508 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
509 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
510 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
511 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
512 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
513 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
514 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
515 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
516 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
517 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
518 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
519 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
520 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
521 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
522 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
523 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
524 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
525 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
526 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
527 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
528 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
529 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
530 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
531 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
532 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
533 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
534 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
535 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
536 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
537 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
538 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
539 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
540 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
541 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
542 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
543 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
544 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
545 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
546 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
547 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
548 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
549 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
550 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
551 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
552 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
553 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
554 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
555 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
556 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
557 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
558 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
559 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
560 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
561 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
562 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.04
Metatranscriptomes 0
Isolates 22.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.24
Nodule 17.83
Rhizoplane 4.96
Rhizosphere 46.28
Stem 0
Stem Tuber 0
Unclassified 13.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10020552 3300001989 Bacteria 2358
2 JGI24744J21845_10019353 3300002077 Bacteria 1346
3 JGI25406J46586_10003200 3300003203 Bacteria 7701
4 JGI25153J46596_10001605 3300003215 Bacteria 13405
5 JGI25153J46596_10001681 3300003215 Bacteria 13120
6 JGI25153J46596_10002174 3300003215 Bacteria 11449
7 JGI25153J46596_10006321 3300003215 Bacteria 6030
8 JGI25153J46596_10010258 3300003215 Bacteria 4255
9 JGI25160J50197_1001638 3300003354 Bacteria 10988
10 JGI25160J50197_1010618 3300003354 Bacteria 3316
11 JGI25404J52841_10000137 3300003659 Bacteria 7837
12 JGI25404J52841_10002771 3300003659 Bacteria 3373
13 JGI25404J52841_10004641 3300003659 Bacteria 2801
14 JGI25404J52841_10010896 3300003659 Bacteria 1956
15 JGI25404J52841_10025480 3300003659 Bacteria 1274
16 Ga0055542_1003545 3300003762 Bacteria 4166
17 Ga0055526_1021877 3300003771 Bacteria 2202
18 Ga0055524_1042262 3300003775 Bacteria 1136
19 Ga0055531_10003204 3300003794 Bacteria 10510
20 Ga0065165_1002933 3300005262 Bacteria 13012
21 Ga0065165_1003030 3300005262 Bacteria 12651
22 Ga0065165_1014086 3300005262 Bacteria 3123
23 Ga0065165_1056889 3300005262 Bacteria 1085
24 Ga0068869_100155314 3300005334 Bacteria 1777
25 Ga0068869_100178089 3300005334 Bacteria 1665
26 Ga0070666_10115195 3300005335 Bacteria 1861
27 Ga0070680_100080883 3300005336 Bacteria 2680
28 Ga0070661_100119936 3300005344 Bacteria 1969
29 Ga0070668_100078426 3300005347 Bacteria 2583
30 Ga0070668_100125879 3300005347 Bacteria 2052
31 Ga0070668_100431590 3300005347 Bacteria 1130
32 Ga0070669_100171540 3300005353 Bacteria 1691
33 Ga0070673_100312248 3300005364 Bacteria 1387
34 Ga0070659_100353692 3300005366 Bacteria 1233
35 Ga0070713_100087059 3300005436 Bacteria 2679
36 Ga0070713_100234239 3300005436 Bacteria 1670
37 Ga0070713_100308924 3300005436 Bacteria 1458
38 Ga0070710_10003972 3300005437 Bacteria 7008
39 Ga0070700_100133773 3300005441 Bacteria 1676
40 Ga0070663_100004604 3300005455 Bacteria 8122
41 Ga0070663_100049717 3300005455 Bacteria 2979
42 Ga0070663_100069514 3300005455 Bacteria 2558
43 Ga0070663_100099022 3300005455 Bacteria 2173
44 Ga0070663_100290115 3300005455 Bacteria 1306
45 Ga0070678_100033410 3300005456 Bacteria 3571
46 Ga0070678_100340380 3300005456 Bacteria 1287
47 Ga0070662_100205776 3300005457 Bacteria 1564
48 Ga0070681_10046762 3300005458 Bacteria 4325
49 Ga0068867_100139178 3300005459 Bacteria 1895
50 Ga0070698_100088915 3300005471 Bacteria 3073
51 Ga0070679_100024632 3300005530 Bacteria 5898
52 Ga0068853_100230936 3300005539 Bacteria 1693
53 Ga0070665_100014247 3300005548 Bacteria 7985
54 Ga0070665_100116569 3300005548 Bacteria 2674
55 Ga0070665_100244563 3300005548 Bacteria 1794
56 Ga0068855_100009982 3300005563 Bacteria 11442
57 Ga0068855_100193197 3300005563 Bacteria 2295
58 Ga0068857_100042407 3300005577 Bacteria 4037
59 Ga0068857_100452125 3300005577 Bacteria 1201
60 Ga0068854_100366219 3300005578 Bacteria 1184
61 Ga0068856_100000801 3300005614 Bacteria 33923
62 Ga0068856_100127671 3300005614 Bacteria 2546
63 Ga0068856_100251455 3300005614 Bacteria 1782
64 Ga0068852_100160576 3300005616 Bacteria 2098
65 Ga0068852_100394281 3300005616 Bacteria 1360
66 Ga0068852_100591691 3300005616 Bacteria 1113
67 Ga0068859_100162200 3300005617 Bacteria 2314
68 Ga0068861_100073532 3300005719 Bacteria 2655
69 Ga0068861_100143690 3300005719 Bacteria 1950
70 Ga0068858_100345314 3300005842 Bacteria 1425
71 Ga0068860_100532423 3300005843 Bacteria 1175
72 Ga0081455_10005195 3300005937 Bacteria 14318
73 Ga0081455_10006414 3300005937 Bacteria 12614
74 Ga0081455_10012939 3300005937 Bacteria 8277
75 Ga0081455_10029403 3300005937 Bacteria 5010
76 Ga0081455_10118688 3300005937 Bacteria 2088
77 Ga0081538_10022359 3300005981 Bacteria 4582
78 Ga0081540_1003002 3300005983 Bacteria 13529
79 Ga0081540_1004227 3300005983 Bacteria 11032
80 Ga0081540_1007182 3300005983 Bacteria 7990
81 Ga0081540_1007515 3300005983 Bacteria 7760
82 Ga0081540_1008741 3300005983 Bacteria 7044
83 Ga0081540_1009467 3300005983 Bacteria 6713
84 Ga0081540_1009938 3300005983 Bacteria 6488
85 Ga0081540_1018965 3300005983 Bacteria 4201
86 Ga0081540_1024300 3300005983 Bacteria 3519
87 Ga0081540_1044637 3300005983 Bacteria 2260
88 Ga0081540_1044908 3300005983 Bacteria 2250
89 Ga0081540_1047626 3300005983 Bacteria 2154
90 Ga0081540_1070660 3300005983 Bacteria 1616
91 Ga0081539_10004421 3300005985 Bacteria 15548
92 Ga0081539_10158188 3300005985 Bacteria 1083
93 Ga0070717_10005195 3300006028 Bacteria 9483
94 Ga0070717_10290923 3300006028 Bacteria 1450
95 Ga0075365_10037225 3300006038 Bacteria 3157
96 Ga0075365_10098053 3300006038 Bacteria 2004
97 Ga0075365_10105905 3300006038 Bacteria 1929
98 Ga0075368_10022719 3300006042 Bacteria 2389
99 Ga0075363_100011119 3300006048 Bacteria 4301
100 Ga0075363_100096498 3300006048 Bacteria 1632
101 Ga0075363_100120279 3300006048 Bacteria 1466
102 Ga0075362_10041328 3300006177 Bacteria 2034
103 Ga0075367_10032532 3300006178 Bacteria 3002
104 Ga0075367_10044340 3300006178 Bacteria 2606
105 Ga0075367_10048736 3300006178 Bacteria 2496
106 Ga0075367_10081854 3300006178 Bacteria 1954
107 Ga0075369_10005456 3300006186 Bacteria 4753
108 Ga0075366_10060463 3300006195 Bacteria 2250
109 Ga0097621_100221013 3300006237 Bacteria 1651
110 Ga0075370_10024575 3300006353 Bacteria 3329
111 Ga0075370_10087190 3300006353 Bacteria 1798
112 Ga0075370_10110187 3300006353 Bacteria 1598
113 Ga0075370_10137370 3300006353 Bacteria 1428
114 Ga0075428_100291394 3300006844 Bacteria 1755
115 Ga0075434_100362764 3300006871 Bacteria 1470
116 Ga0068865_100104257 3300006881 Bacteria 2081
117 Ga0068865_100350564 3300006881 Bacteria 1196
118 Ga0097620_100162190 3300006931 Bacteria 2314
119 Ga0099824_1009679 3300006942 Bacteria 11728
120 Ga0075435_100210958 3300007076 Bacteria 1648
121 Ga0105240_10034476 3300009093 Bacteria 6528
122 Ga0105240_10066315 3300009093 Bacteria 4479
123 Ga0111539_10207522 3300009094 Bacteria 2283
124 Ga0105245_10380949 3300009098 Bacteria 1405
125 Ga0105247_10142808 3300009101 Bacteria 1570
126 Ga0105247_10181149 3300009101 Bacteria 1406
127 Ga0105247_10339260 3300009101 Bacteria 1054
128 Ga0105243_10014700 3300009148 Bacteria 5921
129 Ga0105243_10084249 3300009148 Bacteria 2603
130 Ga0105241_10122930 3300009174 Bacteria 2092
131 Ga0105241_10509678 3300009174 Bacteria 1074
132 Ga0105242_10305681 3300009176 Bacteria 1453
133 Ga0105248_10271785 3300009177 Bacteria 1908
134 Ga0105248_10632559 3300009177 Bacteria 1207
135 Ga0105237_10008437 3300009545 Bacteria 11149
136 Ga0105237_10064882 3300009545 Bacteria 3647
137 Ga0105237_10079037 3300009545 Bacteria 3279
138 Ga0105237_10325014 3300009545 Bacteria 1542
139 Ga0105238_10034241 3300009551 Bacteria 5168
140 Ga0105238_10516519 3300009551 Bacteria 1197
141 Ga0105238_10609853 3300009551 Bacteria 1100
142 Ga0105249_10063882 3300009553 Bacteria 3383
143 Ga0105249_10527553 3300009553 Bacteria 1229
144 Ga0105239_10070706 3300010375 Bacteria 3834
145 Ga0105239_10176220 3300010375 Bacteria 2391
146 Ga0105239_10546429 3300010375 Bacteria 1319
147 Ga0157370_10014703 3300013104 Bacteria 7993
148 Ga0157369_10366127 3300013105 Bacteria 1496
149 Ga0163162_10110726 3300013306 Bacteria 2843
150 Ga0163162_10137697 3300013306 Bacteria 2553
151 Ga0157372_10292913 3300013307 Bacteria 1893
152 Ga0157375_10333243 3300013308 Bacteria 1682
153 Ga0163163_10153397 3300014325 Bacteria 2347
154 Ga0163163_10194056 3300014325 Bacteria 2078
155 Ga0157380_10083701 3300014326 Bacteria 2614
156 Ga0157380_10209379 3300014326 Bacteria 1736
157 Ga0157380_10537117 3300014326 Bacteria 1144
158 Ga0157377_10093706 3300014745 Bacteria 1778
159 Ga0157376_10153581 3300014969 Bacteria 2079
160 Ga0214544_1000016 3300021320 Bacteria 204278
161 Ga0214542_1000016 3300021321 Bacteria 210332
162 Ga0214545_1000008 3300021324 Bacteria 215190
163 Ga0214543_1000043 3300021327 Bacteria 160517
164 Ga0213873_10035309 3300021358 Bacteria 1264
165 Ga0213871_10004007 3300021441 Bacteria 2903
166 Ga0209563_103011 3300025230 Bacteria 3613
167 Ga0209437_101863 3300025233 Bacteria 4441
168 Ga0209677_100602 3300025253 Bacteria 19450
169 Ga0209677_101634 3300025253 Bacteria 9449
170 Ga0209148_1000282 3300025254 Bacteria 78016
171 Ga0209148_1006149 3300025254 Bacteria 2635
172 Ga0209233_1000910 3300025261 Bacteria 12914
173 Ga0209233_1005145 3300025261 Bacteria 4371
174 Ga0209233_1007414 3300025261 Bacteria 3478
175 Ga0209455_1003612 3300025272 Bacteria 5386
176 Ga0209455_1005231 3300025272 Bacteria 4058
177 Ga0209455_1005706 3300025272 Bacteria 3796
178 Ga0209564_1009106 3300025295 Bacteria 4779
179 Ga0209758_1000069 3300025297 Bacteria 286161
180 Ga0209758_1000253 3300025297 Bacteria 107937
181 Ga0209758_1003514 3300025297 Bacteria 14143
182 Ga0209758_1004217 3300025297 Bacteria 12175
183 Ga0209758_1010924 3300025297 Bacteria 5347
184 Ga0209758_1023573 3300025297 Bacteria 2778
185 Ga0209256_1008971 3300025299 Bacteria 4492
186 Ga0209256_1030493 3300025299 Bacteria 1488
187 Ga0207426_1000420 3300025302 Bacteria 69895
188 Ga0207426_1001303 3300025302 Bacteria 21427
189 Ga0207426_1007899 3300025302 Bacteria 4384
190 Ga0207426_1019149 3300025302 Bacteria 2398
191 Ga0207426_1026336 3300025302 Bacteria 1949
192 Ga0209257_1000564 3300025304 Bacteria 62815
193 Ga0207682_10039189 3300025893 Bacteria 1925
194 Ga0207692_10084858 3300025898 Bacteria 1703
195 Ga0207692_10110683 3300025898 Bacteria 1523
196 Ga0207688_10062625 3300025901 Bacteria 2097
197 Ga0207647_10014127 3300025904 Bacteria 5514
198 Ga0207699_10043815 3300025906 Bacteria 2602
199 Ga0207645_10238159 3300025907 Bacteria 1202
200 Ga0207643_10103778 3300025908 Bacteria 1669
201 Ga0207705_10082949 3300025909 Bacteria 2338
202 Ga0207654_10009133 3300025911 Bacteria 5027
203 Ga0207654_10144214 3300025911 Bacteria 1522
204 Ga0207707_10164164 3300025912 Bacteria 1941
205 Ga0207695_10001820 3300025913 Bacteria 33567
206 Ga0207695_10117416 3300025913 Bacteria 2633
207 Ga0207671_10005387 3300025914 Bacteria 11813
208 Ga0207671_10103090 3300025914 Bacteria 2163
209 Ga0207693_10068294 3300025915 Bacteria 2782
210 Ga0207663_10007768 3300025916 Bacteria 5586
211 Ga0207663_10056809 3300025916 Bacteria 2464
212 Ga0207662_10074388 3300025918 Bacteria 2062
213 Ga0207657_10120181 3300025919 Bacteria 2162
214 Ga0207649_10034561 3300025920 Bacteria 3030
215 Ga0207652_10438236 3300025921 Bacteria 1178
216 Ga0207694_10110990 3300025924 Bacteria 2181
217 Ga0207694_10544949 3300025924 Bacteria 973
218 Ga0207659_10388707 3300025926 Bacteria 1165
219 Ga0207687_10075277 3300025927 Bacteria 2422
220 Ga0207700_10032152 3300025928 Bacteria 3739
221 Ga0207700_10068716 3300025928 Bacteria 2716
222 Ga0207700_10425273 3300025928 Bacteria 1167
223 Ga0207706_10074600 3300025933 Bacteria 2983
224 Ga0207686_10081704 3300025934 Bacteria 2110
225 Ga0207709_10078663 3300025935 Bacteria 2118
226 Ga0207709_10082247 3300025935 Bacteria 2079
227 Ga0207711_10179905 3300025941 Bacteria 1922
228 Ga0207711_10569440 3300025941 Bacteria 1057
229 Ga0207689_10027750 3300025942 Bacteria 4738
230 Ga0207667_10219690 3300025949 Bacteria 1947
231 Ga0207667_10228549 3300025949 Bacteria 1905
232 Ga0207651_10084556 3300025960 Bacteria 2299
233 Ga0207712_10175592 3300025961 Bacteria 1678
234 Ga0207668_10054083 3300025972 Bacteria 2785
235 Ga0207668_10290669 3300025972 Bacteria 1344
236 Ga0207658_10469390 3300025986 Bacteria 1117
237 Ga0207677_10072717 3300026023 Bacteria 2432
238 Ga0207677_10101090 3300026023 Bacteria 2122
239 Ga0207639_10113378 3300026041 Bacteria 2214
240 Ga0207639_10135388 3300026041 Bacteria 2045
241 Ga0207639_10578448 3300026041 Bacteria 1034
242 Ga0207678_10022715 3300026067 Bacteria 5493
243 Ga0207678_10028222 3300026067 Bacteria 4901
244 Ga0207678_10036470 3300026067 Bacteria 4280
245 Ga0207678_10045029 3300026067 Bacteria 3815
246 Ga0207678_10202413 3300026067 Bacteria 1698
247 Ga0207678_10202846 3300026067 Bacteria 1696
248 Ga0207708_10075025 3300026075 Bacteria 2593
249 Ga0207708_10425510 3300026075 Bacteria 1102
250 Ga0207702_10000559 3300026078 Bacteria 41394
251 Ga0207702_10018890 3300026078 Bacteria 5702
252 Ga0207702_10224835 3300026078 Bacteria 1751
253 Ga0207641_10308598 3300026088 Bacteria 1497
254 Ga0207648_10022011 3300026089 Bacteria 5726
255 Ga0207676_10142306 3300026095 Bacteria 2055
256 Ga0207676_10483566 3300026095 Bacteria 1173
257 Ga0207674_10181806 3300026116 Bacteria 2054
258 Ga0207675_100098448 3300026118 Bacteria 2754
259 Ga0207675_100133354 3300026118 Bacteria 2355
260 Ga0207675_100285528 3300026118 Bacteria 1604
261 Ga0207683_10132358 3300026121 Bacteria 2243
262 Ga0207698_10415278 3300026142 Bacteria 1290
263 Ga0207698_10473579 3300026142 Bacteria 1213
264 Ga0207698_10550349 3300026142 Bacteria 1131
265 Ga0209389_1000033 3300027296 Bacteria 131516
266 Ga0209389_1000071 3300027296 Bacteria 97411
267 Ga0209589_1000040 3300027357 Bacteria 126550
268 Ga0209489_100045 3300027361 Bacteria 158225
269 Ga0209489_100209 3300027361 Bacteria 96349
270 Ga0209700_100011 3300027363 Bacteria 362159
271 Ga0209179_1019216 3300027512 Bacteria 1313
272 Ga0209813_10011560 3300027866 Bacteria 2311
273 Ga0207428_10185789 3300027907 Bacteria 1568
274 Ga0268266_10001477 3300028379 Bacteria 27905
275 Ga0268266_10078556 3300028379 Bacteria 2872
276 Ga0268266_10124570 3300028379 Bacteria 2298
277 Ga0268266_10149695 3300028379 Bacteria 2102
278 Ga0268266_10197554 3300028379 Bacteria 1839
279 Ga0268266_10259601 3300028379 Unclassified 1610
280 Ga0268266_10471011 3300028379 Bacteria 1196
281 Ga0268266_10641333 3300028379 Bacteria 1022
282 Ga0268265_10093120 3300028380 Bacteria 2413
283 Ga0268264_10000062 3300028381 Bacteria 302110
284 Ga0265319_1071087 3300028563 Bacteria 1115
285 Ga0265323_10001474 3300028653 Bacteria 11520
286 Ga0265336_10001883 3300028666 Bacteria 9072
287 Ga0307517_10000942 3300028786 Bacteria 49547
288 Ga0307515_10214312 3300028794 Bacteria 1761
289 Ga0265338_10000835 3300028800 Bacteria 51961
290 Ga0265324_10010545 3300029957 Bacteria 3554
291 Ga0307511_10191602 3300030521 Bacteria 1079
292 Ga0307513_10314456 3300031456 Bacteria 1327
293 Ga0307509_10006490 3300031507 Bacteria 15715
294 Ga0307509_10168844 3300031507 Bacteria 2071
295 Ga0307509_10375798 3300031507 Bacteria 1136
296 Ga0307408_100286915 3300031548 Bacteria 1373
297 Ga0307508_10012397 3300031616 Bacteria 7796
298 Ga0307508_10251642 3300031616 Bacteria 1362
299 Ga0307516_10000908 3300031730 Bacteria 40669
300 Ga0307516_10007372 3300031730 Bacteria 12657
301 Ga0307516_10219498 3300031730 Bacteria 1611
302 Ga0307405_10180349 3300031731 Bacteria 1516
303 Ga0307406_10149105 3300031901 Bacteria 1666
304 Ga0307406_10336454 3300031901 Bacteria 1174
305 Ga0307407_10138964 3300031903 Bacteria 1565
306 Ga0307412_10021115 3300031911 Bacteria 3973
307 Ga0307415_100060590 3300032126 Bacteria 2616
308 Ga0307415_100191502 3300032126 Bacteria 1614
309 Ga0307507_10034714 3300033179 Bacteria 5201
310 Ga0307510_10001783 3300033180 Bacteria 24028
311 Ga0307510_10104982 3300033180 Bacteria 2596
312 Ga0373929_0004256 3300035085 Bacteria 2567
313 Ga0373940_0055576 3300035088 Bacteria 1121
314 Ga0373954_0005067 3300035118 Bacteria 5684
315 Ga0373957_0045440 3300035120 Bacteria 1664
316 Ga0373924_0017818 3300035410 Bacteria 2730
317 Ga0373931_0001442 3300035691 Bacteria 10201
318 Ga0373935_0026124 3300035692 Bacteria 3601
319 Ga0373927_0031111 3300035695 Bacteria 3481
320 Ga0373927_0121537 3300035695 Bacteria 1704
321 Ga0373927_0180911 3300035695 Bacteria 1383
322 Ga0373933_0029672 3300035724 Bacteria 3164
323 Ga0373937_0401275 3300036401 Bacteria 1301
324 Ga0373925_0188953 3300037068 Bacteria 1634
325 Ga0395900_0002352 3300037418 Bacteria 20935
326 Ga0395898_0010389 3300037466 Bacteria 9734
327 Ga0395898_0075904 3300037466 Bacteria 3246
328 Ga0395898_0404477 3300037466 Bacteria 1302
329 Ga0395905_0005266 3300037471 Bacteria 13232
330 Ga0395901_0140218 3300038443 Bacteria 2541
331 Ga0395901_0356492 3300038443 Bacteria 1509
332 Ga0395901_0572400 3300038443 Bacteria 1142
333 Ga0436365_0239060 3300039437 Bacteria 1382
334 Ga0436365_1614403 3300039437 Bacteria 1707
335 Ga0436360_0583126 3300039438 Bacteria 1174
336 Ga0436361_0678323 3300039447 Bacteria 1414
337 Ga0436362_1007196 3300039453 Bacteria 1182
338 Ga0436362_1141340 3300039453 Bacteria 2499
339 Ga0439465_0041151 3300041413 Bacteria 1495
340 Ga0451843_0070413 3300041509 Bacteria 1142
341 Ga0451853_3958553 3300041512 Bacteria 1107
342 Ga0466969_0029204 3300044656 Bacteria 2817
343 Ga0466969_0053505 3300044656 Bacteria 1980
344 Ga0466972_0000107 3300044658 Bacteria 71873
345 Ga0466972_0010521 3300044658 Bacteria 4643
346 Ga0466966_0000359 3300044684 Bacteria 29538
347 Ga0466961_0000074 3300044693 Bacteria 61968
348 Ga0466961_0213502 3300044693 Bacteria 1190
349 Ga0466963_0008648 3300044694 Bacteria 6111
350 Ga0466968_0063652 3300044735 Bacteria 1594
351 Ga0466970_0149363 3300044765 Bacteria 1290
352 Ga0466957_0028553 3300044842 Bacteria 3323
353 Ga0466960_0018945 3300044901 Bacteria 3024
354 Ga0466959_0012948 3300045049 Bacteria 6038
355 Ga0466959_0102710 3300045049 Bacteria 2046
356 Ga0466967_0066439 3300045976 Bacteria 3213
357 Ga0495592_0045385 3300046454 Bacteria 3279
358 Ga0495603_0021429 3300046455 Bacteria 3914
359 Ga0495629_0003567 3300046459 Bacteria 11757
360 Ga0495629_0048190 3300046459 Bacteria 2987
361 Ga0495638_0021875 3300046460 Bacteria 4203
362 Ga0495638_0040321 3300046460 Bacteria 2959
363 Ga0495638_0086117 3300046460 Bacteria 1899
364 Ga0495638_0253912 3300046460 Bacteria 968
365 Ga0495641_0110786 3300046461 Bacteria 1225
366 Ga0495651_0001605 3300046462 Bacteria 17492
367 Ga0495651_0020406 3300046462 Bacteria 5144
368 Ga0495651_0141987 3300046462 Bacteria 1740
369 Ga0495653_0120956 3300046463 Bacteria 1866
370 Ga0495582_0039830 3300046473 Bacteria 2587
371 Ga0495662_0101352 3300046476 Bacteria 1408
372 Ga0495585_0025153 3300046492 Bacteria 3413
373 Ga0495585_0066329 3300046492 Bacteria 1976
374 Ga0495585_0144946 3300046492 Bacteria 1242
375 Ga0495594_0084582 3300046499 Bacteria 1774
376 Ga0495607_0067061 3300046501 Bacteria 2017
377 Ga0495583_0086397 3300046506 Bacteria 1357
378 Ga0495583_0101861 3300046506 Bacteria 1225
379 Ga0495606_0063702 3300046507 Bacteria 2349
380 Ga0495606_0102271 3300046507 Bacteria 1742
381 Ga0495608_0054900 3300046511 Bacteria 2633
382 Ga0495608_0102202 3300046511 Bacteria 1848
383 Ga0495610_0060436 3300046512 Bacteria 1804
384 Ga0495616_0095202 3300046513 Bacteria 1404
385 Ga0495616_0111996 3300046513 Bacteria 1267
386 Ga0495620_0011469 3300046515 Bacteria 4623
387 Ga0495620_0106497 3300046515 Bacteria 1114
388 Ga0495628_0006943 3300046516 Bacteria 9831
389 Ga0495630_0067911 3300046517 Bacteria 2680
390 Ga0495630_0294145 3300046517 Bacteria 1241
391 Ga0495631_0086851 3300046518 Bacteria 1347
392 Ga0495631_0108825 3300046518 Bacteria 1192
393 Ga0495643_0061112 3300046522 Bacteria 1998
394 Ga0495643_0189268 3300046522 Bacteria 995
395 Ga0495644_0039752 3300046523 Bacteria 1773
396 Ga0495644_0044691 3300046523 Bacteria 1666
397 Ga0495648_0019456 3300046524 Bacteria 4773
398 Ga0495648_0066548 3300046524 Bacteria 2112
399 Ga0495648_0167840 3300046524 Bacteria 1128
400 Ga0495648_0181311 3300046524 Bacteria 1070
401 Ga0495652_0079383 3300046529 Bacteria 2713
402 Ga0495652_0085255 3300046529 Bacteria 2596
403 Ga0495652_0103226 3300046529 Bacteria 2308
404 Ga0495652_0265395 3300046529 Bacteria 1265
405 Ga0495654_0102150 3300046530 Bacteria 1318
406 Ga0495640_0019945 3300046533 Bacteria 4944
407 Ga0495640_0052900 3300046533 Bacteria 2786
408 Ga0495640_0144401 3300046533 Bacteria 1532
409 Ga0495586_0082645 3300046535 Bacteria 1766
410 Ga0495587_0129005 3300046536 Bacteria 1446
411 Ga0495621_0029489 3300046539 Bacteria 1871
412 Ga0495622_0004671 3300046557 Bacteria 6351
413 Ga0495622_0030909 3300046557 Bacteria 2503
414 Ga0495622_0067816 3300046557 Bacteria 1648
415 Ga0495633_0146533 3300046558 Bacteria 1091
416 Ga0495667_0054959 3300046559 Bacteria 2618
417 Ga0495656_0006632 3300046615 Bacteria 4064
418 Ga0495668_0081496 3300046616 Bacteria 1775
419 Ga0495668_0195876 3300046616 Bacteria 1106
420 Ga0495634_0098445 3300046642 Bacteria 1892
421 Ga0495611_0021934 3300046648 Bacteria 2761
422 Ga0495611_0055256 3300046648 Bacteria 1796
423 Ga0495625_0096584 3300046660 Bacteria 2035
424 Ga0495635_0011766 3300046663 Bacteria 6135
425 Ga0495659_0022816 3300046664 Bacteria 2121
426 Ga0495661_0016545 3300046665 Bacteria 4885
427 Ga0495661_0134725 3300046665 Bacteria 1350
428 Ga0495588_0081173 3300046674 Bacteria 1693
429 Ga0495588_0087797 3300046674 Bacteria 1627
430 Ga0495588_0095033 3300046674 Bacteria 1563
431 Ga0495657_0001337 3300046675 Bacteria 21445
432 Ga0495657_0059266 3300046675 Bacteria 2539
433 Ga0495599_0006930 3300046678 Bacteria 6851
434 Ga0495623_0037009 3300046679 Bacteria 3125
435 Ga0495646_0018648 3300046680 Bacteria 4394
436 Ga0495646_0072191 3300046680 Bacteria 2030
437 Ga0495658_0031121 3300046683 Bacteria 2903
438 Ga0495669_0000707 3300046684 Bacteria 14557
439 Ga0495669_0073107 3300046684 Bacteria 1565
440 Ga0495613_0087584 3300046689 Bacteria 2257
441 Ga0495613_0129561 3300046689 Bacteria 1807
442 Ga0495624_0008528 3300046690 Bacteria 7139
443 Ga0495670_0008620 3300046691 Bacteria 5019
444 Ga0495671_0103922 3300046692 Bacteria 1387
445 Ga0495671_0107934 3300046692 Bacteria 1359
446 Ga0495649_0212826 3300046694 Bacteria 1001
447 Ga0495600_0003467 3300046809 Bacteria 9281
448 Ga0495600_0030191 3300046809 Bacteria 3510
449 Ga0495660_0049244 3300046810 Bacteria 2301
450 Ga0495660_0150829 3300046810 Bacteria 1148
451 Ga0495581_0193638 3300047315 Bacteria 1189
452 Ga0495604_0003032 3300047317 Bacteria 13430
453 Ga0495604_0053163 3300047317 Bacteria 3133
454 Ga0495604_0054736 3300047317 Bacteria 3077
455 Ga0495604_0132594 3300047317 Bacteria 1789
456 Ga0495636_0022368 3300047318 Bacteria 2555
457 Ga0495674_0024007 3300047319 Bacteria 5610
458 Ga0495674_0051131 3300047319 Bacteria 3643
459 Ga0495674_0164931 3300047319 Bacteria 1852
460 Ga0495672_0103375 3300047320 Bacteria 1541
461 Ga0495676_0017318 3300047321 Bacteria 6374
462 Ga0495676_0281877 3300047321 Bacteria 1125
463 Ga0495687_034550 3300047443 Bacteria 2283
464 Ga0495687_106791 3300047443 Bacteria 1038
465 Ga0495675_0003289 3300047444 Bacteria 9716
466 Ga0495675_0152660 3300047444 Bacteria 1426
467 Ga0495677_0055961 3300047445 Bacteria 1456
468 Ga0495686_0023895 3300047472 Bacteria 4021
469 Ga0495593_0015175 3300047673 Bacteria 4372
470 Ga0495593_0102716 3300047673 Bacteria 1465
471 Ga0495602_0003905 3300048088 Bacteria 15517
472 Ga0495602_0070368 3300048088 Bacteria 2994
473 Ga0495602_0120534 3300048088 Bacteria 2111
474 Ga0495614_0084977 3300048089 Bacteria 1373
475 Ga0495615_0013867 3300048090 Bacteria 1692
476 Ga0496100_0095372 3300048903 Bacteria 2039
477 Ga0496100_0108082 3300048903 Bacteria 1928
478 Ga0496100_0274670 3300048903 Bacteria 1254
479 Ga0496100_0366754 3300048903 Bacteria 1091
480 Ga0496101_0120113 3300048904 Bacteria 1986
481 Ga0496101_0293049 3300048904 Bacteria 1273
482 Ga0496102_0283251 3300048905 Bacteria 1562
483 Ga0496102_0457877 3300048905 Bacteria 1196
484 Ga0496103_0015992 3300048906 Bacteria 4475
485 Ga0496104_0002854 3300048907 Bacteria 14892
486 Ga0496104_0035592 3300048907 Bacteria 4649
487 Ga0496105_0005297 3300048908 Bacteria 9775
488 Ga0496105_0156783 3300048908 Bacteria 1869
489 Ga0496105_0259916 3300048908 Bacteria 1404
490 Ga0496106_0002286 3300048909 Bacteria 14292
491 Ga0496106_0010158 3300048909 Bacteria 6954
492 Ga0496107_0153321 3300048910 Bacteria 1705
493 Ga0496107_0259414 3300048910 Bacteria 1293
494 Ga0496108_0000902 3300048911 Bacteria 23152
495 Ga0496108_0101712 3300048911 Bacteria 2452
496 Ga0496109_0000224 3300048912 Bacteria 55854
497 Ga0496109_0159446 3300048912 Bacteria 2114
498 Ga0496109_0189817 3300048912 Bacteria 1931
499 Ga0496109_0276535 3300048912 Bacteria 1582
500 Ga0496109_0514869 3300048912 Bacteria 1129
501 Ga0496110_0037293 3300048913 Bacteria 4225
502 Ga0496110_0314907 3300048913 Bacteria 1425
503 Ga0496110_0424880 3300048913 Bacteria 1211
504 Ga0496111_0172265 3300048914 Bacteria 1608
505 Ga0496112_0021849 3300048915 Bacteria 6089
506 Ga0496112_0143460 3300048915 Bacteria 2357
507 Ga0496112_0153851 3300048915 Bacteria 2267
508 Ga0496112_0173928 3300048915 Bacteria 2118
509 Ga0496112_0440910 3300048915 Bacteria 1240
510 Ga0496113_0079640 3300048916 Bacteria 2508
511 Ga0496113_0158696 3300048916 Bacteria 1787
512 Ga0496114_0386975 3300048917 Bacteria 1238
513 Ga0496114_0550594 3300048917 Bacteria 1019
514 Ga0496115_0032240 3300048918 Bacteria 4133
515 Ga0496115_0076677 3300048918 Bacteria 2717
516 Ga0496115_0082090 3300048918 Bacteria 2626
517 Ga0496116_0003593 3300048919 Bacteria 15253
518 Ga0496116_0027414 3300048919 Bacteria 4148
519 Ga0496116_0104457 3300048919 Bacteria 1683
520 Ga0496116_0157545 3300048919 Bacteria 1251
521 Ga0496117_0051115 3300048920 Bacteria 2925
522 Ga0496117_0062558 3300048920 Bacteria 2550
523 Ga0496117_0114240 3300048920 Bacteria 1674
524 Ga0496117_0124305 3300048920 Bacteria 1578
525 Ga0496117_0126629 3300048920 Bacteria 1557
526 Ga0496118_0007916 3300048921 Bacteria 11123
527 Ga0496118_0031566 3300048921 Bacteria 4388
528 Ga0496118_0076118 3300048921 Bacteria 2388
529 Ga0496118_0085775 3300048921 Bacteria 2191
530 Ga0496118_0109826 3300048921 Bacteria 1834
531 Ga0496119_0110857 3300048922 Bacteria 1523
532 Ga0496119_0136530 3300048922 Bacteria 1329
533 Ga0496120_0005151 3300048923 Bacteria 10561
534 Ga0496120_0005624 3300048923 Bacteria 9931
535 Ga0496120_0051621 3300048923 Bacteria 2347
536 Ga0496121_0000203 3300048924 Bacteria 130984
537 Ga0496121_0006789 3300048924 Bacteria 14022
538 Ga0496121_0014289 3300048924 Bacteria 8441
539 Ga0496121_0040026 3300048924 Bacteria 4118
540 Ga0496121_0117002 3300048924 Bacteria 2020
541 Ga0496121_0176282 3300048924 Bacteria 1547
542 Ga0496121_0265229 3300048924 Bacteria 1183
543 Ga0496122_0073840 3300048925 Bacteria 2416
544 Ga0496123_0032787 3300048926 Bacteria 3751
545 Ga0496124_0001303 3300048927 Bacteria 37721
546 Ga0496124_0088308 3300048927 Bacteria 2534
547 Ga0496124_0137642 3300048927 Bacteria 1931
548 Ga0496124_0207066 3300048927 Bacteria 1487
549 Ga0496125_0006319 3300048928 Bacteria 12855
550 Ga0496125_0051858 3300048928 Bacteria 3379
551 Ga0496125_0053477 3300048928 Bacteria 3309
552 Ga0496125_0085487 3300048928 Bacteria 2390
553 Ga0496125_0224489 3300048928 Bacteria 1207
554 Ga0496126_0009504 3300048929 Bacteria 10318
555 Ga0496126_0014074 3300048929 Bacteria 8104
556 Ga0496126_0034653 3300048929 Bacteria 4739
557 Ga0496126_0093470 3300048929 Bacteria 2640
558 Ga0496126_0244973 3300048929 Bacteria 1496
559 Ga0496126_0367377 3300048929 Bacteria 1174
560 Ga0495682_0092499 3300049460 Bacteria 1086
561 nmdc:mga03683_74255_c1 3300050489 Bacteria 1458
562 nmdc:mga03n38_100_c1 3300050490 Bacteria 19063
563 nmdc:mga03n38_3836_c1 3300050490 Bacteria 4887
564 nmdc:mga00v17_234003_c1 3300050491 Bacteria 1191
565 nmdc:mga00v17_24325_c1 3300050491 Bacteria 3512
566 nmdc:mga00v17_51910_c1 3300050491 Bacteria 2493
567 nmdc:mga0yw44_105755_c1 3300050492 Bacteria 1798
568 nmdc:mga0yw44_115815_c1 3300050492 Bacteria 1722
569 nmdc:mga0yw44_3943_c1 3300050492 Bacteria 6692
570 nmdc:mga0yw44_64841_c1 3300050492 Bacteria 2249
571 nmdc:mga0k408_28970_c1 3300050493 Bacteria 3150
572 nmdc:mga06z11_213770_c1 3300050494 Bacteria 1125
573 nmdc:mga04h51_16234_c1 3300050495 Bacteria 2159
574 nmdc:mga07m45_36666_c1 3300050496 Bacteria 2732
575 nmdc:mga07m45_8217_c1 3300050496 Bacteria 5354
576 nmdc:mga08y16_163429_c1 3300050511 Bacteria 2313
577 nmdc:mga08x19_67744_c1 3300050514 Bacteria 2322
578 nmdc:mga0sz30_55570_c1 3300050516 Bacteria 1685
579 Ga0495601_0033069 3300053077 Bacteria 3221
580 Ga0495601_0228175 3300053077 Bacteria 1216
581 Ga0500610_0056732 3300053079 Bacteria 2044
582 Ga0500635_0008265 3300053080 Bacteria 2847
583 Ga0500635_0020430 3300053080 Bacteria 2029
584 Ga0495619_0174066 3300053085 Bacteria 1489
585 Ga0500578_0037049 3300053086 Bacteria 3132
586 Ga0500643_000063 3300053087 Bacteria 122135
587 Ga0500581_030352 3300053089 Bacteria 2762
588 Ga0500583_0073495 3300053092 Bacteria 1639
589 Ga0500651_0028247 3300053093 Bacteria 3527
590 Ga0500566_0000150 3300053094 Bacteria 35703
591 Ga0500566_0000252 3300053094 Bacteria 28789
592 Ga0500566_0000871 3300053094 Bacteria 17224
593 Ga0500566_0026715 3300053094 Bacteria 3379
594 Ga0500640_053774 3300053095 Bacteria 1757
595 Ga0500641_0030013 3300053096 Bacteria 2133
596 Ga0500648_070204 3300053097 Bacteria 1981
597 Ga0500650_0044914 3300053098 Bacteria 2045
598 Ga0500555_006776 3300053103 Bacteria 3256
599 Ga0500556_0000006 3300053104 Bacteria 453982
600 Ga0500557_000037 3300053105 Bacteria 71114
601 Ga0500569_015334 3300053109 Bacteria 1917
602 Ga0500572_004369 3300053111 Bacteria 3210
603 Ga0500591_087386 3300053115 Bacteria 1370
604 Ga0500592_002807 3300053116 Bacteria 2801
605 Ga0500594_0039130 3300053118 Bacteria 1288
606 Ga0500595_000258 3300053119 Bacteria 35116
607 Ga0500614_006800 3300053123 Bacteria 2405
608 Ga0500618_019156 3300053125 Bacteria 1686
609 Ga0500642_0000004 3300053130 Bacteria 433122
610 Ga0500642_0000153 3300053130 Bacteria 28618
611 Ga0500642_0000465 3300053130 Bacteria 12688
612 Ga0500652_000340 3300053131 Bacteria 16804
613 Ga0500559_0000244 3300053136 Bacteria 42994
614 Ga0500559_0006889 3300053136 Bacteria 5089
615 Ga0500559_0007889 3300053136 Bacteria 4697
616 Ga0500559_0012098 3300053136 Bacteria 3675
617 Ga0500568_0022832 3300053139 Bacteria 2668
618 Ga0500573_0023834 3300053140 Bacteria 3515
619 Ga0500577_0001120 3300053142 Bacteria 6859
620 Ga0500586_038491 3300053145 Bacteria 1612
621 Ga0500589_040026 3300053147 Bacteria 2188
622 Ga0500590_058534 3300053148 Bacteria 1941
623 Ga0500590_072275 3300053148 Bacteria 1712
624 Ga0500603_004927 3300053150 Bacteria 2863
625 Ga0500603_010583 3300053150 Bacteria 2085
626 Ga0500604_0009376 3300053151 Bacteria 2608
627 Ga0500616_0000022 3300053153 Bacteria 460463
628 Ga0500619_057226 3300053154 Bacteria 1275
629 Ga0500620_003346 3300053155 Bacteria 3409
630 Ga0500622_0000837 3300053156 Bacteria 26291
631 Ga0500630_042531 3300053159 Bacteria 2216
632 Ga0500634_0036711 3300053161 Bacteria 2667
633 Ga0500634_0085537 3300053161 Bacteria 1613
634 Ga0500638_000200 3300053162 Bacteria 12409
635 Ga0500638_073190 3300053162 Bacteria 1636
636 Ga0500639_021924 3300053163 Bacteria 3376
637 Ga0500639_143672 3300053163 Bacteria 1111
638 Ga0500636_0000197 3300053177 Bacteria 32448
639 Ga0500636_0005335 3300053177 Bacteria 7324
640 Ga0500636_0018791 3300053177 Bacteria 4087
641 Ga0500636_0201033 3300053177 Bacteria 1054
642 Ga0500637_0000147 3300053178 Bacteria 25930
643 Ga0500611_025274 3300053727 Bacteria 1175
644 Ga0500625_042885 3300053729 Bacteria 2121
645 Ga0500609_008074 3300053731 Bacteria 1420
646 Ga0500596_004822 3300053735 Bacteria 2438
647 Ga0500596_011161 3300053735 Bacteria 1376
648 Ga0500601_000733 3300053737 Bacteria 4295
649 Ga0500661_000152 3300055283 Bacteria 11839
650 Ga0500661_014906 3300055283 Bacteria 1396
651 Ga0530510_0206776 3300061734 Bacteria 1459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041509 Ga0451843_0070413 Ga0451843_0070413_319_1086 247
2 3300048904 Ga0496101_0120113 Ga0496101_0120113_156_1076 277
3 3300035724 Ga0373933_0029672 Ga0373933_0029672_14_859 281
4 3300046522 Ga0495643_0189268 Ga0495643_0189268_123_968 281
5 3300044658 Ga0466972_0010521 Ga0466972_0010521_1210_2133 282
6 3300044901 Ga0466960_0018945 Ga0466960_0018945_732_1655 282
7 3300003215 JGI25153J46596_10006321 JGI25153J46596_100063213 283
8 3300003354 JGI25160J50197_1001638 JGI25160J50197_10016381 283
9 3300003771 Ga0055526_1021877 Ga0055526_10218773 283
10 3300006038 Ga0075365_10037225 Ga0075365_100372252 283
11 3300006178 Ga0075367_10032532 Ga0075367_100325322 283
12 3300006353 Ga0075370_10024575 Ga0075370_100245753 283
13 3300025295 Ga0209564_1009106 Ga0209564_10091062 283
14 3300025297 Ga0209758_1003514 Ga0209758_10035144 283
15 3300025302 Ga0207426_1000420 Ga0207426_100042045 283
16 3300048928 Ga0496125_0085487 Ga0496125_0085487_218_1141 283
17 3300050492 nmdc:mga0yw44_105755_c1 nmdc:mga0yw44_105755_c1_103_1026 283
18 3300003215 JGI25153J46596_10001605 JGI25153J46596_100016055 285
19 3300025297 Ga0209758_1000253 Ga0209758_1000253109 285
20 3300037471 Ga0395905_0005266 Ga0395905_0005266_8476_9411 285
21 3300038443 Ga0395901_0572400 Ga0395901_0572400_15_950 285
22 3300039437 Ga0436365_0239060 Ga0436365_0239060_365_1288 285
23 3300044656 Ga0466969_0053505 Ga0466969_0053505_283_1206 285
24 3300044658 Ga0466972_0000107 Ga0466972_0000107_17722_18645 285
25 3300044684 Ga0466966_0000359 Ga0466966_0000359_12808_13731 285
26 3300044693 Ga0466961_0000074 Ga0466961_0000074_46301_47224 285
27 3300044735 Ga0466968_0063652 Ga0466968_0063652_191_1114 285
28 3300045049 Ga0466959_0012948 Ga0466959_0012948_5091_6014 285
29 3300005366 Ga0070659_100353692 Ga0070659_1003536922 286
30 3300005455 Ga0070663_100099022 Ga0070663_1000990222 286
31 3300005548 Ga0070665_100116569 Ga0070665_1001165692 286
32 3300005563 Ga0068855_100193197 Ga0068855_1001931971 286
33 3300005577 Ga0068857_100042407 Ga0068857_1000424072 286
34 3300006042 Ga0075368_10022719 Ga0075368_100227193 286
35 3300006048 Ga0075363_100120279 Ga0075363_1001202792 286
36 3300006353 Ga0075370_10110187 Ga0075370_101101871 286
37 3300009176 Ga0105242_10305681 Ga0105242_103056812 286
38 3300013306 Ga0163162_10137697 Ga0163162_101376973 286
39 3300014325 Ga0163163_10153397 Ga0163163_101533971 286
40 3300014745 Ga0157377_10093706 Ga0157377_100937062 286
41 3300025297 Ga0209758_1004217 Ga0209758_10042173 286
42 3300025901 Ga0207688_10062625 Ga0207688_100626253 286
43 3300025904 Ga0207647_10014127 Ga0207647_100141275 286
44 3300025941 Ga0207711_10179905 Ga0207711_101799052 286
45 3300026095 Ga0207676_10142306 Ga0207676_101423061 286
46 3300026116 Ga0207674_10181806 Ga0207674_101818062 286
47 3300027866 Ga0209813_10011560 Ga0209813_100115602 286
48 3300028379 Ga0268266_10124570 Ga0268266_101245703 286
49 3300046515 Ga0495620_0106497 Ga0495620_0106497_82_1005 286
50 3300046522 Ga0495643_0061112 Ga0495643_0061112_62_985 286
51 3300046616 Ga0495668_0195876 Ga0495668_0195876_145_1068 286
52 3300046810 Ga0495660_0150829 Ga0495660_0150829_14_937 286
53 3300047443 Ga0495687_034550 Ga0495687_034550_32_955 286
54 3300048903 Ga0496100_0366754 Ga0496100_0366754_37_960 286
55 3300048904 Ga0496101_0293049 Ga0496101_0293049_192_1115 286
56 3300048905 Ga0496102_0457877 Ga0496102_0457877_129_1052 286
57 3300048906 Ga0496103_0015992 Ga0496103_0015992_1967_2890 286
58 3300048912 Ga0496109_0514869 Ga0496109_0514869_135_1058 286
59 3300048913 Ga0496110_0424880 Ga0496110_0424880_57_980 286
60 3300048921 Ga0496118_0109826 Ga0496118_0109826_189_1112 286
61 3300050491 nmdc:mga00v17_234003_c1 nmdc:mga00v17_234003_c1_193_1116 286
62 3300050493 nmdc:mga0k408_28970_c1 nmdc:mga0k408_28970_c1_81_1004 286
63 3300050494 nmdc:mga06z11_213770_c1 nmdc:mga06z11_213770_c1_157_1080 286
64 3300050495 nmdc:mga04h51_16234_c1 nmdc:mga04h51_16234_c1_81_1004 286
65 3300046513 Ga0495616_0095202 Ga0495616_0095202_363_1286 287
66 3300047320 Ga0495672_0103375 Ga0495672_0103375_473_1393 287
67 iso_pu_bacteria 8016530956 8016539802 287
68 3300038443 Ga0395901_0356492 Ga0395901_0356492_531_1454 288
69 3300046460 Ga0495638_0253912 Ga0495638_0253912_13_933 288
70 3300053109 Ga0500569_015334 Ga0500569_015334_14_880 288
71 iso_pu_bacteria 8016539877 8016544107 288
72 3300048915 Ga0496112_0153851 Ga0496112_0153851_299_1222 292
73 3300025233 Ga0209437_101863 Ga0209437_1018633 293
74 3300025261 Ga0209233_1000910 Ga0209233_10009102 293
75 iso_pu_bacteria 8019530166 8019531079 296
76 3300021320 Ga0214544_1000016 Ga0214544_1000016136 299
77 3300021321 Ga0214542_1000016 Ga0214542_100001666 299
78 3300021324 Ga0214545_1000008 Ga0214545_100000872 299
79 3300021327 Ga0214543_1000043 Ga0214543_100004322 299
80 3300005471 Ga0070698_100088915 Ga0070698_1000889153 301
81 3300050491 nmdc:mga00v17_24325_c1 nmdc:mga00v17_24325_c1_2594_3502 302
82 iso_pu_bacteria 2508501128 2509151878 302
83 iso_pu_bacteria 2791355199 2793083624 302
84 iso_pu_bacteria 2889033259 2889035453 302
85 iso_pu_bacteria 2922386360 2922392597 302
86 iso_pu_bacteria 8006964411 8006967491 302
87 iso_pu_bacteria 8006984368 8006990955 302
88 iso_pu_bacteria 8056673599 8056675770 302
89 iso_pu_bacteria 2507262055 2507505314 303
90 iso_pu_bacteria 2508501009 2508539204 303
91 iso_pu_bacteria 2508501042 2508695524 303
92 iso_pu_bacteria 2511231028 2511394340 303
93 iso_pu_bacteria 2513237094 2513644641 303
94 iso_pu_bacteria 2513237095 2513651476 303
95 iso_pu_bacteria 2513237101 2513695144 303
96 iso_pu_bacteria 2513237102 2513699899 303
97 iso_pu_bacteria 2513237104 2513720266 303
98 iso_pu_bacteria 2513237139 2513873492 303
99 iso_pu_bacteria 2513237141 2513888809 303
100 iso_pu_bacteria 2513237161 2514012523 303
101 iso_pu_bacteria 2515154112 2515627481 303
102 iso_pu_bacteria 2517093001 2517107147 303
103 iso_pu_bacteria 2524023205 2524440851 303
104 iso_pu_bacteria 2528768022 2528854068 303
105 iso_pu_bacteria 2602042107 2603858557 303
106 iso_pu_bacteria 2617270735 2617352435 303
107 iso_pu_bacteria 2617270741 2617373795 303
108 iso_pu_bacteria 2721755755 2723841674 303
109 iso_pu_bacteria 2744054633 2745081729 303
110 iso_pu_bacteria 2791355196 2793062083 303
111 iso_pu_bacteria 2802429603 2805915576 303
112 iso_pu_bacteria 2816332527 2818237689 303
113 iso_pu_bacteria 2824600985 2824604543 303
114 iso_pu_bacteria 2824609381 2824612366 303
115 iso_pu_bacteria 2824617872 2824626107 303
116 iso_pu_bacteria 2824626560 2824634821 303
117 iso_pu_bacteria 2824635225 2824642932 303
118 iso_pu_bacteria 2824644064 2824651300 303
119 iso_pu_bacteria 2824653114 2824655231 303
120 iso_pu_bacteria 2824661429 2824667599 303
121 iso_pu_bacteria 2824671348 2824674403 303
122 iso_pu_bacteria 2824679649 2824685858 303
123 iso_pu_bacteria 2824687955 2824691099 303
124 iso_pu_bacteria 2824696289 2824700148 303
125 iso_pu_bacteria 2824704595 2824711536 303
126 iso_pu_bacteria 2824714736 2824720945 303
127 iso_pu_bacteria 2824723954 2824731123 303
128 iso_pu_bacteria 2824732956 2824738856 303
129 iso_pu_bacteria 2824746037 2824748662 303
130 iso_pu_bacteria 2824753945 2824759909 303
131 iso_pu_bacteria 2824763712 2824770343 303
132 iso_pu_bacteria 2824773399 2824775483 303
133 iso_pu_bacteria 2838122688 2838124553 303
134 iso_pu_bacteria 2841941048 2841945240 303
135 iso_pu_bacteria 2841949485 2841952021 303
136 iso_pu_bacteria 2841957949 2841965583 303
137 iso_pu_bacteria 2841966195 2841970585 303
138 iso_pu_bacteria 2841974524 2841981834 303
139 iso_pu_bacteria 2841983080 2841985112 303
140 iso_pu_bacteria 2842038055 2842043470 303
141 iso_pu_bacteria 2842045827 2842052540 303
142 iso_pu_bacteria 2844315083 2844315379 303
143 iso_pu_bacteria 2847930680 2847931112 303
144 iso_pu_bacteria 2847939898 2847942192 303
145 iso_pu_bacteria 2849076700 2849083071 303
146 iso_pu_bacteria 2857509624 2857511963 303
147 iso_pu_bacteria 2857524615 2857526320 303
148 iso_pu_bacteria 2874590934 2874594485 303
149 iso_pu_bacteria 2874604998 2874608031 303
150 iso_pu_bacteria 2874612657 2874613398 303
151 iso_pu_bacteria 2874620515 2874624827 303
152 iso_pu_bacteria 2874628541 2874628748 303
153 iso_pu_bacteria 2874645413 2874649857 303
154 iso_pu_bacteria 2876761206 2876770941 303
155 iso_pu_bacteria 2876771140 2876773977 303
156 iso_pu_bacteria 2876818435 2876821857 303
157 iso_pu_bacteria 2879074833 2879078299 303
158 iso_pu_bacteria 2879083081 2879085947 303
159 iso_pu_bacteria 2879099564 2879105983 303
160 iso_pu_bacteria 2879127579 2879130559 303
161 iso_pu_bacteria 2879142872 2879147165 303
162 iso_pu_bacteria 2881364244 2881365283 303
163 iso_pu_bacteria 2881665667 2881668147 303
164 iso_pu_bacteria 2885366525 2885370985 303
165 iso_pu_bacteria 2885409591 2885411624 303
166 iso_pu_bacteria 2888378607 2888379547 303
167 iso_pu_bacteria 2888388044 2888390642 303
168 iso_pu_bacteria 2888419890 2888420265 303
169 iso_pu_bacteria 2893066018 2893067405 303
170 iso_pu_bacteria 2903727486 2903732238 303
171 iso_pu_bacteria 2904666416 2904670218 303
172 iso_pu_bacteria 2904711408 2904713225 303
173 iso_pu_bacteria 2906602504 2906604317 303
174 iso_pu_bacteria 2906626472 2906628481 303
175 iso_pu_bacteria 2906643746 2906648137 303
176 iso_pu_bacteria 2908775508 2908776312 303
177 iso_pu_bacteria 2919073203 2919073828 303
178 iso_pu_bacteria 2922361189 2922363965 303
179 iso_pu_bacteria 2922368715 2922369536 303
180 iso_pu_bacteria 2922393267 2922394274 303
181 iso_pu_bacteria 2929615660 2929618642 303
182 iso_pu_bacteria 2929624759 2929628673 303
183 iso_pu_bacteria 2932784394 2932790821 303
184 iso_pu_bacteria 2932794094 2932794274 303
185 iso_pu_bacteria 2932801729 2932808132 303
186 iso_pu_bacteria 2932809354 2932812126 303
187 iso_pu_bacteria 2932818245 2932823116 303
188 iso_pu_bacteria 2932828146 2932833508 303
189 iso_pu_bacteria 2933577622 2933580646 303
190 iso_pu_bacteria 2935608549 2935615686 303
191 iso_pu_bacteria 2935616580 2935623064 303
192 iso_pu_bacteria 2935638405 2935644139 303
193 iso_pu_bacteria 2935648319 2935653580 303
194 iso_pu_bacteria 2935656913 2935662329 303
195 iso_pu_bacteria 2935665750 2935672279 303
196 iso_pu_bacteria 2935675223 2935679196 303
197 iso_pu_bacteria 2935684952 2935686442 303
198 iso_pu_bacteria 2935694250 2935700222 303
199 iso_pu_bacteria 2935703347 2935710171 303
200 iso_pu_bacteria 2935713505 2935716130 303
201 iso_pu_bacteria 2935722832 2935723746 303
202 iso_pu_bacteria 2935732158 2935735301 303
203 iso_pu_bacteria 2935741537 2935743908 303
204 iso_pu_bacteria 2935750917 2935752408 303
205 iso_pu_bacteria 2935760218 2935763496 303
206 iso_pu_bacteria 2935769743 2935773000 303
207 iso_pu_bacteria 2935777560 2935782943 303
208 iso_pu_bacteria 2935785616 2935788012 303
209 iso_pu_bacteria 2935793552 2935796412 303
210 iso_pu_bacteria 2935801545 2935808163 303
211 iso_pu_bacteria 2935810662 2935816224 303
212 iso_pu_bacteria 2935819856 2935825516 303
213 iso_pu_bacteria 2935827899 2935833617 303
214 iso_pu_bacteria 2935837841 2935844570 303
215 iso_pu_bacteria 2935847175 2935853305 303
216 iso_pu_bacteria 2935855204 2935861312 303
217 iso_pu_bacteria 2935864058 2935869431 303
218 iso_pu_bacteria 2935873716 2935879760 303
219 iso_pu_bacteria 2935883170 2935890052 303
220 iso_pu_bacteria 2935908558 2935914778 303
221 iso_pu_bacteria 2935916978 2935918754 303
222 iso_pu_bacteria 2935926038 2935931529 303
223 iso_pu_bacteria 2935934488 2935940126 303
224 iso_pu_bacteria 2935942939 2935947527 303
225 iso_pu_bacteria 2935951376 2935956299 303
226 iso_pu_bacteria 2935959822 2935962679 303
227 iso_pu_bacteria 2935967501 2935973092 303
228 iso_pu_bacteria 2935975950 2935980664 303
229 iso_pu_bacteria 2935984226 2935985182 303
230 iso_pu_bacteria 2935992306 2935998017 303
231 iso_pu_bacteria 2936002035 2936008717 303
232 iso_pu_bacteria 2936011229 2936016631 303
233 iso_pu_bacteria 2936019824 2936025264 303
234 iso_pu_bacteria 2936028420 2936034106 303
235 iso_pu_bacteria 2936037263 2936041229 303
236 iso_pu_bacteria 2936046547 2936052163 303
237 iso_pu_bacteria 2936055302 2936056354 303
238 iso_pu_bacteria 2940556831 2940558321 303
239 iso_pu_bacteria 2941531003 2941535473 303
240 iso_pu_bacteria 2941538514 2941543245 303
241 iso_pu_bacteria 3005483717 3005489036 303
242 iso_pu_bacteria 3005506211 3005509126 303
243 iso_pu_bacteria 3005587118 3005591554 303
244 iso_pu_bacteria 3005594810 3005595093 303
245 iso_pu_bacteria 3005710791 3005711037 303
246 iso_pu_bacteria 3005718088 3005718344 303
247 iso_pu_bacteria 8006926726 8006928928 303
248 iso_pu_bacteria 8006994254 8006996476 303
249 iso_pu_bacteria 8016511872 8016518143 303
250 iso_pu_bacteria 8016583857 8016586324 303
251 iso_pu_bacteria 8016603502 8016606521 303
252 iso_pu_bacteria 8016613128 8016618420 303
253 iso_pu_bacteria 8016622563 8016623062 303
254 iso_pu_bacteria 8016630954 8016635581 303
255 iso_pu_bacteria 8017057580 8017058503 303
256 iso_pu_bacteria 8019538911 8019540479 303
257 iso_pu_bacteria 8019547302 8019550067 303
258 iso_pu_bacteria 8019576017 8019577190 303
259 iso_pu_bacteria 8019586578 8019595268 303
260 iso_pu_bacteria 8019597564 8019606485 303
261 iso_pu_bacteria 8019608314 8019612036 303
262 iso_pu_bacteria 8019619141 8019623012 303
263 iso_pu_bacteria 8019638758 8019640521 303
264 iso_pu_bacteria 8019648815 8019652425 303
265 iso_pu_bacteria 8019668869 8019676683 303
266 iso_pu_bacteria 8019678201 8019679307 303
267 iso_pu_bacteria 8019687851 8019696199 303
268 iso_pu_bacteria 8055742211 8055742492 303
269 3300006028 Ga0070717_10290923 Ga0070717_102909232 305
270 3300013306 Ga0163162_10110726 Ga0163162_101107263 305
271 3300025906 Ga0207699_10043815 Ga0207699_100438153 305
272 3300025915 Ga0207693_10068294 Ga0207693_100682944 305
273 3300025916 Ga0207663_10056809 Ga0207663_100568092 305
274 3300025928 Ga0207700_10068716 Ga0207700_100687163 305
275 3300028379 Ga0268266_10259601 Ga0268266_102596012 305
276 3300046511 Ga0495608_0102202 Ga0495608_0102202_879_1817 305
277 3300046533 Ga0495640_0144401 Ga0495640_0144401_134_1072 305
278 3300047319 Ga0495674_0164931 Ga0495674_0164931_376_1314 305
279 3300048929 Ga0496126_0034653 Ga0496126_0034653_1170_2138 305
280 3300053077 Ga0495601_0033069 Ga0495601_0033069_1618_2556 305
281 3300002077 JGI24744J21845_10019353 JGI24744J21845_100193532 306
282 3300003215 JGI25153J46596_10002174 JGI25153J46596_100021748 306
283 3300003659 JGI25404J52841_10004641 JGI25404J52841_100046412 306
284 3300005334 Ga0068869_100155314 Ga0068869_1001553142 306
285 3300005334 Ga0068869_100178089 Ga0068869_1001780892 306
286 3300005335 Ga0070666_10115195 Ga0070666_101151952 306
287 3300005336 Ga0070680_100080883 Ga0070680_1000808833 306
288 3300005347 Ga0070668_100078426 Ga0070668_1000784263 306
289 3300005347 Ga0070668_100125879 Ga0070668_1001258791 306
290 3300005353 Ga0070669_100171540 Ga0070669_1001715402 306
291 3300005364 Ga0070673_100312248 Ga0070673_1003122481 306
292 3300005436 Ga0070713_100087059 Ga0070713_1000870593 306
293 3300005436 Ga0070713_100234239 Ga0070713_1002342391 306
294 3300005436 Ga0070713_100308924 Ga0070713_1003089241 306
295 3300005437 Ga0070710_10003972 Ga0070710_100039722 306
296 3300005441 Ga0070700_100133773 Ga0070700_1001337732 306
297 3300005455 Ga0070663_100290115 Ga0070663_1002901151 306
298 3300005456 Ga0070678_100033410 Ga0070678_1000334102 306
299 3300005456 Ga0070678_100340380 Ga0070678_1003403802 306
300 3300005457 Ga0070662_100205776 Ga0070662_1002057762 306
301 3300005458 Ga0070681_10046762 Ga0070681_100467625 306
302 3300005459 Ga0068867_100139178 Ga0068867_1001391782 306
303 3300005530 Ga0070679_100024632 Ga0070679_1000246323 306
304 3300005539 Ga0068853_100230936 Ga0068853_1002309361 306
305 3300005563 Ga0068855_100009982 Ga0068855_1000099821 306
306 3300005614 Ga0068856_100000801 Ga0068856_1000008015 306
307 3300005614 Ga0068856_100127671 Ga0068856_1001276712 306
308 3300005616 Ga0068852_100394281 Ga0068852_1003942812 306
309 3300005617 Ga0068859_100162200 Ga0068859_1001622002 306
310 3300005719 Ga0068861_100143690 Ga0068861_1001436903 306
311 3300005842 Ga0068858_100345314 Ga0068858_1003453142 306
312 3300005843 Ga0068860_100532423 Ga0068860_1005324231 306
313 3300005937 Ga0081455_10005195 Ga0081455_100051954 306
314 3300005937 Ga0081455_10006414 Ga0081455_100064146 306
315 3300005981 Ga0081538_10022359 Ga0081538_100223591 306
316 3300005983 Ga0081540_1007182 Ga0081540_10071826 306
317 3300005983 Ga0081540_1008741 Ga0081540_10087416 306
318 3300005983 Ga0081540_1009467 Ga0081540_10094672 306
319 3300005983 Ga0081540_1044637 Ga0081540_10446372 306
320 3300005983 Ga0081540_1044908 Ga0081540_10449082 306
321 3300006028 Ga0070717_10005195 Ga0070717_100051958 306
322 3300006048 Ga0075363_100096498 Ga0075363_1000964982 306
323 3300006178 Ga0075367_10048736 Ga0075367_100487361 306
324 3300006195 Ga0075366_10060463 Ga0075366_100604632 306
325 3300006237 Ga0097621_100221013 Ga0097621_1002210132 306
326 3300006353 Ga0075370_10137370 Ga0075370_101373701 306
327 3300006844 Ga0075428_100291394 Ga0075428_1002913942 306
328 3300006871 Ga0075434_100362764 Ga0075434_1003627641 306
329 3300006881 Ga0068865_100104257 Ga0068865_1001042572 306
330 3300006881 Ga0068865_100350564 Ga0068865_1003505641 306
331 3300006931 Ga0097620_100162190 Ga0097620_1001621902 306
332 3300007076 Ga0075435_100210958 Ga0075435_1002109582 306
333 3300009093 Ga0105240_10066315 Ga0105240_100663153 306
334 3300009094 Ga0111539_10207522 Ga0111539_102075222 306
335 3300009098 Ga0105245_10380949 Ga0105245_103809492 306
336 3300009101 Ga0105247_10181149 Ga0105247_101811491 306
337 3300009148 Ga0105243_10014700 Ga0105243_100147001 306
338 3300009148 Ga0105243_10084249 Ga0105243_100842493 306
339 3300009174 Ga0105241_10509678 Ga0105241_105096781 306
340 3300009177 Ga0105248_10271785 Ga0105248_102717851 306
341 3300009545 Ga0105237_10008437 Ga0105237_100084375 306
342 3300009545 Ga0105237_10079037 Ga0105237_100790373 306
343 3300009545 Ga0105237_10325014 Ga0105237_103250141 306
344 3300009551 Ga0105238_10034241 Ga0105238_100342414 306
345 3300009553 Ga0105249_10063882 Ga0105249_100638822 306
346 3300009553 Ga0105249_10527553 Ga0105249_105275531 306
347 3300010375 Ga0105239_10070706 Ga0105239_100707064 306
348 3300010375 Ga0105239_10176220 Ga0105239_101762202 306
349 3300010375 Ga0105239_10546429 Ga0105239_105464292 306
350 3300013104 Ga0157370_10014703 Ga0157370_100147033 306
351 3300013307 Ga0157372_10292913 Ga0157372_102929132 306
352 3300014325 Ga0163163_10194056 Ga0163163_101940562 306
353 3300014326 Ga0157380_10209379 Ga0157380_102093792 306
354 3300014969 Ga0157376_10153581 Ga0157376_101535813 306
355 3300025253 Ga0209677_100602 Ga0209677_1006026 306
356 3300025254 Ga0209148_1006149 Ga0209148_10061492 306
357 3300025261 Ga0209233_1005145 Ga0209233_10051454 306
358 3300025272 Ga0209455_1003612 Ga0209455_10036125 306
359 3300025272 Ga0209455_1005706 Ga0209455_10057063 306
360 3300025893 Ga0207682_10039189 Ga0207682_100391893 306
361 3300025898 Ga0207692_10084858 Ga0207692_100848581 306
362 3300025898 Ga0207692_10110683 Ga0207692_101106832 306
363 3300025907 Ga0207645_10238159 Ga0207645_102381591 306
364 3300025909 Ga0207705_10082949 Ga0207705_100829493 306
365 3300025911 Ga0207654_10009133 Ga0207654_100091333 306
366 3300025911 Ga0207654_10144214 Ga0207654_101442142 306
367 3300025912 Ga0207707_10164164 Ga0207707_101641643 306
368 3300025913 Ga0207695_10117416 Ga0207695_101174163 306
369 3300025914 Ga0207671_10103090 Ga0207671_101030902 306
370 3300025916 Ga0207663_10007768 Ga0207663_100077681 306
371 3300025918 Ga0207662_10074388 Ga0207662_100743882 306
372 3300025921 Ga0207652_10438236 Ga0207652_104382361 306
373 3300025924 Ga0207694_10544949 Ga0207694_105449491 306
374 3300025926 Ga0207659_10388707 Ga0207659_103887072 306
375 3300025928 Ga0207700_10032152 Ga0207700_100321524 306
376 3300025928 Ga0207700_10425273 Ga0207700_104252731 306
377 3300025934 Ga0207686_10081704 Ga0207686_100817041 306
378 3300025935 Ga0207709_10078663 Ga0207709_100786632 306
379 3300025935 Ga0207709_10082247 Ga0207709_100822472 306
380 3300025942 Ga0207689_10027750 Ga0207689_100277503 306
381 3300025949 Ga0207667_10219690 Ga0207667_102196902 306
382 3300025960 Ga0207651_10084556 Ga0207651_100845562 306
383 3300025961 Ga0207712_10175592 Ga0207712_101755922 306
384 3300025972 Ga0207668_10054083 Ga0207668_100540833 306
385 3300025972 Ga0207668_10290669 Ga0207668_102906691 306
386 3300025986 Ga0207658_10469390 Ga0207658_104693901 306
387 3300026023 Ga0207677_10101090 Ga0207677_101010902 306
388 3300026041 Ga0207639_10113378 Ga0207639_101133781 306
389 3300026041 Ga0207639_10135388 Ga0207639_101353882 306
390 3300026067 Ga0207678_10202846 Ga0207678_102028462 306
391 3300026075 Ga0207708_10075025 Ga0207708_100750253 306
392 3300026078 Ga0207702_10000559 Ga0207702_100005596 306
393 3300026078 Ga0207702_10224835 Ga0207702_102248351 306
394 3300026089 Ga0207648_10022011 Ga0207648_100220116 306
395 3300026118 Ga0207675_100133354 Ga0207675_1001333541 306
396 3300026118 Ga0207675_100285528 Ga0207675_1002855282 306
397 3300026121 Ga0207683_10132358 Ga0207683_101323581 306
398 3300026142 Ga0207698_10415278 Ga0207698_104152782 306
399 3300026142 Ga0207698_10473579 Ga0207698_104735791 306
400 3300027512 Ga0209179_1019216 Ga0209179_10192162 306
401 3300027907 Ga0207428_10185789 Ga0207428_101857892 306
402 3300028379 Ga0268266_10078556 Ga0268266_100785563 306
403 3300028379 Ga0268266_10471011 Ga0268266_104710111 306
404 3300028786 Ga0307517_10000942 Ga0307517_1000094211 306
405 3300031456 Ga0307513_10314456 Ga0307513_103144562 306
406 3300031507 Ga0307509_10168844 Ga0307509_101688442 306
407 3300031548 Ga0307408_100286915 Ga0307408_1002869152 306
408 3300031616 Ga0307508_10012397 Ga0307508_100123978 306
409 3300031730 Ga0307516_10007372 Ga0307516_100073722 306
410 3300031731 Ga0307405_10180349 Ga0307405_101803492 306
411 3300031901 Ga0307406_10149105 Ga0307406_101491051 306
412 3300032126 Ga0307415_100060590 Ga0307415_1000605904 306
413 3300032126 Ga0307415_100191502 Ga0307415_1001915022 306
414 3300033180 Ga0307510_10001783 Ga0307510_1000178320 306
415 3300033180 Ga0307510_10104982 Ga0307510_101049823 306
416 3300035085 Ga0373929_0004256 Ga0373929_0004256_122_1042 306
417 3300035088 Ga0373940_0055576 Ga0373940_0055576_86_1006 306
418 3300035118 Ga0373954_0005067 Ga0373954_0005067_2628_3548 306
419 3300035120 Ga0373957_0045440 Ga0373957_0045440_453_1373 306
420 3300035410 Ga0373924_0017818 Ga0373924_0017818_687_1607 306
421 3300035691 Ga0373931_0001442 Ga0373931_0001442_3943_4863 306
422 3300035692 Ga0373935_0026124 Ga0373935_0026124_836_1756 306
423 3300035695 Ga0373927_0031111 Ga0373927_0031111_947_1867 306
424 3300035695 Ga0373927_0180911 Ga0373927_0180911_36_956 306
425 3300036401 Ga0373937_0401275 Ga0373937_0401275_13_933 306
426 3300037068 Ga0373925_0188953 Ga0373925_0188953_596_1516 306
427 3300038443 Ga0395901_0140218 Ga0395901_0140218_763_1683 306
428 3300039437 Ga0436365_1614403 Ga0436365_1614403_225_1145 306
429 3300039453 Ga0436362_1141340 Ga0436362_1141340_1358_2278 306
430 3300041413 Ga0439465_0041151 Ga0439465_0041151_552_1472 306
431 3300046454 Ga0495592_0045385 Ga0495592_0045385_999_1919 306
432 3300046455 Ga0495603_0021429 Ga0495603_0021429_2982_3902 306
433 3300046459 Ga0495629_0048190 Ga0495629_0048190_915_1835 306
434 3300046460 Ga0495638_0021875 Ga0495638_0021875_890_1810 306
435 3300046461 Ga0495641_0110786 Ga0495641_0110786_243_1163 306
436 3300046462 Ga0495651_0020406 Ga0495651_0020406_788_1708 306
437 3300046473 Ga0495582_0039830 Ga0495582_0039830_1375_2295 306
438 3300046492 Ga0495585_0025153 Ga0495585_0025153_885_1805 306
439 3300046492 Ga0495585_0144946 Ga0495585_0144946_39_959 306
440 3300046499 Ga0495594_0084582 Ga0495594_0084582_292_1212 306
441 3300046506 Ga0495583_0101861 Ga0495583_0101861_32_952 306
442 3300046513 Ga0495616_0111996 Ga0495616_0111996_267_1187 306
443 3300046516 Ga0495628_0006943 Ga0495628_0006943_4985_5905 306
444 3300046517 Ga0495630_0067911 Ga0495630_0067911_1187_2107 306
445 3300046518 Ga0495631_0108825 Ga0495631_0108825_207_1127 306
446 3300046523 Ga0495644_0044691 Ga0495644_0044691_630_1550 306
447 3300046524 Ga0495648_0181311 Ga0495648_0181311_19_939 306
448 3300046529 Ga0495652_0103226 Ga0495652_0103226_476_1396 306
449 3300046529 Ga0495652_0265395 Ga0495652_0265395_282_1202 306
450 3300046535 Ga0495586_0082645 Ga0495586_0082645_133_1053 306
451 3300046557 Ga0495622_0004671 Ga0495622_0004671_3882_4802 306
452 3300046558 Ga0495633_0146533 Ga0495633_0146533_132_1052 306
453 3300046559 Ga0495667_0054959 Ga0495667_0054959_935_1855 306
454 3300046616 Ga0495668_0081496 Ga0495668_0081496_391_1311 306
455 3300046660 Ga0495625_0096584 Ga0495625_0096584_535_1455 306
456 3300046674 Ga0495588_0095033 Ga0495588_0095033_49_969 306
457 3300046678 Ga0495599_0006930 Ga0495599_0006930_2788_3708 306
458 3300046679 Ga0495623_0037009 Ga0495623_0037009_1429_2349 306
459 3300046683 Ga0495658_0031121 Ga0495658_0031121_72_992 306
460 3300046684 Ga0495669_0000707 Ga0495669_0000707_13480_14400 306
461 3300046689 Ga0495613_0087584 Ga0495613_0087584_110_1030 306
462 3300046692 Ga0495671_0107934 Ga0495671_0107934_16_936 306
463 3300047315 Ga0495581_0193638 Ga0495581_0193638_118_1038 306
464 3300047317 Ga0495604_0054736 Ga0495604_0054736_1243_2163 306
465 3300047319 Ga0495674_0051131 Ga0495674_0051131_1964_2884 306
466 3300047321 Ga0495676_0281877 Ga0495676_0281877_133_1053 306
467 3300047673 Ga0495593_0102716 Ga0495593_0102716_49_969 306
468 3300048088 Ga0495602_0070368 Ga0495602_0070368_1026_1946 306
469 3300048090 Ga0495615_0013867 Ga0495615_0013867_498_1418 306
470 3300048903 Ga0496100_0095372 Ga0496100_0095372_1046_1966 306
471 3300048903 Ga0496100_0108082 Ga0496100_0108082_101_1021 306
472 3300048905 Ga0496102_0283251 Ga0496102_0283251_82_1002 306
473 3300048907 Ga0496104_0035592 Ga0496104_0035592_1543_2463 306
474 3300048908 Ga0496105_0156783 Ga0496105_0156783_670_1590 306
475 3300048909 Ga0496106_0010158 Ga0496106_0010158_2418_3338 306
476 3300048911 Ga0496108_0000902 Ga0496108_0000902_20468_21388 306
477 3300048911 Ga0496108_0101712 Ga0496108_0101712_1030_1950 306
478 3300048912 Ga0496109_0000224 Ga0496109_0000224_52534_53454 306
479 3300048913 Ga0496110_0037293 Ga0496110_0037293_3272_4192 306
480 3300048914 Ga0496111_0172265 Ga0496111_0172265_465_1385 306
481 3300048915 Ga0496112_0021849 Ga0496112_0021849_2783_3703 306
482 3300048915 Ga0496112_0143460 Ga0496112_0143460_585_1505 306
483 3300048915 Ga0496112_0173928 Ga0496112_0173928_198_1118 306
484 3300048916 Ga0496113_0079640 Ga0496113_0079640_757_1677 306
485 3300048916 Ga0496113_0158696 Ga0496113_0158696_639_1559 306
486 3300048919 Ga0496116_0003593 Ga0496116_0003593_9387_10307 306
487 3300048920 Ga0496117_0051115 Ga0496117_0051115_1584_2504 306
488 3300048924 Ga0496121_0040026 Ga0496121_0040026_85_1005 306
489 3300048924 Ga0496121_0176282 Ga0496121_0176282_187_1107 306
490 3300048924 Ga0496121_0265229 Ga0496121_0265229_29_949 306
491 3300048927 Ga0496124_0207066 Ga0496124_0207066_68_988 306
492 3300048929 Ga0496126_0009504 Ga0496126_0009504_3932_4852 306
493 3300048929 Ga0496126_0367377 Ga0496126_0367377_206_1126 306
494 3300050490 nmdc:mga03n38_3836_c1 nmdc:mga03n38_3836_c1_41_961 306
495 3300050511 nmdc:mga08y16_163429_c1 nmdc:mga08y16_163429_c1_778_1698 306
496 3300053077 Ga0495601_0228175 Ga0495601_0228175_89_1009 306
497 3300053079 Ga0500610_0056732 Ga0500610_0056732_167_1087 306
498 3300053092 Ga0500583_0073495 Ga0500583_0073495_425_1345 306
499 3300053094 Ga0500566_0000150 Ga0500566_0000150_11520_12440 306
500 3300053094 Ga0500566_0026715 Ga0500566_0026715_2223_3143 306
501 3300053095 Ga0500640_053774 Ga0500640_053774_135_1055 306
502 3300053111 Ga0500572_004369 Ga0500572_004369_2241_3161 306
503 3300053115 Ga0500591_087386 Ga0500591_087386_215_1135 306
504 3300053118 Ga0500594_0039130 Ga0500594_0039130_19_939 306
505 3300053119 Ga0500595_000258 Ga0500595_000258_5528_6448 306
506 3300053123 Ga0500614_006800 Ga0500614_006800_469_1389 306
507 3300053136 Ga0500559_0000244 Ga0500559_0000244_13594_14514 306
508 3300053142 Ga0500577_0001120 Ga0500577_0001120_5802_6722 306
509 3300053147 Ga0500589_040026 Ga0500589_040026_73_993 306
510 3300053150 Ga0500603_004927 Ga0500603_004927_1603_2523 306
511 3300053150 Ga0500603_010583 Ga0500603_010583_164_1084 306
512 3300053159 Ga0500630_042531 Ga0500630_042531_1221_2141 306
513 3300053161 Ga0500634_0036711 Ga0500634_0036711_939_1859 306
514 3300053161 Ga0500634_0085537 Ga0500634_0085537_679_1599 306
515 3300053162 Ga0500638_000200 Ga0500638_000200_1861_2781 306
516 3300053162 Ga0500638_073190 Ga0500638_073190_59_979 306
517 3300053163 Ga0500639_021924 Ga0500639_021924_989_1909 306
518 3300053177 Ga0500636_0018791 Ga0500636_0018791_1741_2661 306
519 3300053178 Ga0500637_0000147 Ga0500637_0000147_18888_19808 306
520 3300053735 Ga0500596_004822 Ga0500596_004822_795_1715 306
521 3300053735 Ga0500596_011161 Ga0500596_011161_434_1354 306
522 3300055283 Ga0500661_000152 Ga0500661_000152_29_949 306
523 3300001989 JGI24739J22299_10020552 JGI24739J22299_100205521 307
524 3300003203 JGI25406J46586_10003200 JGI25406J46586_100032006 307
525 3300003215 JGI25153J46596_10001681 JGI25153J46596_100016818 307
526 3300003215 JGI25153J46596_10010258 JGI25153J46596_100102583 307
527 3300003354 JGI25160J50197_1010618 JGI25160J50197_10106182 307
528 3300003659 JGI25404J52841_10000137 JGI25404J52841_100001373 307
529 3300003659 JGI25404J52841_10002771 JGI25404J52841_100027711 307
530 3300003659 JGI25404J52841_10010896 JGI25404J52841_100108962 307
531 3300003659 JGI25404J52841_10025480 JGI25404J52841_100254802 307
532 3300003762 Ga0055542_1003545 Ga0055542_10035454 307
533 3300003775 Ga0055524_1042262 Ga0055524_10422621 307
534 3300003794 Ga0055531_10003204 Ga0055531_100032047 307
535 3300005262 Ga0065165_1002933 Ga0065165_10029339 307
536 3300005262 Ga0065165_1003030 Ga0065165_10030309 307
537 3300005262 Ga0065165_1014086 Ga0065165_10140861 307
538 3300005262 Ga0065165_1056889 Ga0065165_10568891 307
539 3300005344 Ga0070661_100119936 Ga0070661_1001199361 307
540 3300005347 Ga0070668_100431590 Ga0070668_1004315901 307
541 3300005455 Ga0070663_100004604 Ga0070663_1000046047 307
542 3300005455 Ga0070663_100049717 Ga0070663_1000497173 307
543 3300005455 Ga0070663_100069514 Ga0070663_1000695141 307
544 3300005548 Ga0070665_100014247 Ga0070665_1000142477 307
545 3300005548 Ga0070665_100244563 Ga0070665_1002445632 307
546 3300005577 Ga0068857_100452125 Ga0068857_1004521251 307
547 3300005578 Ga0068854_100366219 Ga0068854_1003662191 307
548 3300005614 Ga0068856_100251455 Ga0068856_1002514552 307
549 3300005616 Ga0068852_100160576 Ga0068852_1001605763 307
550 3300005616 Ga0068852_100591691 Ga0068852_1005916911 307
551 3300005719 Ga0068861_100073532 Ga0068861_1000735322 307
552 3300005937 Ga0081455_10012939 Ga0081455_100129396 307
553 3300005937 Ga0081455_10029403 Ga0081455_100294033 307
554 3300005937 Ga0081455_10118688 Ga0081455_101186881 307
555 3300005983 Ga0081540_1003002 Ga0081540_10030024 307
556 3300005983 Ga0081540_1004227 Ga0081540_100422711 307
557 3300005983 Ga0081540_1007515 Ga0081540_10075155 307
558 3300005983 Ga0081540_1009938 Ga0081540_10099384 307
559 3300005983 Ga0081540_1018965 Ga0081540_10189653 307
560 3300005983 Ga0081540_1024300 Ga0081540_10243002 307
561 3300005983 Ga0081540_1047626 Ga0081540_10476263 307
562 3300005983 Ga0081540_1070660 Ga0081540_10706602 307
563 3300005985 Ga0081539_10004421 Ga0081539_1000442110 307
564 3300005985 Ga0081539_10158188 Ga0081539_101581881 307
565 3300006038 Ga0075365_10098053 Ga0075365_100980532 307
566 3300006038 Ga0075365_10105905 Ga0075365_101059052 307
567 3300006048 Ga0075363_100011119 Ga0075363_1000111195 307
568 3300006177 Ga0075362_10041328 Ga0075362_100413282 307
569 3300006178 Ga0075367_10044340 Ga0075367_100443403 307
570 3300006178 Ga0075367_10081854 Ga0075367_100818542 307
571 3300006186 Ga0075369_10005456 Ga0075369_100054562 307
572 3300006353 Ga0075370_10087190 Ga0075370_100871901 307
573 3300006942 Ga0099824_1009679 Ga0099824_10096798 307
574 3300009093 Ga0105240_10034476 Ga0105240_100344763 307
575 3300009101 Ga0105247_10142808 Ga0105247_101428081 307
576 3300009101 Ga0105247_10339260 Ga0105247_103392601 307
577 3300009174 Ga0105241_10122930 Ga0105241_101229302 307
578 3300009177 Ga0105248_10632559 Ga0105248_106325591 307
579 3300009545 Ga0105237_10064882 Ga0105237_100648823 307
580 3300009551 Ga0105238_10516519 Ga0105238_105165191 307
581 3300009551 Ga0105238_10609853 Ga0105238_106098531 307
582 3300013105 Ga0157369_10366127 Ga0157369_103661272 307
583 3300013308 Ga0157375_10333243 Ga0157375_103332432 307
584 3300014326 Ga0157380_10083701 Ga0157380_100837013 307
585 3300014326 Ga0157380_10537117 Ga0157380_105371171 307
586 3300021358 Ga0213873_10035309 Ga0213873_100353091 307
587 3300021441 Ga0213871_10004007 Ga0213871_100040073 307
588 3300025230 Ga0209563_103011 Ga0209563_1030112 307
589 3300025253 Ga0209677_101634 Ga0209677_1016341 307
590 3300025254 Ga0209148_1000282 Ga0209148_100028264 307
591 3300025261 Ga0209233_1007414 Ga0209233_10074142 307
592 3300025272 Ga0209455_1005231 Ga0209455_10052313 307
593 3300025297 Ga0209758_1000069 Ga0209758_100006993 307
594 3300025297 Ga0209758_1010924 Ga0209758_10109244 307
595 3300025297 Ga0209758_1023573 Ga0209758_10235733 307
596 3300025299 Ga0209256_1008971 Ga0209256_10089712 307
597 3300025299 Ga0209256_1030493 Ga0209256_10304932 307
598 3300025302 Ga0207426_1001303 Ga0207426_10013037 307
599 3300025302 Ga0207426_1007899 Ga0207426_10078993 307
600 3300025302 Ga0207426_1019149 Ga0207426_10191492 307
601 3300025302 Ga0207426_1026336 Ga0207426_10263362 307
602 3300025304 Ga0209257_1000564 Ga0209257_100056453 307
603 3300025908 Ga0207643_10103778 Ga0207643_101037782 307
604 3300025913 Ga0207695_10001820 Ga0207695_1000182015 307
605 3300025914 Ga0207671_10005387 Ga0207671_100053878 307
606 3300025919 Ga0207657_10120181 Ga0207657_101201812 307
607 3300025920 Ga0207649_10034561 Ga0207649_100345613 307
608 3300025924 Ga0207694_10110990 Ga0207694_101109901 307
609 3300025927 Ga0207687_10075277 Ga0207687_100752772 307
610 3300025933 Ga0207706_10074600 Ga0207706_100746001 307
611 3300025941 Ga0207711_10569440 Ga0207711_105694401 307
612 3300025949 Ga0207667_10228549 Ga0207667_102285492 307
613 3300026023 Ga0207677_10072717 Ga0207677_100727171 307
614 3300026041 Ga0207639_10578448 Ga0207639_105784481 307
615 3300026067 Ga0207678_10022715 Ga0207678_100227153 307
616 3300026067 Ga0207678_10028222 Ga0207678_100282225 307
617 3300026067 Ga0207678_10036470 Ga0207678_100364703 307
618 3300026067 Ga0207678_10045029 Ga0207678_100450293 307
619 3300026067 Ga0207678_10202413 Ga0207678_102024132 307
620 3300026075 Ga0207708_10425510 Ga0207708_104255101 307
621 3300026078 Ga0207702_10018890 Ga0207702_100188905 307
622 3300026088 Ga0207641_10308598 Ga0207641_103085982 307
623 3300026095 Ga0207676_10483566 Ga0207676_104835661 307
624 3300026118 Ga0207675_100098448 Ga0207675_1000984482 307
625 3300026142 Ga0207698_10550349 Ga0207698_105503491 307
626 3300027296 Ga0209389_1000033 Ga0209389_100003368 307
627 3300027296 Ga0209389_1000071 Ga0209389_100007162 307
628 3300027357 Ga0209589_1000040 Ga0209589_100004068 307
629 3300027361 Ga0209489_100045 Ga0209489_10004580 307
630 3300027361 Ga0209489_100209 Ga0209489_10020985 307
631 3300027363 Ga0209700_100011 Ga0209700_100011237 307
632 3300028379 Ga0268266_10001477 Ga0268266_1000147722 307
633 3300028379 Ga0268266_10149695 Ga0268266_101496953 307
634 3300028379 Ga0268266_10197554 Ga0268266_101975542 307
635 3300028379 Ga0268266_10641333 Ga0268266_106413331 307
636 3300028380 Ga0268265_10093120 Ga0268265_100931203 307
637 3300028381 Ga0268264_10000062 Ga0268264_1000006263 307
638 3300028563 Ga0265319_1071087 Ga0265319_10710871 307
639 3300028653 Ga0265323_10001474 Ga0265323_100014747 307
640 3300028666 Ga0265336_10001883 Ga0265336_100018833 307
641 3300028794 Ga0307515_10214312 Ga0307515_102143122 307
642 3300028800 Ga0265338_10000835 Ga0265338_1000083551 307
643 3300029957 Ga0265324_10010545 Ga0265324_100105454 307
644 3300030521 Ga0307511_10191602 Ga0307511_101916021 307
645 3300031507 Ga0307509_10006490 Ga0307509_100064906 307
646 3300031507 Ga0307509_10375798 Ga0307509_103757981 307
647 3300031616 Ga0307508_10251642 Ga0307508_102516422 307
648 3300031730 Ga0307516_10000908 Ga0307516_1000090817 307
649 3300031730 Ga0307516_10219498 Ga0307516_102194982 307
650 3300031901 Ga0307406_10336454 Ga0307406_103364541 307
651 3300031903 Ga0307407_10138964 Ga0307407_101389641 307
652 3300031911 Ga0307412_10021115 Ga0307412_100211153 307
653 3300033179 Ga0307507_10034714 Ga0307507_100347144 307
654 3300035695 Ga0373927_0121537 Ga0373927_0121537_180_1106 307
655 3300037418 Ga0395900_0002352 Ga0395900_0002352_8561_9484 307
656 3300037466 Ga0395898_0010389 Ga0395898_0010389_84_1007 307
657 3300037466 Ga0395898_0075904 Ga0395898_0075904_1033_2016 307
658 3300037466 Ga0395898_0404477 Ga0395898_0404477_19_942 307
659 3300039438 Ga0436360_0583126 Ga0436360_0583126_81_1004 307
660 3300039447 Ga0436361_0678323 Ga0436361_0678323_70_993 307
661 3300039453 Ga0436362_1007196 Ga0436362_1007196_70_993 307
662 3300041512 Ga0451853_3958553 Ga0451853_3958553_78_1001 307
663 3300044656 Ga0466969_0029204 Ga0466969_0029204_743_1666 307
664 3300044693 Ga0466961_0213502 Ga0466961_0213502_237_1160 307
665 3300044694 Ga0466963_0008648 Ga0466963_0008648_2659_3582 307
666 3300044765 Ga0466970_0149363 Ga0466970_0149363_210_1133 307
667 3300044842 Ga0466957_0028553 Ga0466957_0028553_2267_3190 307
668 3300045049 Ga0466959_0102710 Ga0466959_0102710_982_1911 307
669 3300045976 Ga0466967_0066439 Ga0466967_0066439_493_1416 307
670 3300046459 Ga0495629_0003567 Ga0495629_0003567_10568_11491 307
671 3300046460 Ga0495638_0040321 Ga0495638_0040321_1342_2265 307
672 3300046460 Ga0495638_0086117 Ga0495638_0086117_899_1822 307
673 3300046462 Ga0495651_0001605 Ga0495651_0001605_5919_6842 307
674 3300046462 Ga0495651_0141987 Ga0495651_0141987_66_989 307
675 3300046463 Ga0495653_0120956 Ga0495653_0120956_371_1294 307
676 3300046476 Ga0495662_0101352 Ga0495662_0101352_447_1370 307
677 3300046492 Ga0495585_0066329 Ga0495585_0066329_652_1575 307
678 3300046501 Ga0495607_0067061 Ga0495607_0067061_916_1839 307
679 3300046506 Ga0495583_0086397 Ga0495583_0086397_328_1251 307
680 3300046507 Ga0495606_0063702 Ga0495606_0063702_1060_1983 307
681 3300046507 Ga0495606_0102271 Ga0495606_0102271_735_1658 307
682 3300046511 Ga0495608_0054900 Ga0495608_0054900_153_1076 307
683 3300046512 Ga0495610_0060436 Ga0495610_0060436_767_1690 307
684 3300046515 Ga0495620_0011469 Ga0495620_0011469_570_1493 307
685 3300046517 Ga0495630_0294145 Ga0495630_0294145_270_1193 307
686 3300046518 Ga0495631_0086851 Ga0495631_0086851_231_1154 307
687 3300046523 Ga0495644_0039752 Ga0495644_0039752_349_1272 307
688 3300046524 Ga0495648_0019456 Ga0495648_0019456_3269_4192 307
689 3300046524 Ga0495648_0066548 Ga0495648_0066548_266_1189 307
690 3300046524 Ga0495648_0167840 Ga0495648_0167840_46_969 307
691 3300046529 Ga0495652_0079383 Ga0495652_0079383_1592_2515 307
692 3300046529 Ga0495652_0085255 Ga0495652_0085255_1486_2409 307
693 3300046530 Ga0495654_0102150 Ga0495654_0102150_142_1065 307
694 3300046533 Ga0495640_0019945 Ga0495640_0019945_717_1640 307
695 3300046533 Ga0495640_0052900 Ga0495640_0052900_663_1586 307
696 3300046536 Ga0495587_0129005 Ga0495587_0129005_214_1137 307
697 3300046539 Ga0495621_0029489 Ga0495621_0029489_825_1748 307
698 3300046557 Ga0495622_0030909 Ga0495622_0030909_1522_2445 307
699 3300046557 Ga0495622_0067816 Ga0495622_0067816_140_1066 307
700 3300046615 Ga0495656_0006632 Ga0495656_0006632_1673_2596 307
701 3300046642 Ga0495634_0098445 Ga0495634_0098445_433_1356 307
702 3300046648 Ga0495611_0021934 Ga0495611_0021934_1701_2624 307
703 3300046648 Ga0495611_0055256 Ga0495611_0055256_547_1470 307
704 3300046663 Ga0495635_0011766 Ga0495635_0011766_5062_5985 307
705 3300046664 Ga0495659_0022816 Ga0495659_0022816_478_1401 307
706 3300046665 Ga0495661_0016545 Ga0495661_0016545_3606_4529 307
707 3300046665 Ga0495661_0134725 Ga0495661_0134725_150_1073 307
708 3300046674 Ga0495588_0081173 Ga0495588_0081173_676_1599 307
709 3300046674 Ga0495588_0087797 Ga0495588_0087797_543_1466 307
710 3300046675 Ga0495657_0001337 Ga0495657_0001337_15747_16670 307
711 3300046675 Ga0495657_0059266 Ga0495657_0059266_159_1082 307
712 3300046680 Ga0495646_0018648 Ga0495646_0018648_173_1096 307
713 3300046680 Ga0495646_0072191 Ga0495646_0072191_772_1695 307
714 3300046684 Ga0495669_0073107 Ga0495669_0073107_441_1364 307
715 3300046689 Ga0495613_0129561 Ga0495613_0129561_220_1143 307
716 3300046690 Ga0495624_0008528 Ga0495624_0008528_1133_2056 307
717 3300046691 Ga0495670_0008620 Ga0495670_0008620_159_1082 307
718 3300046692 Ga0495671_0103922 Ga0495671_0103922_147_1070 307
719 3300046694 Ga0495649_0212826 Ga0495649_0212826_46_969 307
720 3300046809 Ga0495600_0003467 Ga0495600_0003467_1643_2566 307
721 3300046809 Ga0495600_0030191 Ga0495600_0030191_112_1035 307
722 3300046810 Ga0495660_0049244 Ga0495660_0049244_1035_1958 307
723 3300047317 Ga0495604_0003032 Ga0495604_0003032_1760_2683 307
724 3300047317 Ga0495604_0053163 Ga0495604_0053163_2115_3038 307
725 3300047317 Ga0495604_0132594 Ga0495604_0132594_475_1398 307
726 3300047318 Ga0495636_0022368 Ga0495636_0022368_484_1407 307
727 3300047319 Ga0495674_0024007 Ga0495674_0024007_318_1241 307
728 3300047321 Ga0495676_0017318 Ga0495676_0017318_1799_2722 307
729 3300047443 Ga0495687_106791 Ga0495687_106791_78_1001 307
730 3300047444 Ga0495675_0003289 Ga0495675_0003289_1217_2140 307
731 3300047444 Ga0495675_0152660 Ga0495675_0152660_241_1164 307
732 3300047445 Ga0495677_0055961 Ga0495677_0055961_468_1391 307
733 3300047472 Ga0495686_0023895 Ga0495686_0023895_1145_2068 307
734 3300047673 Ga0495593_0015175 Ga0495593_0015175_3167_4090 307
735 3300048088 Ga0495602_0003905 Ga0495602_0003905_8896_9819 307
736 3300048088 Ga0495602_0120534 Ga0495602_0120534_1167_2090 307
737 3300048089 Ga0495614_0084977 Ga0495614_0084977_38_961 307
738 3300048903 Ga0496100_0274670 Ga0496100_0274670_236_1159 307
739 3300048907 Ga0496104_0002854 Ga0496104_0002854_5551_6474 307
740 3300048908 Ga0496105_0005297 Ga0496105_0005297_233_1156 307
741 3300048908 Ga0496105_0259916 Ga0496105_0259916_103_1026 307
742 3300048909 Ga0496106_0002286 Ga0496106_0002286_5342_6268 307
743 3300048910 Ga0496107_0153321 Ga0496107_0153321_272_1195 307
744 3300048910 Ga0496107_0259414 Ga0496107_0259414_323_1246 307
745 3300048912 Ga0496109_0159446 Ga0496109_0159446_630_1553 307
746 3300048912 Ga0496109_0189817 Ga0496109_0189817_538_1461 307
747 3300048912 Ga0496109_0276535 Ga0496109_0276535_255_1178 307
748 3300048913 Ga0496110_0314907 Ga0496110_0314907_427_1350 307
749 3300048915 Ga0496112_0440910 Ga0496112_0440910_38_961 307
750 3300048917 Ga0496114_0386975 Ga0496114_0386975_90_1013 307
751 3300048917 Ga0496114_0550594 Ga0496114_0550594_82_1005 307
752 3300048918 Ga0496115_0032240 Ga0496115_0032240_2689_3612 307
753 3300048918 Ga0496115_0076677 Ga0496115_0076677_458_1381 307
754 3300048918 Ga0496115_0082090 Ga0496115_0082090_914_1837 307
755 3300048919 Ga0496116_0027414 Ga0496116_0027414_266_1189 307
756 3300048919 Ga0496116_0104457 Ga0496116_0104457_512_1435 307
757 3300048919 Ga0496116_0157545 Ga0496116_0157545_159_1085 307
758 3300048920 Ga0496117_0062558 Ga0496117_0062558_1420_2343 307
759 3300048920 Ga0496117_0114240 Ga0496117_0114240_570_1493 307
760 3300048920 Ga0496117_0124305 Ga0496117_0124305_632_1555 307
761 3300048920 Ga0496117_0126629 Ga0496117_0126629_499_1422 307
762 3300048921 Ga0496118_0007916 Ga0496118_0007916_9790_10716 307
763 3300048921 Ga0496118_0031566 Ga0496118_0031566_1315_2280 307
764 3300048921 Ga0496118_0076118 Ga0496118_0076118_926_1849 307
765 3300048921 Ga0496118_0085775 Ga0496118_0085775_555_1478 307
766 3300048922 Ga0496119_0110857 Ga0496119_0110857_526_1449 307
767 3300048922 Ga0496119_0136530 Ga0496119_0136530_327_1250 307
768 3300048923 Ga0496120_0005151 Ga0496120_0005151_1031_1996 307
769 3300048923 Ga0496120_0005624 Ga0496120_0005624_6819_7742 307
770 3300048923 Ga0496120_0051621 Ga0496120_0051621_143_1066 307
771 3300048924 Ga0496121_0000203 Ga0496121_0000203_85060_85986 307
772 3300048924 Ga0496121_0006789 Ga0496121_0006789_217_1140 307
773 3300048924 Ga0496121_0014289 Ga0496121_0014289_3697_4620 307
774 3300048924 Ga0496121_0117002 Ga0496121_0117002_308_1231 307
775 3300048925 Ga0496122_0073840 Ga0496122_0073840_903_1826 307
776 3300048926 Ga0496123_0032787 Ga0496123_0032787_292_1215 307
777 3300048927 Ga0496124_0001303 Ga0496124_0001303_28589_29515 307
778 3300048927 Ga0496124_0088308 Ga0496124_0088308_847_1770 307
779 3300048927 Ga0496124_0137642 Ga0496124_0137642_258_1181 307
780 3300048928 Ga0496125_0006319 Ga0496125_0006319_7609_8532 307
781 3300048928 Ga0496125_0051858 Ga0496125_0051858_2050_2973 307
782 3300048928 Ga0496125_0053477 Ga0496125_0053477_749_1675 307
783 3300048928 Ga0496125_0224489 Ga0496125_0224489_99_1022 307
784 3300048929 Ga0496126_0014074 Ga0496126_0014074_119_1042 307
785 3300048929 Ga0496126_0093470 Ga0496126_0093470_56_979 307
786 3300048929 Ga0496126_0244973 Ga0496126_0244973_86_1009 307
787 3300049460 Ga0495682_0092499 Ga0495682_0092499_142_1065 307
788 3300050489 nmdc:mga03683_74255_c1 nmdc:mga03683_74255_c1_77_1000 307
789 3300050490 nmdc:mga03n38_100_c1 nmdc:mga03n38_100_c1_9943_10866 307
790 3300050491 nmdc:mga00v17_51910_c1 nmdc:mga00v17_51910_c1_733_1656 307
791 3300050492 nmdc:mga0yw44_115815_c1 nmdc:mga0yw44_115815_c1_619_1542 307
792 3300050492 nmdc:mga0yw44_3943_c1 nmdc:mga0yw44_3943_c1_1947_2870 307
793 3300050492 nmdc:mga0yw44_64841_c1 nmdc:mga0yw44_64841_c1_902_1825 307
794 3300050496 nmdc:mga07m45_36666_c1 nmdc:mga07m45_36666_c1_1139_2062 307
795 3300050496 nmdc:mga07m45_8217_c1 nmdc:mga07m45_8217_c1_1447_2370 307
796 3300050514 nmdc:mga08x19_67744_c1 nmdc:mga08x19_67744_c1_209_1192 307
797 3300050516 nmdc:mga0sz30_55570_c1 nmdc:mga0sz30_55570_c1_174_1097 307
798 3300053080 Ga0500635_0008265 Ga0500635_0008265_1119_2045 307
799 3300053080 Ga0500635_0020430 Ga0500635_0020430_689_1612 307
800 3300053085 Ga0495619_0174066 Ga0495619_0174066_436_1359 307
801 3300053086 Ga0500578_0037049 Ga0500578_0037049_1040_1963 307
802 3300053087 Ga0500643_000063 Ga0500643_000063_96728_97651 307
803 3300053089 Ga0500581_030352 Ga0500581_030352_275_1198 307
804 3300053093 Ga0500651_0028247 Ga0500651_0028247_1189_2112 307
805 3300053094 Ga0500566_0000252 Ga0500566_0000252_11891_12814 307
806 3300053094 Ga0500566_0000871 Ga0500566_0000871_1833_2756 307
807 3300053096 Ga0500641_0030013 Ga0500641_0030013_1113_2036 307
808 3300053097 Ga0500648_070204 Ga0500648_070204_930_1856 307
809 3300053098 Ga0500650_0044914 Ga0500650_0044914_369_1292 307
810 3300053103 Ga0500555_006776 Ga0500555_006776_152_1075 307
811 3300053104 Ga0500556_0000006 Ga0500556_0000006_304859_305782 307
812 3300053105 Ga0500557_000037 Ga0500557_000037_4160_5083 307
813 3300053116 Ga0500592_002807 Ga0500592_002807_1337_2260 307
814 3300053125 Ga0500618_019156 Ga0500618_019156_751_1674 307
815 3300053130 Ga0500642_0000004 Ga0500642_0000004_181237_182160 307
816 3300053130 Ga0500642_0000153 Ga0500642_0000153_27672_28595 307
817 3300053130 Ga0500642_0000465 Ga0500642_0000465_11742_12665 307
818 3300053131 Ga0500652_000340 Ga0500652_000340_14351_15274 307
819 3300053136 Ga0500559_0006889 Ga0500559_0006889_4049_4975 307
820 3300053136 Ga0500559_0007889 Ga0500559_0007889_637_1560 307
821 3300053136 Ga0500559_0012098 Ga0500559_0012098_2534_3457 307
822 3300053139 Ga0500568_0022832 Ga0500568_0022832_945_1868 307
823 3300053140 Ga0500573_0023834 Ga0500573_0023834_168_1094 307
824 3300053145 Ga0500586_038491 Ga0500586_038491_425_1348 307
825 3300053148 Ga0500590_058534 Ga0500590_058534_698_1621 307
826 3300053148 Ga0500590_072275 Ga0500590_072275_768_1694 307
827 3300053151 Ga0500604_0009376 Ga0500604_0009376_1313_2236 307
828 3300053153 Ga0500616_0000022 Ga0500616_0000022_299360_300283 307
829 3300053154 Ga0500619_057226 Ga0500619_057226_194_1117 307
830 3300053155 Ga0500620_003346 Ga0500620_003346_1924_2847 307
831 3300053156 Ga0500622_0000837 Ga0500622_0000837_7072_7995 307
832 3300053163 Ga0500639_143672 Ga0500639_143672_71_997 307
833 3300053177 Ga0500636_0000197 Ga0500636_0000197_7376_8299 307
834 3300053177 Ga0500636_0005335 Ga0500636_0005335_2126_3049 307
835 3300053177 Ga0500636_0201033 Ga0500636_0201033_58_984 307
836 3300053727 Ga0500611_025274 Ga0500611_025274_84_1007 307
837 3300053729 Ga0500625_042885 Ga0500625_042885_771_1694 307
838 3300053731 Ga0500609_008074 Ga0500609_008074_214_1137 307
839 3300053737 Ga0500601_000733 Ga0500601_000733_2613_3536 307
840 3300055283 Ga0500661_014906 Ga0500661_014906_143_1066 307
841 3300061734 Ga0530510_0206776 Ga0530510_0206776_40_963 307
842 iso_pu_bacteria 8016522445 8016526187 307
843 iso_pu_bacteria 8016548790 8016549203 307
844 iso_pu_bacteria 8016557553 8016557628 307
845 iso_pu_bacteria 8016575299 8016582122 307
846 iso_pu_bacteria 8016595262 8016595664 307
847 iso_pu_bacteria 8056967851 8056971330 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

3

153

0.97

PF08546

ApbA_C

Ketopantoate reductase PanE/ApbA C terminal

178

302

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hwr-assembly1.cif.gz_B crystal structure of pane/apba family ketopantoate reductase (yp_299159.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9181 1 307
3hwr-assembly1.cif.gz_B crystal structure of pane/apba family ketopantoate reductase (yp_299159.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9152 1 307
3hn2-assembly2.cif.gz_D crystal structure of 2-dehydropantoate 2-reductase from geobacter metallireducens gs-15 0.9033 1 300
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.9002 1 307
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.8993 1 303
ID Description Score Start End Superfamily
5hwsD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.921 1 176 3.40.50.720
3hn2C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.92 1 176 3.40.50.720
5hwsD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9109 1 176 3.40.50.720
3hn2C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9101 1 176 3.40.50.720
af_Q54HR9_1_452_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8995 3 29 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7Y6SSN2-F1-model_v4 deleted 0.9897 1 307
AF-A0A370WSS6-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9871 1 307 GO:0005737
GO:0008677
GO:0015940
AF-A0A7Y6SSN2-F1-model_v4 deleted 0.9865 1 307
AF-Q02B99-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9819 1 306 GO:0005737
GO:0008677
GO:0015940
AF-A0A363THC6-F1-model_v4 Ketopantoate reductase C-terminal domain-containing protein 0.9815 122 306 GO:0005737

Feature Viewer

pLDDT pTM Quality
95.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map