F483343
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 847 | 457 | 775 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_65424_c1|nmdc:mga0n895_65424_c1_760_1908 |
| Length | 382 |
| Sequence | MGRTGTLRVGGARGVQAAAITRGPAAGAKRQARVGHRRTISNQEEVASGRLENAMKTVKAAAVQISPVLYSREGTVDKVVRQIKDLGRQGVQFATFPETVVPYYPYFSFVQSAYQIIAGREHLKLLDQAVAVPSPTTMAISEACKEAGVVVSIGVNERDGGTLYNAQLLFDADGTLIQRRRKIMPTYHERMVWGLGDGSGLCAVDSKAGRIGQLACWEHYNPLARYAMMADGEQIHSAMYPGSIFGNLFAEQTEVNIRQHALESACFVVCATAWLDADQQAQIVKDTGGSIGAISGGCFTTIAAPDGTLLGEPVRSSEGVVIADLDFTLIDKRKQLMDSRGHYSRPELLSLLIDRTPAAPVHERQNQRVAQEGSEELLSTTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 5 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 6 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 7 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 8 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 9 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 10 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 11 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 12 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 13 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 14 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 15 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 16 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 17 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 22 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 23 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 24 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 25 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 26 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 27 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 28 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 29 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 30 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 31 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 32 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 33 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 34 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 35 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 36 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 37 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 38 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 39 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 40 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 41 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 42 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 43 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 44 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 45 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 46 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 47 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 48 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 49 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 50 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 51 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 52 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 53 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 54 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 55 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 56 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 57 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 58 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 59 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 60 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 61 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 62 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 63 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 64 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 65 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 66 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 69 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 74 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 79 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 107 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 115 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 125 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 126 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 127 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 129 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 130 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 131 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 132 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 133 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 134 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 135 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 136 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 137 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 138 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 139 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 140 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 141 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 142 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 143 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 144 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 145 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 146 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 147 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 149 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 150 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 151 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 152 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 153 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 154 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 171 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 184 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 189 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 259 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 268 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 276 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 277 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 278 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 279 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 280 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 281 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 282 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 283 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 284 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 285 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 288 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 289 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 290 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 291 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 292 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 293 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 294 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 295 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 296 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 297 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 298 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 299 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 394 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 395 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 396 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 397 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 398 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 399 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 400 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 401 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 402 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 403 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 404 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 405 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 406 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 409 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 410 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 411 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 414 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 415 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 417 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 435 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 437 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 438 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 439 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 440 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 441 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 442 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 443 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 444 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 445 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 446 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 447 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 448 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 449 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 450 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 451 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 452 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 453 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 454 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 455 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 456 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 457 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.5 |
| Metatranscriptomes | 0 |
| Isolates | 8.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 6.26 |
| Nodule | 3.9 |
| Rhizoplane | 4.13 |
| Rhizosphere | 78.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_5159 | 2124908027 | Bacteria | 5101 |
| 2 | JGI24740J21852_10030275 | 3300001979 | Bacteria | 1765 |
| 3 | JGI24739J22299_10000469 | 3300001989 | Bacteria | 14200 |
| 4 | JGI24735J21928_10017968 | 3300002067 | Bacteria | 2185 |
| 5 | JGI24738J21930_10002384 | 3300002075 | Bacteria | 4941 |
| 6 | JGI25156J39149_1000269 | 3300002705 | Bacteria | 35211 |
| 7 | JGI25165J46597_1000606 | 3300003214 | Bacteria | 30552 |
| 8 | rootL2_10054155 | 3300003322 | Bacteria | 4571 |
| 9 | rootH1_10022382 | 3300003323 | Bacteria | 49541 |
| 10 | Ga0055533_1000140 | 3300003756 | Bacteria | 76502 |
| 11 | Ga0055532_1000003 | 3300003758 | Bacteria | 494004 |
| 12 | Ga0055527_1000006 | 3300003760 | Bacteria | 494004 |
| 13 | Ga0055535_1000003 | 3300003761 | Bacteria | 494004 |
| 14 | Ga0055542_1000007 | 3300003762 | Bacteria | 494004 |
| 15 | Ga0055529_1000003 | 3300003763 | Bacteria | 494004 |
| 16 | Ga0065714_10000224 | 3300005288 | Bacteria | 7203 |
| 17 | Ga0065714_10007661 | 3300005288 | Bacteria | 3157 |
| 18 | Ga0065714_10076134 | 3300005288 | Bacteria | 2825 |
| 19 | Ga0065714_10128234 | 3300005288 | Bacteria | 1275 |
| 20 | Ga0065712_10020220 | 3300005290 | Bacteria | 1232 |
| 21 | Ga0065712_10069381 | 3300005290 | Bacteria | 7407 |
| 22 | Ga0065712_10071037 | 3300005290 | Bacteria | 5528 |
| 23 | Ga0065715_10038261 | 3300005293 | Bacteria | 1630 |
| 24 | Ga0065715_10089898 | 3300005293 | Bacteria | 8174 |
| 25 | Ga0065715_10110552 | 3300005293 | Bacteria | 2615 |
| 26 | Ga0065715_10136864 | 3300005293 | Bacteria | 1894 |
| 27 | Ga0065715_10249136 | 3300005293 | Bacteria | 1173 |
| 28 | Ga0070658_10038553 | 3300005327 | Bacteria | 3853 |
| 29 | Ga0070658_10088993 | 3300005327 | Bacteria | 2542 |
| 30 | Ga0070676_10011830 | 3300005328 | Bacteria | 4751 |
| 31 | Ga0070683_100009446 | 3300005329 | Bacteria | 8341 |
| 32 | Ga0070683_100224798 | 3300005329 | Unclassified | 1784 |
| 33 | Ga0070690_100022389 | 3300005330 | Bacteria | 3866 |
| 34 | Ga0070670_100007156 | 3300005331 | Bacteria | 9450 |
| 35 | Ga0070670_100140997 | 3300005331 | Bacteria | 2084 |
| 36 | Ga0068869_100025692 | 3300005334 | Bacteria | 4092 |
| 37 | Ga0070680_100018122 | 3300005336 | Bacteria | 5562 |
| 38 | Ga0070682_100002341 | 3300005337 | Bacteria | 10489 |
| 39 | Ga0068868_100035497 | 3300005338 | Bacteria | 3854 |
| 40 | Ga0068868_100191086 | 3300005338 | Bacteria | 1703 |
| 41 | Ga0068868_100230102 | 3300005338 | Bacteria | 1555 |
| 42 | Ga0070660_100096678 | 3300005339 | Unclassified | 2336 |
| 43 | Ga0070660_100111098 | 3300005339 | Bacteria | 2180 |
| 44 | Ga0070660_100128322 | 3300005339 | Unclassified | 2028 |
| 45 | Ga0070689_100000031 | 3300005340 | Bacteria | 93387 |
| 46 | Ga0070689_100230745 | 3300005340 | Unclassified | 1521 |
| 47 | Ga0070687_100001327 | 3300005343 | Bacteria | 8647 |
| 48 | Ga0070661_100004754 | 3300005344 | Bacteria | 9346 |
| 49 | Ga0070661_100149648 | 3300005344 | Bacteria | 1764 |
| 50 | Ga0070669_100003066 | 3300005353 | Bacteria | 12016 |
| 51 | Ga0070675_100003303 | 3300005354 | Bacteria | 12231 |
| 52 | Ga0070675_100017418 | 3300005354 | Bacteria | 5709 |
| 53 | Ga0070671_100043540 | 3300005355 | Bacteria | 3730 |
| 54 | Ga0070671_100100895 | 3300005355 | Bacteria | 2421 |
| 55 | Ga0070671_100106082 | 3300005355 | Bacteria | 2358 |
| 56 | Ga0070674_100072799 | 3300005356 | Bacteria | 2435 |
| 57 | Ga0070673_100008156 | 3300005364 | Bacteria | 6950 |
| 58 | Ga0070673_100074823 | 3300005364 | Bacteria | 2730 |
| 59 | Ga0070688_100000612 | 3300005365 | Bacteria | 17859 |
| 60 | Ga0070688_100006974 | 3300005365 | Bacteria | 6071 |
| 61 | Ga0070688_100011783 | 3300005365 | Bacteria | 4874 |
| 62 | Ga0070659_100020994 | 3300005366 | Bacteria | 4967 |
| 63 | Ga0070659_100060442 | 3300005366 | Unclassified | 2993 |
| 64 | Ga0070709_10122260 | 3300005434 | Bacteria | 1766 |
| 65 | Ga0070713_100060462 | 3300005436 | Bacteria | 3167 |
| 66 | Ga0070701_10000522 | 3300005438 | Bacteria | 13248 |
| 67 | Ga0070705_100012955 | 3300005440 | Bacteria | 4253 |
| 68 | Ga0070705_100013917 | 3300005440 | Bacteria | 4126 |
| 69 | Ga0070705_100117135 | 3300005440 | Unclassified | 1713 |
| 70 | Ga0070705_100159061 | 3300005440 | Bacteria | 1508 |
| 71 | Ga0070700_100000180 | 3300005441 | Bacteria | 35814 |
| 72 | Ga0070694_100011224 | 3300005444 | Bacteria | 5546 |
| 73 | Ga0070708_100164839 | 3300005445 | Bacteria | 2067 |
| 74 | Ga0070663_100002053 | 3300005455 | Bacteria | 11243 |
| 75 | Ga0070663_100003821 | 3300005455 | Bacteria | 8765 |
| 76 | Ga0070663_100060072 | 3300005455 | Bacteria | 2733 |
| 77 | Ga0070678_100007814 | 3300005456 | Bacteria | 6363 |
| 78 | Ga0070678_100026029 | 3300005456 | Bacteria | 3948 |
| 79 | Ga0070678_100473812 | 3300005456 | Bacteria | 1100 |
| 80 | Ga0070662_100006743 | 3300005457 | Bacteria | 7423 |
| 81 | Ga0070662_100121036 | 3300005457 | Bacteria | 2006 |
| 82 | Ga0070681_10004260 | 3300005458 | Bacteria | 13564 |
| 83 | Ga0070681_10018802 | 3300005458 | Bacteria | 6914 |
| 84 | Ga0070681_10071858 | 3300005458 | Bacteria | 3425 |
| 85 | Ga0070681_10085310 | 3300005458 | Bacteria | 3111 |
| 86 | Ga0070681_10292041 | 3300005458 | Bacteria | 1540 |
| 87 | Ga0068867_100001414 | 3300005459 | Bacteria | 16594 |
| 88 | Ga0068867_100059282 | 3300005459 | Bacteria | 2838 |
| 89 | Ga0068867_100059301 | 3300005459 | Bacteria | 2837 |
| 90 | Ga0068867_100118756 | 3300005459 | Bacteria | 2041 |
| 91 | Ga0070685_10001089 | 3300005466 | Bacteria | 14533 |
| 92 | Ga0070685_10099741 | 3300005466 | Bacteria | 1772 |
| 93 | Ga0070706_100211199 | 3300005467 | Bacteria | 1812 |
| 94 | Ga0070707_100031250 | 3300005468 | Bacteria | 5071 |
| 95 | Ga0070707_100116735 | 3300005468 | Bacteria | 2590 |
| 96 | Ga0070698_100149071 | 3300005471 | Bacteria | 2287 |
| 97 | Ga0070679_100032902 | 3300005530 | Bacteria | 5131 |
| 98 | Ga0070679_100045513 | 3300005530 | Bacteria | 4373 |
| 99 | Ga0070679_100346592 | 3300005530 | Unclassified | 1433 |
| 100 | Ga0070684_100005692 | 3300005535 | Bacteria | 9570 |
| 101 | Ga0070684_100226623 | 3300005535 | Unclassified | 1706 |
| 102 | Ga0070684_100344398 | 3300005535 | Bacteria | 1370 |
| 103 | Ga0070684_100443721 | 3300005535 | Bacteria | 1199 |
| 104 | Ga0070697_100009345 | 3300005536 | Bacteria | 7662 |
| 105 | Ga0068853_100004494 | 3300005539 | Bacteria | 10816 |
| 106 | Ga0070672_100002263 | 3300005543 | Bacteria | 12146 |
| 107 | Ga0070686_100000517 | 3300005544 | Bacteria | 23112 |
| 108 | Ga0070686_100073039 | 3300005544 | Bacteria | 2251 |
| 109 | Ga0070686_100138768 | 3300005544 | Unclassified | 1690 |
| 110 | Ga0070695_100056594 | 3300005545 | Bacteria | 2531 |
| 111 | Ga0070696_100039656 | 3300005546 | Bacteria | 3252 |
| 112 | Ga0070696_100088416 | 3300005546 | Bacteria | 2202 |
| 113 | Ga0070693_100036990 | 3300005547 | Bacteria | 2719 |
| 114 | Ga0070665_100001922 | 3300005548 | Bacteria | 23458 |
| 115 | Ga0070704_100021775 | 3300005549 | Bacteria | 4161 |
| 116 | Ga0068855_100032462 | 3300005563 | Bacteria | 6234 |
| 117 | Ga0068855_100059748 | 3300005563 | Bacteria | 4460 |
| 118 | Ga0070664_100343512 | 3300005564 | Bacteria | 1356 |
| 119 | Ga0068857_100001455 | 3300005577 | Bacteria | 18803 |
| 120 | Ga0068857_100010201 | 3300005577 | Bacteria | 8167 |
| 121 | Ga0068857_100013777 | 3300005577 | Bacteria | 7045 |
| 122 | Ga0068854_100100541 | 3300005578 | Bacteria | 2167 |
| 123 | Ga0068856_100051411 | 3300005614 | Bacteria | 4063 |
| 124 | Ga0070702_100016681 | 3300005615 | Bacteria | 3773 |
| 125 | Ga0070702_100096420 | 3300005615 | Bacteria | 1805 |
| 126 | Ga0070702_100176577 | 3300005615 | Unclassified | 1394 |
| 127 | Ga0068852_100000608 | 3300005616 | Bacteria | 23481 |
| 128 | Ga0068859_100027750 | 3300005617 | Bacteria | 5678 |
| 129 | Ga0068859_100318326 | 3300005617 | Bacteria | 1650 |
| 130 | Ga0068859_100549551 | 3300005617 | Bacteria | 1249 |
| 131 | Ga0068864_100104881 | 3300005618 | Bacteria | 2512 |
| 132 | Ga0068864_100105488 | 3300005618 | Bacteria | 2505 |
| 133 | Ga0068864_100110347 | 3300005618 | Bacteria | 2449 |
| 134 | Ga0068864_100111947 | 3300005618 | Unclassified | 2432 |
| 135 | Ga0068864_100293734 | 3300005618 | Unclassified | 1520 |
| 136 | Ga0068866_10024206 | 3300005718 | Bacteria | 2835 |
| 137 | Ga0068866_10026751 | 3300005718 | Bacteria | 2729 |
| 138 | Ga0068861_100304508 | 3300005719 | Bacteria | 1382 |
| 139 | Ga0068851_10002037 | 3300005834 | Bacteria | 8920 |
| 140 | Ga0068870_10011138 | 3300005840 | Bacteria | 4157 |
| 141 | Ga0068863_100003501 | 3300005841 | Bacteria | 15490 |
| 142 | Ga0068863_100046411 | 3300005841 | Bacteria | 4123 |
| 143 | Ga0068863_100336118 | 3300005841 | Bacteria | 1469 |
| 144 | Ga0068858_100035748 | 3300005842 | Bacteria | 4606 |
| 145 | Ga0068858_100054556 | 3300005842 | Bacteria | 3695 |
| 146 | Ga0068858_100141536 | 3300005842 | Bacteria | 2258 |
| 147 | Ga0068860_100019448 | 3300005843 | Bacteria | 6585 |
| 148 | Ga0068860_100070188 | 3300005843 | Bacteria | 3331 |
| 149 | Ga0068860_100111365 | 3300005843 | Bacteria | 2617 |
| 150 | Ga0068862_100018369 | 3300005844 | Bacteria | 5822 |
| 151 | Ga0068862_100046428 | 3300005844 | Bacteria | 3706 |
| 152 | Ga0068862_100218232 | 3300005844 | Unclassified | 1726 |
| 153 | Ga0068862_100378950 | 3300005844 | Bacteria | 1319 |
| 154 | Ga0068862_100411672 | 3300005844 | Bacteria | 1267 |
| 155 | Ga0068862_100440717 | 3300005844 | Bacteria | 1226 |
| 156 | Ga0081540_1000537 | 3300005983 | Bacteria | 36699 |
| 157 | Ga0081540_1000611 | 3300005983 | Bacteria | 34020 |
| 158 | Ga0075365_10042160 | 3300006038 | Bacteria | 2983 |
| 159 | Ga0075365_10308341 | 3300006038 | Bacteria | 1114 |
| 160 | Ga0075363_100026247 | 3300006048 | Bacteria | 2978 |
| 161 | Ga0075364_10004579 | 3300006051 | Bacteria | 7962 |
| 162 | Ga0075364_10079667 | 3300006051 | Bacteria | 2164 |
| 163 | Ga0075364_10084692 | 3300006051 | Bacteria | 2099 |
| 164 | Ga0075364_10130304 | 3300006051 | Bacteria | 1687 |
| 165 | Ga0075432_10063094 | 3300006058 | Bacteria | 1322 |
| 166 | Ga0075362_10037629 | 3300006177 | Bacteria | 2122 |
| 167 | Ga0075367_10005759 | 3300006178 | Bacteria | 6195 |
| 168 | Ga0075367_10006892 | 3300006178 | Bacteria | 5785 |
| 169 | Ga0075367_10058144 | 3300006178 | Bacteria | 2300 |
| 170 | Ga0075367_10120039 | 3300006178 | Bacteria | 1619 |
| 171 | Ga0075366_10067532 | 3300006195 | Bacteria | 2128 |
| 172 | Ga0075366_10134883 | 3300006195 | Bacteria | 1490 |
| 173 | Ga0097621_100108811 | 3300006237 | Bacteria | 2340 |
| 174 | Ga0097621_100170431 | 3300006237 | Bacteria | 1876 |
| 175 | Ga0075370_10012587 | 3300006353 | Bacteria | 4477 |
| 176 | Ga0075370_10043709 | 3300006353 | Bacteria | 2532 |
| 177 | Ga0075428_100258204 | 3300006844 | Bacteria | 1877 |
| 178 | Ga0075430_100000150 | 3300006846 | Bacteria | 44915 |
| 179 | Ga0075431_100000478 | 3300006847 | Bacteria | 33199 |
| 180 | Ga0075433_10037910 | 3300006852 | Bacteria | 4160 |
| 181 | Ga0075433_10089694 | 3300006852 | Bacteria | 2717 |
| 182 | Ga0068865_100006599 | 3300006881 | Bacteria | 7095 |
| 183 | Ga0068865_100089721 | 3300006881 | Bacteria | 2227 |
| 184 | Ga0068865_100129270 | 3300006881 | Bacteria | 1890 |
| 185 | Ga0097620_100027750 | 3300006931 | Bacteria | 5678 |
| 186 | Ga0097620_100318341 | 3300006931 | Bacteria | 1650 |
| 187 | Ga0097620_100549554 | 3300006931 | Bacteria | 1249 |
| 188 | Ga0075435_100001379 | 3300007076 | Bacteria | 15691 |
| 189 | Ga0105251_10002329 | 3300009011 | Bacteria | 15027 |
| 190 | Ga0105244_10020167 | 3300009036 | Bacteria | 3706 |
| 191 | Ga0105244_10029726 | 3300009036 | Bacteria | 2915 |
| 192 | Ga0105250_10000426 | 3300009092 | Bacteria | 30810 |
| 193 | Ga0105240_10009514 | 3300009093 | Bacteria | 13757 |
| 194 | Ga0105245_10023853 | 3300009098 | Bacteria | 5370 |
| 195 | Ga0105247_10005335 | 3300009101 | Bacteria | 8102 |
| 196 | Ga0105247_10008256 | 3300009101 | Bacteria | 6354 |
| 197 | Ga0114129_10396739 | 3300009147 | Bacteria | 1819 |
| 198 | Ga0114129_10492827 | 3300009147 | Bacteria | 1601 |
| 199 | Ga0105243_10000027 | 3300009148 | Bacteria | 191224 |
| 200 | Ga0105241_10002471 | 3300009174 | Bacteria | 13899 |
| 201 | Ga0105241_10007576 | 3300009174 | Bacteria | 7980 |
| 202 | Ga0105241_10072609 | 3300009174 | Bacteria | 2675 |
| 203 | Ga0105242_10000056 | 3300009176 | Bacteria | 76052 |
| 204 | Ga0105242_10089593 | 3300009176 | Bacteria | 2586 |
| 205 | Ga0105248_10001714 | 3300009177 | Bacteria | 24367 |
| 206 | Ga0105248_10003555 | 3300009177 | Bacteria | 17280 |
| 207 | Ga0105248_10076392 | 3300009177 | Bacteria | 3765 |
| 208 | Ga0105248_10098363 | 3300009177 | Bacteria | 3296 |
| 209 | Ga0105248_10115639 | 3300009177 | Bacteria | 3025 |
| 210 | Ga0105248_10217303 | 3300009177 | Bacteria | 2153 |
| 211 | Ga0105248_10523791 | 3300009177 | Bacteria | 1337 |
| 212 | Ga0105237_10388639 | 3300009545 | Bacteria | 1400 |
| 213 | Ga0105237_10418830 | 3300009545 | Bacteria | 1345 |
| 214 | Ga0105238_10016084 | 3300009551 | Bacteria | 7566 |
| 215 | Ga0105238_10094665 | 3300009551 | Bacteria | 2974 |
| 216 | Ga0105238_10199530 | 3300009551 | Bacteria | 1976 |
| 217 | Ga0105249_10702794 | 3300009553 | Bacteria | 1071 |
| 218 | Ga0099796_10027736 | 3300010159 | Bacteria | 1811 |
| 219 | Ga0105239_10060831 | 3300010375 | Unclassified | 4145 |
| 220 | Ga0105239_10141603 | 3300010375 | Bacteria | 2680 |
| 221 | Ga0105239_10155010 | 3300010375 | Bacteria | 2558 |
| 222 | Ga0105246_10001423 | 3300011119 | Bacteria | 14183 |
| 223 | Ga0105246_10033410 | 3300011119 | Bacteria | 3419 |
| 224 | Ga0157373_10003842 | 3300013100 | Bacteria | 11354 |
| 225 | Ga0157373_10005649 | 3300013100 | Bacteria | 9372 |
| 226 | Ga0157373_10093534 | 3300013100 | Bacteria | 2117 |
| 227 | Ga0157373_10106174 | 3300013100 | Bacteria | 1975 |
| 228 | Ga0157371_10000500 | 3300013102 | Bacteria | 47414 |
| 229 | Ga0157371_10013270 | 3300013102 | Bacteria | 6268 |
| 230 | Ga0157370_10000003 | 3300013104 | Bacteria | 367417 |
| 231 | Ga0157370_10007047 | 3300013104 | Bacteria | 12271 |
| 232 | Ga0157370_10076008 | 3300013104 | Bacteria | 3165 |
| 233 | Ga0157369_10000377 | 3300013105 | Bacteria | 59193 |
| 234 | Ga0157374_10007769 | 3300013296 | Bacteria | 9154 |
| 235 | Ga0157374_10024813 | 3300013296 | Bacteria | 5377 |
| 236 | Ga0157374_10065223 | 3300013296 | Bacteria | 3419 |
| 237 | Ga0157374_10295845 | 3300013296 | Bacteria | 1601 |
| 238 | Ga0163162_10213326 | 3300013306 | Unclassified | 2060 |
| 239 | Ga0163162_10217608 | 3300013306 | Bacteria | 2040 |
| 240 | Ga0163162_10384173 | 3300013306 | Bacteria | 1537 |
| 241 | Ga0157372_10018203 | 3300013307 | Bacteria | 7552 |
| 242 | Ga0157372_10046450 | 3300013307 | Plasmid | 4821 |
| 243 | Ga0157372_10063606 | 3300013307 | Bacteria | 4138 |
| 244 | Ga0157372_10266096 | 3300013307 | Bacteria | 1991 |
| 245 | Ga0157375_10020435 | 3300013308 | Bacteria | 6049 |
| 246 | Ga0157375_10027192 | 3300013308 | Bacteria | 5344 |
| 247 | Ga0157375_10152127 | 3300013308 | Bacteria | 2450 |
| 248 | Ga0157375_10208923 | 3300013308 | Bacteria | 2109 |
| 249 | Ga0157375_10291332 | 3300013308 | Bacteria | 1795 |
| 250 | Ga0157375_10640312 | 3300013308 | Bacteria | 1220 |
| 251 | Ga0163163_10001651 | 3300014325 | Bacteria | 18781 |
| 252 | Ga0163163_10022523 | 3300014325 | Bacteria | 5967 |
| 253 | Ga0163163_10083413 | 3300014325 | Unclassified | 3201 |
| 254 | Ga0157380_10010043 | 3300014326 | Bacteria | 6794 |
| 255 | Ga0157380_10072364 | 3300014326 | Bacteria | 2792 |
| 256 | Ga0182008_10005197 | 3300014497 | Bacteria | 7464 |
| 257 | Ga0157377_10004857 | 3300014745 | Bacteria | 6249 |
| 258 | Ga0157379_10047635 | 3300014968 | Bacteria | 3824 |
| 259 | Ga0157379_10179165 | 3300014968 | Bacteria | 1914 |
| 260 | Ga0157376_10040609 | 3300014969 | Bacteria | 3803 |
| 261 | Ga0157376_10051207 | 3300014969 | Bacteria | 3430 |
| 262 | Ga0163161_10002355 | 3300017792 | Bacteria | 13542 |
| 263 | Ga0163161_10008691 | 3300017792 | Bacteria | 7024 |
| 264 | Ga0163161_10008695 | 3300017792 | Bacteria | 7022 |
| 265 | Ga0163161_10055756 | 3300017792 | Bacteria | 2869 |
| 266 | Ga0163161_10177205 | 3300017792 | Bacteria | 1633 |
| 267 | Ga0213872_10000280 | 3300021361 | Bacteria | 43485 |
| 268 | Ga0213872_10007442 | 3300021361 | Bacteria | 5389 |
| 269 | Ga0209674_100025 | 3300025226 | Bacteria | 515942 |
| 270 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 271 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 272 | Ga0209563_101861 | 3300025230 | Bacteria | 5143 |
| 273 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 274 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 275 | Ga0209759_1000014 | 3300025256 | Bacteria | 396291 |
| 276 | Ga0209759_1022745 | 3300025256 | Bacteria | 1395 |
| 277 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 278 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 279 | Ga0209676_1001951 | 3300025292 | Bacteria | 16588 |
| 280 | Ga0209050_1001399 | 3300025298 | Bacteria | 26176 |
| 281 | Ga0209051_1005551 | 3300025303 | Bacteria | 7337 |
| 282 | Ga0207696_1000266 | 3300025711 | Bacteria | 65599 |
| 283 | Ga0207655_1012147 | 3300025728 | Bacteria | 5060 |
| 284 | Ga0207655_1018366 | 3300025728 | Bacteria | 3713 |
| 285 | Ga0207655_1040805 | 3300025728 | Bacteria | 1997 |
| 286 | Ga0207713_1009943 | 3300025735 | Bacteria | 5315 |
| 287 | Ga0207713_1019882 | 3300025735 | Bacteria | 3271 |
| 288 | Ga0207713_1032504 | 3300025735 | Bacteria | 2290 |
| 289 | Ga0207653_10001217 | 3300025885 | Bacteria | 8419 |
| 290 | Ga0207710_10028258 | 3300025900 | Bacteria | 2434 |
| 291 | Ga0207710_10076165 | 3300025900 | Bacteria | 1548 |
| 292 | Ga0207688_10060540 | 3300025901 | Bacteria | 2133 |
| 293 | Ga0207647_10020614 | 3300025904 | Bacteria | 4417 |
| 294 | Ga0207647_10025026 | 3300025904 | Bacteria | 3930 |
| 295 | Ga0207647_10026914 | 3300025904 | Bacteria | 3756 |
| 296 | Ga0207647_10072785 | 3300025904 | Bacteria | 2072 |
| 297 | Ga0207699_10105778 | 3300025906 | Bacteria | 1795 |
| 298 | Ga0207645_10001972 | 3300025907 | Bacteria | 16496 |
| 299 | Ga0207643_10000620 | 3300025908 | Bacteria | 22418 |
| 300 | Ga0207705_10012636 | 3300025909 | Bacteria | 6093 |
| 301 | Ga0207654_10021980 | 3300025911 | Bacteria | 3398 |
| 302 | Ga0207654_10053330 | 3300025911 | Bacteria | 2334 |
| 303 | Ga0207707_10049058 | 3300025912 | Unclassified | 3678 |
| 304 | Ga0207707_10074197 | 3300025912 | Bacteria | 2967 |
| 305 | Ga0207707_10239773 | 3300025912 | Bacteria | 1577 |
| 306 | Ga0207707_10309943 | 3300025912 | Bacteria | 1364 |
| 307 | Ga0207695_10000316 | 3300025913 | Bacteria | 116327 |
| 308 | Ga0207695_10019383 | 3300025913 | Bacteria | 7834 |
| 309 | Ga0207671_10259237 | 3300025914 | Bacteria | 1368 |
| 310 | Ga0207663_10010388 | 3300025916 | Bacteria | 4955 |
| 311 | Ga0207662_10000359 | 3300025918 | Bacteria | 20504 |
| 312 | Ga0207662_10020839 | 3300025918 | Bacteria | 3742 |
| 313 | Ga0207657_10027304 | 3300025919 | Bacteria | 5229 |
| 314 | Ga0207657_10064227 | 3300025919 | Bacteria | 3134 |
| 315 | Ga0207649_10000963 | 3300025920 | Bacteria | 17866 |
| 316 | Ga0207652_10020364 | 3300025921 | Bacteria | 5462 |
| 317 | Ga0207652_10278888 | 3300025921 | Bacteria | 1508 |
| 318 | Ga0207652_10466627 | 3300025921 | Bacteria | 1138 |
| 319 | Ga0207681_10006066 | 3300025923 | Bacteria | 7410 |
| 320 | Ga0207694_10238428 | 3300025924 | Bacteria | 1486 |
| 321 | Ga0207650_10000076 | 3300025925 | Bacteria | 132412 |
| 322 | Ga0207650_10011278 | 3300025925 | Bacteria | 6148 |
| 323 | Ga0207659_10076448 | 3300025926 | Bacteria | 2461 |
| 324 | Ga0207659_10252947 | 3300025926 | Bacteria | 1430 |
| 325 | Ga0207687_10044799 | 3300025927 | Bacteria | 3055 |
| 326 | Ga0207700_10054587 | 3300025928 | Bacteria | 3000 |
| 327 | Ga0207644_10025573 | 3300025931 | Bacteria | 4059 |
| 328 | Ga0207644_10094292 | 3300025931 | Bacteria | 2236 |
| 329 | Ga0207644_10126552 | 3300025931 | Bacteria | 1951 |
| 330 | Ga0207644_10140784 | 3300025931 | Bacteria | 1857 |
| 331 | Ga0207690_10023247 | 3300025932 | Bacteria | 3867 |
| 332 | Ga0207706_10001653 | 3300025933 | Bacteria | 22059 |
| 333 | Ga0207706_10100627 | 3300025933 | Bacteria | 2543 |
| 334 | Ga0207706_10105470 | 3300025933 | Bacteria | 2480 |
| 335 | Ga0207686_10000008 | 3300025934 | Bacteria | 245575 |
| 336 | Ga0207686_10145742 | 3300025934 | Bacteria | 1642 |
| 337 | Ga0207686_10330008 | 3300025934 | Bacteria | 1142 |
| 338 | Ga0207709_10000025 | 3300025935 | Bacteria | 364795 |
| 339 | Ga0207670_10000040 | 3300025936 | Bacteria | 102329 |
| 340 | Ga0207670_10052298 | 3300025936 | Bacteria | 2746 |
| 341 | Ga0207704_10074612 | 3300025938 | Bacteria | 2165 |
| 342 | Ga0207691_10000188 | 3300025940 | Bacteria | 58724 |
| 343 | Ga0207711_10005840 | 3300025941 | Bacteria | 10394 |
| 344 | Ga0207711_10011905 | 3300025941 | Bacteria | 7231 |
| 345 | Ga0207711_10031378 | 3300025941 | Bacteria | 4485 |
| 346 | Ga0207711_10079993 | 3300025941 | Bacteria | 2854 |
| 347 | Ga0207711_10296857 | 3300025941 | Bacteria | 1490 |
| 348 | Ga0207689_10003791 | 3300025942 | Bacteria | 13774 |
| 349 | Ga0207689_10059717 | 3300025942 | Bacteria | 3136 |
| 350 | Ga0207661_10005191 | 3300025944 | Bacteria | 9155 |
| 351 | Ga0207679_10000338 | 3300025945 | Bacteria | 34605 |
| 352 | Ga0207679_10155418 | 3300025945 | Unclassified | 1867 |
| 353 | Ga0207667_10009354 | 3300025949 | Bacteria | 11554 |
| 354 | Ga0207667_10061946 | 3300025949 | Bacteria | 3913 |
| 355 | Ga0207667_10597210 | 3300025949 | Bacteria | 1113 |
| 356 | Ga0207712_10003692 | 3300025961 | Bacteria | 9656 |
| 357 | Ga0207640_10055570 | 3300025981 | Bacteria | 2594 |
| 358 | Ga0207640_10256700 | 3300025981 | Bacteria | 1360 |
| 359 | Ga0207703_10060520 | 3300026035 | Bacteria | 3097 |
| 360 | Ga0207703_10112543 | 3300026035 | Bacteria | 2325 |
| 361 | Ga0207639_10006884 | 3300026041 | Bacteria | 7742 |
| 362 | Ga0207639_10074334 | 3300026041 | Bacteria | 2668 |
| 363 | Ga0207678_10000193 | 3300026067 | Bacteria | 52686 |
| 364 | Ga0207678_10000412 | 3300026067 | Bacteria | 38737 |
| 365 | Ga0207678_10039751 | 3300026067 | Bacteria | 4080 |
| 366 | Ga0207678_10226519 | 3300026067 | Bacteria | 1600 |
| 367 | Ga0207708_10000662 | 3300026075 | Bacteria | 26417 |
| 368 | Ga0207708_10019125 | 3300026075 | Bacteria | 5159 |
| 369 | Ga0207708_10124264 | 3300026075 | Bacteria | 2013 |
| 370 | Ga0207708_10372553 | 3300026075 | Bacteria | 1176 |
| 371 | Ga0207641_10000150 | 3300026088 | Bacteria | 99314 |
| 372 | Ga0207641_10044045 | 3300026088 | Bacteria | 3751 |
| 373 | Ga0207641_10359129 | 3300026088 | Bacteria | 1390 |
| 374 | Ga0207641_10404695 | 3300026088 | Unclassified | 1311 |
| 375 | Ga0207648_10004215 | 3300026089 | Bacteria | 14859 |
| 376 | Ga0207648_10009761 | 3300026089 | Bacteria | 9172 |
| 377 | Ga0207648_10053166 | 3300026089 | Bacteria | 3541 |
| 378 | Ga0207676_10003432 | 3300026095 | Bacteria | 11214 |
| 379 | Ga0207676_10004713 | 3300026095 | Bacteria | 9663 |
| 380 | Ga0207676_10215670 | 3300026095 | Bacteria | 1706 |
| 381 | Ga0207674_10005253 | 3300026116 | Bacteria | 15412 |
| 382 | Ga0207674_10005839 | 3300026116 | Bacteria | 14597 |
| 383 | Ga0207674_10132169 | 3300026116 | Bacteria | 2459 |
| 384 | Ga0207674_10149718 | 3300026116 | Bacteria | 2291 |
| 385 | Ga0207674_10330240 | 3300026116 | Unclassified | 1475 |
| 386 | Ga0207674_10340424 | 3300026116 | Bacteria | 1450 |
| 387 | Ga0207675_100396165 | 3300026118 | Unclassified | 1360 |
| 388 | Ga0207675_100529731 | 3300026118 | Bacteria | 1175 |
| 389 | Ga0207683_10015528 | 3300026121 | Bacteria | 6484 |
| 390 | Ga0207683_10032279 | 3300026121 | Bacteria | 4549 |
| 391 | Ga0207683_10141831 | 3300026121 | Bacteria | 2165 |
| 392 | Ga0207683_10377638 | 3300026121 | Bacteria | 1302 |
| 393 | Ga0207698_10000271 | 3300026142 | Bacteria | 31417 |
| 394 | Ga0207698_10018413 | 3300026142 | Bacteria | 4758 |
| 395 | Ga0207698_10402498 | 3300026142 | Bacteria | 1308 |
| 396 | Ga0209813_10011555 | 3300027866 | Bacteria | 2311 |
| 397 | Ga0207428_10036666 | 3300027907 | Bacteria | 3998 |
| 398 | Ga0207428_10039625 | 3300027907 | Bacteria | 3827 |
| 399 | Ga0268266_10000615 | 3300028379 | Bacteria | 48586 |
| 400 | Ga0268266_10008573 | 3300028379 | Bacteria | 9085 |
| 401 | Ga0268266_10041675 | 3300028379 | Bacteria | 3918 |
| 402 | Ga0268265_10003595 | 3300028380 | Bacteria | 11070 |
| 403 | Ga0268265_10022374 | 3300028380 | Bacteria | 4440 |
| 404 | Ga0268265_10030751 | 3300028380 | Bacteria | 3871 |
| 405 | Ga0268264_10018832 | 3300028381 | Bacteria | 5646 |
| 406 | Ga0268264_10365052 | 3300028381 | Bacteria | 1378 |
| 407 | Ga0307511_10056545 | 3300030521 | Bacteria | 3066 |
| 408 | Ga0307513_10086539 | 3300031456 | Unclassified | 3212 |
| 409 | Ga0307405_10001068 | 3300031731 | Bacteria | 11129 |
| 410 | Ga0307413_10001705 | 3300031824 | Bacteria | 8573 |
| 411 | Ga0307410_10001648 | 3300031852 | Bacteria | 10273 |
| 412 | Ga0307412_10000059 | 3300031911 | Bacteria | 138772 |
| 413 | Ga0307409_100019267 | 3300031995 | Bacteria | 4615 |
| 414 | Ga0307409_100024836 | 3300031995 | Bacteria | 4189 |
| 415 | Ga0307409_100039904 | 3300031995 | Bacteria | 3489 |
| 416 | Ga0307409_100132390 | 3300031995 | Unclassified | 2134 |
| 417 | Ga0307416_100038874 | 3300032002 | Bacteria | 3676 |
| 418 | Ga0307411_10001044 | 3300032005 | Bacteria | 10722 |
| 419 | Ga0307411_10003927 | 3300032005 | Bacteria | 7016 |
| 420 | Ga0307415_100170684 | 3300032126 | Bacteria | 1696 |
| 421 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 422 | Ga0395900_0051452 | 3300037418 | Bacteria | 4243 |
| 423 | Ga0395905_0060951 | 3300037471 | Bacteria | 3528 |
| 424 | Ga0395901_0059355 | 3300038443 | Bacteria | 3980 |
| 425 | Ga0436360_0965611 | 3300039438 | Bacteria | 995 |
| 426 | Ga0436361_0207335 | 3300039447 | Bacteria | 51296 |
| 427 | Ga0436361_0505993 | 3300039447 | Unclassified | 1194 |
| 428 | Ga0436361_1082816 | 3300039447 | Unclassified | 1881 |
| 429 | Ga0436363_0511569 | 3300039450 | Plasmid | 2935 |
| 430 | Ga0439438_013233 | 3300041405 | Bacteria | 2497 |
| 431 | Ga0439438_023548 | 3300041405 | Bacteria | 1695 |
| 432 | Ga0439447_000346 | 3300041407 | Bacteria | 16736 |
| 433 | Ga0439447_000499 | 3300041407 | Bacteria | 14616 |
| 434 | Ga0439447_002025 | 3300041407 | Bacteria | 7451 |
| 435 | Ga0439447_021135 | 3300041407 | Bacteria | 1717 |
| 436 | Ga0439466_0000604 | 3300041411 | Bacteria | 13476 |
| 437 | Ga0439466_0007575 | 3300041411 | Bacteria | 4104 |
| 438 | Ga0439466_0010466 | 3300041411 | Bacteria | 3447 |
| 439 | Ga0439466_0021018 | 3300041411 | Bacteria | 2320 |
| 440 | Ga0451833_1179013 | 3300041491 | Bacteria | 3231 |
| 441 | Ga0451837_0929288 | 3300041494 | Bacteria | 5251 |
| 442 | Ga0451839_0136270 | 3300041496 | Bacteria | 1585 |
| 443 | Ga0451841_0223754 | 3300041498 | Bacteria | 6200 |
| 444 | Ga0451845_0177229 | 3300041501 | Bacteria | 4291 |
| 445 | Ga0451849_0015055 | 3300041505 | Bacteria | 9244 |
| 446 | Ga0451843_0211581 | 3300041509 | Bacteria | 7109 |
| 447 | Ga0451855_0193834 | 3300041511 | Bacteria | 8269 |
| 448 | Ga0451853_0384032 | 3300041512 | Bacteria | 11489 |
| 449 | Ga0451853_2342740 | 3300041512 | Bacteria | 1461 |
| 450 | Ga0439432_008378 | 3300042006 | Bacteria | 3629 |
| 451 | Ga0439432_008458 | 3300042006 | Bacteria | 3613 |
| 452 | Ga0439452_000230 | 3300042010 | Bacteria | 38856 |
| 453 | Ga0439452_007172 | 3300042010 | Bacteria | 3431 |
| 454 | Ga0450920_002005 | 3300042122 | Bacteria | 3438 |
| 455 | Ga0450922_000480 | 3300042124 | Bacteria | 4240 |
| 456 | Ga0450902_002707 | 3300042137 | Bacteria | 2523 |
| 457 | Ga0450903_000556 | 3300042138 | Bacteria | 7736 |
| 458 | Ga0450903_001483 | 3300042138 | Bacteria | 4370 |
| 459 | Ga0450906_003883 | 3300042145 | Bacteria | 3171 |
| 460 | Ga0450907_000058 | 3300042146 | Bacteria | 43951 |
| 461 | Ga0450907_000486 | 3300042146 | Bacteria | 11079 |
| 462 | Ga0450908_001794 | 3300042184 | Bacteria | 4190 |
| 463 | Ga0450908_006952 | 3300042184 | Bacteria | 2142 |
| 464 | Ga0439434_0001657 | 3300042435 | Bacteria | 6447 |
| 465 | Ga0439435_0008367 | 3300042436 | Bacteria | 2397 |
| 466 | Ga0439460_0021739 | 3300042461 | Bacteria | 1756 |
| 467 | Ga0466972_0000062 | 3300044658 | Bacteria | 108852 |
| 468 | Ga0451576_0401455 | 3300045051 | Bacteria | 1437 |
| 469 | Ga0495617_000993 | 3300046452 | Bacteria | 13183 |
| 470 | Ga0495617_002201 | 3300046452 | Bacteria | 7958 |
| 471 | Ga0495627_010450 | 3300046453 | Bacteria | 3373 |
| 472 | Ga0495627_058047 | 3300046453 | Bacteria | 1150 |
| 473 | Ga0495592_0082496 | 3300046454 | Bacteria | 2323 |
| 474 | Ga0495603_0005483 | 3300046455 | Bacteria | 7572 |
| 475 | Ga0495603_0032139 | 3300046455 | Bacteria | 3158 |
| 476 | Ga0495590_0001284 | 3300046457 | Bacteria | 10942 |
| 477 | Ga0495590_0001838 | 3300046457 | Bacteria | 8983 |
| 478 | Ga0495591_000568 | 3300046458 | Bacteria | 28319 |
| 479 | Ga0495591_006200 | 3300046458 | Bacteria | 5337 |
| 480 | Ga0495591_013404 | 3300046458 | Bacteria | 3000 |
| 481 | Ga0495629_0006111 | 3300046459 | Bacteria | 8948 |
| 482 | Ga0495629_0018154 | 3300046459 | Bacteria | 5039 |
| 483 | Ga0495638_0001251 | 3300046460 | Bacteria | 23897 |
| 484 | Ga0495638_0013563 | 3300046460 | Bacteria | 5540 |
| 485 | Ga0495638_0013813 | 3300046460 | Bacteria | 5482 |
| 486 | Ga0495638_0028740 | 3300046460 | Bacteria | 3588 |
| 487 | Ga0495638_0044236 | 3300046460 | Bacteria | 2806 |
| 488 | Ga0495638_0074556 | 3300046460 | Bacteria | 2069 |
| 489 | Ga0495638_0138704 | 3300046460 | Bacteria | 1421 |
| 490 | Ga0495641_0021072 | 3300046461 | Bacteria | 3287 |
| 491 | Ga0495653_0003309 | 3300046463 | Bacteria | 12937 |
| 492 | Ga0495650_0003886 | 3300046471 | Bacteria | 10568 |
| 493 | Ga0495650_0058957 | 3300046471 | Bacteria | 1547 |
| 494 | Ga0495580_0000252 | 3300046472 | Bacteria | 42451 |
| 495 | Ga0495580_0007518 | 3300046472 | Bacteria | 8748 |
| 496 | Ga0495580_0093257 | 3300046472 | Bacteria | 2095 |
| 497 | Ga0495582_0005918 | 3300046473 | Bacteria | 6817 |
| 498 | Ga0495605_0000372 | 3300046474 | Bacteria | 42377 |
| 499 | Ga0495605_0002542 | 3300046474 | Bacteria | 11241 |
| 500 | Ga0495605_0005589 | 3300046474 | Bacteria | 7307 |
| 501 | Ga0495605_0009349 | 3300046474 | Bacteria | 5509 |
| 502 | Ga0495605_0025618 | 3300046474 | Bacteria | 3072 |
| 503 | Ga0495664_0002646 | 3300046477 | Bacteria | 9633 |
| 504 | Ga0495584_0000140 | 3300046491 | Bacteria | 50112 |
| 505 | Ga0495584_0029936 | 3300046491 | Bacteria | 2758 |
| 506 | Ga0495584_0200450 | 3300046491 | Bacteria | 1014 |
| 507 | Ga0495585_0004195 | 3300046492 | Bacteria | 9410 |
| 508 | Ga0495585_0020091 | 3300046492 | Bacteria | 3843 |
| 509 | Ga0495585_0041128 | 3300046492 | Bacteria | 2593 |
| 510 | Ga0495607_0002730 | 3300046501 | Bacteria | 14079 |
| 511 | Ga0495607_0012901 | 3300046501 | Bacteria | 5495 |
| 512 | Ga0495583_0000958 | 3300046506 | Bacteria | 33509 |
| 513 | Ga0495583_0003084 | 3300046506 | Bacteria | 13195 |
| 514 | Ga0495583_0021470 | 3300046506 | Bacteria | 3320 |
| 515 | Ga0495606_0001909 | 3300046507 | Bacteria | 25955 |
| 516 | Ga0495610_0000246 | 3300046512 | Bacteria | 56850 |
| 517 | Ga0495610_0024122 | 3300046512 | Bacteria | 3288 |
| 518 | Ga0495610_0028336 | 3300046512 | Bacteria | 2963 |
| 519 | Ga0495616_0024999 | 3300046513 | Bacteria | 3196 |
| 520 | Ga0495618_0006549 | 3300046514 | Bacteria | 7066 |
| 521 | Ga0495620_0001486 | 3300046515 | Bacteria | 13999 |
| 522 | Ga0495620_0040609 | 3300046515 | Bacteria | 2046 |
| 523 | Ga0495628_0006201 | 3300046516 | Bacteria | 10453 |
| 524 | Ga0495628_0008228 | 3300046516 | Bacteria | 8970 |
| 525 | Ga0495628_0094662 | 3300046516 | Bacteria | 2308 |
| 526 | Ga0495628_0196974 | 3300046516 | Bacteria | 1519 |
| 527 | Ga0495630_0058285 | 3300046517 | Bacteria | 2894 |
| 528 | Ga0495632_0000809 | 3300046519 | Bacteria | 27722 |
| 529 | Ga0495632_0007408 | 3300046519 | Bacteria | 6895 |
| 530 | Ga0495632_0035261 | 3300046519 | Bacteria | 2554 |
| 531 | Ga0495632_0144654 | 3300046519 | Bacteria | 1101 |
| 532 | Ga0495637_0006366 | 3300046520 | Bacteria | 5934 |
| 533 | Ga0495637_0119285 | 3300046520 | Bacteria | 1016 |
| 534 | Ga0495643_0004454 | 3300046522 | Bacteria | 9782 |
| 535 | Ga0495643_0032039 | 3300046522 | Bacteria | 2921 |
| 536 | Ga0495644_0001234 | 3300046523 | Bacteria | 10464 |
| 537 | Ga0495644_0033310 | 3300046523 | Bacteria | 1946 |
| 538 | Ga0495648_0007247 | 3300046524 | Bacteria | 8903 |
| 539 | Ga0495648_0008085 | 3300046524 | Bacteria | 8316 |
| 540 | Ga0495648_0011605 | 3300046524 | Bacteria | 6621 |
| 541 | Ga0495648_0018705 | 3300046524 | Bacteria | 4892 |
| 542 | Ga0495648_0043689 | 3300046524 | Bacteria | 2806 |
| 543 | Ga0495666_0002673 | 3300046526 | Bacteria | 8892 |
| 544 | Ga0495666_0070289 | 3300046526 | Bacteria | 1665 |
| 545 | Ga0495642_0000082 | 3300046528 | Bacteria | 55424 |
| 546 | Ga0495642_0000219 | 3300046528 | Bacteria | 32918 |
| 547 | Ga0495642_0040338 | 3300046528 | Bacteria | 1896 |
| 548 | Ga0495652_0009463 | 3300046529 | Bacteria | 8854 |
| 549 | Ga0495652_0097404 | 3300046529 | Bacteria | 2393 |
| 550 | Ga0495654_0003562 | 3300046530 | Bacteria | 9490 |
| 551 | Ga0495654_0008233 | 3300046530 | Bacteria | 5771 |
| 552 | Ga0495654_0039244 | 3300046530 | Bacteria | 2364 |
| 553 | Ga0495665_0026911 | 3300046531 | Bacteria | 3087 |
| 554 | Ga0495640_0006909 | 3300046533 | Bacteria | 8939 |
| 555 | Ga0495586_0000805 | 3300046535 | Bacteria | 18018 |
| 556 | Ga0495587_0003814 | 3300046536 | Bacteria | 9998 |
| 557 | Ga0495587_0004637 | 3300046536 | Bacteria | 9035 |
| 558 | Ga0495609_0000316 | 3300046538 | Bacteria | 43165 |
| 559 | Ga0495609_0001746 | 3300046538 | Bacteria | 13981 |
| 560 | Ga0495609_0008211 | 3300046538 | Bacteria | 5124 |
| 561 | Ga0495609_0038168 | 3300046538 | Bacteria | 2166 |
| 562 | Ga0495597_0004130 | 3300046542 | Bacteria | 8078 |
| 563 | Ga0495597_0004173 | 3300046542 | Bacteria | 8017 |
| 564 | Ga0495597_0056054 | 3300046542 | Bacteria | 1726 |
| 565 | Ga0495597_0068080 | 3300046542 | Bacteria | 1539 |
| 566 | Ga0495645_0004684 | 3300046543 | Bacteria | 9336 |
| 567 | Ga0495622_0002129 | 3300046557 | Bacteria | 9649 |
| 568 | Ga0495622_0018725 | 3300046557 | Bacteria | 3224 |
| 569 | Ga0495622_0061191 | 3300046557 | Bacteria | 1744 |
| 570 | Ga0495622_0091649 | 3300046557 | Bacteria | 1396 |
| 571 | Ga0495633_0040377 | 3300046558 | Bacteria | 2223 |
| 572 | Ga0495656_0004525 | 3300046615 | Bacteria | 4763 |
| 573 | Ga0495656_0012309 | 3300046615 | Plasmid | 3154 |
| 574 | Ga0495656_0019679 | 3300046615 | Plasmid | 2608 |
| 575 | Ga0495668_0003879 | 3300046616 | Bacteria | 10915 |
| 576 | Ga0495634_0001713 | 3300046642 | Bacteria | 19070 |
| 577 | Ga0495634_0005677 | 3300046642 | Bacteria | 9546 |
| 578 | Ga0495611_0029008 | 3300046648 | Bacteria | 2425 |
| 579 | Ga0495611_0083002 | 3300046648 | Bacteria | 1475 |
| 580 | Ga0495625_0042682 | 3300046660 | Bacteria | 3294 |
| 581 | Ga0495625_0054522 | 3300046660 | Bacteria | 2854 |
| 582 | Ga0495625_0063839 | 3300046660 | Bacteria | 2600 |
| 583 | Ga0495625_0194119 | 3300046660 | Bacteria | 1343 |
| 584 | Ga0495635_0000974 | 3300046663 | Bacteria | 18843 |
| 585 | Ga0495635_0044272 | 3300046663 | Bacteria | 3071 |
| 586 | Ga0495659_0001444 | 3300046664 | Bacteria | 8058 |
| 587 | Ga0495661_0001499 | 3300046665 | Bacteria | 19443 |
| 588 | Ga0495661_0051148 | 3300046665 | Bacteria | 2496 |
| 589 | Ga0495588_0005503 | 3300046674 | Bacteria | 5641 |
| 590 | Ga0495588_0025851 | 3300046674 | Bacteria | 2928 |
| 591 | Ga0495588_0042741 | 3300046674 | Bacteria | 2317 |
| 592 | Ga0495599_0007249 | 3300046678 | Bacteria | 6718 |
| 593 | Ga0495599_0015627 | 3300046678 | Bacteria | 4712 |
| 594 | Ga0495623_0005517 | 3300046679 | Bacteria | 8262 |
| 595 | Ga0495623_0089020 | 3300046679 | Bacteria | 1898 |
| 596 | Ga0495646_0004219 | 3300046680 | Bacteria | 9036 |
| 597 | Ga0495646_0012597 | 3300046680 | Bacteria | 5374 |
| 598 | Ga0495646_0060890 | 3300046680 | Bacteria | 2249 |
| 599 | Ga0495646_0102156 | 3300046680 | Bacteria | 1642 |
| 600 | Ga0495669_0006789 | 3300046684 | Bacteria | 4789 |
| 601 | Ga0495669_0009604 | 3300046684 | Bacteria | 4082 |
| 602 | Ga0495613_0001260 | 3300046689 | Bacteria | 19289 |
| 603 | Ga0495624_0038155 | 3300046690 | Bacteria | 3087 |
| 604 | Ga0495670_0003663 | 3300046691 | Bacteria | 7555 |
| 605 | Ga0495670_0015669 | 3300046691 | Bacteria | 3725 |
| 606 | Ga0495671_0001167 | 3300046692 | Bacteria | 18001 |
| 607 | Ga0495671_0001456 | 3300046692 | Bacteria | 15898 |
| 608 | Ga0495671_0009870 | 3300046692 | Bacteria | 5310 |
| 609 | Ga0495671_0010679 | 3300046692 | Bacteria | 5081 |
| 610 | Ga0495671_0020484 | 3300046692 | Bacteria | 3484 |
| 611 | Ga0495671_0045519 | 3300046692 | Bacteria | 2196 |
| 612 | Ga0495649_0003859 | 3300046694 | Bacteria | 9925 |
| 613 | Ga0495649_0006496 | 3300046694 | Bacteria | 7276 |
| 614 | Ga0495649_0021042 | 3300046694 | Bacteria | 3657 |
| 615 | Ga0495649_0084045 | 3300046694 | Bacteria | 1700 |
| 616 | Ga0495589_0001146 | 3300046794 | Bacteria | 15769 |
| 617 | Ga0495589_0006667 | 3300046794 | Bacteria | 6082 |
| 618 | Ga0495589_0018707 | 3300046794 | Bacteria | 3551 |
| 619 | Ga0495660_0053697 | 3300046810 | Bacteria | 2186 |
| 620 | Ga0495660_0070405 | 3300046810 | Bacteria | 1856 |
| 621 | Ga0495660_0102350 | 3300046810 | Bacteria | 1472 |
| 622 | Ga0495581_0016945 | 3300047315 | Bacteria | 4233 |
| 623 | Ga0495604_0010223 | 3300047317 | Bacteria | 7434 |
| 624 | Ga0495604_0050064 | 3300047317 | Bacteria | 3244 |
| 625 | Ga0495604_0050243 | 3300047317 | Bacteria | 3238 |
| 626 | Ga0495604_0158188 | 3300047317 | Bacteria | 1603 |
| 627 | Ga0495636_0000052 | 3300047318 | Bacteria | 51030 |
| 628 | Ga0495636_0007339 | 3300047318 | Plasmid | 4338 |
| 629 | Ga0495636_0019442 | 3300047318 | Plasmid | 2731 |
| 630 | Ga0495674_0003114 | 3300047319 | Bacteria | 16114 |
| 631 | Ga0495674_0010538 | 3300047319 | Bacteria | 8748 |
| 632 | Ga0495674_0020423 | 3300047319 | Bacteria | 6132 |
| 633 | Ga0495674_0021838 | 3300047319 | Bacteria | 5914 |
| 634 | Ga0495674_0027237 | 3300047319 | Bacteria | 5224 |
| 635 | Ga0495674_0061922 | 3300047319 | Bacteria | 3259 |
| 636 | Ga0495674_0139306 | 3300047319 | Bacteria | 2040 |
| 637 | Ga0495672_0001830 | 3300047320 | Bacteria | 20344 |
| 638 | Ga0495672_0002044 | 3300047320 | Bacteria | 18957 |
| 639 | Ga0495672_0002429 | 3300047320 | Bacteria | 17174 |
| 640 | Ga0495672_0006877 | 3300047320 | Bacteria | 8676 |
| 641 | Ga0495672_0009622 | 3300047320 | Bacteria | 6977 |
| 642 | Ga0495672_0010762 | 3300047320 | Bacteria | 6492 |
| 643 | Ga0495672_0011778 | 3300047320 | Bacteria | 6146 |
| 644 | Ga0495672_0026911 | 3300047320 | Bacteria | 3662 |
| 645 | Ga0495672_0039068 | 3300047320 | Bacteria | 2889 |
| 646 | Ga0495672_0050685 | 3300047320 | Bacteria | 2448 |
| 647 | Ga0495672_0092397 | 3300047320 | Bacteria | 1659 |
| 648 | Ga0495676_0001386 | 3300047321 | Bacteria | 20895 |
| 649 | Ga0495680_0002757 | 3300047322 | Bacteria | 17736 |
| 650 | Ga0495683_0007760 | 3300047323 | Bacteria | 5760 |
| 651 | Ga0495683_0018642 | 3300047323 | Bacteria | 3585 |
| 652 | Ga0495683_0057592 | 3300047323 | Bacteria | 1931 |
| 653 | Ga0495687_001526 | 3300047443 | Bacteria | 21130 |
| 654 | Ga0495687_015557 | 3300047443 | Bacteria | 3862 |
| 655 | Ga0495687_042633 | 3300047443 | Bacteria | 1981 |
| 656 | Ga0495675_0020643 | 3300047444 | Bacteria | 4194 |
| 657 | Ga0495675_0021758 | 3300047444 | Bacteria | 4085 |
| 658 | Ga0495675_0034600 | 3300047444 | Bacteria | 3225 |
| 659 | Ga0495677_0000486 | 3300047445 | Bacteria | 16837 |
| 660 | Ga0495679_000759 | 3300047446 | Bacteria | 20554 |
| 661 | Ga0495679_003633 | 3300047446 | Bacteria | 7370 |
| 662 | Ga0495679_005581 | 3300047446 | Bacteria | 5550 |
| 663 | Ga0495673_0000319 | 3300047469 | Bacteria | 61961 |
| 664 | Ga0495673_0001021 | 3300047469 | Bacteria | 24677 |
| 665 | Ga0495673_0006070 | 3300047469 | Bacteria | 7172 |
| 666 | Ga0495673_0006732 | 3300047469 | Bacteria | 6715 |
| 667 | Ga0495673_0010237 | 3300047469 | Bacteria | 5117 |
| 668 | Ga0495673_0022344 | 3300047469 | Bacteria | 3103 |
| 669 | Ga0495681_0000023 | 3300047470 | Bacteria | 154266 |
| 670 | Ga0495681_0025362 | 3300047470 | Bacteria | 3102 |
| 671 | Ga0495684_0135617 | 3300047471 | Bacteria | 1847 |
| 672 | Ga0495593_0003926 | 3300047673 | Bacteria | 8880 |
| 673 | Ga0495593_0037760 | 3300047673 | Bacteria | 2610 |
| 674 | Ga0495602_0072821 | 3300048088 | Bacteria | 2927 |
| 675 | Ga0495602_0220922 | 3300048088 | Bacteria | 1430 |
| 676 | Ga0495614_0000330 | 3300048089 | Bacteria | 18744 |
| 677 | Ga0495626_0000340 | 3300048091 | Bacteria | 49123 |
| 678 | Ga0495626_0000394 | 3300048091 | Bacteria | 45106 |
| 679 | Ga0495626_0008878 | 3300048091 | Bacteria | 5461 |
| 680 | Ga0495626_0018689 | 3300048091 | Bacteria | 3474 |
| 681 | Ga0496100_0031403 | 3300048903 | Bacteria | 3303 |
| 682 | Ga0496100_0038764 | 3300048903 | Bacteria | 3022 |
| 683 | Ga0496100_0198453 | 3300048903 | Bacteria | 1461 |
| 684 | Ga0496101_0017882 | 3300048904 | Bacteria | 4812 |
| 685 | Ga0496101_0030709 | 3300048904 | Bacteria | 3771 |
| 686 | Ga0496102_0002794 | 3300048905 | Bacteria | 14880 |
| 687 | Ga0496102_0217046 | 3300048905 | Unclassified | 1803 |
| 688 | Ga0496103_0002417 | 3300048906 | Bacteria | 11750 |
| 689 | Ga0496103_0130515 | 3300048906 | Bacteria | 1604 |
| 690 | Ga0496104_0074268 | 3300048907 | Bacteria | 3237 |
| 691 | Ga0496104_0162243 | 3300048907 | Bacteria | 2144 |
| 692 | Ga0496104_0307143 | 3300048907 | Bacteria | 1499 |
| 693 | Ga0496105_0000318 | 3300048908 | Bacteria | 31631 |
| 694 | Ga0496105_0300152 | 3300048908 | Bacteria | 1291 |
| 695 | Ga0496106_0119250 | 3300048909 | Unclassified | 2061 |
| 696 | Ga0496106_0152564 | 3300048909 | Bacteria | 1823 |
| 697 | Ga0496108_0000303 | 3300048911 | Bacteria | 42278 |
| 698 | Ga0496108_0021149 | 3300048911 | Bacteria | 5346 |
| 699 | Ga0496108_0058871 | 3300048911 | Bacteria | 3230 |
| 700 | Ga0496108_0180559 | 3300048911 | Bacteria | 1827 |
| 701 | Ga0496109_0000504 | 3300048912 | Bacteria | 33447 |
| 702 | Ga0496109_0072044 | 3300048912 | Bacteria | 3173 |
| 703 | Ga0496110_0001004 | 3300048913 | Bacteria | 19871 |
| 704 | Ga0496110_0070576 | 3300048913 | Bacteria | 3095 |
| 705 | Ga0496112_0000042 | 3300048915 | Bacteria | 88041 |
| 706 | Ga0496112_0000460 | 3300048915 | Bacteria | 27193 |
| 707 | Ga0496112_0011547 | 3300048915 | Bacteria | 8072 |
| 708 | Ga0496112_0015563 | 3300048915 | Bacteria | 7104 |
| 709 | Ga0496112_0223438 | 3300048915 | Bacteria | 1839 |
| 710 | Ga0496113_0006588 | 3300048916 | Bacteria | 7382 |
| 711 | Ga0496113_0033553 | 3300048916 | Bacteria | 3739 |
| 712 | Ga0496114_0276775 | 3300048917 | Bacteria | 1479 |
| 713 | Ga0496115_0012747 | 3300048918 | Bacteria | 6337 |
| 714 | Ga0496115_0194941 | 3300048918 | Bacteria | 1674 |
| 715 | Ga0496116_0048592 | 3300048919 | Bacteria | 2846 |
| 716 | Ga0496116_0056833 | 3300048919 | Bacteria | 2562 |
| 717 | Ga0496117_0006453 | 3300048920 | Bacteria | 11865 |
| 718 | Ga0496117_0012410 | 3300048920 | Bacteria | 7514 |
| 719 | Ga0496117_0088194 | 3300048920 | Bacteria | 2008 |
| 720 | Ga0496117_0155064 | 3300048920 | Bacteria | 1350 |
| 721 | Ga0496118_0005967 | 3300048921 | Bacteria | 13588 |
| 722 | Ga0496118_0015867 | 3300048921 | Bacteria | 6945 |
| 723 | Ga0496118_0016993 | 3300048921 | Bacteria | 6644 |
| 724 | Ga0496119_0107677 | 3300048922 | Bacteria | 1553 |
| 725 | Ga0496121_0000557 | 3300048924 | Bacteria | 70347 |
| 726 | Ga0496124_0004276 | 3300048927 | Bacteria | 16783 |
| 727 | Ga0496125_0060939 | 3300048928 | Bacteria | 3029 |
| 728 | Ga0496126_0138896 | 3300048929 | Bacteria | 2093 |
| 729 | Ga0495678_037804 | 3300049459 | Bacteria | 1957 |
| 730 | Ga0495682_0005771 | 3300049460 | Bacteria | 5100 |
| 731 | Ga0495682_0006897 | 3300049460 | Bacteria | 4563 |
| 732 | Ga0495682_0092839 | 3300049460 | Bacteria | 1083 |
| 733 | Ga0501292_005045 | 3300049515 | Unclassified | 1828 |
| 734 | Ga0501298_022062 | 3300049521 | Unclassified | 1197 |
| 735 | Ga0501299_000069 | 3300049522 | Bacteria | 11575 |
| 736 | Ga0501299_002137 | 3300049522 | Unclassified | 2701 |
| 737 | Ga0501034_0000163 | 3300049571 | Bacteria | 125417 |
| 738 | Ga0501068_0118792 | 3300049584 | Bacteria | 1647 |
| 739 | Ga0501217_006254 | 3300049661 | Plasmid | 2522 |
| 740 | Ga0501225_0003702 | 3300049705 | Bacteria | 4602 |
| 741 | Ga0501080_0206110 | 3300049742 | Bacteria | 1803 |
| 742 | Ga0501283_016512 | 3300049779 | Unclassified | 1146 |
| 743 | nmdc:mga03683_1054_c1 | 3300050489 | Bacteria | 6426 |
| 744 | nmdc:mga03n38_5791_c1 | 3300050490 | Bacteria | 4242 |
| 745 | nmdc:mga00v17_130337_c1 | 3300050491 | Bacteria | 1607 |
| 746 | nmdc:mga0yw44_247174_c1 | 3300050492 | Bacteria | 1187 |
| 747 | nmdc:mga0k408_181516_c1 | 3300050493 | Bacteria | 1255 |
| 748 | nmdc:mga0k408_75415_c1 | 3300050493 | Bacteria | 1970 |
| 749 | nmdc:mga06z11_149602_c1 | 3300050494 | Unclassified | 1326 |
| 750 | nmdc:mga06z11_24340_c1 | 3300050494 | Bacteria | 2855 |
| 751 | nmdc:mga06z11_72028_c1 | 3300050494 | Bacteria | 1831 |
| 752 | nmdc:mga04h51_12817_c1 | 3300050495 | Bacteria | 2362 |
| 753 | nmdc:mga07m45_25840_c1 | 3300050496 | Bacteria | 3224 |
| 754 | nmdc:mga05p37_23905_c1 | 3300050507 | Bacteria | 7419 |
| 755 | nmdc:mga05p37_308638_c1 | 3300050507 | Bacteria | 1876 |
| 756 | nmdc:mga0qj67_97_c1 | 3300050509 | Bacteria | 58508 |
| 757 | nmdc:mga06r32_259_c2 | 3300050510 | Bacteria | 43373 |
| 758 | nmdc:mga06r32_64078_c1 | 3300050510 | Bacteria | 3543 |
| 759 | nmdc:mga08y16_38592_c1 | 3300050511 | Bacteria | 5014 |
| 760 | nmdc:mga0n895_65424_c1 | 3300050512 | Bacteria | 3599 |
| 761 | nmdc:mga0rr50_2086_c1 | 3300050513 | Bacteria | 11169 |
| 762 | nmdc:mga0a205_34474_c1 | 3300050515 | Bacteria | 4855 |
| 763 | nmdc:mga0a205_35009_c1 | 3300050515 | Bacteria | 4822 |
| 764 | nmdc:mga0a205_50343_c1 | 3300050515 | Bacteria | 4022 |
| 765 | nmdc:mga0sz30_25593_c1 | 3300050516 | Bacteria | 2413 |
| 766 | Ga0500644_0013412 | 3300053088 | Bacteria | 2289 |
| 767 | Ga0500595_007412 | 3300053119 | Bacteria | 4553 |
| 768 | Ga0500568_0000850 | 3300053139 | Bacteria | 21493 |
| 769 | Ga0500616_0007172 | 3300053153 | Bacteria | 7128 |
| 770 | Ga0500616_0043944 | 3300053153 | Bacteria | 2386 |
| 771 | Ga0500645_009472 | 3300053730 | Bacteria | 3270 |
| 772 | Ga0590071_000355 | 3300059421 | Bacteria | 13511 |
| 773 | Ga0590074_000726 | 3300059423 | Bacteria | 5014 |
| 774 | Ga0590075_000518 | 3300059424 | Bacteria | 10469 |
| 775 | Ga0590077_000860 | 3300059426 | Bacteria | 7790 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046515 | Ga0495620_0040609 | Ga0495620_0040609_13_813 | 258 |
| 2 | iso_pu_bacteria | 2738543015 | 2739258551 | 284 |
| 3 | iso_pu_bacteria | 8016622563 | 8016628203 | 292 |
| 4 | 3300009553 | Ga0105249_10702794 | Ga0105249_107027941 | 297 |
| 5 | 3300006178 | Ga0075367_10005759 | Ga0075367_100057599 | 298 |
| 6 | 3300050493 | nmdc:mga0k408_75415_c1 | nmdc:mga0k408_75415_c1_935_1927 | 298 |
| 7 | 3300050494 | nmdc:mga06z11_72028_c1 | nmdc:mga06z11_72028_c1_240_1232 | 298 |
| 8 | 3300047320 | Ga0495672_0009622 | Ga0495672_0009622_502_1506 | 305 |
| 9 | iso_pu_bacteria | 2558860280 | 2559423248 | 306 |
| 10 | iso_pu_bacteria | 2919125081 | 2919126939 | 310 |
| 11 | iso_pu_bacteria | 2984504281 | 2984504873 | 310 |
| 12 | iso_pu_bacteria | 8016728285 | 8016733304 | 310 |
| 13 | 3300039438 | Ga0436360_0965611 | Ga0436360_0965611_22_972 | 311 |
| 14 | 3300049584 | Ga0501068_0118792 | Ga0501068_0118792_17_970 | 311 |
| 15 | iso_pu_bacteria | 2517093000 | 2517097703 | 311 |
| 16 | iso_pu_bacteria | 2765235942 | 2766063351 | 311 |
| 17 | 3300042461 | Ga0439460_0021739 | Ga0439460_0021739_94_1041 | 312 |
| 18 | 3300053139 | Ga0500568_0000850 | Ga0500568_0000850_15204_16160 | 312 |
| 19 | iso_pu_bacteria | 3007619802 | 3007621890 | 312 |
| 20 | 3300031995 | Ga0307409_100039904 | Ga0307409_1000399043 | 313 |
| 21 | 3300005844 | Ga0068862_100378950 | Ga0068862_1003789501 | 314 |
| 22 | 3300006048 | Ga0075363_100026247 | Ga0075363_1000262473 | 314 |
| 23 | 3300006051 | Ga0075364_10004579 | Ga0075364_100045797 | 314 |
| 24 | 3300006195 | Ga0075366_10134883 | Ga0075366_101348832 | 314 |
| 25 | 3300006353 | Ga0075370_10012587 | Ga0075370_100125873 | 314 |
| 26 | 3300006353 | Ga0075370_10043709 | Ga0075370_100437093 | 314 |
| 27 | 3300009092 | Ga0105250_10000426 | Ga0105250_1000042620 | 314 |
| 28 | 3300025711 | Ga0207696_1000266 | Ga0207696_100026649 | 314 |
| 29 | 3300025933 | Ga0207706_10100627 | Ga0207706_101006273 | 314 |
| 30 | 3300050490 | nmdc:mga03n38_5791_c1 | nmdc:mga03n38_5791_c1_1537_2511 | 314 |
| 31 | 3300050491 | nmdc:mga00v17_130337_c1 | nmdc:mga00v17_130337_c1_13_987 | 314 |
| 32 | 3300050496 | nmdc:mga07m45_25840_c1 | nmdc:mga07m45_25840_c1_1341_2315 | 314 |
| 33 | 3300050516 | nmdc:mga0sz30_25593_c1 | nmdc:mga0sz30_25593_c1_646_1620 | 314 |
| 34 | 3300009174 | Ga0105241_10002471 | Ga0105241_1000247112 | 315 |
| 35 | 3300025911 | Ga0207654_10021980 | Ga0207654_100219804 | 315 |
| 36 | 3300041491 | Ga0451833_1179013 | Ga0451833_1179013_803_1795 | 315 |
| 37 | 3300041494 | Ga0451837_0929288 | Ga0451837_0929288_2072_3064 | 315 |
| 38 | 3300041496 | Ga0451839_0136270 | Ga0451839_0136270_48_1040 | 315 |
| 39 | 3300041498 | Ga0451841_0223754 | Ga0451841_0223754_2370_3362 | 315 |
| 40 | 3300041501 | Ga0451845_0177229 | Ga0451845_0177229_2870_3862 | 315 |
| 41 | 3300041505 | Ga0451849_0015055 | Ga0451849_0015055_5599_6591 | 315 |
| 42 | 3300041509 | Ga0451843_0211581 | Ga0451843_0211581_802_1794 | 315 |
| 43 | 3300041511 | Ga0451855_0193834 | Ga0451855_0193834_3866_4858 | 315 |
| 44 | 3300041512 | Ga0451853_0384032 | Ga0451853_0384032_3893_4885 | 315 |
| 45 | 3300049742 | Ga0501080_0206110 | Ga0501080_0206110_234_1190 | 315 |
| 46 | 3300005288 | Ga0065714_10076134 | Ga0065714_100761342 | 316 |
| 47 | 3300005354 | Ga0070675_100017418 | Ga0070675_1000174184 | 316 |
| 48 | 3300005364 | Ga0070673_100008156 | Ga0070673_1000081563 | 316 |
| 49 | 3300005457 | Ga0070662_100121036 | Ga0070662_1001210362 | 316 |
| 50 | 3300005544 | Ga0070686_100073039 | Ga0070686_1000730392 | 316 |
| 51 | 3300005547 | Ga0070693_100036990 | Ga0070693_1000369903 | 316 |
| 52 | 3300005577 | Ga0068857_100013777 | Ga0068857_1000137774 | 316 |
| 53 | 3300005617 | Ga0068859_100027750 | Ga0068859_1000277503 | 316 |
| 54 | 3300005618 | Ga0068864_100110347 | Ga0068864_1001103472 | 316 |
| 55 | 3300005719 | Ga0068861_100304508 | Ga0068861_1003045082 | 316 |
| 56 | 3300005843 | Ga0068860_100019448 | Ga0068860_1000194483 | 316 |
| 57 | 3300005844 | Ga0068862_100046428 | Ga0068862_1000464283 | 316 |
| 58 | 3300006931 | Ga0097620_100027750 | Ga0097620_1000277506 | 316 |
| 59 | 3300025885 | Ga0207653_10001217 | Ga0207653_100012174 | 316 |
| 60 | 3300025904 | Ga0207647_10072785 | Ga0207647_100727852 | 316 |
| 61 | 3300025926 | Ga0207659_10252947 | Ga0207659_102529472 | 316 |
| 62 | 3300025933 | Ga0207706_10105470 | Ga0207706_101054703 | 316 |
| 63 | 3300025941 | Ga0207711_10296857 | Ga0207711_102968571 | 316 |
| 64 | 3300025961 | Ga0207712_10003692 | Ga0207712_100036925 | 316 |
| 65 | 3300026067 | Ga0207678_10039751 | Ga0207678_100397515 | 316 |
| 66 | 3300026075 | Ga0207708_10019125 | Ga0207708_100191253 | 316 |
| 67 | 3300026095 | Ga0207676_10004713 | Ga0207676_100047135 | 316 |
| 68 | 3300026116 | Ga0207674_10149718 | Ga0207674_101497181 | 316 |
| 69 | 3300028380 | Ga0268265_10022374 | Ga0268265_100223743 | 316 |
| 70 | 3300028381 | Ga0268264_10018832 | Ga0268264_100188325 | 316 |
| 71 | 3300028381 | Ga0268264_10365052 | Ga0268264_103650522 | 316 |
| 72 | 3300053730 | Ga0500645_009472 | Ga0500645_009472_100_1086 | 316 |
| 73 | iso_pu_bacteria | 2517572143 | 2517887946 | 316 |
| 74 | 3300005337 | Ga0070682_100002341 | Ga0070682_10000234111 | 317 |
| 75 | 3300005338 | Ga0068868_100230102 | Ga0068868_1002301022 | 317 |
| 76 | 3300005344 | Ga0070661_100149648 | Ga0070661_1001496482 | 317 |
| 77 | 3300005440 | Ga0070705_100159061 | Ga0070705_1001590612 | 317 |
| 78 | 3300005455 | Ga0070663_100060072 | Ga0070663_1000600724 | 317 |
| 79 | 3300005456 | Ga0070678_100026029 | Ga0070678_1000260296 | 317 |
| 80 | 3300005458 | Ga0070681_10004260 | Ga0070681_100042609 | 317 |
| 81 | 3300005459 | Ga0068867_100059301 | Ga0068867_1000593013 | 317 |
| 82 | 3300005530 | Ga0070679_100045513 | Ga0070679_1000455134 | 317 |
| 83 | 3300005545 | Ga0070695_100056594 | Ga0070695_1000565942 | 317 |
| 84 | 3300005615 | Ga0070702_100016681 | Ga0070702_1000166812 | 317 |
| 85 | 3300005617 | Ga0068859_100549551 | Ga0068859_1005495511 | 317 |
| 86 | 3300005842 | Ga0068858_100035748 | Ga0068858_1000357486 | 317 |
| 87 | 3300005843 | Ga0068860_100111365 | Ga0068860_1001113652 | 317 |
| 88 | 3300006881 | Ga0068865_100089721 | Ga0068865_1000897212 | 317 |
| 89 | 3300006931 | Ga0097620_100549554 | Ga0097620_1005495541 | 317 |
| 90 | 3300009174 | Ga0105241_10007576 | Ga0105241_100075766 | 317 |
| 91 | 3300009545 | Ga0105237_10388639 | Ga0105237_103886391 | 317 |
| 92 | 3300009551 | Ga0105238_10016084 | Ga0105238_100160844 | 317 |
| 93 | 3300010375 | Ga0105239_10141603 | Ga0105239_101416031 | 317 |
| 94 | 3300011119 | Ga0105246_10033410 | Ga0105246_100334105 | 317 |
| 95 | 3300013308 | Ga0157375_10208923 | Ga0157375_102089232 | 317 |
| 96 | 3300014968 | Ga0157379_10179165 | Ga0157379_101791651 | 317 |
| 97 | 3300025904 | Ga0207647_10020614 | Ga0207647_100206145 | 317 |
| 98 | 3300025911 | Ga0207654_10053330 | Ga0207654_100533301 | 317 |
| 99 | 3300025921 | Ga0207652_10278888 | Ga0207652_102788882 | 317 |
| 100 | 3300025949 | Ga0207667_10597210 | Ga0207667_105972101 | 317 |
| 101 | 3300026041 | Ga0207639_10074334 | Ga0207639_100743344 | 317 |
| 102 | 3300026067 | Ga0207678_10000193 | Ga0207678_1000019343 | 317 |
| 103 | 3300026075 | Ga0207708_10124264 | Ga0207708_101242641 | 317 |
| 104 | 3300026116 | Ga0207674_10132169 | Ga0207674_101321691 | 317 |
| 105 | 3300026121 | Ga0207683_10032279 | Ga0207683_100322792 | 317 |
| 106 | 3300026142 | Ga0207698_10402498 | Ga0207698_104024981 | 317 |
| 107 | 3300037471 | Ga0395905_0060951 | Ga0395905_0060951_1693_2682 | 317 |
| 108 | 3300048903 | Ga0496100_0038764 | Ga0496100_0038764_311_1273 | 317 |
| 109 | 3300048904 | Ga0496101_0017882 | Ga0496101_0017882_1721_2683 | 317 |
| 110 | 3300048906 | Ga0496103_0130515 | Ga0496103_0130515_313_1275 | 317 |
| 111 | 3300048918 | Ga0496115_0012747 | Ga0496115_0012747_5025_5987 | 317 |
| 112 | 3300013306 | Ga0163162_10384173 | Ga0163162_103841732 | 318 |
| 113 | iso_pu_bacteria | 2511231018 | 2511340131 | 318 |
| 114 | iso_pu_bacteria | 2511231019 | 2511347101 | 318 |
| 115 | iso_pu_bacteria | 2687453257 | 2688070011 | 318 |
| 116 | iso_pu_bacteria | 2808606382 | 2808958250 | 318 |
| 117 | iso_pu_bacteria | 2919456309 | 2919456344 | 318 |
| 118 | iso_pu_bacteria | 3007511990 | 3007514686 | 318 |
| 119 | 3300005365 | Ga0070688_100011783 | Ga0070688_1000117835 | 319 |
| 120 | 3300005466 | Ga0070685_10099741 | Ga0070685_100997412 | 319 |
| 121 | 3300005617 | Ga0068859_100318326 | Ga0068859_1003183261 | 319 |
| 122 | 3300006931 | Ga0097620_100318341 | Ga0097620_1003183411 | 319 |
| 123 | 3300037418 | Ga0395900_0051452 | Ga0395900_0051452_1639_2607 | 319 |
| 124 | 3300038443 | Ga0395901_0059355 | Ga0395901_0059355_2368_3336 | 319 |
| 125 | 3300046460 | Ga0495638_0044236 | Ga0495638_0044236_302_1291 | 319 |
| 126 | 3300046660 | Ga0495625_0042682 | Ga0495625_0042682_2108_3097 | 319 |
| 127 | 3300006038 | Ga0075365_10308341 | Ga0075365_103083412 | 320 |
| 128 | 3300009011 | Ga0105251_10002329 | Ga0105251_100023297 | 320 |
| 129 | 3300025735 | Ga0207713_1032504 | Ga0207713_10325042 | 320 |
| 130 | 3300039447 | Ga0436361_1082816 | Ga0436361_1082816_602_1663 | 320 |
| 131 | 3300046457 | Ga0495590_0001838 | Ga0495590_0001838_3003_3965 | 320 |
| 132 | 3300046458 | Ga0495591_006200 | Ga0495591_006200_3361_4323 | 320 |
| 133 | 3300046460 | Ga0495638_0001251 | Ga0495638_0001251_18508_19470 | 320 |
| 134 | 3300046491 | Ga0495584_0200450 | Ga0495584_0200450_17_979 | 320 |
| 135 | 3300046501 | Ga0495607_0002730 | Ga0495607_0002730_9482_10444 | 320 |
| 136 | 3300046519 | Ga0495632_0007408 | Ga0495632_0007408_1580_2542 | 320 |
| 137 | 3300046522 | Ga0495643_0032039 | Ga0495643_0032039_1551_2513 | 320 |
| 138 | 3300046523 | Ga0495644_0001234 | Ga0495644_0001234_4429_5391 | 320 |
| 139 | 3300046542 | Ga0495597_0056054 | Ga0495597_0056054_478_1440 | 320 |
| 140 | 3300046692 | Ga0495671_0009870 | Ga0495671_0009870_1307_2269 | 320 |
| 141 | 3300046694 | Ga0495649_0003859 | Ga0495649_0003859_5300_6262 | 320 |
| 142 | 3300046810 | Ga0495660_0053697 | Ga0495660_0053697_902_1864 | 320 |
| 143 | 3300047320 | Ga0495672_0001830 | Ga0495672_0001830_5207_6169 | 320 |
| 144 | 3300047320 | Ga0495672_0002044 | Ga0495672_0002044_4429_5391 | 320 |
| 145 | 3300047323 | Ga0495683_0007760 | Ga0495683_0007760_227_1189 | 320 |
| 146 | 3300047469 | Ga0495673_0001021 | Ga0495673_0001021_4114_5076 | 320 |
| 147 | 3300048927 | Ga0496124_0004276 | Ga0496124_0004276_5068_6030 | 320 |
| 148 | 3300050492 | nmdc:mga0yw44_247174_c1 | nmdc:mga0yw44_247174_c1_119_1102 | 320 |
| 149 | 3300053153 | Ga0500616_0043944 | Ga0500616_0043944_440_1459 | 320 |
| 150 | iso_pu_bacteria | 2501025504 | 2501411952 | 320 |
| 151 | iso_pu_bacteria | 2510917014 | 2511100950 | 320 |
| 152 | iso_pu_bacteria | 2511231012 | 2511304758 | 320 |
| 153 | iso_pu_bacteria | 2511231014 | 2511313815 | 320 |
| 154 | iso_pu_bacteria | 2511231015 | 2511323085 | 320 |
| 155 | iso_pu_bacteria | 2511231017 | 2511334520 | 320 |
| 156 | iso_pu_bacteria | 2511231020 | 2511352501 | 320 |
| 157 | iso_pu_bacteria | 2511231021 | 2511357733 | 320 |
| 158 | iso_pu_bacteria | 2513237082 | 2513552360 | 320 |
| 159 | iso_pu_bacteria | 2513237083 | 2513565228 | 320 |
| 160 | iso_pu_bacteria | 2513237098 | 2513677494 | 320 |
| 161 | iso_pu_bacteria | 2513237166 | 2514054988 | 320 |
| 162 | iso_pu_bacteria | 2515154189 | 2516019955 | 320 |
| 163 | iso_pu_bacteria | 2617270735 | 2617347289 | 320 |
| 164 | iso_pu_bacteria | 2643221633 | 2644186694 | 320 |
| 165 | iso_pu_bacteria | 2643221643 | 2644239977 | 320 |
| 166 | iso_pu_bacteria | 2738541296 | 2738821156 | 320 |
| 167 | iso_pu_bacteria | 2738541298 | 2738833638 | 320 |
| 168 | iso_pu_bacteria | 2738541306 | 2738877045 | 320 |
| 169 | iso_pu_bacteria | 2738543002 | 2739186794 | 320 |
| 170 | iso_pu_bacteria | 2738543004 | 2739197725 | 320 |
| 171 | iso_pu_bacteria | 2738543008 | 2739223638 | 320 |
| 172 | iso_pu_bacteria | 2744054900 | 2746089991 | 320 |
| 173 | iso_pu_bacteria | 2744054901 | 2746098620 | 320 |
| 174 | iso_pu_bacteria | 2773857670 | 2774123601 | 320 |
| 175 | iso_pu_bacteria | 2784132072 | 2784317232 | 320 |
| 176 | iso_pu_bacteria | 2791355137 | 2792838295 | 320 |
| 177 | iso_pu_bacteria | 2860339153 | 2860342204 | 320 |
| 178 | iso_pu_bacteria | 2879099564 | 2879101613 | 320 |
| 179 | iso_pu_bacteria | 2883087390 | 2883088627 | 320 |
| 180 | iso_pu_bacteria | 2885383462 | 2885390995 | 320 |
| 181 | iso_pu_bacteria | 2904483920 | 2904486945 | 320 |
| 182 | iso_pu_bacteria | 2906635258 | 2906636604 | 320 |
| 183 | iso_pu_bacteria | 2919527303 | 2919528258 | 320 |
| 184 | iso_pu_bacteria | 2931396565 | 2931401138 | 320 |
| 185 | iso_pu_bacteria | 2935785616 | 2935793071 | 320 |
| 186 | iso_pu_bacteria | 2935793552 | 2935801131 | 320 |
| 187 | iso_pu_bacteria | 2939636861 | 2939641377 | 320 |
| 188 | iso_pu_bacteria | 2945934425 | 2945939451 | 320 |
| 189 | iso_pu_bacteria | 2990703756 | 2990706793 | 320 |
| 190 | iso_pu_bacteria | 3005409236 | 3005411721 | 320 |
| 191 | iso_pu_bacteria | 641736151 | 642424714 | 320 |
| 192 | iso_pu_bacteria | 8003955200 | 8003959278 | 320 |
| 193 | iso_pu_bacteria | 8016522445 | 8016524299 | 320 |
| 194 | iso_pu_bacteria | 8016530956 | 8016537850 | 320 |
| 195 | iso_pu_bacteria | 8016539877 | 8016542132 | 320 |
| 196 | iso_pu_bacteria | 8016548790 | 8016551150 | 320 |
| 197 | iso_pu_bacteria | 8016557553 | 8016559549 | 320 |
| 198 | iso_pu_bacteria | 8016575299 | 8016580211 | 320 |
| 199 | iso_pu_bacteria | 8016595262 | 8016597488 | 320 |
| 200 | iso_pu_bacteria | 8019530166 | 8019537524 | 320 |
| 201 | iso_pu_bacteria | 8019547302 | 8019555281 | 320 |
| 202 | iso_pu_bacteria | 8055301274 | 8055309088 | 320 |
| 203 | iso_pu_bacteria | 8056125926 | 8056129356 | 320 |
| 204 | 3300005290 | Ga0065712_10071037 | Ga0065712_100710376 | 321 |
| 205 | 3300005293 | Ga0065715_10110552 | Ga0065715_101105522 | 321 |
| 206 | 3300005327 | Ga0070658_10038553 | Ga0070658_100385533 | 321 |
| 207 | 3300005327 | Ga0070658_10088993 | Ga0070658_100889932 | 321 |
| 208 | 3300005328 | Ga0070676_10011830 | Ga0070676_100118308 | 321 |
| 209 | 3300005329 | Ga0070683_100009446 | Ga0070683_1000094464 | 321 |
| 210 | 3300005330 | Ga0070690_100022389 | Ga0070690_1000223892 | 321 |
| 211 | 3300005331 | Ga0070670_100140997 | Ga0070670_1001409972 | 321 |
| 212 | 3300005334 | Ga0068869_100025692 | Ga0068869_1000256924 | 321 |
| 213 | 3300005338 | Ga0068868_100035497 | Ga0068868_1000354976 | 321 |
| 214 | 3300005344 | Ga0070661_100004754 | Ga0070661_1000047542 | 321 |
| 215 | 3300005353 | Ga0070669_100003066 | Ga0070669_10000306611 | 321 |
| 216 | 3300005354 | Ga0070675_100003303 | Ga0070675_10000330311 | 321 |
| 217 | 3300005355 | Ga0070671_100106082 | Ga0070671_1001060822 | 321 |
| 218 | 3300005364 | Ga0070673_100074823 | Ga0070673_1000748233 | 321 |
| 219 | 3300005365 | Ga0070688_100006974 | Ga0070688_1000069747 | 321 |
| 220 | 3300005366 | Ga0070659_100020994 | Ga0070659_1000209944 | 321 |
| 221 | 3300005455 | Ga0070663_100002053 | Ga0070663_1000020537 | 321 |
| 222 | 3300005455 | Ga0070663_100003821 | Ga0070663_1000038214 | 321 |
| 223 | 3300005456 | Ga0070678_100007814 | Ga0070678_1000078148 | 321 |
| 224 | 3300005457 | Ga0070662_100006743 | Ga0070662_10000674311 | 321 |
| 225 | 3300005458 | Ga0070681_10085310 | Ga0070681_100853102 | 321 |
| 226 | 3300005458 | Ga0070681_10292041 | Ga0070681_102920411 | 321 |
| 227 | 3300005459 | Ga0068867_100059282 | Ga0068867_1000592821 | 321 |
| 228 | 3300005466 | Ga0070685_10001089 | Ga0070685_100010899 | 321 |
| 229 | 3300005535 | Ga0070684_100005692 | Ga0070684_10000569211 | 321 |
| 230 | 3300005535 | Ga0070684_100344398 | Ga0070684_1003443982 | 321 |
| 231 | 3300005543 | Ga0070672_100002263 | Ga0070672_10000226311 | 321 |
| 232 | 3300005546 | Ga0070696_100088416 | Ga0070696_1000884162 | 321 |
| 233 | 3300005563 | Ga0068855_100032462 | Ga0068855_1000324624 | 321 |
| 234 | 3300005563 | Ga0068855_100059748 | Ga0068855_1000597484 | 321 |
| 235 | 3300005577 | Ga0068857_100010201 | Ga0068857_1000102012 | 321 |
| 236 | 3300005578 | Ga0068854_100100541 | Ga0068854_1001005413 | 321 |
| 237 | 3300005614 | Ga0068856_100051411 | Ga0068856_1000514112 | 321 |
| 238 | 3300005616 | Ga0068852_100000608 | Ga0068852_1000006082 | 321 |
| 239 | 3300005718 | Ga0068866_10024206 | Ga0068866_100242064 | 321 |
| 240 | 3300005834 | Ga0068851_10002037 | Ga0068851_100020374 | 321 |
| 241 | 3300005840 | Ga0068870_10011138 | Ga0068870_100111384 | 321 |
| 242 | 3300005841 | Ga0068863_100003501 | Ga0068863_1000035013 | 321 |
| 243 | 3300005842 | Ga0068858_100141536 | Ga0068858_1001415362 | 321 |
| 244 | 3300005844 | Ga0068862_100018369 | Ga0068862_1000183693 | 321 |
| 245 | 3300006237 | Ga0097621_100108811 | Ga0097621_1001088112 | 321 |
| 246 | 3300006881 | Ga0068865_100006599 | Ga0068865_1000065997 | 321 |
| 247 | 3300009093 | Ga0105240_10009514 | Ga0105240_100095145 | 321 |
| 248 | 3300009098 | Ga0105245_10023853 | Ga0105245_100238534 | 321 |
| 249 | 3300009101 | Ga0105247_10005335 | Ga0105247_100053352 | 321 |
| 250 | 3300009174 | Ga0105241_10072609 | Ga0105241_100726093 | 321 |
| 251 | 3300009176 | Ga0105242_10089593 | Ga0105242_100895933 | 321 |
| 252 | 3300009177 | Ga0105248_10523791 | Ga0105248_105237911 | 321 |
| 253 | 3300009545 | Ga0105237_10418830 | Ga0105237_104188301 | 321 |
| 254 | 3300009551 | Ga0105238_10094665 | Ga0105238_100946654 | 321 |
| 255 | 3300010375 | Ga0105239_10155010 | Ga0105239_101550104 | 321 |
| 256 | 3300011119 | Ga0105246_10001423 | Ga0105246_100014238 | 321 |
| 257 | 3300013100 | Ga0157373_10005649 | Ga0157373_100056498 | 321 |
| 258 | 3300013102 | Ga0157371_10013270 | Ga0157371_100132707 | 321 |
| 259 | 3300013104 | Ga0157370_10000003 | Ga0157370_100000035 | 321 |
| 260 | 3300013104 | Ga0157370_10007047 | Ga0157370_1000704711 | 321 |
| 261 | 3300013105 | Ga0157369_10000377 | Ga0157369_1000037727 | 321 |
| 262 | 3300013296 | Ga0157374_10065223 | Ga0157374_100652234 | 321 |
| 263 | 3300013306 | Ga0163162_10217608 | Ga0163162_102176082 | 321 |
| 264 | 3300013307 | Ga0157372_10018203 | Ga0157372_100182033 | 321 |
| 265 | 3300013308 | Ga0157375_10152127 | Ga0157375_101521273 | 321 |
| 266 | 3300014325 | Ga0163163_10001651 | Ga0163163_1000165111 | 321 |
| 267 | 3300014745 | Ga0157377_10004857 | Ga0157377_100048573 | 321 |
| 268 | 3300014968 | Ga0157379_10047635 | Ga0157379_100476354 | 321 |
| 269 | 3300014969 | Ga0157376_10040609 | Ga0157376_100406093 | 321 |
| 270 | 3300017792 | Ga0163161_10055756 | Ga0163161_100557563 | 321 |
| 271 | 3300025900 | Ga0207710_10028258 | Ga0207710_100282583 | 321 |
| 272 | 3300025904 | Ga0207647_10026914 | Ga0207647_100269144 | 321 |
| 273 | 3300025907 | Ga0207645_10001972 | Ga0207645_1000197213 | 321 |
| 274 | 3300025908 | Ga0207643_10000620 | Ga0207643_1000062018 | 321 |
| 275 | 3300025909 | Ga0207705_10012636 | Ga0207705_100126367 | 321 |
| 276 | 3300025912 | Ga0207707_10074197 | Ga0207707_100741974 | 321 |
| 277 | 3300025912 | Ga0207707_10309943 | Ga0207707_103099432 | 321 |
| 278 | 3300025913 | Ga0207695_10000316 | Ga0207695_1000031699 | 321 |
| 279 | 3300025913 | Ga0207695_10019383 | Ga0207695_100193836 | 321 |
| 280 | 3300025914 | Ga0207671_10259237 | Ga0207671_102592371 | 321 |
| 281 | 3300025918 | Ga0207662_10000359 | Ga0207662_1000035918 | 321 |
| 282 | 3300025919 | Ga0207657_10064227 | Ga0207657_100642274 | 321 |
| 283 | 3300025920 | Ga0207649_10000963 | Ga0207649_1000096310 | 321 |
| 284 | 3300025923 | Ga0207681_10006066 | Ga0207681_100060662 | 321 |
| 285 | 3300025925 | Ga0207650_10000076 | Ga0207650_100000762 | 321 |
| 286 | 3300025926 | Ga0207659_10076448 | Ga0207659_100764482 | 321 |
| 287 | 3300025931 | Ga0207644_10025573 | Ga0207644_100255734 | 321 |
| 288 | 3300025932 | Ga0207690_10023247 | Ga0207690_100232474 | 321 |
| 289 | 3300025933 | Ga0207706_10001653 | Ga0207706_1000165314 | 321 |
| 290 | 3300025934 | Ga0207686_10330008 | Ga0207686_103300081 | 321 |
| 291 | 3300025936 | Ga0207670_10052298 | Ga0207670_100522982 | 321 |
| 292 | 3300025940 | Ga0207691_10000188 | Ga0207691_1000018816 | 321 |
| 293 | 3300025941 | Ga0207711_10031378 | Ga0207711_100313784 | 321 |
| 294 | 3300025942 | Ga0207689_10003791 | Ga0207689_1000379110 | 321 |
| 295 | 3300025944 | Ga0207661_10005191 | Ga0207661_100051911 | 321 |
| 296 | 3300025945 | Ga0207679_10000338 | Ga0207679_1000033811 | 321 |
| 297 | 3300025949 | Ga0207667_10009354 | Ga0207667_100093544 | 321 |
| 298 | 3300025949 | Ga0207667_10061946 | Ga0207667_100619464 | 321 |
| 299 | 3300025981 | Ga0207640_10055570 | Ga0207640_100555703 | 321 |
| 300 | 3300026035 | Ga0207703_10060520 | Ga0207703_100605204 | 321 |
| 301 | 3300026067 | Ga0207678_10000412 | Ga0207678_100004126 | 321 |
| 302 | 3300026067 | Ga0207678_10226519 | Ga0207678_102265192 | 321 |
| 303 | 3300026088 | Ga0207641_10000150 | Ga0207641_1000015041 | 321 |
| 304 | 3300026089 | Ga0207648_10009761 | Ga0207648_100097616 | 321 |
| 305 | 3300026095 | Ga0207676_10003432 | Ga0207676_100034328 | 321 |
| 306 | 3300026116 | Ga0207674_10005839 | Ga0207674_100058399 | 321 |
| 307 | 3300026116 | Ga0207674_10340424 | Ga0207674_103404241 | 321 |
| 308 | 3300026121 | Ga0207683_10015528 | Ga0207683_100155286 | 321 |
| 309 | 3300026142 | Ga0207698_10000271 | Ga0207698_100002716 | 321 |
| 310 | 3300026142 | Ga0207698_10018413 | Ga0207698_100184134 | 321 |
| 311 | 3300028379 | Ga0268266_10041675 | Ga0268266_100416752 | 321 |
| 312 | 3300028380 | Ga0268265_10003595 | Ga0268265_1000359510 | 321 |
| 313 | 3300031731 | Ga0307405_10001068 | Ga0307405_1000106811 | 321 |
| 314 | 3300031824 | Ga0307413_10001705 | Ga0307413_100017054 | 321 |
| 315 | 3300031852 | Ga0307410_10001648 | Ga0307410_100016481 | 321 |
| 316 | 3300031995 | Ga0307409_100024836 | Ga0307409_1000248363 | 321 |
| 317 | 3300032002 | Ga0307416_100038874 | Ga0307416_1000388744 | 321 |
| 318 | 3300032005 | Ga0307411_10001044 | Ga0307411_100010447 | 321 |
| 319 | 3300042010 | Ga0439452_007172 | Ga0439452_007172_2061_3026 | 321 |
| 320 | 3300042138 | Ga0450903_001483 | Ga0450903_001483_739_1704 | 321 |
| 321 | 3300047320 | Ga0495672_0026911 | Ga0495672_0026911_1814_2797 | 321 |
| 322 | 3300048903 | Ga0496100_0198453 | Ga0496100_0198453_140_1153 | 321 |
| 323 | 3300048909 | Ga0496106_0152564 | Ga0496106_0152564_578_1591 | 321 |
| 324 | 3300048911 | Ga0496108_0000303 | Ga0496108_0000303_40956_41969 | 321 |
| 325 | 3300048912 | Ga0496109_0000504 | Ga0496109_0000504_16355_17368 | 321 |
| 326 | 3300048913 | Ga0496110_0001004 | Ga0496110_0001004_14334_15347 | 321 |
| 327 | 3300048915 | Ga0496112_0000042 | Ga0496112_0000042_81281_82294 | 321 |
| 328 | 3300048916 | Ga0496113_0006588 | Ga0496113_0006588_989_2002 | 321 |
| 329 | 3300050515 | nmdc:mga0a205_35009_c1 | nmdc:mga0a205_35009_c1_1517_2497 | 321 |
| 330 | 3300005288 | Ga0065714_10007661 | Ga0065714_100076613 | 322 |
| 331 | 3300005293 | Ga0065715_10089898 | Ga0065715_100898982 | 322 |
| 332 | 3300005355 | Ga0070671_100043540 | Ga0070671_1000435403 | 322 |
| 333 | 3300005355 | Ga0070671_100100895 | Ga0070671_1001008953 | 322 |
| 334 | 3300005530 | Ga0070679_100346592 | Ga0070679_1003465921 | 322 |
| 335 | 3300005618 | Ga0068864_100105488 | Ga0068864_1001054883 | 322 |
| 336 | 3300005844 | Ga0068862_100440717 | Ga0068862_1004407171 | 322 |
| 337 | 3300006852 | Ga0075433_10037910 | Ga0075433_100379103 | 322 |
| 338 | 3300007076 | Ga0075435_100001379 | Ga0075435_10000137914 | 322 |
| 339 | 3300013100 | Ga0157373_10003842 | Ga0157373_100038429 | 322 |
| 340 | 3300017792 | Ga0163161_10002355 | Ga0163161_100023553 | 322 |
| 341 | 3300025931 | Ga0207644_10126552 | Ga0207644_101265522 | 322 |
| 342 | 3300025931 | Ga0207644_10140784 | Ga0207644_101407842 | 322 |
| 343 | 3300026075 | Ga0207708_10372553 | Ga0207708_103725531 | 322 |
| 344 | 3300026118 | Ga0207675_100529731 | Ga0207675_1005297312 | 322 |
| 345 | 3300030521 | Ga0307511_10056545 | Ga0307511_100565452 | 322 |
| 346 | 3300041405 | Ga0439438_023548 | Ga0439438_023548_629_1597 | 322 |
| 347 | 3300041407 | Ga0439447_000499 | Ga0439447_000499_7741_8709 | 322 |
| 348 | 3300041411 | Ga0439466_0000604 | Ga0439466_0000604_6630_7598 | 322 |
| 349 | 3300042010 | Ga0439452_000230 | Ga0439452_000230_29156_30124 | 322 |
| 350 | 3300042137 | Ga0450902_002707 | Ga0450902_002707_1184_2152 | 322 |
| 351 | 3300046460 | Ga0495638_0138704 | Ga0495638_0138704_321_1289 | 322 |
| 352 | 3300046519 | Ga0495632_0144654 | Ga0495632_0144654_53_1021 | 322 |
| 353 | 3300046542 | Ga0495597_0004173 | Ga0495597_0004173_6614_7582 | 322 |
| 354 | 3300046557 | Ga0495622_0002129 | Ga0495622_0002129_6293_7261 | 322 |
| 355 | 3300046615 | Ga0495656_0012309 | Ga0495656_0012309_48_1025 | 322 |
| 356 | 3300046615 | Ga0495656_0019679 | Ga0495656_0019679_729_1706 | 322 |
| 357 | 3300046660 | Ga0495625_0194119 | Ga0495625_0194119_82_1050 | 322 |
| 358 | 3300046674 | Ga0495588_0005503 | Ga0495588_0005503_1968_2936 | 322 |
| 359 | 3300047318 | Ga0495636_0000052 | Ga0495636_0000052_26819_27796 | 322 |
| 360 | 3300047318 | Ga0495636_0007339 | Ga0495636_0007339_2653_3630 | 322 |
| 361 | 3300047318 | Ga0495636_0019442 | Ga0495636_0019442_538_1515 | 322 |
| 362 | 3300047470 | Ga0495681_0000023 | Ga0495681_0000023_143349_144317 | 322 |
| 363 | 3300048911 | Ga0496108_0180559 | Ga0496108_0180559_518_1498 | 322 |
| 364 | 3300048915 | Ga0496112_0223438 | Ga0496112_0223438_148_1128 | 322 |
| 365 | 3300005336 | Ga0070680_100018122 | Ga0070680_1000181222 | 323 |
| 366 | 3300005434 | Ga0070709_10122260 | Ga0070709_101222601 | 323 |
| 367 | 3300005436 | Ga0070713_100060462 | Ga0070713_1000604623 | 323 |
| 368 | 3300005458 | Ga0070681_10018802 | Ga0070681_100188025 | 323 |
| 369 | 3300005458 | Ga0070681_10071858 | Ga0070681_100718582 | 323 |
| 370 | 3300005530 | Ga0070679_100032902 | Ga0070679_1000329021 | 323 |
| 371 | 3300005535 | Ga0070684_100226623 | Ga0070684_1002266232 | 323 |
| 372 | 3300005548 | Ga0070665_100001922 | Ga0070665_10000192221 | 323 |
| 373 | 3300005564 | Ga0070664_100343512 | Ga0070664_1003435122 | 323 |
| 374 | 3300005615 | Ga0070702_100176577 | Ga0070702_1001765771 | 323 |
| 375 | 3300005841 | Ga0068863_100046411 | Ga0068863_1000464112 | 323 |
| 376 | 3300006038 | Ga0075365_10042160 | Ga0075365_100421602 | 323 |
| 377 | 3300006051 | Ga0075364_10084692 | Ga0075364_100846924 | 323 |
| 378 | 3300006177 | Ga0075362_10037629 | Ga0075362_100376292 | 323 |
| 379 | 3300006178 | Ga0075367_10058144 | Ga0075367_100581445 | 323 |
| 380 | 3300009147 | Ga0114129_10492827 | Ga0114129_104928272 | 323 |
| 381 | 3300009148 | Ga0105243_10000027 | Ga0105243_1000002747 | 323 |
| 382 | 3300009176 | Ga0105242_10000056 | Ga0105242_1000005649 | 323 |
| 383 | 3300009177 | Ga0105248_10076392 | Ga0105248_100763921 | 323 |
| 384 | 3300013296 | Ga0157374_10024813 | Ga0157374_100248133 | 323 |
| 385 | 3300025906 | Ga0207699_10105778 | Ga0207699_101057782 | 323 |
| 386 | 3300025912 | Ga0207707_10239773 | Ga0207707_102397732 | 323 |
| 387 | 3300025916 | Ga0207663_10010388 | Ga0207663_100103888 | 323 |
| 388 | 3300025921 | Ga0207652_10466627 | Ga0207652_104666271 | 323 |
| 389 | 3300025928 | Ga0207700_10054587 | Ga0207700_100545874 | 323 |
| 390 | 3300025934 | Ga0207686_10000008 | Ga0207686_1000000847 | 323 |
| 391 | 3300025935 | Ga0207709_10000025 | Ga0207709_1000002597 | 323 |
| 392 | 3300025941 | Ga0207711_10079993 | Ga0207711_100799931 | 323 |
| 393 | 3300025981 | Ga0207640_10256700 | Ga0207640_102567002 | 323 |
| 394 | 3300026088 | Ga0207641_10044045 | Ga0207641_100440452 | 323 |
| 395 | 3300026121 | Ga0207683_10141831 | Ga0207683_101418312 | 323 |
| 396 | 3300028379 | Ga0268266_10000615 | Ga0268266_1000061521 | 323 |
| 397 | 3300028380 | Ga0268265_10030751 | Ga0268265_100307514 | 323 |
| 398 | 3300031995 | Ga0307409_100132390 | Ga0307409_1001323902 | 323 |
| 399 | 3300041512 | Ga0451853_2342740 | Ga0451853_2342740_254_1246 | 323 |
| 400 | 3300046460 | Ga0495638_0013813 | Ga0495638_0013813_2472_3443 | 323 |
| 401 | 3300046542 | Ga0495597_0004130 | Ga0495597_0004130_3515_4486 | 323 |
| 402 | 3300048908 | Ga0496105_0300152 | Ga0496105_0300152_154_1149 | 323 |
| 403 | 3300049515 | Ga0501292_005045 | Ga0501292_005045_18_1010 | 323 |
| 404 | 3300049521 | Ga0501298_022062 | Ga0501298_022062_48_1040 | 323 |
| 405 | 3300049522 | Ga0501299_002137 | Ga0501299_002137_758_1750 | 323 |
| 406 | 3300049661 | Ga0501217_006254 | Ga0501217_006254_760_1752 | 323 |
| 407 | 3300049779 | Ga0501283_016512 | Ga0501283_016512_65_1057 | 323 |
| 408 | 3300050489 | nmdc:mga03683_1054_c1 | nmdc:mga03683_1054_c1_1936_2928 | 323 |
| 409 | 3300053088 | Ga0500644_0013412 | Ga0500644_0013412_1071_2066 | 323 |
| 410 | 3300053119 | Ga0500595_007412 | Ga0500595_007412_1344_2339 | 323 |
| 411 | 3300001979 | JGI24740J21852_10030275 | JGI24740J21852_100302751 | 324 |
| 412 | 3300001989 | JGI24739J22299_10000469 | JGI24739J22299_1000046911 | 324 |
| 413 | 3300002067 | JGI24735J21928_10017968 | JGI24735J21928_100179682 | 324 |
| 414 | 3300002075 | JGI24738J21930_10002384 | JGI24738J21930_100023843 | 324 |
| 415 | 3300002705 | JGI25156J39149_1000269 | JGI25156J39149_100026920 | 324 |
| 416 | 3300003214 | JGI25165J46597_1000606 | JGI25165J46597_10006065 | 324 |
| 417 | 3300003756 | Ga0055533_1000140 | Ga0055533_100014035 | 324 |
| 418 | 3300003758 | Ga0055532_1000003 | Ga0055532_1000003275 | 324 |
| 419 | 3300003760 | Ga0055527_1000006 | Ga0055527_1000006181 | 324 |
| 420 | 3300003761 | Ga0055535_1000003 | Ga0055535_1000003275 | 324 |
| 421 | 3300003762 | Ga0055542_1000007 | Ga0055542_1000007275 | 324 |
| 422 | 3300003763 | Ga0055529_1000003 | Ga0055529_1000003181 | 324 |
| 423 | 3300005288 | Ga0065714_10000224 | Ga0065714_100002248 | 324 |
| 424 | 3300005288 | Ga0065714_10128234 | Ga0065714_101282341 | 324 |
| 425 | 3300005290 | Ga0065712_10020220 | Ga0065712_100202201 | 324 |
| 426 | 3300005290 | Ga0065712_10069381 | Ga0065712_100693814 | 324 |
| 427 | 3300005293 | Ga0065715_10038261 | Ga0065715_100382612 | 324 |
| 428 | 3300005293 | Ga0065715_10136864 | Ga0065715_101368642 | 324 |
| 429 | 3300005293 | Ga0065715_10249136 | Ga0065715_102491361 | 324 |
| 430 | 3300005329 | Ga0070683_100224798 | Ga0070683_1002247982 | 324 |
| 431 | 3300005338 | Ga0068868_100191086 | Ga0068868_1001910862 | 324 |
| 432 | 3300005339 | Ga0070660_100111098 | Ga0070660_1001110983 | 324 |
| 433 | 3300005339 | Ga0070660_100128322 | Ga0070660_1001283222 | 324 |
| 434 | 3300005340 | Ga0070689_100000031 | Ga0070689_10000003159 | 324 |
| 435 | 3300005340 | Ga0070689_100230745 | Ga0070689_1002307452 | 324 |
| 436 | 3300005343 | Ga0070687_100001327 | Ga0070687_1000013273 | 324 |
| 437 | 3300005356 | Ga0070674_100072799 | Ga0070674_1000727992 | 324 |
| 438 | 3300005365 | Ga0070688_100000612 | Ga0070688_1000006127 | 324 |
| 439 | 3300005366 | Ga0070659_100060442 | Ga0070659_1000604422 | 324 |
| 440 | 3300005438 | Ga0070701_10000522 | Ga0070701_1000052211 | 324 |
| 441 | 3300005440 | Ga0070705_100013917 | Ga0070705_1000139173 | 324 |
| 442 | 3300005440 | Ga0070705_100117135 | Ga0070705_1001171352 | 324 |
| 443 | 3300005441 | Ga0070700_100000180 | Ga0070700_1000001805 | 324 |
| 444 | 3300005444 | Ga0070694_100011224 | Ga0070694_1000112243 | 324 |
| 445 | 3300005445 | Ga0070708_100164839 | Ga0070708_1001648393 | 324 |
| 446 | 3300005456 | Ga0070678_100473812 | Ga0070678_1004738121 | 324 |
| 447 | 3300005459 | Ga0068867_100001414 | Ga0068867_1000014144 | 324 |
| 448 | 3300005459 | Ga0068867_100118756 | Ga0068867_1001187563 | 324 |
| 449 | 3300005467 | Ga0070706_100211199 | Ga0070706_1002111993 | 324 |
| 450 | 3300005468 | Ga0070707_100031250 | Ga0070707_1000312503 | 324 |
| 451 | 3300005468 | Ga0070707_100116735 | Ga0070707_1001167353 | 324 |
| 452 | 3300005471 | Ga0070698_100149071 | Ga0070698_1001490712 | 324 |
| 453 | 3300005535 | Ga0070684_100443721 | Ga0070684_1004437211 | 324 |
| 454 | 3300005536 | Ga0070697_100009345 | Ga0070697_1000093453 | 324 |
| 455 | 3300005539 | Ga0068853_100004494 | Ga0068853_1000044943 | 324 |
| 456 | 3300005544 | Ga0070686_100000517 | Ga0070686_1000005175 | 324 |
| 457 | 3300005544 | Ga0070686_100138768 | Ga0070686_1001387682 | 324 |
| 458 | 3300005546 | Ga0070696_100039656 | Ga0070696_1000396562 | 324 |
| 459 | 3300005549 | Ga0070704_100021775 | Ga0070704_1000217753 | 324 |
| 460 | 3300005615 | Ga0070702_100096420 | Ga0070702_1000964202 | 324 |
| 461 | 3300005618 | Ga0068864_100111947 | Ga0068864_1001119473 | 324 |
| 462 | 3300005618 | Ga0068864_100293734 | Ga0068864_1002937342 | 324 |
| 463 | 3300005718 | Ga0068866_10026751 | Ga0068866_100267514 | 324 |
| 464 | 3300005841 | Ga0068863_100336118 | Ga0068863_1003361182 | 324 |
| 465 | 3300005842 | Ga0068858_100054556 | Ga0068858_1000545563 | 324 |
| 466 | 3300005843 | Ga0068860_100070188 | Ga0068860_1000701883 | 324 |
| 467 | 3300005844 | Ga0068862_100218232 | Ga0068862_1002182322 | 324 |
| 468 | 3300005844 | Ga0068862_100411672 | Ga0068862_1004116722 | 324 |
| 469 | 3300005983 | Ga0081540_1000537 | Ga0081540_100053722 | 324 |
| 470 | 3300005983 | Ga0081540_1000611 | Ga0081540_100061120 | 324 |
| 471 | 3300006051 | Ga0075364_10079667 | Ga0075364_100796672 | 324 |
| 472 | 3300006051 | Ga0075364_10130304 | Ga0075364_101303042 | 324 |
| 473 | 3300006058 | Ga0075432_10063094 | Ga0075432_100630941 | 324 |
| 474 | 3300006178 | Ga0075367_10006892 | Ga0075367_100068923 | 324 |
| 475 | 3300006178 | Ga0075367_10120039 | Ga0075367_101200392 | 324 |
| 476 | 3300006195 | Ga0075366_10067532 | Ga0075366_100675323 | 324 |
| 477 | 3300006844 | Ga0075428_100258204 | Ga0075428_1002582041 | 324 |
| 478 | 3300006846 | Ga0075430_100000150 | Ga0075430_10000015015 | 324 |
| 479 | 3300006847 | Ga0075431_100000478 | Ga0075431_1000004785 | 324 |
| 480 | 3300006852 | Ga0075433_10089694 | Ga0075433_100896943 | 324 |
| 481 | 3300006881 | Ga0068865_100129270 | Ga0068865_1001292702 | 324 |
| 482 | 3300009036 | Ga0105244_10029726 | Ga0105244_100297263 | 324 |
| 483 | 3300009101 | Ga0105247_10008256 | Ga0105247_100082565 | 324 |
| 484 | 3300009147 | Ga0114129_10396739 | Ga0114129_103967393 | 324 |
| 485 | 3300009177 | Ga0105248_10001714 | Ga0105248_100017149 | 324 |
| 486 | 3300009177 | Ga0105248_10003555 | Ga0105248_1000355515 | 324 |
| 487 | 3300009177 | Ga0105248_10098363 | Ga0105248_100983631 | 324 |
| 488 | 3300009177 | Ga0105248_10115639 | Ga0105248_101156392 | 324 |
| 489 | 3300009177 | Ga0105248_10217303 | Ga0105248_102173032 | 324 |
| 490 | 3300009551 | Ga0105238_10199530 | Ga0105238_101995302 | 324 |
| 491 | 3300010159 | Ga0099796_10027736 | Ga0099796_100277362 | 324 |
| 492 | 3300010375 | Ga0105239_10060831 | Ga0105239_100608313 | 324 |
| 493 | 3300013100 | Ga0157373_10093534 | Ga0157373_100935341 | 324 |
| 494 | 3300013296 | Ga0157374_10007769 | Ga0157374_1000776910 | 324 |
| 495 | 3300013296 | Ga0157374_10295845 | Ga0157374_102958452 | 324 |
| 496 | 3300013306 | Ga0163162_10213326 | Ga0163162_102133262 | 324 |
| 497 | 3300013307 | Ga0157372_10046450 | Ga0157372_100464504 | 324 |
| 498 | 3300013307 | Ga0157372_10063606 | Ga0157372_100636064 | 324 |
| 499 | 3300013308 | Ga0157375_10020435 | Ga0157375_100204357 | 324 |
| 500 | 3300013308 | Ga0157375_10027192 | Ga0157375_100271923 | 324 |
| 501 | 3300013308 | Ga0157375_10291332 | Ga0157375_102913322 | 324 |
| 502 | 3300013308 | Ga0157375_10640312 | Ga0157375_106403122 | 324 |
| 503 | 3300014325 | Ga0163163_10022523 | Ga0163163_100225234 | 324 |
| 504 | 3300014326 | Ga0157380_10072364 | Ga0157380_100723641 | 324 |
| 505 | 3300014497 | Ga0182008_10005197 | Ga0182008_100051977 | 324 |
| 506 | 3300014969 | Ga0157376_10051207 | Ga0157376_100512072 | 324 |
| 507 | 3300017792 | Ga0163161_10008695 | Ga0163161_100086959 | 324 |
| 508 | 3300017792 | Ga0163161_10177205 | Ga0163161_101772052 | 324 |
| 509 | 3300021361 | Ga0213872_10000280 | Ga0213872_1000028013 | 324 |
| 510 | 3300021361 | Ga0213872_10007442 | Ga0213872_100074426 | 324 |
| 511 | 3300025226 | Ga0209674_100025 | Ga0209674_100025266 | 324 |
| 512 | 3300025228 | Ga0209672_100002 | Ga0209672_1000021169 | 324 |
| 513 | 3300025229 | Ga0209147_100003 | Ga0209147_1000031169 | 324 |
| 514 | 3300025230 | Ga0209563_101861 | Ga0209563_1018616 | 324 |
| 515 | 3300025242 | Ga0209258_100005 | Ga0209258_100005811 | 324 |
| 516 | 3300025254 | Ga0209148_1000006 | Ga0209148_10000061169 | 324 |
| 517 | 3300025256 | Ga0209759_1000014 | Ga0209759_1000014185 | 324 |
| 518 | 3300025256 | Ga0209759_1022745 | Ga0209759_10227452 | 324 |
| 519 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018184 | 324 |
| 520 | 3300025272 | Ga0209455_1000003 | Ga0209455_10000031169 | 324 |
| 521 | 3300025292 | Ga0209676_1001951 | Ga0209676_10019519 | 324 |
| 522 | 3300025298 | Ga0209050_1001399 | Ga0209050_10013997 | 324 |
| 523 | 3300025303 | Ga0209051_1005551 | Ga0209051_10055517 | 324 |
| 524 | 3300025728 | Ga0207655_1012147 | Ga0207655_10121472 | 324 |
| 525 | 3300025728 | Ga0207655_1018366 | Ga0207655_10183664 | 324 |
| 526 | 3300025728 | Ga0207655_1040805 | Ga0207655_10408052 | 324 |
| 527 | 3300025735 | Ga0207713_1009943 | Ga0207713_10099435 | 324 |
| 528 | 3300025735 | Ga0207713_1019882 | Ga0207713_10198824 | 324 |
| 529 | 3300025900 | Ga0207710_10076165 | Ga0207710_100761651 | 324 |
| 530 | 3300025901 | Ga0207688_10060540 | Ga0207688_100605401 | 324 |
| 531 | 3300025904 | Ga0207647_10025026 | Ga0207647_100250263 | 324 |
| 532 | 3300025918 | Ga0207662_10020839 | Ga0207662_100208392 | 324 |
| 533 | 3300025924 | Ga0207694_10238428 | Ga0207694_102384281 | 324 |
| 534 | 3300025927 | Ga0207687_10044799 | Ga0207687_100447995 | 324 |
| 535 | 3300025931 | Ga0207644_10094292 | Ga0207644_100942923 | 324 |
| 536 | 3300025934 | Ga0207686_10145742 | Ga0207686_101457422 | 324 |
| 537 | 3300025936 | Ga0207670_10000040 | Ga0207670_1000004032 | 324 |
| 538 | 3300025938 | Ga0207704_10074612 | Ga0207704_100746123 | 324 |
| 539 | 3300025941 | Ga0207711_10005840 | Ga0207711_100058406 | 324 |
| 540 | 3300025941 | Ga0207711_10011905 | Ga0207711_100119057 | 324 |
| 541 | 3300026035 | Ga0207703_10112543 | Ga0207703_101125433 | 324 |
| 542 | 3300026041 | Ga0207639_10006884 | Ga0207639_100068844 | 324 |
| 543 | 3300026075 | Ga0207708_10000662 | Ga0207708_1000066222 | 324 |
| 544 | 3300026088 | Ga0207641_10359129 | Ga0207641_103591292 | 324 |
| 545 | 3300026088 | Ga0207641_10404695 | Ga0207641_104046952 | 324 |
| 546 | 3300026089 | Ga0207648_10004215 | Ga0207648_100042154 | 324 |
| 547 | 3300026089 | Ga0207648_10053166 | Ga0207648_100531662 | 324 |
| 548 | 3300026095 | Ga0207676_10215670 | Ga0207676_102156702 | 324 |
| 549 | 3300026116 | Ga0207674_10330240 | Ga0207674_103302401 | 324 |
| 550 | 3300026118 | Ga0207675_100396165 | Ga0207675_1003961652 | 324 |
| 551 | 3300026121 | Ga0207683_10377638 | Ga0207683_103776382 | 324 |
| 552 | 3300027866 | Ga0209813_10011555 | Ga0209813_100115553 | 324 |
| 553 | 3300027907 | Ga0207428_10036666 | Ga0207428_100366663 | 324 |
| 554 | 3300027907 | Ga0207428_10039625 | Ga0207428_100396254 | 324 |
| 555 | 3300028379 | Ga0268266_10008573 | Ga0268266_1000857311 | 324 |
| 556 | 3300031911 | Ga0307412_10000059 | Ga0307412_10000059131 | 324 |
| 557 | 3300031995 | Ga0307409_100019267 | Ga0307409_1000192673 | 324 |
| 558 | 3300032005 | Ga0307411_10003927 | Ga0307411_100039276 | 324 |
| 559 | 3300032126 | Ga0307415_100170684 | Ga0307415_1001706841 | 324 |
| 560 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006137 | 324 |
| 561 | 3300039447 | Ga0436361_0207335 | Ga0436361_0207335_24020_25090 | 324 |
| 562 | 3300039447 | Ga0436361_0505993 | Ga0436361_0505993_84_1082 | 324 |
| 563 | 3300039450 | Ga0436363_0511569 | Ga0436363_0511569_535_1527 | 324 |
| 564 | 3300041407 | Ga0439447_000346 | Ga0439447_000346_12859_13833 | 324 |
| 565 | 3300041407 | Ga0439447_002025 | Ga0439447_002025_3206_4180 | 324 |
| 566 | 3300041411 | Ga0439466_0007575 | Ga0439466_0007575_2579_3553 | 324 |
| 567 | 3300041411 | Ga0439466_0010466 | Ga0439466_0010466_1842_2816 | 324 |
| 568 | 3300041411 | Ga0439466_0021018 | Ga0439466_0021018_994_1968 | 324 |
| 569 | 3300042006 | Ga0439432_008458 | Ga0439432_008458_2094_3068 | 324 |
| 570 | 3300042122 | Ga0450920_002005 | Ga0450920_002005_730_1704 | 324 |
| 571 | 3300042124 | Ga0450922_000480 | Ga0450922_000480_248_1222 | 324 |
| 572 | 3300042138 | Ga0450903_000556 | Ga0450903_000556_6613_7587 | 324 |
| 573 | 3300042145 | Ga0450906_003883 | Ga0450906_003883_2165_3139 | 324 |
| 574 | 3300042146 | Ga0450907_000486 | Ga0450907_000486_7855_8829 | 324 |
| 575 | 3300042184 | Ga0450908_001794 | Ga0450908_001794_2842_3834 | 324 |
| 576 | 3300042184 | Ga0450908_006952 | Ga0450908_006952_759_1733 | 324 |
| 577 | 3300042436 | Ga0439435_0008367 | Ga0439435_0008367_654_1646 | 324 |
| 578 | 3300045051 | Ga0451576_0401455 | Ga0451576_0401455_268_1260 | 324 |
| 579 | 3300046452 | Ga0495617_000993 | Ga0495617_000993_7271_8245 | 324 |
| 580 | 3300046452 | Ga0495617_002201 | Ga0495617_002201_2034_3008 | 324 |
| 581 | 3300046454 | Ga0495592_0082496 | Ga0495592_0082496_239_1231 | 324 |
| 582 | 3300046455 | Ga0495603_0005483 | Ga0495603_0005483_1702_2676 | 324 |
| 583 | 3300046455 | Ga0495603_0032139 | Ga0495603_0032139_378_1370 | 324 |
| 584 | 3300046457 | Ga0495590_0001284 | Ga0495590_0001284_4299_5273 | 324 |
| 585 | 3300046459 | Ga0495629_0006111 | Ga0495629_0006111_7669_8661 | 324 |
| 586 | 3300046459 | Ga0495629_0018154 | Ga0495629_0018154_978_1970 | 324 |
| 587 | 3300046460 | Ga0495638_0013563 | Ga0495638_0013563_3612_4586 | 324 |
| 588 | 3300046460 | Ga0495638_0074556 | Ga0495638_0074556_616_1590 | 324 |
| 589 | 3300046461 | Ga0495641_0021072 | Ga0495641_0021072_1022_2014 | 324 |
| 590 | 3300046463 | Ga0495653_0003309 | Ga0495653_0003309_11568_12560 | 324 |
| 591 | 3300046471 | Ga0495650_0003886 | Ga0495650_0003886_79_1053 | 324 |
| 592 | 3300046472 | Ga0495580_0000252 | Ga0495580_0000252_31468_32466 | 324 |
| 593 | 3300046472 | Ga0495580_0007518 | Ga0495580_0007518_7571_8563 | 324 |
| 594 | 3300046472 | Ga0495580_0093257 | Ga0495580_0093257_344_1357 | 324 |
| 595 | 3300046473 | Ga0495582_0005918 | Ga0495582_0005918_239_1231 | 324 |
| 596 | 3300046474 | Ga0495605_0000372 | Ga0495605_0000372_27609_28583 | 324 |
| 597 | 3300046474 | Ga0495605_0005589 | Ga0495605_0005589_4708_5721 | 324 |
| 598 | 3300046477 | Ga0495664_0002646 | Ga0495664_0002646_7662_8654 | 324 |
| 599 | 3300046491 | Ga0495584_0029936 | Ga0495584_0029936_1437_2411 | 324 |
| 600 | 3300046492 | Ga0495585_0020091 | Ga0495585_0020091_1011_1985 | 324 |
| 601 | 3300046492 | Ga0495585_0041128 | Ga0495585_0041128_621_1634 | 324 |
| 602 | 3300046506 | Ga0495583_0021470 | Ga0495583_0021470_1597_2610 | 324 |
| 603 | 3300046512 | Ga0495610_0000246 | Ga0495610_0000246_20971_21981 | 324 |
| 604 | 3300046512 | Ga0495610_0024122 | Ga0495610_0024122_533_1507 | 324 |
| 605 | 3300046513 | Ga0495616_0024999 | Ga0495616_0024999_1061_2035 | 324 |
| 606 | 3300046514 | Ga0495618_0006549 | Ga0495618_0006549_5772_6764 | 324 |
| 607 | 3300046516 | Ga0495628_0006201 | Ga0495628_0006201_5348_6340 | 324 |
| 608 | 3300046516 | Ga0495628_0008228 | Ga0495628_0008228_289_1281 | 324 |
| 609 | 3300046516 | Ga0495628_0094662 | Ga0495628_0094662_90_1082 | 324 |
| 610 | 3300046516 | Ga0495628_0196974 | Ga0495628_0196974_471_1484 | 324 |
| 611 | 3300046517 | Ga0495630_0058285 | Ga0495630_0058285_378_1370 | 324 |
| 612 | 3300046519 | Ga0495632_0000809 | Ga0495632_0000809_16119_17093 | 324 |
| 613 | 3300046520 | Ga0495637_0006366 | Ga0495637_0006366_87_1061 | 324 |
| 614 | 3300046520 | Ga0495637_0119285 | Ga0495637_0119285_14_988 | 324 |
| 615 | 3300046522 | Ga0495643_0004454 | Ga0495643_0004454_2720_3694 | 324 |
| 616 | 3300046523 | Ga0495644_0033310 | Ga0495644_0033310_83_1057 | 324 |
| 617 | 3300046524 | Ga0495648_0007247 | Ga0495648_0007247_7638_8630 | 324 |
| 618 | 3300046524 | Ga0495648_0008085 | Ga0495648_0008085_2076_3050 | 324 |
| 619 | 3300046524 | Ga0495648_0011605 | Ga0495648_0011605_418_1410 | 324 |
| 620 | 3300046524 | Ga0495648_0018705 | Ga0495648_0018705_2042_3016 | 324 |
| 621 | 3300046524 | Ga0495648_0043689 | Ga0495648_0043689_843_1817 | 324 |
| 622 | 3300046526 | Ga0495666_0002673 | Ga0495666_0002673_7697_8689 | 324 |
| 623 | 3300046526 | Ga0495666_0070289 | Ga0495666_0070289_669_1643 | 324 |
| 624 | 3300046528 | Ga0495642_0000082 | Ga0495642_0000082_9746_10720 | 324 |
| 625 | 3300046528 | Ga0495642_0000219 | Ga0495642_0000219_26915_27889 | 324 |
| 626 | 3300046529 | Ga0495652_0009463 | Ga0495652_0009463_278_1270 | 324 |
| 627 | 3300046530 | Ga0495654_0003562 | Ga0495654_0003562_4761_5735 | 324 |
| 628 | 3300046530 | Ga0495654_0039244 | Ga0495654_0039244_1329_2303 | 324 |
| 629 | 3300046531 | Ga0495665_0026911 | Ga0495665_0026911_307_1299 | 324 |
| 630 | 3300046533 | Ga0495640_0006909 | Ga0495640_0006909_7669_8661 | 324 |
| 631 | 3300046535 | Ga0495586_0000805 | Ga0495586_0000805_16816_17808 | 324 |
| 632 | 3300046536 | Ga0495587_0003814 | Ga0495587_0003814_8987_9961 | 324 |
| 633 | 3300046536 | Ga0495587_0004637 | Ga0495587_0004637_7666_8658 | 324 |
| 634 | 3300046538 | Ga0495609_0008211 | Ga0495609_0008211_3614_4588 | 324 |
| 635 | 3300046538 | Ga0495609_0038168 | Ga0495609_0038168_767_1741 | 324 |
| 636 | 3300046543 | Ga0495645_0004684 | Ga0495645_0004684_7696_8688 | 324 |
| 637 | 3300046557 | Ga0495622_0061191 | Ga0495622_0061191_662_1636 | 324 |
| 638 | 3300046615 | Ga0495656_0004525 | Ga0495656_0004525_2131_3105 | 324 |
| 639 | 3300046616 | Ga0495668_0003879 | Ga0495668_0003879_3781_4755 | 324 |
| 640 | 3300046642 | Ga0495634_0005677 | Ga0495634_0005677_7696_8688 | 324 |
| 641 | 3300046648 | Ga0495611_0029008 | Ga0495611_0029008_1321_2295 | 324 |
| 642 | 3300046660 | Ga0495625_0063839 | Ga0495625_0063839_374_1366 | 324 |
| 643 | 3300046663 | Ga0495635_0000974 | Ga0495635_0000974_3097_4071 | 324 |
| 644 | 3300046663 | Ga0495635_0044272 | Ga0495635_0044272_1253_2245 | 324 |
| 645 | 3300046664 | Ga0495659_0001444 | Ga0495659_0001444_4476_5450 | 324 |
| 646 | 3300046665 | Ga0495661_0001499 | Ga0495661_0001499_18163_19155 | 324 |
| 647 | 3300046665 | Ga0495661_0051148 | Ga0495661_0051148_890_1864 | 324 |
| 648 | 3300046674 | Ga0495588_0025851 | Ga0495588_0025851_298_1290 | 324 |
| 649 | 3300046674 | Ga0495588_0042741 | Ga0495588_0042741_378_1352 | 324 |
| 650 | 3300046678 | Ga0495599_0007249 | Ga0495599_0007249_5440_6432 | 324 |
| 651 | 3300046679 | Ga0495623_0005517 | Ga0495623_0005517_52_1026 | 324 |
| 652 | 3300046679 | Ga0495623_0089020 | Ga0495623_0089020_225_1217 | 324 |
| 653 | 3300046680 | Ga0495646_0004219 | Ga0495646_0004219_7689_8681 | 324 |
| 654 | 3300046680 | Ga0495646_0012597 | Ga0495646_0012597_4239_5231 | 324 |
| 655 | 3300046680 | Ga0495646_0102156 | Ga0495646_0102156_425_1399 | 324 |
| 656 | 3300046684 | Ga0495669_0006789 | Ga0495669_0006789_3588_4562 | 324 |
| 657 | 3300046684 | Ga0495669_0009604 | Ga0495669_0009604_790_1764 | 324 |
| 658 | 3300046689 | Ga0495613_0001260 | Ga0495613_0001260_18093_19085 | 324 |
| 659 | 3300046690 | Ga0495624_0038155 | Ga0495624_0038155_307_1299 | 324 |
| 660 | 3300046691 | Ga0495670_0003663 | Ga0495670_0003663_4626_5600 | 324 |
| 661 | 3300046692 | Ga0495671_0001167 | Ga0495671_0001167_11309_12283 | 324 |
| 662 | 3300046692 | Ga0495671_0001456 | Ga0495671_0001456_2692_3666 | 324 |
| 663 | 3300046692 | Ga0495671_0010679 | Ga0495671_0010679_3136_4110 | 324 |
| 664 | 3300046692 | Ga0495671_0020484 | Ga0495671_0020484_110_1105 | 324 |
| 665 | 3300046694 | Ga0495649_0006496 | Ga0495649_0006496_3896_4870 | 324 |
| 666 | 3300046794 | Ga0495589_0001146 | Ga0495589_0001146_9971_10984 | 324 |
| 667 | 3300046794 | Ga0495589_0006667 | Ga0495589_0006667_235_1209 | 324 |
| 668 | 3300046794 | Ga0495589_0018707 | Ga0495589_0018707_1006_1980 | 324 |
| 669 | 3300046810 | Ga0495660_0102350 | Ga0495660_0102350_87_1061 | 324 |
| 670 | 3300047315 | Ga0495581_0016945 | Ga0495581_0016945_378_1370 | 324 |
| 671 | 3300047317 | Ga0495604_0010223 | Ga0495604_0010223_4654_5646 | 324 |
| 672 | 3300047317 | Ga0495604_0050243 | Ga0495604_0050243_1331_2323 | 324 |
| 673 | 3300047317 | Ga0495604_0158188 | Ga0495604_0158188_594_1586 | 324 |
| 674 | 3300047319 | Ga0495674_0003114 | Ga0495674_0003114_5358_6350 | 324 |
| 675 | 3300047319 | Ga0495674_0010538 | Ga0495674_0010538_7571_8563 | 324 |
| 676 | 3300047319 | Ga0495674_0020423 | Ga0495674_0020423_4640_5638 | 324 |
| 677 | 3300047319 | Ga0495674_0021838 | Ga0495674_0021838_3438_4430 | 324 |
| 678 | 3300047319 | Ga0495674_0027237 | Ga0495674_0027237_2140_3132 | 324 |
| 679 | 3300047319 | Ga0495674_0061922 | Ga0495674_0061922_753_1727 | 324 |
| 680 | 3300047319 | Ga0495674_0139306 | Ga0495674_0139306_712_1725 | 324 |
| 681 | 3300047320 | Ga0495672_0002429 | Ga0495672_0002429_7041_8036 | 324 |
| 682 | 3300047320 | Ga0495672_0010762 | Ga0495672_0010762_1144_2118 | 324 |
| 683 | 3300047320 | Ga0495672_0011778 | Ga0495672_0011778_4263_5237 | 324 |
| 684 | 3300047320 | Ga0495672_0039068 | Ga0495672_0039068_1076_2050 | 324 |
| 685 | 3300047320 | Ga0495672_0050685 | Ga0495672_0050685_1441_2415 | 324 |
| 686 | 3300047321 | Ga0495676_0001386 | Ga0495676_0001386_17363_18355 | 324 |
| 687 | 3300047322 | Ga0495680_0002757 | Ga0495680_0002757_16559_17551 | 324 |
| 688 | 3300047443 | Ga0495687_001526 | Ga0495687_001526_5113_6087 | 324 |
| 689 | 3300047443 | Ga0495687_015557 | Ga0495687_015557_2076_3050 | 324 |
| 690 | 3300047444 | Ga0495675_0020643 | Ga0495675_0020643_2329_3321 | 324 |
| 691 | 3300047444 | Ga0495675_0034600 | Ga0495675_0034600_906_1898 | 324 |
| 692 | 3300047445 | Ga0495677_0000486 | Ga0495677_0000486_48_1022 | 324 |
| 693 | 3300047446 | Ga0495679_000759 | Ga0495679_000759_378_1370 | 324 |
| 694 | 3300047446 | Ga0495679_005581 | Ga0495679_005581_12_986 | 324 |
| 695 | 3300047469 | Ga0495673_0006732 | Ga0495673_0006732_3597_4571 | 324 |
| 696 | 3300047469 | Ga0495673_0022344 | Ga0495673_0022344_1739_2713 | 324 |
| 697 | 3300047470 | Ga0495681_0025362 | Ga0495681_0025362_531_1523 | 324 |
| 698 | 3300047471 | Ga0495684_0135617 | Ga0495684_0135617_595_1587 | 324 |
| 699 | 3300047673 | Ga0495593_0003926 | Ga0495593_0003926_7689_8681 | 324 |
| 700 | 3300047673 | Ga0495593_0037760 | Ga0495593_0037760_641_1615 | 324 |
| 701 | 3300048088 | Ga0495602_0072821 | Ga0495602_0072821_275_1267 | 324 |
| 702 | 3300048088 | Ga0495602_0220922 | Ga0495602_0220922_216_1208 | 324 |
| 703 | 3300048089 | Ga0495614_0000330 | Ga0495614_0000330_17498_18490 | 324 |
| 704 | 3300048091 | Ga0495626_0000394 | Ga0495626_0000394_5857_6831 | 324 |
| 705 | 3300048091 | Ga0495626_0018689 | Ga0495626_0018689_23_1033 | 324 |
| 706 | 3300048907 | Ga0496104_0074268 | Ga0496104_0074268_1632_2624 | 324 |
| 707 | 3300048907 | Ga0496104_0162243 | Ga0496104_0162243_893_1885 | 324 |
| 708 | 3300048907 | Ga0496104_0307143 | Ga0496104_0307143_134_1147 | 324 |
| 709 | 3300048908 | Ga0496105_0000318 | Ga0496105_0000318_1245_2237 | 324 |
| 710 | 3300048911 | Ga0496108_0021149 | Ga0496108_0021149_1311_2303 | 324 |
| 711 | 3300048915 | Ga0496112_0011547 | Ga0496112_0011547_3672_4664 | 324 |
| 712 | 3300048915 | Ga0496112_0015563 | Ga0496112_0015563_1091_2083 | 324 |
| 713 | 3300048916 | Ga0496113_0033553 | Ga0496113_0033553_1154_2146 | 324 |
| 714 | 3300048918 | Ga0496115_0194941 | Ga0496115_0194941_26_1018 | 324 |
| 715 | 3300048919 | Ga0496116_0048592 | Ga0496116_0048592_1435_2421 | 324 |
| 716 | 3300048920 | Ga0496117_0088194 | Ga0496117_0088194_634_1620 | 324 |
| 717 | 3300048920 | Ga0496117_0155064 | Ga0496117_0155064_105_1079 | 324 |
| 718 | 3300048921 | Ga0496118_0015867 | Ga0496118_0015867_957_1931 | 324 |
| 719 | 3300048922 | Ga0496119_0107677 | Ga0496119_0107677_227_1219 | 324 |
| 720 | 3300048924 | Ga0496121_0000557 | Ga0496121_0000557_40486_41478 | 324 |
| 721 | 3300048929 | Ga0496126_0138896 | Ga0496126_0138896_58_1032 | 324 |
| 722 | 3300049459 | Ga0495678_037804 | Ga0495678_037804_905_1879 | 324 |
| 723 | 3300049460 | Ga0495682_0005771 | Ga0495682_0005771_4020_4994 | 324 |
| 724 | 3300049460 | Ga0495682_0092839 | Ga0495682_0092839_76_1050 | 324 |
| 725 | 3300049522 | Ga0501299_000069 | Ga0501299_000069_2850_3842 | 324 |
| 726 | 3300049571 | Ga0501034_0000163 | Ga0501034_0000163_10279_11271 | 324 |
| 727 | 3300049705 | Ga0501225_0003702 | Ga0501225_0003702_2964_3956 | 324 |
| 728 | 3300050493 | nmdc:mga0k408_181516_c1 | nmdc:mga0k408_181516_c1_82_1101 | 324 |
| 729 | 3300050507 | nmdc:mga05p37_23905_c1 | nmdc:mga05p37_23905_c1_2592_3614 | 324 |
| 730 | 3300050507 | nmdc:mga05p37_308638_c1 | nmdc:mga05p37_308638_c1_659_1651 | 324 |
| 731 | 3300050509 | nmdc:mga0qj67_97_c1 | nmdc:mga0qj67_97_c1_26730_27722 | 324 |
| 732 | 3300050510 | nmdc:mga06r32_259_c2 | nmdc:mga06r32_259_c2_41217_42209 | 324 |
| 733 | 3300050511 | nmdc:mga08y16_38592_c1 | nmdc:mga08y16_38592_c1_1572_2564 | 324 |
| 734 | 3300050515 | nmdc:mga0a205_34474_c1 | nmdc:mga0a205_34474_c1_3289_4281 | 324 |
| 735 | 3300059421 | Ga0590071_000355 | Ga0590071_000355_7902_8900 | 325 |
| 736 | 3300059423 | Ga0590074_000726 | Ga0590074_000726_1104_2102 | 325 |
| 737 | 3300059424 | Ga0590075_000518 | Ga0590075_000518_5960_6958 | 325 |
| 738 | 3300059426 | Ga0590077_000860 | Ga0590077_000860_1883_2881 | 325 |
| 739 | 3300048917 | Ga0496114_0276775 | Ga0496114_0276775_326_1327 | 326 |
| 740 | 3300025942 | Ga0207689_10059717 | Ga0207689_100597173 | 327 |
| 741 | 3300050494 | nmdc:mga06z11_24340_c1 | nmdc:mga06z11_24340_c1_234_1277 | 327 |
| 742 | 3300050495 | nmdc:mga04h51_12817_c1 | nmdc:mga04h51_12817_c1_401_1444 | 327 |
| 743 | iso_pu_bacteria | 2919437846 | 2919438384 | 327 |
| 744 | 3300044658 | Ga0466972_0000062 | Ga0466972_0000062_37058_38071 | 328 |
| 745 | 3300003322 | rootL2_10054155 | rootL2_100541551 | 330 |
| 746 | 3300003323 | rootH1_10022382 | rootH1_1002238218 | 330 |
| 747 | 3300005339 | Ga0070660_100096678 | Ga0070660_1000966783 | 330 |
| 748 | 3300005577 | Ga0068857_100001455 | Ga0068857_1000014553 | 330 |
| 749 | 3300005618 | Ga0068864_100104881 | Ga0068864_1001048812 | 330 |
| 750 | 3300013100 | Ga0157373_10106174 | Ga0157373_101061742 | 330 |
| 751 | 3300013307 | Ga0157372_10266096 | Ga0157372_102660961 | 330 |
| 752 | 3300014325 | Ga0163163_10083413 | Ga0163163_100834133 | 330 |
| 753 | 3300014326 | Ga0157380_10010043 | Ga0157380_100100437 | 330 |
| 754 | 3300025912 | Ga0207707_10049058 | Ga0207707_100490582 | 330 |
| 755 | 3300025919 | Ga0207657_10027304 | Ga0207657_100273043 | 330 |
| 756 | 3300025921 | Ga0207652_10020364 | Ga0207652_100203646 | 330 |
| 757 | 3300025945 | Ga0207679_10155418 | Ga0207679_101554182 | 330 |
| 758 | 3300026116 | Ga0207674_10005253 | Ga0207674_100052531 | 330 |
| 759 | 3300005331 | Ga0070670_100007156 | Ga0070670_1000071567 | 331 |
| 760 | 3300025925 | Ga0207650_10011278 | Ga0207650_100112782 | 331 |
| 761 | 3300046694 | Ga0495649_0021042 | Ga0495649_0021042_1310_2332 | 331 |
| 762 | 3300053153 | Ga0500616_0007172 | Ga0500616_0007172_5328_6368 | 331 |
| 763 | 3300031456 | Ga0307513_10086539 | Ga0307513_100865393 | 332 |
| 764 | 3300048903 | Ga0496100_0031403 | Ga0496100_0031403_1918_2940 | 333 |
| 765 | 3300048904 | Ga0496101_0030709 | Ga0496101_0030709_1762_2784 | 333 |
| 766 | 3300048911 | Ga0496108_0058871 | Ga0496108_0058871_141_1163 | 333 |
| 767 | 3300048912 | Ga0496109_0072044 | Ga0496109_0072044_1332_2354 | 333 |
| 768 | 3300048915 | Ga0496112_0000460 | Ga0496112_0000460_10018_11040 | 333 |
| 769 | 3300050494 | nmdc:mga06z11_149602_c1 | nmdc:mga06z11_149602_c1_190_1272 | 333 |
| 770 | 3300017792 | Ga0163161_10008691 | Ga0163161_100086912 | 337 |
| 771 | 3300046528 | Ga0495642_0040338 | Ga0495642_0040338_599_1669 | 338 |
| 772 | 3300046557 | Ga0495622_0091649 | Ga0495622_0091649_79_1095 | 338 |
| 773 | 3300046694 | Ga0495649_0084045 | Ga0495649_0084045_599_1669 | 338 |
| 774 | 3300047323 | Ga0495683_0057592 | Ga0495683_0057592_235_1305 | 338 |
| 775 | 3300047443 | Ga0495687_042633 | Ga0495687_042633_234_1304 | 338 |
| 776 | 3300048920 | Ga0496117_0012410 | Ga0496117_0012410_2811_3881 | 338 |
| 777 | 3300048921 | Ga0496118_0005967 | Ga0496118_0005967_4291_5361 | 338 |
| 778 | iso_pu_bacteria | 642555112 | 642596905 | 338 |
| 779 | 3300005440 | Ga0070705_100012955 | Ga0070705_1000129553 | 342 |
| 780 | 3300006237 | Ga0097621_100170431 | Ga0097621_1001704312 | 342 |
| 781 | 3300048905 | Ga0496102_0217046 | Ga0496102_0217046_22_1086 | 342 |
| 782 | 3300048909 | Ga0496106_0119250 | Ga0496106_0119250_967_2031 | 342 |
| 783 | 3300046506 | Ga0495583_0003084 | Ga0495583_0003084_485_1516 | 343 |
| 784 | 3300046512 | Ga0495610_0028336 | Ga0495610_0028336_465_1514 | 343 |
| 785 | 3300050510 | nmdc:mga06r32_64078_c1 | nmdc:mga06r32_64078_c1_811_2010 | 343 |
| 786 | 3300046558 | Ga0495633_0040377 | Ga0495633_0040377_835_1869 | 344 |
| 787 | 3300046678 | Ga0495599_0015627 | Ga0495599_0015627_2815_3912 | 345 |
| 788 | 3300041405 | Ga0439438_013233 | Ga0439438_013233_1148_2191 | 346 |
| 789 | 3300050512 | nmdc:mga0n895_65424_c1 | nmdc:mga0n895_65424_c1_760_1908 | 347 |
| 790 | 3300050513 | nmdc:mga0rr50_2086_c1 | nmdc:mga0rr50_2086_c1_6217_7365 | 347 |
| 791 | 3300050515 | nmdc:mga0a205_50343_c1 | nmdc:mga0a205_50343_c1_2253_3401 | 347 |
| 792 | 3300013102 | Ga0157371_10000500 | Ga0157371_1000050032 | 349 |
| 793 | 3300046453 | Ga0495627_058047 | Ga0495627_058047_13_1065 | 349 |
| 794 | 3300046474 | Ga0495605_0002542 | Ga0495605_0002542_2958_4010 | 349 |
| 795 | 3300047320 | Ga0495672_0092397 | Ga0495672_0092397_521_1570 | 349 |
| 796 | 3300047469 | Ga0495673_0000319 | Ga0495673_0000319_7576_8625 | 349 |
| 797 | 2124908027 | MRS2a_Contig_5159 | MRS2a_00058310 | 351 |
| 798 | 3300009036 | Ga0105244_10020167 | Ga0105244_100201675 | 351 |
| 799 | 3300013104 | Ga0157370_10076008 | Ga0157370_100760084 | 351 |
| 800 | 3300041407 | Ga0439447_021135 | Ga0439447_021135_604_1659 | 351 |
| 801 | 3300042006 | Ga0439432_008378 | Ga0439432_008378_609_1664 | 351 |
| 802 | 3300042146 | Ga0450907_000058 | Ga0450907_000058_8695_9750 | 351 |
| 803 | 3300042435 | Ga0439434_0001657 | Ga0439434_0001657_3435_4490 | 351 |
| 804 | 3300046453 | Ga0495627_010450 | Ga0495627_010450_1764_2819 | 351 |
| 805 | 3300046458 | Ga0495591_000568 | Ga0495591_000568_25432_26487 | 351 |
| 806 | 3300046458 | Ga0495591_013404 | Ga0495591_013404_1839_2897 | 351 |
| 807 | 3300046460 | Ga0495638_0028740 | Ga0495638_0028740_2181_3239 | 351 |
| 808 | 3300046471 | Ga0495650_0058957 | Ga0495650_0058957_14_1072 | 351 |
| 809 | 3300046474 | Ga0495605_0009349 | Ga0495605_0009349_35_1093 | 351 |
| 810 | 3300046474 | Ga0495605_0025618 | Ga0495605_0025618_1190_2248 | 351 |
| 811 | 3300046491 | Ga0495584_0000140 | Ga0495584_0000140_10504_11559 | 351 |
| 812 | 3300046492 | Ga0495585_0004195 | Ga0495585_0004195_3562_4617 | 351 |
| 813 | 3300046501 | Ga0495607_0012901 | Ga0495607_0012901_3024_4082 | 351 |
| 814 | 3300046506 | Ga0495583_0000958 | Ga0495583_0000958_23806_24864 | 351 |
| 815 | 3300046507 | Ga0495606_0001909 | Ga0495606_0001909_11767_12825 | 351 |
| 816 | 3300046515 | Ga0495620_0001486 | Ga0495620_0001486_6542_7600 | 351 |
| 817 | 3300046519 | Ga0495632_0035261 | Ga0495632_0035261_1483_2541 | 351 |
| 818 | 3300046529 | Ga0495652_0097404 | Ga0495652_0097404_373_1431 | 351 |
| 819 | 3300046530 | Ga0495654_0008233 | Ga0495654_0008233_2777_3835 | 351 |
| 820 | 3300046538 | Ga0495609_0000316 | Ga0495609_0000316_41752_42810 | 351 |
| 821 | 3300046538 | Ga0495609_0001746 | Ga0495609_0001746_12601_13659 | 351 |
| 822 | 3300046542 | Ga0495597_0068080 | Ga0495597_0068080_12_1067 | 351 |
| 823 | 3300046557 | Ga0495622_0018725 | Ga0495622_0018725_482_1537 | 351 |
| 824 | 3300046642 | Ga0495634_0001713 | Ga0495634_0001713_3448_4506 | 351 |
| 825 | 3300046648 | Ga0495611_0083002 | Ga0495611_0083002_308_1363 | 351 |
| 826 | 3300046660 | Ga0495625_0054522 | Ga0495625_0054522_1361_2419 | 351 |
| 827 | 3300046680 | Ga0495646_0060890 | Ga0495646_0060890_851_1909 | 351 |
| 828 | 3300046691 | Ga0495670_0015669 | Ga0495670_0015669_83_1138 | 351 |
| 829 | 3300046692 | Ga0495671_0045519 | Ga0495671_0045519_78_1133 | 351 |
| 830 | 3300046810 | Ga0495660_0070405 | Ga0495660_0070405_13_1071 | 351 |
| 831 | 3300047317 | Ga0495604_0050064 | Ga0495604_0050064_1937_2995 | 351 |
| 832 | 3300047320 | Ga0495672_0006877 | Ga0495672_0006877_2028_3083 | 351 |
| 833 | 3300047323 | Ga0495683_0018642 | Ga0495683_0018642_75_1130 | 351 |
| 834 | 3300047444 | Ga0495675_0021758 | Ga0495675_0021758_2526_3584 | 351 |
| 835 | 3300047446 | Ga0495679_003633 | Ga0495679_003633_4500_5558 | 351 |
| 836 | 3300047469 | Ga0495673_0006070 | Ga0495673_0006070_970_2028 | 351 |
| 837 | 3300047469 | Ga0495673_0010237 | Ga0495673_0010237_3935_4993 | 351 |
| 838 | 3300048091 | Ga0495626_0000340 | Ga0495626_0000340_14344_15402 | 351 |
| 839 | 3300048091 | Ga0495626_0008878 | Ga0495626_0008878_1433_2491 | 351 |
| 840 | 3300048905 | Ga0496102_0002794 | Ga0496102_0002794_10545_11603 | 351 |
| 841 | 3300048906 | Ga0496103_0002417 | Ga0496103_0002417_10545_11603 | 351 |
| 842 | 3300048913 | Ga0496110_0070576 | Ga0496110_0070576_481_1536 | 351 |
| 843 | 3300048919 | Ga0496116_0056833 | Ga0496116_0056833_328_1386 | 351 |
| 844 | 3300048920 | Ga0496117_0006453 | Ga0496117_0006453_10536_11594 | 351 |
| 845 | 3300048921 | Ga0496118_0016993 | Ga0496118_0016993_5361_6419 | 351 |
| 846 | 3300048928 | Ga0496125_0060939 | Ga0496125_0060939_1860_2915 | 351 |
| 847 | 3300049460 | Ga0495682_0006897 | Ga0495682_0006897_2588_3643 | 351 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wuy-assembly1.cif.gz_A | crystal structure of nit6803 | 0.9635 | 28 | 308 |
| 3wuy-assembly1.cif.gz_A | crystal structure of nit6803 | 0.9405 | 28 | 308 |
| 6zby-assembly1.cif.gz_E | cryo-em structure of the nitrilase from pseudomonas fluorescens ebc191 at 3.3 angstroms | 0.9324 | 29 | 333 |
| 6zby-assembly1.cif.gz_E | cryo-em structure of the nitrilase from pseudomonas fluorescens ebc191 at 3.3 angstroms | 0.8991 | 29 | 333 |
| 3iw3-assembly1.cif.gz_B | crystal structure of hyperthermophilic nitrilase | 0.889 | 31 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3wuyB00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9633 | 28 | 308 | 3.60.110.10 |
| 3wuyB00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9403 | 28 | 308 | 3.60.110.10 |
| af_P40447_2_198_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9152 | 33 | 211 | 3.60.110.10 |
| 1j31B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.8805 | 31 | 317 | 3.60.110.10 |
| af_P32961_18_309_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.8759 | 29 | 308 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2YQU3-F1-model_v4 | Aliphatic nitrilase | 0.9859 | 31 | 247 |
GO:0000257
|
| AF-A0A1Z4GUH3-F1-model_v4 | deleted | 0.9855 | 29 | 218 |
|
| AF-A0A6P0DSL0-F1-model_v4 | Aliphatic nitrilase | 0.9851 | 104 | 235 |
GO:0000257
|
| AF-A0A520IJG1-F1-model_v4 | Carbon-nitrogen hydrolase family protein | 0.9817 | 33 | 211 |
GO:0000257
|
| AF-A0A853LZT2-F1-model_v4 | CN hydrolase domain-containing protein | 0.9801 | 39 | 143 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar