F483343

General Info

Members Datasets Scaffolds Average Seq Length
847 457 775 330

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_65424_c1|nmdc:mga0n895_65424_c1_760_1908
Length 382
Sequence MGRTGTLRVGGARGVQAAAITRGPAAGAKRQARVGHRRTISNQEEVASGRLENAMKTVKAAAVQISPVLYSREGTVDKVVRQIKDLGRQGVQFATFPETVVPYYPYFSFVQSAYQIIAGREHLKLLDQAVAVPSPTTMAISEACKEAGVVVSIGVNERDGGTLYNAQLLFDADGTLIQRRRKIMPTYHERMVWGLGDGSGLCAVDSKAGRIGQLACWEHYNPLARYAMMADGEQIHSAMYPGSIFGNLFAEQTEVNIRQHALESACFVVCATAWLDADQQAQIVKDTGGSIGAISGGCFTTIAAPDGTLLGEPVRSSEGVVIADLDFTLIDKRKQLMDSRGHYSRPELLSLLIDRTPAAPVHERQNQRVAQEGSEELLSTTV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2511231012 Pseudomonas sp. GM33 Isolate Nodule
5 2511231014 Pseudomonas sp. GM48 Isolate Nodule
6 2511231015 Pseudomonas sp. GM49 Isolate Nodule
7 2511231017 Pseudomonas sp. GM55 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231020 Pseudomonas sp. GM74 Isolate Nodule
11 2511231021 Pseudomonas sp. GM78 Isolate Nodule
12 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
13 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
14 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
15 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
16 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
17 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2558860280 Kutzneria sp. 744 Isolate Unclassified
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
22 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
23 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
24 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
25 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
26 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
27 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
28 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
29 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
30 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
31 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
32 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
33 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
34 2773857670 Pseudomonas sp. 478 Isolate Unclassified
35 2784132072 Pseudomonas sp. 460 Isolate Unclassified
36 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
37 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
38 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
39 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
40 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
41 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
42 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
43 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
44 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
45 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
46 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
47 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
48 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
49 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
50 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
51 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
52 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
53 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
54 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
55 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
56 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
57 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
61 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
64 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
67 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
68 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
69 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
70 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
71 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
74 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
92 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
93 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
98 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
99 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
100 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
101 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
117 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
118 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
119 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
128 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
129 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
130 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
131 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
132 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
133 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
134 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
135 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
139 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
140 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
141 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
142 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
143 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
144 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
145 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
146 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
147 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
149 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
150 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
151 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
152 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
153 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
154 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
157 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
166 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
167 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
168 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
169 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
170 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
179 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
180 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
181 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
182 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
189 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
196 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
197 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
254 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
276 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
277 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
278 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
279 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
280 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
281 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
282 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
283 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
284 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
285 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
288 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
289 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
290 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
291 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
292 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
293 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
294 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
295 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
296 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
297 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
298 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
302 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
306 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
328 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
329 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
330 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
336 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
337 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
338 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
341 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
348 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
349 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
364 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
381 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
382 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
383 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
392 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
393 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
394 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
395 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
396 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
397 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
398 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
399 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
400 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
401 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
402 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
403 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
407 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
408 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
409 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
410 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
411 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
413 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
414 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
415 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
416 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
417 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
434 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
435 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
438 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
439 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
440 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
441 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
442 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
443 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
444 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
445 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
446 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
447 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
448 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
449 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
450 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
451 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
452 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
453 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
454 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
455 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
456 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
457 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.5
Metatranscriptomes 0
Isolates 8.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 6.26
Nodule 3.9
Rhizoplane 4.13
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 6.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5159 2124908027 Bacteria 5101
2 JGI24740J21852_10030275 3300001979 Bacteria 1765
3 JGI24739J22299_10000469 3300001989 Bacteria 14200
4 JGI24735J21928_10017968 3300002067 Bacteria 2185
5 JGI24738J21930_10002384 3300002075 Bacteria 4941
6 JGI25156J39149_1000269 3300002705 Bacteria 35211
7 JGI25165J46597_1000606 3300003214 Bacteria 30552
8 rootL2_10054155 3300003322 Bacteria 4571
9 rootH1_10022382 3300003323 Bacteria 49541
10 Ga0055533_1000140 3300003756 Bacteria 76502
11 Ga0055532_1000003 3300003758 Bacteria 494004
12 Ga0055527_1000006 3300003760 Bacteria 494004
13 Ga0055535_1000003 3300003761 Bacteria 494004
14 Ga0055542_1000007 3300003762 Bacteria 494004
15 Ga0055529_1000003 3300003763 Bacteria 494004
16 Ga0065714_10000224 3300005288 Bacteria 7203
17 Ga0065714_10007661 3300005288 Bacteria 3157
18 Ga0065714_10076134 3300005288 Bacteria 2825
19 Ga0065714_10128234 3300005288 Bacteria 1275
20 Ga0065712_10020220 3300005290 Bacteria 1232
21 Ga0065712_10069381 3300005290 Bacteria 7407
22 Ga0065712_10071037 3300005290 Bacteria 5528
23 Ga0065715_10038261 3300005293 Bacteria 1630
24 Ga0065715_10089898 3300005293 Bacteria 8174
25 Ga0065715_10110552 3300005293 Bacteria 2615
26 Ga0065715_10136864 3300005293 Bacteria 1894
27 Ga0065715_10249136 3300005293 Bacteria 1173
28 Ga0070658_10038553 3300005327 Bacteria 3853
29 Ga0070658_10088993 3300005327 Bacteria 2542
30 Ga0070676_10011830 3300005328 Bacteria 4751
31 Ga0070683_100009446 3300005329 Bacteria 8341
32 Ga0070683_100224798 3300005329 Unclassified 1784
33 Ga0070690_100022389 3300005330 Bacteria 3866
34 Ga0070670_100007156 3300005331 Bacteria 9450
35 Ga0070670_100140997 3300005331 Bacteria 2084
36 Ga0068869_100025692 3300005334 Bacteria 4092
37 Ga0070680_100018122 3300005336 Bacteria 5562
38 Ga0070682_100002341 3300005337 Bacteria 10489
39 Ga0068868_100035497 3300005338 Bacteria 3854
40 Ga0068868_100191086 3300005338 Bacteria 1703
41 Ga0068868_100230102 3300005338 Bacteria 1555
42 Ga0070660_100096678 3300005339 Unclassified 2336
43 Ga0070660_100111098 3300005339 Bacteria 2180
44 Ga0070660_100128322 3300005339 Unclassified 2028
45 Ga0070689_100000031 3300005340 Bacteria 93387
46 Ga0070689_100230745 3300005340 Unclassified 1521
47 Ga0070687_100001327 3300005343 Bacteria 8647
48 Ga0070661_100004754 3300005344 Bacteria 9346
49 Ga0070661_100149648 3300005344 Bacteria 1764
50 Ga0070669_100003066 3300005353 Bacteria 12016
51 Ga0070675_100003303 3300005354 Bacteria 12231
52 Ga0070675_100017418 3300005354 Bacteria 5709
53 Ga0070671_100043540 3300005355 Bacteria 3730
54 Ga0070671_100100895 3300005355 Bacteria 2421
55 Ga0070671_100106082 3300005355 Bacteria 2358
56 Ga0070674_100072799 3300005356 Bacteria 2435
57 Ga0070673_100008156 3300005364 Bacteria 6950
58 Ga0070673_100074823 3300005364 Bacteria 2730
59 Ga0070688_100000612 3300005365 Bacteria 17859
60 Ga0070688_100006974 3300005365 Bacteria 6071
61 Ga0070688_100011783 3300005365 Bacteria 4874
62 Ga0070659_100020994 3300005366 Bacteria 4967
63 Ga0070659_100060442 3300005366 Unclassified 2993
64 Ga0070709_10122260 3300005434 Bacteria 1766
65 Ga0070713_100060462 3300005436 Bacteria 3167
66 Ga0070701_10000522 3300005438 Bacteria 13248
67 Ga0070705_100012955 3300005440 Bacteria 4253
68 Ga0070705_100013917 3300005440 Bacteria 4126
69 Ga0070705_100117135 3300005440 Unclassified 1713
70 Ga0070705_100159061 3300005440 Bacteria 1508
71 Ga0070700_100000180 3300005441 Bacteria 35814
72 Ga0070694_100011224 3300005444 Bacteria 5546
73 Ga0070708_100164839 3300005445 Bacteria 2067
74 Ga0070663_100002053 3300005455 Bacteria 11243
75 Ga0070663_100003821 3300005455 Bacteria 8765
76 Ga0070663_100060072 3300005455 Bacteria 2733
77 Ga0070678_100007814 3300005456 Bacteria 6363
78 Ga0070678_100026029 3300005456 Bacteria 3948
79 Ga0070678_100473812 3300005456 Bacteria 1100
80 Ga0070662_100006743 3300005457 Bacteria 7423
81 Ga0070662_100121036 3300005457 Bacteria 2006
82 Ga0070681_10004260 3300005458 Bacteria 13564
83 Ga0070681_10018802 3300005458 Bacteria 6914
84 Ga0070681_10071858 3300005458 Bacteria 3425
85 Ga0070681_10085310 3300005458 Bacteria 3111
86 Ga0070681_10292041 3300005458 Bacteria 1540
87 Ga0068867_100001414 3300005459 Bacteria 16594
88 Ga0068867_100059282 3300005459 Bacteria 2838
89 Ga0068867_100059301 3300005459 Bacteria 2837
90 Ga0068867_100118756 3300005459 Bacteria 2041
91 Ga0070685_10001089 3300005466 Bacteria 14533
92 Ga0070685_10099741 3300005466 Bacteria 1772
93 Ga0070706_100211199 3300005467 Bacteria 1812
94 Ga0070707_100031250 3300005468 Bacteria 5071
95 Ga0070707_100116735 3300005468 Bacteria 2590
96 Ga0070698_100149071 3300005471 Bacteria 2287
97 Ga0070679_100032902 3300005530 Bacteria 5131
98 Ga0070679_100045513 3300005530 Bacteria 4373
99 Ga0070679_100346592 3300005530 Unclassified 1433
100 Ga0070684_100005692 3300005535 Bacteria 9570
101 Ga0070684_100226623 3300005535 Unclassified 1706
102 Ga0070684_100344398 3300005535 Bacteria 1370
103 Ga0070684_100443721 3300005535 Bacteria 1199
104 Ga0070697_100009345 3300005536 Bacteria 7662
105 Ga0068853_100004494 3300005539 Bacteria 10816
106 Ga0070672_100002263 3300005543 Bacteria 12146
107 Ga0070686_100000517 3300005544 Bacteria 23112
108 Ga0070686_100073039 3300005544 Bacteria 2251
109 Ga0070686_100138768 3300005544 Unclassified 1690
110 Ga0070695_100056594 3300005545 Bacteria 2531
111 Ga0070696_100039656 3300005546 Bacteria 3252
112 Ga0070696_100088416 3300005546 Bacteria 2202
113 Ga0070693_100036990 3300005547 Bacteria 2719
114 Ga0070665_100001922 3300005548 Bacteria 23458
115 Ga0070704_100021775 3300005549 Bacteria 4161
116 Ga0068855_100032462 3300005563 Bacteria 6234
117 Ga0068855_100059748 3300005563 Bacteria 4460
118 Ga0070664_100343512 3300005564 Bacteria 1356
119 Ga0068857_100001455 3300005577 Bacteria 18803
120 Ga0068857_100010201 3300005577 Bacteria 8167
121 Ga0068857_100013777 3300005577 Bacteria 7045
122 Ga0068854_100100541 3300005578 Bacteria 2167
123 Ga0068856_100051411 3300005614 Bacteria 4063
124 Ga0070702_100016681 3300005615 Bacteria 3773
125 Ga0070702_100096420 3300005615 Bacteria 1805
126 Ga0070702_100176577 3300005615 Unclassified 1394
127 Ga0068852_100000608 3300005616 Bacteria 23481
128 Ga0068859_100027750 3300005617 Bacteria 5678
129 Ga0068859_100318326 3300005617 Bacteria 1650
130 Ga0068859_100549551 3300005617 Bacteria 1249
131 Ga0068864_100104881 3300005618 Bacteria 2512
132 Ga0068864_100105488 3300005618 Bacteria 2505
133 Ga0068864_100110347 3300005618 Bacteria 2449
134 Ga0068864_100111947 3300005618 Unclassified 2432
135 Ga0068864_100293734 3300005618 Unclassified 1520
136 Ga0068866_10024206 3300005718 Bacteria 2835
137 Ga0068866_10026751 3300005718 Bacteria 2729
138 Ga0068861_100304508 3300005719 Bacteria 1382
139 Ga0068851_10002037 3300005834 Bacteria 8920
140 Ga0068870_10011138 3300005840 Bacteria 4157
141 Ga0068863_100003501 3300005841 Bacteria 15490
142 Ga0068863_100046411 3300005841 Bacteria 4123
143 Ga0068863_100336118 3300005841 Bacteria 1469
144 Ga0068858_100035748 3300005842 Bacteria 4606
145 Ga0068858_100054556 3300005842 Bacteria 3695
146 Ga0068858_100141536 3300005842 Bacteria 2258
147 Ga0068860_100019448 3300005843 Bacteria 6585
148 Ga0068860_100070188 3300005843 Bacteria 3331
149 Ga0068860_100111365 3300005843 Bacteria 2617
150 Ga0068862_100018369 3300005844 Bacteria 5822
151 Ga0068862_100046428 3300005844 Bacteria 3706
152 Ga0068862_100218232 3300005844 Unclassified 1726
153 Ga0068862_100378950 3300005844 Bacteria 1319
154 Ga0068862_100411672 3300005844 Bacteria 1267
155 Ga0068862_100440717 3300005844 Bacteria 1226
156 Ga0081540_1000537 3300005983 Bacteria 36699
157 Ga0081540_1000611 3300005983 Bacteria 34020
158 Ga0075365_10042160 3300006038 Bacteria 2983
159 Ga0075365_10308341 3300006038 Bacteria 1114
160 Ga0075363_100026247 3300006048 Bacteria 2978
161 Ga0075364_10004579 3300006051 Bacteria 7962
162 Ga0075364_10079667 3300006051 Bacteria 2164
163 Ga0075364_10084692 3300006051 Bacteria 2099
164 Ga0075364_10130304 3300006051 Bacteria 1687
165 Ga0075432_10063094 3300006058 Bacteria 1322
166 Ga0075362_10037629 3300006177 Bacteria 2122
167 Ga0075367_10005759 3300006178 Bacteria 6195
168 Ga0075367_10006892 3300006178 Bacteria 5785
169 Ga0075367_10058144 3300006178 Bacteria 2300
170 Ga0075367_10120039 3300006178 Bacteria 1619
171 Ga0075366_10067532 3300006195 Bacteria 2128
172 Ga0075366_10134883 3300006195 Bacteria 1490
173 Ga0097621_100108811 3300006237 Bacteria 2340
174 Ga0097621_100170431 3300006237 Bacteria 1876
175 Ga0075370_10012587 3300006353 Bacteria 4477
176 Ga0075370_10043709 3300006353 Bacteria 2532
177 Ga0075428_100258204 3300006844 Bacteria 1877
178 Ga0075430_100000150 3300006846 Bacteria 44915
179 Ga0075431_100000478 3300006847 Bacteria 33199
180 Ga0075433_10037910 3300006852 Bacteria 4160
181 Ga0075433_10089694 3300006852 Bacteria 2717
182 Ga0068865_100006599 3300006881 Bacteria 7095
183 Ga0068865_100089721 3300006881 Bacteria 2227
184 Ga0068865_100129270 3300006881 Bacteria 1890
185 Ga0097620_100027750 3300006931 Bacteria 5678
186 Ga0097620_100318341 3300006931 Bacteria 1650
187 Ga0097620_100549554 3300006931 Bacteria 1249
188 Ga0075435_100001379 3300007076 Bacteria 15691
189 Ga0105251_10002329 3300009011 Bacteria 15027
190 Ga0105244_10020167 3300009036 Bacteria 3706
191 Ga0105244_10029726 3300009036 Bacteria 2915
192 Ga0105250_10000426 3300009092 Bacteria 30810
193 Ga0105240_10009514 3300009093 Bacteria 13757
194 Ga0105245_10023853 3300009098 Bacteria 5370
195 Ga0105247_10005335 3300009101 Bacteria 8102
196 Ga0105247_10008256 3300009101 Bacteria 6354
197 Ga0114129_10396739 3300009147 Bacteria 1819
198 Ga0114129_10492827 3300009147 Bacteria 1601
199 Ga0105243_10000027 3300009148 Bacteria 191224
200 Ga0105241_10002471 3300009174 Bacteria 13899
201 Ga0105241_10007576 3300009174 Bacteria 7980
202 Ga0105241_10072609 3300009174 Bacteria 2675
203 Ga0105242_10000056 3300009176 Bacteria 76052
204 Ga0105242_10089593 3300009176 Bacteria 2586
205 Ga0105248_10001714 3300009177 Bacteria 24367
206 Ga0105248_10003555 3300009177 Bacteria 17280
207 Ga0105248_10076392 3300009177 Bacteria 3765
208 Ga0105248_10098363 3300009177 Bacteria 3296
209 Ga0105248_10115639 3300009177 Bacteria 3025
210 Ga0105248_10217303 3300009177 Bacteria 2153
211 Ga0105248_10523791 3300009177 Bacteria 1337
212 Ga0105237_10388639 3300009545 Bacteria 1400
213 Ga0105237_10418830 3300009545 Bacteria 1345
214 Ga0105238_10016084 3300009551 Bacteria 7566
215 Ga0105238_10094665 3300009551 Bacteria 2974
216 Ga0105238_10199530 3300009551 Bacteria 1976
217 Ga0105249_10702794 3300009553 Bacteria 1071
218 Ga0099796_10027736 3300010159 Bacteria 1811
219 Ga0105239_10060831 3300010375 Unclassified 4145
220 Ga0105239_10141603 3300010375 Bacteria 2680
221 Ga0105239_10155010 3300010375 Bacteria 2558
222 Ga0105246_10001423 3300011119 Bacteria 14183
223 Ga0105246_10033410 3300011119 Bacteria 3419
224 Ga0157373_10003842 3300013100 Bacteria 11354
225 Ga0157373_10005649 3300013100 Bacteria 9372
226 Ga0157373_10093534 3300013100 Bacteria 2117
227 Ga0157373_10106174 3300013100 Bacteria 1975
228 Ga0157371_10000500 3300013102 Bacteria 47414
229 Ga0157371_10013270 3300013102 Bacteria 6268
230 Ga0157370_10000003 3300013104 Bacteria 367417
231 Ga0157370_10007047 3300013104 Bacteria 12271
232 Ga0157370_10076008 3300013104 Bacteria 3165
233 Ga0157369_10000377 3300013105 Bacteria 59193
234 Ga0157374_10007769 3300013296 Bacteria 9154
235 Ga0157374_10024813 3300013296 Bacteria 5377
236 Ga0157374_10065223 3300013296 Bacteria 3419
237 Ga0157374_10295845 3300013296 Bacteria 1601
238 Ga0163162_10213326 3300013306 Unclassified 2060
239 Ga0163162_10217608 3300013306 Bacteria 2040
240 Ga0163162_10384173 3300013306 Bacteria 1537
241 Ga0157372_10018203 3300013307 Bacteria 7552
242 Ga0157372_10046450 3300013307 Plasmid 4821
243 Ga0157372_10063606 3300013307 Bacteria 4138
244 Ga0157372_10266096 3300013307 Bacteria 1991
245 Ga0157375_10020435 3300013308 Bacteria 6049
246 Ga0157375_10027192 3300013308 Bacteria 5344
247 Ga0157375_10152127 3300013308 Bacteria 2450
248 Ga0157375_10208923 3300013308 Bacteria 2109
249 Ga0157375_10291332 3300013308 Bacteria 1795
250 Ga0157375_10640312 3300013308 Bacteria 1220
251 Ga0163163_10001651 3300014325 Bacteria 18781
252 Ga0163163_10022523 3300014325 Bacteria 5967
253 Ga0163163_10083413 3300014325 Unclassified 3201
254 Ga0157380_10010043 3300014326 Bacteria 6794
255 Ga0157380_10072364 3300014326 Bacteria 2792
256 Ga0182008_10005197 3300014497 Bacteria 7464
257 Ga0157377_10004857 3300014745 Bacteria 6249
258 Ga0157379_10047635 3300014968 Bacteria 3824
259 Ga0157379_10179165 3300014968 Bacteria 1914
260 Ga0157376_10040609 3300014969 Bacteria 3803
261 Ga0157376_10051207 3300014969 Bacteria 3430
262 Ga0163161_10002355 3300017792 Bacteria 13542
263 Ga0163161_10008691 3300017792 Bacteria 7024
264 Ga0163161_10008695 3300017792 Bacteria 7022
265 Ga0163161_10055756 3300017792 Bacteria 2869
266 Ga0163161_10177205 3300017792 Bacteria 1633
267 Ga0213872_10000280 3300021361 Bacteria 43485
268 Ga0213872_10007442 3300021361 Bacteria 5389
269 Ga0209674_100025 3300025226 Bacteria 515942
270 Ga0209672_100002 3300025228 Bacteria 1733325
271 Ga0209147_100003 3300025229 Bacteria 1733325
272 Ga0209563_101861 3300025230 Bacteria 5143
273 Ga0209258_100005 3300025242 Bacteria 1087938
274 Ga0209148_1000006 3300025254 Bacteria 1733325
275 Ga0209759_1000014 3300025256 Bacteria 396291
276 Ga0209759_1022745 3300025256 Bacteria 1395
277 Ga0209233_1000018 3300025261 Bacteria 886857
278 Ga0209455_1000003 3300025272 Bacteria 1471893
279 Ga0209676_1001951 3300025292 Bacteria 16588
280 Ga0209050_1001399 3300025298 Bacteria 26176
281 Ga0209051_1005551 3300025303 Bacteria 7337
282 Ga0207696_1000266 3300025711 Bacteria 65599
283 Ga0207655_1012147 3300025728 Bacteria 5060
284 Ga0207655_1018366 3300025728 Bacteria 3713
285 Ga0207655_1040805 3300025728 Bacteria 1997
286 Ga0207713_1009943 3300025735 Bacteria 5315
287 Ga0207713_1019882 3300025735 Bacteria 3271
288 Ga0207713_1032504 3300025735 Bacteria 2290
289 Ga0207653_10001217 3300025885 Bacteria 8419
290 Ga0207710_10028258 3300025900 Bacteria 2434
291 Ga0207710_10076165 3300025900 Bacteria 1548
292 Ga0207688_10060540 3300025901 Bacteria 2133
293 Ga0207647_10020614 3300025904 Bacteria 4417
294 Ga0207647_10025026 3300025904 Bacteria 3930
295 Ga0207647_10026914 3300025904 Bacteria 3756
296 Ga0207647_10072785 3300025904 Bacteria 2072
297 Ga0207699_10105778 3300025906 Bacteria 1795
298 Ga0207645_10001972 3300025907 Bacteria 16496
299 Ga0207643_10000620 3300025908 Bacteria 22418
300 Ga0207705_10012636 3300025909 Bacteria 6093
301 Ga0207654_10021980 3300025911 Bacteria 3398
302 Ga0207654_10053330 3300025911 Bacteria 2334
303 Ga0207707_10049058 3300025912 Unclassified 3678
304 Ga0207707_10074197 3300025912 Bacteria 2967
305 Ga0207707_10239773 3300025912 Bacteria 1577
306 Ga0207707_10309943 3300025912 Bacteria 1364
307 Ga0207695_10000316 3300025913 Bacteria 116327
308 Ga0207695_10019383 3300025913 Bacteria 7834
309 Ga0207671_10259237 3300025914 Bacteria 1368
310 Ga0207663_10010388 3300025916 Bacteria 4955
311 Ga0207662_10000359 3300025918 Bacteria 20504
312 Ga0207662_10020839 3300025918 Bacteria 3742
313 Ga0207657_10027304 3300025919 Bacteria 5229
314 Ga0207657_10064227 3300025919 Bacteria 3134
315 Ga0207649_10000963 3300025920 Bacteria 17866
316 Ga0207652_10020364 3300025921 Bacteria 5462
317 Ga0207652_10278888 3300025921 Bacteria 1508
318 Ga0207652_10466627 3300025921 Bacteria 1138
319 Ga0207681_10006066 3300025923 Bacteria 7410
320 Ga0207694_10238428 3300025924 Bacteria 1486
321 Ga0207650_10000076 3300025925 Bacteria 132412
322 Ga0207650_10011278 3300025925 Bacteria 6148
323 Ga0207659_10076448 3300025926 Bacteria 2461
324 Ga0207659_10252947 3300025926 Bacteria 1430
325 Ga0207687_10044799 3300025927 Bacteria 3055
326 Ga0207700_10054587 3300025928 Bacteria 3000
327 Ga0207644_10025573 3300025931 Bacteria 4059
328 Ga0207644_10094292 3300025931 Bacteria 2236
329 Ga0207644_10126552 3300025931 Bacteria 1951
330 Ga0207644_10140784 3300025931 Bacteria 1857
331 Ga0207690_10023247 3300025932 Bacteria 3867
332 Ga0207706_10001653 3300025933 Bacteria 22059
333 Ga0207706_10100627 3300025933 Bacteria 2543
334 Ga0207706_10105470 3300025933 Bacteria 2480
335 Ga0207686_10000008 3300025934 Bacteria 245575
336 Ga0207686_10145742 3300025934 Bacteria 1642
337 Ga0207686_10330008 3300025934 Bacteria 1142
338 Ga0207709_10000025 3300025935 Bacteria 364795
339 Ga0207670_10000040 3300025936 Bacteria 102329
340 Ga0207670_10052298 3300025936 Bacteria 2746
341 Ga0207704_10074612 3300025938 Bacteria 2165
342 Ga0207691_10000188 3300025940 Bacteria 58724
343 Ga0207711_10005840 3300025941 Bacteria 10394
344 Ga0207711_10011905 3300025941 Bacteria 7231
345 Ga0207711_10031378 3300025941 Bacteria 4485
346 Ga0207711_10079993 3300025941 Bacteria 2854
347 Ga0207711_10296857 3300025941 Bacteria 1490
348 Ga0207689_10003791 3300025942 Bacteria 13774
349 Ga0207689_10059717 3300025942 Bacteria 3136
350 Ga0207661_10005191 3300025944 Bacteria 9155
351 Ga0207679_10000338 3300025945 Bacteria 34605
352 Ga0207679_10155418 3300025945 Unclassified 1867
353 Ga0207667_10009354 3300025949 Bacteria 11554
354 Ga0207667_10061946 3300025949 Bacteria 3913
355 Ga0207667_10597210 3300025949 Bacteria 1113
356 Ga0207712_10003692 3300025961 Bacteria 9656
357 Ga0207640_10055570 3300025981 Bacteria 2594
358 Ga0207640_10256700 3300025981 Bacteria 1360
359 Ga0207703_10060520 3300026035 Bacteria 3097
360 Ga0207703_10112543 3300026035 Bacteria 2325
361 Ga0207639_10006884 3300026041 Bacteria 7742
362 Ga0207639_10074334 3300026041 Bacteria 2668
363 Ga0207678_10000193 3300026067 Bacteria 52686
364 Ga0207678_10000412 3300026067 Bacteria 38737
365 Ga0207678_10039751 3300026067 Bacteria 4080
366 Ga0207678_10226519 3300026067 Bacteria 1600
367 Ga0207708_10000662 3300026075 Bacteria 26417
368 Ga0207708_10019125 3300026075 Bacteria 5159
369 Ga0207708_10124264 3300026075 Bacteria 2013
370 Ga0207708_10372553 3300026075 Bacteria 1176
371 Ga0207641_10000150 3300026088 Bacteria 99314
372 Ga0207641_10044045 3300026088 Bacteria 3751
373 Ga0207641_10359129 3300026088 Bacteria 1390
374 Ga0207641_10404695 3300026088 Unclassified 1311
375 Ga0207648_10004215 3300026089 Bacteria 14859
376 Ga0207648_10009761 3300026089 Bacteria 9172
377 Ga0207648_10053166 3300026089 Bacteria 3541
378 Ga0207676_10003432 3300026095 Bacteria 11214
379 Ga0207676_10004713 3300026095 Bacteria 9663
380 Ga0207676_10215670 3300026095 Bacteria 1706
381 Ga0207674_10005253 3300026116 Bacteria 15412
382 Ga0207674_10005839 3300026116 Bacteria 14597
383 Ga0207674_10132169 3300026116 Bacteria 2459
384 Ga0207674_10149718 3300026116 Bacteria 2291
385 Ga0207674_10330240 3300026116 Unclassified 1475
386 Ga0207674_10340424 3300026116 Bacteria 1450
387 Ga0207675_100396165 3300026118 Unclassified 1360
388 Ga0207675_100529731 3300026118 Bacteria 1175
389 Ga0207683_10015528 3300026121 Bacteria 6484
390 Ga0207683_10032279 3300026121 Bacteria 4549
391 Ga0207683_10141831 3300026121 Bacteria 2165
392 Ga0207683_10377638 3300026121 Bacteria 1302
393 Ga0207698_10000271 3300026142 Bacteria 31417
394 Ga0207698_10018413 3300026142 Bacteria 4758
395 Ga0207698_10402498 3300026142 Bacteria 1308
396 Ga0209813_10011555 3300027866 Bacteria 2311
397 Ga0207428_10036666 3300027907 Bacteria 3998
398 Ga0207428_10039625 3300027907 Bacteria 3827
399 Ga0268266_10000615 3300028379 Bacteria 48586
400 Ga0268266_10008573 3300028379 Bacteria 9085
401 Ga0268266_10041675 3300028379 Bacteria 3918
402 Ga0268265_10003595 3300028380 Bacteria 11070
403 Ga0268265_10022374 3300028380 Bacteria 4440
404 Ga0268265_10030751 3300028380 Bacteria 3871
405 Ga0268264_10018832 3300028381 Bacteria 5646
406 Ga0268264_10365052 3300028381 Bacteria 1378
407 Ga0307511_10056545 3300030521 Bacteria 3066
408 Ga0307513_10086539 3300031456 Unclassified 3212
409 Ga0307405_10001068 3300031731 Bacteria 11129
410 Ga0307413_10001705 3300031824 Bacteria 8573
411 Ga0307410_10001648 3300031852 Bacteria 10273
412 Ga0307412_10000059 3300031911 Bacteria 138772
413 Ga0307409_100019267 3300031995 Bacteria 4615
414 Ga0307409_100024836 3300031995 Bacteria 4189
415 Ga0307409_100039904 3300031995 Bacteria 3489
416 Ga0307409_100132390 3300031995 Unclassified 2134
417 Ga0307416_100038874 3300032002 Bacteria 3676
418 Ga0307411_10001044 3300032005 Bacteria 10722
419 Ga0307411_10003927 3300032005 Bacteria 7016
420 Ga0307415_100170684 3300032126 Bacteria 1696
421 Ga0315911_1000006 3300033442 Bacteria 414563
422 Ga0395900_0051452 3300037418 Bacteria 4243
423 Ga0395905_0060951 3300037471 Bacteria 3528
424 Ga0395901_0059355 3300038443 Bacteria 3980
425 Ga0436360_0965611 3300039438 Bacteria 995
426 Ga0436361_0207335 3300039447 Bacteria 51296
427 Ga0436361_0505993 3300039447 Unclassified 1194
428 Ga0436361_1082816 3300039447 Unclassified 1881
429 Ga0436363_0511569 3300039450 Plasmid 2935
430 Ga0439438_013233 3300041405 Bacteria 2497
431 Ga0439438_023548 3300041405 Bacteria 1695
432 Ga0439447_000346 3300041407 Bacteria 16736
433 Ga0439447_000499 3300041407 Bacteria 14616
434 Ga0439447_002025 3300041407 Bacteria 7451
435 Ga0439447_021135 3300041407 Bacteria 1717
436 Ga0439466_0000604 3300041411 Bacteria 13476
437 Ga0439466_0007575 3300041411 Bacteria 4104
438 Ga0439466_0010466 3300041411 Bacteria 3447
439 Ga0439466_0021018 3300041411 Bacteria 2320
440 Ga0451833_1179013 3300041491 Bacteria 3231
441 Ga0451837_0929288 3300041494 Bacteria 5251
442 Ga0451839_0136270 3300041496 Bacteria 1585
443 Ga0451841_0223754 3300041498 Bacteria 6200
444 Ga0451845_0177229 3300041501 Bacteria 4291
445 Ga0451849_0015055 3300041505 Bacteria 9244
446 Ga0451843_0211581 3300041509 Bacteria 7109
447 Ga0451855_0193834 3300041511 Bacteria 8269
448 Ga0451853_0384032 3300041512 Bacteria 11489
449 Ga0451853_2342740 3300041512 Bacteria 1461
450 Ga0439432_008378 3300042006 Bacteria 3629
451 Ga0439432_008458 3300042006 Bacteria 3613
452 Ga0439452_000230 3300042010 Bacteria 38856
453 Ga0439452_007172 3300042010 Bacteria 3431
454 Ga0450920_002005 3300042122 Bacteria 3438
455 Ga0450922_000480 3300042124 Bacteria 4240
456 Ga0450902_002707 3300042137 Bacteria 2523
457 Ga0450903_000556 3300042138 Bacteria 7736
458 Ga0450903_001483 3300042138 Bacteria 4370
459 Ga0450906_003883 3300042145 Bacteria 3171
460 Ga0450907_000058 3300042146 Bacteria 43951
461 Ga0450907_000486 3300042146 Bacteria 11079
462 Ga0450908_001794 3300042184 Bacteria 4190
463 Ga0450908_006952 3300042184 Bacteria 2142
464 Ga0439434_0001657 3300042435 Bacteria 6447
465 Ga0439435_0008367 3300042436 Bacteria 2397
466 Ga0439460_0021739 3300042461 Bacteria 1756
467 Ga0466972_0000062 3300044658 Bacteria 108852
468 Ga0451576_0401455 3300045051 Bacteria 1437
469 Ga0495617_000993 3300046452 Bacteria 13183
470 Ga0495617_002201 3300046452 Bacteria 7958
471 Ga0495627_010450 3300046453 Bacteria 3373
472 Ga0495627_058047 3300046453 Bacteria 1150
473 Ga0495592_0082496 3300046454 Bacteria 2323
474 Ga0495603_0005483 3300046455 Bacteria 7572
475 Ga0495603_0032139 3300046455 Bacteria 3158
476 Ga0495590_0001284 3300046457 Bacteria 10942
477 Ga0495590_0001838 3300046457 Bacteria 8983
478 Ga0495591_000568 3300046458 Bacteria 28319
479 Ga0495591_006200 3300046458 Bacteria 5337
480 Ga0495591_013404 3300046458 Bacteria 3000
481 Ga0495629_0006111 3300046459 Bacteria 8948
482 Ga0495629_0018154 3300046459 Bacteria 5039
483 Ga0495638_0001251 3300046460 Bacteria 23897
484 Ga0495638_0013563 3300046460 Bacteria 5540
485 Ga0495638_0013813 3300046460 Bacteria 5482
486 Ga0495638_0028740 3300046460 Bacteria 3588
487 Ga0495638_0044236 3300046460 Bacteria 2806
488 Ga0495638_0074556 3300046460 Bacteria 2069
489 Ga0495638_0138704 3300046460 Bacteria 1421
490 Ga0495641_0021072 3300046461 Bacteria 3287
491 Ga0495653_0003309 3300046463 Bacteria 12937
492 Ga0495650_0003886 3300046471 Bacteria 10568
493 Ga0495650_0058957 3300046471 Bacteria 1547
494 Ga0495580_0000252 3300046472 Bacteria 42451
495 Ga0495580_0007518 3300046472 Bacteria 8748
496 Ga0495580_0093257 3300046472 Bacteria 2095
497 Ga0495582_0005918 3300046473 Bacteria 6817
498 Ga0495605_0000372 3300046474 Bacteria 42377
499 Ga0495605_0002542 3300046474 Bacteria 11241
500 Ga0495605_0005589 3300046474 Bacteria 7307
501 Ga0495605_0009349 3300046474 Bacteria 5509
502 Ga0495605_0025618 3300046474 Bacteria 3072
503 Ga0495664_0002646 3300046477 Bacteria 9633
504 Ga0495584_0000140 3300046491 Bacteria 50112
505 Ga0495584_0029936 3300046491 Bacteria 2758
506 Ga0495584_0200450 3300046491 Bacteria 1014
507 Ga0495585_0004195 3300046492 Bacteria 9410
508 Ga0495585_0020091 3300046492 Bacteria 3843
509 Ga0495585_0041128 3300046492 Bacteria 2593
510 Ga0495607_0002730 3300046501 Bacteria 14079
511 Ga0495607_0012901 3300046501 Bacteria 5495
512 Ga0495583_0000958 3300046506 Bacteria 33509
513 Ga0495583_0003084 3300046506 Bacteria 13195
514 Ga0495583_0021470 3300046506 Bacteria 3320
515 Ga0495606_0001909 3300046507 Bacteria 25955
516 Ga0495610_0000246 3300046512 Bacteria 56850
517 Ga0495610_0024122 3300046512 Bacteria 3288
518 Ga0495610_0028336 3300046512 Bacteria 2963
519 Ga0495616_0024999 3300046513 Bacteria 3196
520 Ga0495618_0006549 3300046514 Bacteria 7066
521 Ga0495620_0001486 3300046515 Bacteria 13999
522 Ga0495620_0040609 3300046515 Bacteria 2046
523 Ga0495628_0006201 3300046516 Bacteria 10453
524 Ga0495628_0008228 3300046516 Bacteria 8970
525 Ga0495628_0094662 3300046516 Bacteria 2308
526 Ga0495628_0196974 3300046516 Bacteria 1519
527 Ga0495630_0058285 3300046517 Bacteria 2894
528 Ga0495632_0000809 3300046519 Bacteria 27722
529 Ga0495632_0007408 3300046519 Bacteria 6895
530 Ga0495632_0035261 3300046519 Bacteria 2554
531 Ga0495632_0144654 3300046519 Bacteria 1101
532 Ga0495637_0006366 3300046520 Bacteria 5934
533 Ga0495637_0119285 3300046520 Bacteria 1016
534 Ga0495643_0004454 3300046522 Bacteria 9782
535 Ga0495643_0032039 3300046522 Bacteria 2921
536 Ga0495644_0001234 3300046523 Bacteria 10464
537 Ga0495644_0033310 3300046523 Bacteria 1946
538 Ga0495648_0007247 3300046524 Bacteria 8903
539 Ga0495648_0008085 3300046524 Bacteria 8316
540 Ga0495648_0011605 3300046524 Bacteria 6621
541 Ga0495648_0018705 3300046524 Bacteria 4892
542 Ga0495648_0043689 3300046524 Bacteria 2806
543 Ga0495666_0002673 3300046526 Bacteria 8892
544 Ga0495666_0070289 3300046526 Bacteria 1665
545 Ga0495642_0000082 3300046528 Bacteria 55424
546 Ga0495642_0000219 3300046528 Bacteria 32918
547 Ga0495642_0040338 3300046528 Bacteria 1896
548 Ga0495652_0009463 3300046529 Bacteria 8854
549 Ga0495652_0097404 3300046529 Bacteria 2393
550 Ga0495654_0003562 3300046530 Bacteria 9490
551 Ga0495654_0008233 3300046530 Bacteria 5771
552 Ga0495654_0039244 3300046530 Bacteria 2364
553 Ga0495665_0026911 3300046531 Bacteria 3087
554 Ga0495640_0006909 3300046533 Bacteria 8939
555 Ga0495586_0000805 3300046535 Bacteria 18018
556 Ga0495587_0003814 3300046536 Bacteria 9998
557 Ga0495587_0004637 3300046536 Bacteria 9035
558 Ga0495609_0000316 3300046538 Bacteria 43165
559 Ga0495609_0001746 3300046538 Bacteria 13981
560 Ga0495609_0008211 3300046538 Bacteria 5124
561 Ga0495609_0038168 3300046538 Bacteria 2166
562 Ga0495597_0004130 3300046542 Bacteria 8078
563 Ga0495597_0004173 3300046542 Bacteria 8017
564 Ga0495597_0056054 3300046542 Bacteria 1726
565 Ga0495597_0068080 3300046542 Bacteria 1539
566 Ga0495645_0004684 3300046543 Bacteria 9336
567 Ga0495622_0002129 3300046557 Bacteria 9649
568 Ga0495622_0018725 3300046557 Bacteria 3224
569 Ga0495622_0061191 3300046557 Bacteria 1744
570 Ga0495622_0091649 3300046557 Bacteria 1396
571 Ga0495633_0040377 3300046558 Bacteria 2223
572 Ga0495656_0004525 3300046615 Bacteria 4763
573 Ga0495656_0012309 3300046615 Plasmid 3154
574 Ga0495656_0019679 3300046615 Plasmid 2608
575 Ga0495668_0003879 3300046616 Bacteria 10915
576 Ga0495634_0001713 3300046642 Bacteria 19070
577 Ga0495634_0005677 3300046642 Bacteria 9546
578 Ga0495611_0029008 3300046648 Bacteria 2425
579 Ga0495611_0083002 3300046648 Bacteria 1475
580 Ga0495625_0042682 3300046660 Bacteria 3294
581 Ga0495625_0054522 3300046660 Bacteria 2854
582 Ga0495625_0063839 3300046660 Bacteria 2600
583 Ga0495625_0194119 3300046660 Bacteria 1343
584 Ga0495635_0000974 3300046663 Bacteria 18843
585 Ga0495635_0044272 3300046663 Bacteria 3071
586 Ga0495659_0001444 3300046664 Bacteria 8058
587 Ga0495661_0001499 3300046665 Bacteria 19443
588 Ga0495661_0051148 3300046665 Bacteria 2496
589 Ga0495588_0005503 3300046674 Bacteria 5641
590 Ga0495588_0025851 3300046674 Bacteria 2928
591 Ga0495588_0042741 3300046674 Bacteria 2317
592 Ga0495599_0007249 3300046678 Bacteria 6718
593 Ga0495599_0015627 3300046678 Bacteria 4712
594 Ga0495623_0005517 3300046679 Bacteria 8262
595 Ga0495623_0089020 3300046679 Bacteria 1898
596 Ga0495646_0004219 3300046680 Bacteria 9036
597 Ga0495646_0012597 3300046680 Bacteria 5374
598 Ga0495646_0060890 3300046680 Bacteria 2249
599 Ga0495646_0102156 3300046680 Bacteria 1642
600 Ga0495669_0006789 3300046684 Bacteria 4789
601 Ga0495669_0009604 3300046684 Bacteria 4082
602 Ga0495613_0001260 3300046689 Bacteria 19289
603 Ga0495624_0038155 3300046690 Bacteria 3087
604 Ga0495670_0003663 3300046691 Bacteria 7555
605 Ga0495670_0015669 3300046691 Bacteria 3725
606 Ga0495671_0001167 3300046692 Bacteria 18001
607 Ga0495671_0001456 3300046692 Bacteria 15898
608 Ga0495671_0009870 3300046692 Bacteria 5310
609 Ga0495671_0010679 3300046692 Bacteria 5081
610 Ga0495671_0020484 3300046692 Bacteria 3484
611 Ga0495671_0045519 3300046692 Bacteria 2196
612 Ga0495649_0003859 3300046694 Bacteria 9925
613 Ga0495649_0006496 3300046694 Bacteria 7276
614 Ga0495649_0021042 3300046694 Bacteria 3657
615 Ga0495649_0084045 3300046694 Bacteria 1700
616 Ga0495589_0001146 3300046794 Bacteria 15769
617 Ga0495589_0006667 3300046794 Bacteria 6082
618 Ga0495589_0018707 3300046794 Bacteria 3551
619 Ga0495660_0053697 3300046810 Bacteria 2186
620 Ga0495660_0070405 3300046810 Bacteria 1856
621 Ga0495660_0102350 3300046810 Bacteria 1472
622 Ga0495581_0016945 3300047315 Bacteria 4233
623 Ga0495604_0010223 3300047317 Bacteria 7434
624 Ga0495604_0050064 3300047317 Bacteria 3244
625 Ga0495604_0050243 3300047317 Bacteria 3238
626 Ga0495604_0158188 3300047317 Bacteria 1603
627 Ga0495636_0000052 3300047318 Bacteria 51030
628 Ga0495636_0007339 3300047318 Plasmid 4338
629 Ga0495636_0019442 3300047318 Plasmid 2731
630 Ga0495674_0003114 3300047319 Bacteria 16114
631 Ga0495674_0010538 3300047319 Bacteria 8748
632 Ga0495674_0020423 3300047319 Bacteria 6132
633 Ga0495674_0021838 3300047319 Bacteria 5914
634 Ga0495674_0027237 3300047319 Bacteria 5224
635 Ga0495674_0061922 3300047319 Bacteria 3259
636 Ga0495674_0139306 3300047319 Bacteria 2040
637 Ga0495672_0001830 3300047320 Bacteria 20344
638 Ga0495672_0002044 3300047320 Bacteria 18957
639 Ga0495672_0002429 3300047320 Bacteria 17174
640 Ga0495672_0006877 3300047320 Bacteria 8676
641 Ga0495672_0009622 3300047320 Bacteria 6977
642 Ga0495672_0010762 3300047320 Bacteria 6492
643 Ga0495672_0011778 3300047320 Bacteria 6146
644 Ga0495672_0026911 3300047320 Bacteria 3662
645 Ga0495672_0039068 3300047320 Bacteria 2889
646 Ga0495672_0050685 3300047320 Bacteria 2448
647 Ga0495672_0092397 3300047320 Bacteria 1659
648 Ga0495676_0001386 3300047321 Bacteria 20895
649 Ga0495680_0002757 3300047322 Bacteria 17736
650 Ga0495683_0007760 3300047323 Bacteria 5760
651 Ga0495683_0018642 3300047323 Bacteria 3585
652 Ga0495683_0057592 3300047323 Bacteria 1931
653 Ga0495687_001526 3300047443 Bacteria 21130
654 Ga0495687_015557 3300047443 Bacteria 3862
655 Ga0495687_042633 3300047443 Bacteria 1981
656 Ga0495675_0020643 3300047444 Bacteria 4194
657 Ga0495675_0021758 3300047444 Bacteria 4085
658 Ga0495675_0034600 3300047444 Bacteria 3225
659 Ga0495677_0000486 3300047445 Bacteria 16837
660 Ga0495679_000759 3300047446 Bacteria 20554
661 Ga0495679_003633 3300047446 Bacteria 7370
662 Ga0495679_005581 3300047446 Bacteria 5550
663 Ga0495673_0000319 3300047469 Bacteria 61961
664 Ga0495673_0001021 3300047469 Bacteria 24677
665 Ga0495673_0006070 3300047469 Bacteria 7172
666 Ga0495673_0006732 3300047469 Bacteria 6715
667 Ga0495673_0010237 3300047469 Bacteria 5117
668 Ga0495673_0022344 3300047469 Bacteria 3103
669 Ga0495681_0000023 3300047470 Bacteria 154266
670 Ga0495681_0025362 3300047470 Bacteria 3102
671 Ga0495684_0135617 3300047471 Bacteria 1847
672 Ga0495593_0003926 3300047673 Bacteria 8880
673 Ga0495593_0037760 3300047673 Bacteria 2610
674 Ga0495602_0072821 3300048088 Bacteria 2927
675 Ga0495602_0220922 3300048088 Bacteria 1430
676 Ga0495614_0000330 3300048089 Bacteria 18744
677 Ga0495626_0000340 3300048091 Bacteria 49123
678 Ga0495626_0000394 3300048091 Bacteria 45106
679 Ga0495626_0008878 3300048091 Bacteria 5461
680 Ga0495626_0018689 3300048091 Bacteria 3474
681 Ga0496100_0031403 3300048903 Bacteria 3303
682 Ga0496100_0038764 3300048903 Bacteria 3022
683 Ga0496100_0198453 3300048903 Bacteria 1461
684 Ga0496101_0017882 3300048904 Bacteria 4812
685 Ga0496101_0030709 3300048904 Bacteria 3771
686 Ga0496102_0002794 3300048905 Bacteria 14880
687 Ga0496102_0217046 3300048905 Unclassified 1803
688 Ga0496103_0002417 3300048906 Bacteria 11750
689 Ga0496103_0130515 3300048906 Bacteria 1604
690 Ga0496104_0074268 3300048907 Bacteria 3237
691 Ga0496104_0162243 3300048907 Bacteria 2144
692 Ga0496104_0307143 3300048907 Bacteria 1499
693 Ga0496105_0000318 3300048908 Bacteria 31631
694 Ga0496105_0300152 3300048908 Bacteria 1291
695 Ga0496106_0119250 3300048909 Unclassified 2061
696 Ga0496106_0152564 3300048909 Bacteria 1823
697 Ga0496108_0000303 3300048911 Bacteria 42278
698 Ga0496108_0021149 3300048911 Bacteria 5346
699 Ga0496108_0058871 3300048911 Bacteria 3230
700 Ga0496108_0180559 3300048911 Bacteria 1827
701 Ga0496109_0000504 3300048912 Bacteria 33447
702 Ga0496109_0072044 3300048912 Bacteria 3173
703 Ga0496110_0001004 3300048913 Bacteria 19871
704 Ga0496110_0070576 3300048913 Bacteria 3095
705 Ga0496112_0000042 3300048915 Bacteria 88041
706 Ga0496112_0000460 3300048915 Bacteria 27193
707 Ga0496112_0011547 3300048915 Bacteria 8072
708 Ga0496112_0015563 3300048915 Bacteria 7104
709 Ga0496112_0223438 3300048915 Bacteria 1839
710 Ga0496113_0006588 3300048916 Bacteria 7382
711 Ga0496113_0033553 3300048916 Bacteria 3739
712 Ga0496114_0276775 3300048917 Bacteria 1479
713 Ga0496115_0012747 3300048918 Bacteria 6337
714 Ga0496115_0194941 3300048918 Bacteria 1674
715 Ga0496116_0048592 3300048919 Bacteria 2846
716 Ga0496116_0056833 3300048919 Bacteria 2562
717 Ga0496117_0006453 3300048920 Bacteria 11865
718 Ga0496117_0012410 3300048920 Bacteria 7514
719 Ga0496117_0088194 3300048920 Bacteria 2008
720 Ga0496117_0155064 3300048920 Bacteria 1350
721 Ga0496118_0005967 3300048921 Bacteria 13588
722 Ga0496118_0015867 3300048921 Bacteria 6945
723 Ga0496118_0016993 3300048921 Bacteria 6644
724 Ga0496119_0107677 3300048922 Bacteria 1553
725 Ga0496121_0000557 3300048924 Bacteria 70347
726 Ga0496124_0004276 3300048927 Bacteria 16783
727 Ga0496125_0060939 3300048928 Bacteria 3029
728 Ga0496126_0138896 3300048929 Bacteria 2093
729 Ga0495678_037804 3300049459 Bacteria 1957
730 Ga0495682_0005771 3300049460 Bacteria 5100
731 Ga0495682_0006897 3300049460 Bacteria 4563
732 Ga0495682_0092839 3300049460 Bacteria 1083
733 Ga0501292_005045 3300049515 Unclassified 1828
734 Ga0501298_022062 3300049521 Unclassified 1197
735 Ga0501299_000069 3300049522 Bacteria 11575
736 Ga0501299_002137 3300049522 Unclassified 2701
737 Ga0501034_0000163 3300049571 Bacteria 125417
738 Ga0501068_0118792 3300049584 Bacteria 1647
739 Ga0501217_006254 3300049661 Plasmid 2522
740 Ga0501225_0003702 3300049705 Bacteria 4602
741 Ga0501080_0206110 3300049742 Bacteria 1803
742 Ga0501283_016512 3300049779 Unclassified 1146
743 nmdc:mga03683_1054_c1 3300050489 Bacteria 6426
744 nmdc:mga03n38_5791_c1 3300050490 Bacteria 4242
745 nmdc:mga00v17_130337_c1 3300050491 Bacteria 1607
746 nmdc:mga0yw44_247174_c1 3300050492 Bacteria 1187
747 nmdc:mga0k408_181516_c1 3300050493 Bacteria 1255
748 nmdc:mga0k408_75415_c1 3300050493 Bacteria 1970
749 nmdc:mga06z11_149602_c1 3300050494 Unclassified 1326
750 nmdc:mga06z11_24340_c1 3300050494 Bacteria 2855
751 nmdc:mga06z11_72028_c1 3300050494 Bacteria 1831
752 nmdc:mga04h51_12817_c1 3300050495 Bacteria 2362
753 nmdc:mga07m45_25840_c1 3300050496 Bacteria 3224
754 nmdc:mga05p37_23905_c1 3300050507 Bacteria 7419
755 nmdc:mga05p37_308638_c1 3300050507 Bacteria 1876
756 nmdc:mga0qj67_97_c1 3300050509 Bacteria 58508
757 nmdc:mga06r32_259_c2 3300050510 Bacteria 43373
758 nmdc:mga06r32_64078_c1 3300050510 Bacteria 3543
759 nmdc:mga08y16_38592_c1 3300050511 Bacteria 5014
760 nmdc:mga0n895_65424_c1 3300050512 Bacteria 3599
761 nmdc:mga0rr50_2086_c1 3300050513 Bacteria 11169
762 nmdc:mga0a205_34474_c1 3300050515 Bacteria 4855
763 nmdc:mga0a205_35009_c1 3300050515 Bacteria 4822
764 nmdc:mga0a205_50343_c1 3300050515 Bacteria 4022
765 nmdc:mga0sz30_25593_c1 3300050516 Bacteria 2413
766 Ga0500644_0013412 3300053088 Bacteria 2289
767 Ga0500595_007412 3300053119 Bacteria 4553
768 Ga0500568_0000850 3300053139 Bacteria 21493
769 Ga0500616_0007172 3300053153 Bacteria 7128
770 Ga0500616_0043944 3300053153 Bacteria 2386
771 Ga0500645_009472 3300053730 Bacteria 3270
772 Ga0590071_000355 3300059421 Bacteria 13511
773 Ga0590074_000726 3300059423 Bacteria 5014
774 Ga0590075_000518 3300059424 Bacteria 10469
775 Ga0590077_000860 3300059426 Bacteria 7790

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0040609 Ga0495620_0040609_13_813 258
2 iso_pu_bacteria 2738543015 2739258551 284
3 iso_pu_bacteria 8016622563 8016628203 292
4 3300009553 Ga0105249_10702794 Ga0105249_107027941 297
5 3300006178 Ga0075367_10005759 Ga0075367_100057599 298
6 3300050493 nmdc:mga0k408_75415_c1 nmdc:mga0k408_75415_c1_935_1927 298
7 3300050494 nmdc:mga06z11_72028_c1 nmdc:mga06z11_72028_c1_240_1232 298
8 3300047320 Ga0495672_0009622 Ga0495672_0009622_502_1506 305
9 iso_pu_bacteria 2558860280 2559423248 306
10 iso_pu_bacteria 2919125081 2919126939 310
11 iso_pu_bacteria 2984504281 2984504873 310
12 iso_pu_bacteria 8016728285 8016733304 310
13 3300039438 Ga0436360_0965611 Ga0436360_0965611_22_972 311
14 3300049584 Ga0501068_0118792 Ga0501068_0118792_17_970 311
15 iso_pu_bacteria 2517093000 2517097703 311
16 iso_pu_bacteria 2765235942 2766063351 311
17 3300042461 Ga0439460_0021739 Ga0439460_0021739_94_1041 312
18 3300053139 Ga0500568_0000850 Ga0500568_0000850_15204_16160 312
19 iso_pu_bacteria 3007619802 3007621890 312
20 3300031995 Ga0307409_100039904 Ga0307409_1000399043 313
21 3300005844 Ga0068862_100378950 Ga0068862_1003789501 314
22 3300006048 Ga0075363_100026247 Ga0075363_1000262473 314
23 3300006051 Ga0075364_10004579 Ga0075364_100045797 314
24 3300006195 Ga0075366_10134883 Ga0075366_101348832 314
25 3300006353 Ga0075370_10012587 Ga0075370_100125873 314
26 3300006353 Ga0075370_10043709 Ga0075370_100437093 314
27 3300009092 Ga0105250_10000426 Ga0105250_1000042620 314
28 3300025711 Ga0207696_1000266 Ga0207696_100026649 314
29 3300025933 Ga0207706_10100627 Ga0207706_101006273 314
30 3300050490 nmdc:mga03n38_5791_c1 nmdc:mga03n38_5791_c1_1537_2511 314
31 3300050491 nmdc:mga00v17_130337_c1 nmdc:mga00v17_130337_c1_13_987 314
32 3300050496 nmdc:mga07m45_25840_c1 nmdc:mga07m45_25840_c1_1341_2315 314
33 3300050516 nmdc:mga0sz30_25593_c1 nmdc:mga0sz30_25593_c1_646_1620 314
34 3300009174 Ga0105241_10002471 Ga0105241_1000247112 315
35 3300025911 Ga0207654_10021980 Ga0207654_100219804 315
36 3300041491 Ga0451833_1179013 Ga0451833_1179013_803_1795 315
37 3300041494 Ga0451837_0929288 Ga0451837_0929288_2072_3064 315
38 3300041496 Ga0451839_0136270 Ga0451839_0136270_48_1040 315
39 3300041498 Ga0451841_0223754 Ga0451841_0223754_2370_3362 315
40 3300041501 Ga0451845_0177229 Ga0451845_0177229_2870_3862 315
41 3300041505 Ga0451849_0015055 Ga0451849_0015055_5599_6591 315
42 3300041509 Ga0451843_0211581 Ga0451843_0211581_802_1794 315
43 3300041511 Ga0451855_0193834 Ga0451855_0193834_3866_4858 315
44 3300041512 Ga0451853_0384032 Ga0451853_0384032_3893_4885 315
45 3300049742 Ga0501080_0206110 Ga0501080_0206110_234_1190 315
46 3300005288 Ga0065714_10076134 Ga0065714_100761342 316
47 3300005354 Ga0070675_100017418 Ga0070675_1000174184 316
48 3300005364 Ga0070673_100008156 Ga0070673_1000081563 316
49 3300005457 Ga0070662_100121036 Ga0070662_1001210362 316
50 3300005544 Ga0070686_100073039 Ga0070686_1000730392 316
51 3300005547 Ga0070693_100036990 Ga0070693_1000369903 316
52 3300005577 Ga0068857_100013777 Ga0068857_1000137774 316
53 3300005617 Ga0068859_100027750 Ga0068859_1000277503 316
54 3300005618 Ga0068864_100110347 Ga0068864_1001103472 316
55 3300005719 Ga0068861_100304508 Ga0068861_1003045082 316
56 3300005843 Ga0068860_100019448 Ga0068860_1000194483 316
57 3300005844 Ga0068862_100046428 Ga0068862_1000464283 316
58 3300006931 Ga0097620_100027750 Ga0097620_1000277506 316
59 3300025885 Ga0207653_10001217 Ga0207653_100012174 316
60 3300025904 Ga0207647_10072785 Ga0207647_100727852 316
61 3300025926 Ga0207659_10252947 Ga0207659_102529472 316
62 3300025933 Ga0207706_10105470 Ga0207706_101054703 316
63 3300025941 Ga0207711_10296857 Ga0207711_102968571 316
64 3300025961 Ga0207712_10003692 Ga0207712_100036925 316
65 3300026067 Ga0207678_10039751 Ga0207678_100397515 316
66 3300026075 Ga0207708_10019125 Ga0207708_100191253 316
67 3300026095 Ga0207676_10004713 Ga0207676_100047135 316
68 3300026116 Ga0207674_10149718 Ga0207674_101497181 316
69 3300028380 Ga0268265_10022374 Ga0268265_100223743 316
70 3300028381 Ga0268264_10018832 Ga0268264_100188325 316
71 3300028381 Ga0268264_10365052 Ga0268264_103650522 316
72 3300053730 Ga0500645_009472 Ga0500645_009472_100_1086 316
73 iso_pu_bacteria 2517572143 2517887946 316
74 3300005337 Ga0070682_100002341 Ga0070682_10000234111 317
75 3300005338 Ga0068868_100230102 Ga0068868_1002301022 317
76 3300005344 Ga0070661_100149648 Ga0070661_1001496482 317
77 3300005440 Ga0070705_100159061 Ga0070705_1001590612 317
78 3300005455 Ga0070663_100060072 Ga0070663_1000600724 317
79 3300005456 Ga0070678_100026029 Ga0070678_1000260296 317
80 3300005458 Ga0070681_10004260 Ga0070681_100042609 317
81 3300005459 Ga0068867_100059301 Ga0068867_1000593013 317
82 3300005530 Ga0070679_100045513 Ga0070679_1000455134 317
83 3300005545 Ga0070695_100056594 Ga0070695_1000565942 317
84 3300005615 Ga0070702_100016681 Ga0070702_1000166812 317
85 3300005617 Ga0068859_100549551 Ga0068859_1005495511 317
86 3300005842 Ga0068858_100035748 Ga0068858_1000357486 317
87 3300005843 Ga0068860_100111365 Ga0068860_1001113652 317
88 3300006881 Ga0068865_100089721 Ga0068865_1000897212 317
89 3300006931 Ga0097620_100549554 Ga0097620_1005495541 317
90 3300009174 Ga0105241_10007576 Ga0105241_100075766 317
91 3300009545 Ga0105237_10388639 Ga0105237_103886391 317
92 3300009551 Ga0105238_10016084 Ga0105238_100160844 317
93 3300010375 Ga0105239_10141603 Ga0105239_101416031 317
94 3300011119 Ga0105246_10033410 Ga0105246_100334105 317
95 3300013308 Ga0157375_10208923 Ga0157375_102089232 317
96 3300014968 Ga0157379_10179165 Ga0157379_101791651 317
97 3300025904 Ga0207647_10020614 Ga0207647_100206145 317
98 3300025911 Ga0207654_10053330 Ga0207654_100533301 317
99 3300025921 Ga0207652_10278888 Ga0207652_102788882 317
100 3300025949 Ga0207667_10597210 Ga0207667_105972101 317
101 3300026041 Ga0207639_10074334 Ga0207639_100743344 317
102 3300026067 Ga0207678_10000193 Ga0207678_1000019343 317
103 3300026075 Ga0207708_10124264 Ga0207708_101242641 317
104 3300026116 Ga0207674_10132169 Ga0207674_101321691 317
105 3300026121 Ga0207683_10032279 Ga0207683_100322792 317
106 3300026142 Ga0207698_10402498 Ga0207698_104024981 317
107 3300037471 Ga0395905_0060951 Ga0395905_0060951_1693_2682 317
108 3300048903 Ga0496100_0038764 Ga0496100_0038764_311_1273 317
109 3300048904 Ga0496101_0017882 Ga0496101_0017882_1721_2683 317
110 3300048906 Ga0496103_0130515 Ga0496103_0130515_313_1275 317
111 3300048918 Ga0496115_0012747 Ga0496115_0012747_5025_5987 317
112 3300013306 Ga0163162_10384173 Ga0163162_103841732 318
113 iso_pu_bacteria 2511231018 2511340131 318
114 iso_pu_bacteria 2511231019 2511347101 318
115 iso_pu_bacteria 2687453257 2688070011 318
116 iso_pu_bacteria 2808606382 2808958250 318
117 iso_pu_bacteria 2919456309 2919456344 318
118 iso_pu_bacteria 3007511990 3007514686 318
119 3300005365 Ga0070688_100011783 Ga0070688_1000117835 319
120 3300005466 Ga0070685_10099741 Ga0070685_100997412 319
121 3300005617 Ga0068859_100318326 Ga0068859_1003183261 319
122 3300006931 Ga0097620_100318341 Ga0097620_1003183411 319
123 3300037418 Ga0395900_0051452 Ga0395900_0051452_1639_2607 319
124 3300038443 Ga0395901_0059355 Ga0395901_0059355_2368_3336 319
125 3300046460 Ga0495638_0044236 Ga0495638_0044236_302_1291 319
126 3300046660 Ga0495625_0042682 Ga0495625_0042682_2108_3097 319
127 3300006038 Ga0075365_10308341 Ga0075365_103083412 320
128 3300009011 Ga0105251_10002329 Ga0105251_100023297 320
129 3300025735 Ga0207713_1032504 Ga0207713_10325042 320
130 3300039447 Ga0436361_1082816 Ga0436361_1082816_602_1663 320
131 3300046457 Ga0495590_0001838 Ga0495590_0001838_3003_3965 320
132 3300046458 Ga0495591_006200 Ga0495591_006200_3361_4323 320
133 3300046460 Ga0495638_0001251 Ga0495638_0001251_18508_19470 320
134 3300046491 Ga0495584_0200450 Ga0495584_0200450_17_979 320
135 3300046501 Ga0495607_0002730 Ga0495607_0002730_9482_10444 320
136 3300046519 Ga0495632_0007408 Ga0495632_0007408_1580_2542 320
137 3300046522 Ga0495643_0032039 Ga0495643_0032039_1551_2513 320
138 3300046523 Ga0495644_0001234 Ga0495644_0001234_4429_5391 320
139 3300046542 Ga0495597_0056054 Ga0495597_0056054_478_1440 320
140 3300046692 Ga0495671_0009870 Ga0495671_0009870_1307_2269 320
141 3300046694 Ga0495649_0003859 Ga0495649_0003859_5300_6262 320
142 3300046810 Ga0495660_0053697 Ga0495660_0053697_902_1864 320
143 3300047320 Ga0495672_0001830 Ga0495672_0001830_5207_6169 320
144 3300047320 Ga0495672_0002044 Ga0495672_0002044_4429_5391 320
145 3300047323 Ga0495683_0007760 Ga0495683_0007760_227_1189 320
146 3300047469 Ga0495673_0001021 Ga0495673_0001021_4114_5076 320
147 3300048927 Ga0496124_0004276 Ga0496124_0004276_5068_6030 320
148 3300050492 nmdc:mga0yw44_247174_c1 nmdc:mga0yw44_247174_c1_119_1102 320
149 3300053153 Ga0500616_0043944 Ga0500616_0043944_440_1459 320
150 iso_pu_bacteria 2501025504 2501411952 320
151 iso_pu_bacteria 2510917014 2511100950 320
152 iso_pu_bacteria 2511231012 2511304758 320
153 iso_pu_bacteria 2511231014 2511313815 320
154 iso_pu_bacteria 2511231015 2511323085 320
155 iso_pu_bacteria 2511231017 2511334520 320
156 iso_pu_bacteria 2511231020 2511352501 320
157 iso_pu_bacteria 2511231021 2511357733 320
158 iso_pu_bacteria 2513237082 2513552360 320
159 iso_pu_bacteria 2513237083 2513565228 320
160 iso_pu_bacteria 2513237098 2513677494 320
161 iso_pu_bacteria 2513237166 2514054988 320
162 iso_pu_bacteria 2515154189 2516019955 320
163 iso_pu_bacteria 2617270735 2617347289 320
164 iso_pu_bacteria 2643221633 2644186694 320
165 iso_pu_bacteria 2643221643 2644239977 320
166 iso_pu_bacteria 2738541296 2738821156 320
167 iso_pu_bacteria 2738541298 2738833638 320
168 iso_pu_bacteria 2738541306 2738877045 320
169 iso_pu_bacteria 2738543002 2739186794 320
170 iso_pu_bacteria 2738543004 2739197725 320
171 iso_pu_bacteria 2738543008 2739223638 320
172 iso_pu_bacteria 2744054900 2746089991 320
173 iso_pu_bacteria 2744054901 2746098620 320
174 iso_pu_bacteria 2773857670 2774123601 320
175 iso_pu_bacteria 2784132072 2784317232 320
176 iso_pu_bacteria 2791355137 2792838295 320
177 iso_pu_bacteria 2860339153 2860342204 320
178 iso_pu_bacteria 2879099564 2879101613 320
179 iso_pu_bacteria 2883087390 2883088627 320
180 iso_pu_bacteria 2885383462 2885390995 320
181 iso_pu_bacteria 2904483920 2904486945 320
182 iso_pu_bacteria 2906635258 2906636604 320
183 iso_pu_bacteria 2919527303 2919528258 320
184 iso_pu_bacteria 2931396565 2931401138 320
185 iso_pu_bacteria 2935785616 2935793071 320
186 iso_pu_bacteria 2935793552 2935801131 320
187 iso_pu_bacteria 2939636861 2939641377 320
188 iso_pu_bacteria 2945934425 2945939451 320
189 iso_pu_bacteria 2990703756 2990706793 320
190 iso_pu_bacteria 3005409236 3005411721 320
191 iso_pu_bacteria 641736151 642424714 320
192 iso_pu_bacteria 8003955200 8003959278 320
193 iso_pu_bacteria 8016522445 8016524299 320
194 iso_pu_bacteria 8016530956 8016537850 320
195 iso_pu_bacteria 8016539877 8016542132 320
196 iso_pu_bacteria 8016548790 8016551150 320
197 iso_pu_bacteria 8016557553 8016559549 320
198 iso_pu_bacteria 8016575299 8016580211 320
199 iso_pu_bacteria 8016595262 8016597488 320
200 iso_pu_bacteria 8019530166 8019537524 320
201 iso_pu_bacteria 8019547302 8019555281 320
202 iso_pu_bacteria 8055301274 8055309088 320
203 iso_pu_bacteria 8056125926 8056129356 320
204 3300005290 Ga0065712_10071037 Ga0065712_100710376 321
205 3300005293 Ga0065715_10110552 Ga0065715_101105522 321
206 3300005327 Ga0070658_10038553 Ga0070658_100385533 321
207 3300005327 Ga0070658_10088993 Ga0070658_100889932 321
208 3300005328 Ga0070676_10011830 Ga0070676_100118308 321
209 3300005329 Ga0070683_100009446 Ga0070683_1000094464 321
210 3300005330 Ga0070690_100022389 Ga0070690_1000223892 321
211 3300005331 Ga0070670_100140997 Ga0070670_1001409972 321
212 3300005334 Ga0068869_100025692 Ga0068869_1000256924 321
213 3300005338 Ga0068868_100035497 Ga0068868_1000354976 321
214 3300005344 Ga0070661_100004754 Ga0070661_1000047542 321
215 3300005353 Ga0070669_100003066 Ga0070669_10000306611 321
216 3300005354 Ga0070675_100003303 Ga0070675_10000330311 321
217 3300005355 Ga0070671_100106082 Ga0070671_1001060822 321
218 3300005364 Ga0070673_100074823 Ga0070673_1000748233 321
219 3300005365 Ga0070688_100006974 Ga0070688_1000069747 321
220 3300005366 Ga0070659_100020994 Ga0070659_1000209944 321
221 3300005455 Ga0070663_100002053 Ga0070663_1000020537 321
222 3300005455 Ga0070663_100003821 Ga0070663_1000038214 321
223 3300005456 Ga0070678_100007814 Ga0070678_1000078148 321
224 3300005457 Ga0070662_100006743 Ga0070662_10000674311 321
225 3300005458 Ga0070681_10085310 Ga0070681_100853102 321
226 3300005458 Ga0070681_10292041 Ga0070681_102920411 321
227 3300005459 Ga0068867_100059282 Ga0068867_1000592821 321
228 3300005466 Ga0070685_10001089 Ga0070685_100010899 321
229 3300005535 Ga0070684_100005692 Ga0070684_10000569211 321
230 3300005535 Ga0070684_100344398 Ga0070684_1003443982 321
231 3300005543 Ga0070672_100002263 Ga0070672_10000226311 321
232 3300005546 Ga0070696_100088416 Ga0070696_1000884162 321
233 3300005563 Ga0068855_100032462 Ga0068855_1000324624 321
234 3300005563 Ga0068855_100059748 Ga0068855_1000597484 321
235 3300005577 Ga0068857_100010201 Ga0068857_1000102012 321
236 3300005578 Ga0068854_100100541 Ga0068854_1001005413 321
237 3300005614 Ga0068856_100051411 Ga0068856_1000514112 321
238 3300005616 Ga0068852_100000608 Ga0068852_1000006082 321
239 3300005718 Ga0068866_10024206 Ga0068866_100242064 321
240 3300005834 Ga0068851_10002037 Ga0068851_100020374 321
241 3300005840 Ga0068870_10011138 Ga0068870_100111384 321
242 3300005841 Ga0068863_100003501 Ga0068863_1000035013 321
243 3300005842 Ga0068858_100141536 Ga0068858_1001415362 321
244 3300005844 Ga0068862_100018369 Ga0068862_1000183693 321
245 3300006237 Ga0097621_100108811 Ga0097621_1001088112 321
246 3300006881 Ga0068865_100006599 Ga0068865_1000065997 321
247 3300009093 Ga0105240_10009514 Ga0105240_100095145 321
248 3300009098 Ga0105245_10023853 Ga0105245_100238534 321
249 3300009101 Ga0105247_10005335 Ga0105247_100053352 321
250 3300009174 Ga0105241_10072609 Ga0105241_100726093 321
251 3300009176 Ga0105242_10089593 Ga0105242_100895933 321
252 3300009177 Ga0105248_10523791 Ga0105248_105237911 321
253 3300009545 Ga0105237_10418830 Ga0105237_104188301 321
254 3300009551 Ga0105238_10094665 Ga0105238_100946654 321
255 3300010375 Ga0105239_10155010 Ga0105239_101550104 321
256 3300011119 Ga0105246_10001423 Ga0105246_100014238 321
257 3300013100 Ga0157373_10005649 Ga0157373_100056498 321
258 3300013102 Ga0157371_10013270 Ga0157371_100132707 321
259 3300013104 Ga0157370_10000003 Ga0157370_100000035 321
260 3300013104 Ga0157370_10007047 Ga0157370_1000704711 321
261 3300013105 Ga0157369_10000377 Ga0157369_1000037727 321
262 3300013296 Ga0157374_10065223 Ga0157374_100652234 321
263 3300013306 Ga0163162_10217608 Ga0163162_102176082 321
264 3300013307 Ga0157372_10018203 Ga0157372_100182033 321
265 3300013308 Ga0157375_10152127 Ga0157375_101521273 321
266 3300014325 Ga0163163_10001651 Ga0163163_1000165111 321
267 3300014745 Ga0157377_10004857 Ga0157377_100048573 321
268 3300014968 Ga0157379_10047635 Ga0157379_100476354 321
269 3300014969 Ga0157376_10040609 Ga0157376_100406093 321
270 3300017792 Ga0163161_10055756 Ga0163161_100557563 321
271 3300025900 Ga0207710_10028258 Ga0207710_100282583 321
272 3300025904 Ga0207647_10026914 Ga0207647_100269144 321
273 3300025907 Ga0207645_10001972 Ga0207645_1000197213 321
274 3300025908 Ga0207643_10000620 Ga0207643_1000062018 321
275 3300025909 Ga0207705_10012636 Ga0207705_100126367 321
276 3300025912 Ga0207707_10074197 Ga0207707_100741974 321
277 3300025912 Ga0207707_10309943 Ga0207707_103099432 321
278 3300025913 Ga0207695_10000316 Ga0207695_1000031699 321
279 3300025913 Ga0207695_10019383 Ga0207695_100193836 321
280 3300025914 Ga0207671_10259237 Ga0207671_102592371 321
281 3300025918 Ga0207662_10000359 Ga0207662_1000035918 321
282 3300025919 Ga0207657_10064227 Ga0207657_100642274 321
283 3300025920 Ga0207649_10000963 Ga0207649_1000096310 321
284 3300025923 Ga0207681_10006066 Ga0207681_100060662 321
285 3300025925 Ga0207650_10000076 Ga0207650_100000762 321
286 3300025926 Ga0207659_10076448 Ga0207659_100764482 321
287 3300025931 Ga0207644_10025573 Ga0207644_100255734 321
288 3300025932 Ga0207690_10023247 Ga0207690_100232474 321
289 3300025933 Ga0207706_10001653 Ga0207706_1000165314 321
290 3300025934 Ga0207686_10330008 Ga0207686_103300081 321
291 3300025936 Ga0207670_10052298 Ga0207670_100522982 321
292 3300025940 Ga0207691_10000188 Ga0207691_1000018816 321
293 3300025941 Ga0207711_10031378 Ga0207711_100313784 321
294 3300025942 Ga0207689_10003791 Ga0207689_1000379110 321
295 3300025944 Ga0207661_10005191 Ga0207661_100051911 321
296 3300025945 Ga0207679_10000338 Ga0207679_1000033811 321
297 3300025949 Ga0207667_10009354 Ga0207667_100093544 321
298 3300025949 Ga0207667_10061946 Ga0207667_100619464 321
299 3300025981 Ga0207640_10055570 Ga0207640_100555703 321
300 3300026035 Ga0207703_10060520 Ga0207703_100605204 321
301 3300026067 Ga0207678_10000412 Ga0207678_100004126 321
302 3300026067 Ga0207678_10226519 Ga0207678_102265192 321
303 3300026088 Ga0207641_10000150 Ga0207641_1000015041 321
304 3300026089 Ga0207648_10009761 Ga0207648_100097616 321
305 3300026095 Ga0207676_10003432 Ga0207676_100034328 321
306 3300026116 Ga0207674_10005839 Ga0207674_100058399 321
307 3300026116 Ga0207674_10340424 Ga0207674_103404241 321
308 3300026121 Ga0207683_10015528 Ga0207683_100155286 321
309 3300026142 Ga0207698_10000271 Ga0207698_100002716 321
310 3300026142 Ga0207698_10018413 Ga0207698_100184134 321
311 3300028379 Ga0268266_10041675 Ga0268266_100416752 321
312 3300028380 Ga0268265_10003595 Ga0268265_1000359510 321
313 3300031731 Ga0307405_10001068 Ga0307405_1000106811 321
314 3300031824 Ga0307413_10001705 Ga0307413_100017054 321
315 3300031852 Ga0307410_10001648 Ga0307410_100016481 321
316 3300031995 Ga0307409_100024836 Ga0307409_1000248363 321
317 3300032002 Ga0307416_100038874 Ga0307416_1000388744 321
318 3300032005 Ga0307411_10001044 Ga0307411_100010447 321
319 3300042010 Ga0439452_007172 Ga0439452_007172_2061_3026 321
320 3300042138 Ga0450903_001483 Ga0450903_001483_739_1704 321
321 3300047320 Ga0495672_0026911 Ga0495672_0026911_1814_2797 321
322 3300048903 Ga0496100_0198453 Ga0496100_0198453_140_1153 321
323 3300048909 Ga0496106_0152564 Ga0496106_0152564_578_1591 321
324 3300048911 Ga0496108_0000303 Ga0496108_0000303_40956_41969 321
325 3300048912 Ga0496109_0000504 Ga0496109_0000504_16355_17368 321
326 3300048913 Ga0496110_0001004 Ga0496110_0001004_14334_15347 321
327 3300048915 Ga0496112_0000042 Ga0496112_0000042_81281_82294 321
328 3300048916 Ga0496113_0006588 Ga0496113_0006588_989_2002 321
329 3300050515 nmdc:mga0a205_35009_c1 nmdc:mga0a205_35009_c1_1517_2497 321
330 3300005288 Ga0065714_10007661 Ga0065714_100076613 322
331 3300005293 Ga0065715_10089898 Ga0065715_100898982 322
332 3300005355 Ga0070671_100043540 Ga0070671_1000435403 322
333 3300005355 Ga0070671_100100895 Ga0070671_1001008953 322
334 3300005530 Ga0070679_100346592 Ga0070679_1003465921 322
335 3300005618 Ga0068864_100105488 Ga0068864_1001054883 322
336 3300005844 Ga0068862_100440717 Ga0068862_1004407171 322
337 3300006852 Ga0075433_10037910 Ga0075433_100379103 322
338 3300007076 Ga0075435_100001379 Ga0075435_10000137914 322
339 3300013100 Ga0157373_10003842 Ga0157373_100038429 322
340 3300017792 Ga0163161_10002355 Ga0163161_100023553 322
341 3300025931 Ga0207644_10126552 Ga0207644_101265522 322
342 3300025931 Ga0207644_10140784 Ga0207644_101407842 322
343 3300026075 Ga0207708_10372553 Ga0207708_103725531 322
344 3300026118 Ga0207675_100529731 Ga0207675_1005297312 322
345 3300030521 Ga0307511_10056545 Ga0307511_100565452 322
346 3300041405 Ga0439438_023548 Ga0439438_023548_629_1597 322
347 3300041407 Ga0439447_000499 Ga0439447_000499_7741_8709 322
348 3300041411 Ga0439466_0000604 Ga0439466_0000604_6630_7598 322
349 3300042010 Ga0439452_000230 Ga0439452_000230_29156_30124 322
350 3300042137 Ga0450902_002707 Ga0450902_002707_1184_2152 322
351 3300046460 Ga0495638_0138704 Ga0495638_0138704_321_1289 322
352 3300046519 Ga0495632_0144654 Ga0495632_0144654_53_1021 322
353 3300046542 Ga0495597_0004173 Ga0495597_0004173_6614_7582 322
354 3300046557 Ga0495622_0002129 Ga0495622_0002129_6293_7261 322
355 3300046615 Ga0495656_0012309 Ga0495656_0012309_48_1025 322
356 3300046615 Ga0495656_0019679 Ga0495656_0019679_729_1706 322
357 3300046660 Ga0495625_0194119 Ga0495625_0194119_82_1050 322
358 3300046674 Ga0495588_0005503 Ga0495588_0005503_1968_2936 322
359 3300047318 Ga0495636_0000052 Ga0495636_0000052_26819_27796 322
360 3300047318 Ga0495636_0007339 Ga0495636_0007339_2653_3630 322
361 3300047318 Ga0495636_0019442 Ga0495636_0019442_538_1515 322
362 3300047470 Ga0495681_0000023 Ga0495681_0000023_143349_144317 322
363 3300048911 Ga0496108_0180559 Ga0496108_0180559_518_1498 322
364 3300048915 Ga0496112_0223438 Ga0496112_0223438_148_1128 322
365 3300005336 Ga0070680_100018122 Ga0070680_1000181222 323
366 3300005434 Ga0070709_10122260 Ga0070709_101222601 323
367 3300005436 Ga0070713_100060462 Ga0070713_1000604623 323
368 3300005458 Ga0070681_10018802 Ga0070681_100188025 323
369 3300005458 Ga0070681_10071858 Ga0070681_100718582 323
370 3300005530 Ga0070679_100032902 Ga0070679_1000329021 323
371 3300005535 Ga0070684_100226623 Ga0070684_1002266232 323
372 3300005548 Ga0070665_100001922 Ga0070665_10000192221 323
373 3300005564 Ga0070664_100343512 Ga0070664_1003435122 323
374 3300005615 Ga0070702_100176577 Ga0070702_1001765771 323
375 3300005841 Ga0068863_100046411 Ga0068863_1000464112 323
376 3300006038 Ga0075365_10042160 Ga0075365_100421602 323
377 3300006051 Ga0075364_10084692 Ga0075364_100846924 323
378 3300006177 Ga0075362_10037629 Ga0075362_100376292 323
379 3300006178 Ga0075367_10058144 Ga0075367_100581445 323
380 3300009147 Ga0114129_10492827 Ga0114129_104928272 323
381 3300009148 Ga0105243_10000027 Ga0105243_1000002747 323
382 3300009176 Ga0105242_10000056 Ga0105242_1000005649 323
383 3300009177 Ga0105248_10076392 Ga0105248_100763921 323
384 3300013296 Ga0157374_10024813 Ga0157374_100248133 323
385 3300025906 Ga0207699_10105778 Ga0207699_101057782 323
386 3300025912 Ga0207707_10239773 Ga0207707_102397732 323
387 3300025916 Ga0207663_10010388 Ga0207663_100103888 323
388 3300025921 Ga0207652_10466627 Ga0207652_104666271 323
389 3300025928 Ga0207700_10054587 Ga0207700_100545874 323
390 3300025934 Ga0207686_10000008 Ga0207686_1000000847 323
391 3300025935 Ga0207709_10000025 Ga0207709_1000002597 323
392 3300025941 Ga0207711_10079993 Ga0207711_100799931 323
393 3300025981 Ga0207640_10256700 Ga0207640_102567002 323
394 3300026088 Ga0207641_10044045 Ga0207641_100440452 323
395 3300026121 Ga0207683_10141831 Ga0207683_101418312 323
396 3300028379 Ga0268266_10000615 Ga0268266_1000061521 323
397 3300028380 Ga0268265_10030751 Ga0268265_100307514 323
398 3300031995 Ga0307409_100132390 Ga0307409_1001323902 323
399 3300041512 Ga0451853_2342740 Ga0451853_2342740_254_1246 323
400 3300046460 Ga0495638_0013813 Ga0495638_0013813_2472_3443 323
401 3300046542 Ga0495597_0004130 Ga0495597_0004130_3515_4486 323
402 3300048908 Ga0496105_0300152 Ga0496105_0300152_154_1149 323
403 3300049515 Ga0501292_005045 Ga0501292_005045_18_1010 323
404 3300049521 Ga0501298_022062 Ga0501298_022062_48_1040 323
405 3300049522 Ga0501299_002137 Ga0501299_002137_758_1750 323
406 3300049661 Ga0501217_006254 Ga0501217_006254_760_1752 323
407 3300049779 Ga0501283_016512 Ga0501283_016512_65_1057 323
408 3300050489 nmdc:mga03683_1054_c1 nmdc:mga03683_1054_c1_1936_2928 323
409 3300053088 Ga0500644_0013412 Ga0500644_0013412_1071_2066 323
410 3300053119 Ga0500595_007412 Ga0500595_007412_1344_2339 323
411 3300001979 JGI24740J21852_10030275 JGI24740J21852_100302751 324
412 3300001989 JGI24739J22299_10000469 JGI24739J22299_1000046911 324
413 3300002067 JGI24735J21928_10017968 JGI24735J21928_100179682 324
414 3300002075 JGI24738J21930_10002384 JGI24738J21930_100023843 324
415 3300002705 JGI25156J39149_1000269 JGI25156J39149_100026920 324
416 3300003214 JGI25165J46597_1000606 JGI25165J46597_10006065 324
417 3300003756 Ga0055533_1000140 Ga0055533_100014035 324
418 3300003758 Ga0055532_1000003 Ga0055532_1000003275 324
419 3300003760 Ga0055527_1000006 Ga0055527_1000006181 324
420 3300003761 Ga0055535_1000003 Ga0055535_1000003275 324
421 3300003762 Ga0055542_1000007 Ga0055542_1000007275 324
422 3300003763 Ga0055529_1000003 Ga0055529_1000003181 324
423 3300005288 Ga0065714_10000224 Ga0065714_100002248 324
424 3300005288 Ga0065714_10128234 Ga0065714_101282341 324
425 3300005290 Ga0065712_10020220 Ga0065712_100202201 324
426 3300005290 Ga0065712_10069381 Ga0065712_100693814 324
427 3300005293 Ga0065715_10038261 Ga0065715_100382612 324
428 3300005293 Ga0065715_10136864 Ga0065715_101368642 324
429 3300005293 Ga0065715_10249136 Ga0065715_102491361 324
430 3300005329 Ga0070683_100224798 Ga0070683_1002247982 324
431 3300005338 Ga0068868_100191086 Ga0068868_1001910862 324
432 3300005339 Ga0070660_100111098 Ga0070660_1001110983 324
433 3300005339 Ga0070660_100128322 Ga0070660_1001283222 324
434 3300005340 Ga0070689_100000031 Ga0070689_10000003159 324
435 3300005340 Ga0070689_100230745 Ga0070689_1002307452 324
436 3300005343 Ga0070687_100001327 Ga0070687_1000013273 324
437 3300005356 Ga0070674_100072799 Ga0070674_1000727992 324
438 3300005365 Ga0070688_100000612 Ga0070688_1000006127 324
439 3300005366 Ga0070659_100060442 Ga0070659_1000604422 324
440 3300005438 Ga0070701_10000522 Ga0070701_1000052211 324
441 3300005440 Ga0070705_100013917 Ga0070705_1000139173 324
442 3300005440 Ga0070705_100117135 Ga0070705_1001171352 324
443 3300005441 Ga0070700_100000180 Ga0070700_1000001805 324
444 3300005444 Ga0070694_100011224 Ga0070694_1000112243 324
445 3300005445 Ga0070708_100164839 Ga0070708_1001648393 324
446 3300005456 Ga0070678_100473812 Ga0070678_1004738121 324
447 3300005459 Ga0068867_100001414 Ga0068867_1000014144 324
448 3300005459 Ga0068867_100118756 Ga0068867_1001187563 324
449 3300005467 Ga0070706_100211199 Ga0070706_1002111993 324
450 3300005468 Ga0070707_100031250 Ga0070707_1000312503 324
451 3300005468 Ga0070707_100116735 Ga0070707_1001167353 324
452 3300005471 Ga0070698_100149071 Ga0070698_1001490712 324
453 3300005535 Ga0070684_100443721 Ga0070684_1004437211 324
454 3300005536 Ga0070697_100009345 Ga0070697_1000093453 324
455 3300005539 Ga0068853_100004494 Ga0068853_1000044943 324
456 3300005544 Ga0070686_100000517 Ga0070686_1000005175 324
457 3300005544 Ga0070686_100138768 Ga0070686_1001387682 324
458 3300005546 Ga0070696_100039656 Ga0070696_1000396562 324
459 3300005549 Ga0070704_100021775 Ga0070704_1000217753 324
460 3300005615 Ga0070702_100096420 Ga0070702_1000964202 324
461 3300005618 Ga0068864_100111947 Ga0068864_1001119473 324
462 3300005618 Ga0068864_100293734 Ga0068864_1002937342 324
463 3300005718 Ga0068866_10026751 Ga0068866_100267514 324
464 3300005841 Ga0068863_100336118 Ga0068863_1003361182 324
465 3300005842 Ga0068858_100054556 Ga0068858_1000545563 324
466 3300005843 Ga0068860_100070188 Ga0068860_1000701883 324
467 3300005844 Ga0068862_100218232 Ga0068862_1002182322 324
468 3300005844 Ga0068862_100411672 Ga0068862_1004116722 324
469 3300005983 Ga0081540_1000537 Ga0081540_100053722 324
470 3300005983 Ga0081540_1000611 Ga0081540_100061120 324
471 3300006051 Ga0075364_10079667 Ga0075364_100796672 324
472 3300006051 Ga0075364_10130304 Ga0075364_101303042 324
473 3300006058 Ga0075432_10063094 Ga0075432_100630941 324
474 3300006178 Ga0075367_10006892 Ga0075367_100068923 324
475 3300006178 Ga0075367_10120039 Ga0075367_101200392 324
476 3300006195 Ga0075366_10067532 Ga0075366_100675323 324
477 3300006844 Ga0075428_100258204 Ga0075428_1002582041 324
478 3300006846 Ga0075430_100000150 Ga0075430_10000015015 324
479 3300006847 Ga0075431_100000478 Ga0075431_1000004785 324
480 3300006852 Ga0075433_10089694 Ga0075433_100896943 324
481 3300006881 Ga0068865_100129270 Ga0068865_1001292702 324
482 3300009036 Ga0105244_10029726 Ga0105244_100297263 324
483 3300009101 Ga0105247_10008256 Ga0105247_100082565 324
484 3300009147 Ga0114129_10396739 Ga0114129_103967393 324
485 3300009177 Ga0105248_10001714 Ga0105248_100017149 324
486 3300009177 Ga0105248_10003555 Ga0105248_1000355515 324
487 3300009177 Ga0105248_10098363 Ga0105248_100983631 324
488 3300009177 Ga0105248_10115639 Ga0105248_101156392 324
489 3300009177 Ga0105248_10217303 Ga0105248_102173032 324
490 3300009551 Ga0105238_10199530 Ga0105238_101995302 324
491 3300010159 Ga0099796_10027736 Ga0099796_100277362 324
492 3300010375 Ga0105239_10060831 Ga0105239_100608313 324
493 3300013100 Ga0157373_10093534 Ga0157373_100935341 324
494 3300013296 Ga0157374_10007769 Ga0157374_1000776910 324
495 3300013296 Ga0157374_10295845 Ga0157374_102958452 324
496 3300013306 Ga0163162_10213326 Ga0163162_102133262 324
497 3300013307 Ga0157372_10046450 Ga0157372_100464504 324
498 3300013307 Ga0157372_10063606 Ga0157372_100636064 324
499 3300013308 Ga0157375_10020435 Ga0157375_100204357 324
500 3300013308 Ga0157375_10027192 Ga0157375_100271923 324
501 3300013308 Ga0157375_10291332 Ga0157375_102913322 324
502 3300013308 Ga0157375_10640312 Ga0157375_106403122 324
503 3300014325 Ga0163163_10022523 Ga0163163_100225234 324
504 3300014326 Ga0157380_10072364 Ga0157380_100723641 324
505 3300014497 Ga0182008_10005197 Ga0182008_100051977 324
506 3300014969 Ga0157376_10051207 Ga0157376_100512072 324
507 3300017792 Ga0163161_10008695 Ga0163161_100086959 324
508 3300017792 Ga0163161_10177205 Ga0163161_101772052 324
509 3300021361 Ga0213872_10000280 Ga0213872_1000028013 324
510 3300021361 Ga0213872_10007442 Ga0213872_100074426 324
511 3300025226 Ga0209674_100025 Ga0209674_100025266 324
512 3300025228 Ga0209672_100002 Ga0209672_1000021169 324
513 3300025229 Ga0209147_100003 Ga0209147_1000031169 324
514 3300025230 Ga0209563_101861 Ga0209563_1018616 324
515 3300025242 Ga0209258_100005 Ga0209258_100005811 324
516 3300025254 Ga0209148_1000006 Ga0209148_10000061169 324
517 3300025256 Ga0209759_1000014 Ga0209759_1000014185 324
518 3300025256 Ga0209759_1022745 Ga0209759_10227452 324
519 3300025261 Ga0209233_1000018 Ga0209233_1000018184 324
520 3300025272 Ga0209455_1000003 Ga0209455_10000031169 324
521 3300025292 Ga0209676_1001951 Ga0209676_10019519 324
522 3300025298 Ga0209050_1001399 Ga0209050_10013997 324
523 3300025303 Ga0209051_1005551 Ga0209051_10055517 324
524 3300025728 Ga0207655_1012147 Ga0207655_10121472 324
525 3300025728 Ga0207655_1018366 Ga0207655_10183664 324
526 3300025728 Ga0207655_1040805 Ga0207655_10408052 324
527 3300025735 Ga0207713_1009943 Ga0207713_10099435 324
528 3300025735 Ga0207713_1019882 Ga0207713_10198824 324
529 3300025900 Ga0207710_10076165 Ga0207710_100761651 324
530 3300025901 Ga0207688_10060540 Ga0207688_100605401 324
531 3300025904 Ga0207647_10025026 Ga0207647_100250263 324
532 3300025918 Ga0207662_10020839 Ga0207662_100208392 324
533 3300025924 Ga0207694_10238428 Ga0207694_102384281 324
534 3300025927 Ga0207687_10044799 Ga0207687_100447995 324
535 3300025931 Ga0207644_10094292 Ga0207644_100942923 324
536 3300025934 Ga0207686_10145742 Ga0207686_101457422 324
537 3300025936 Ga0207670_10000040 Ga0207670_1000004032 324
538 3300025938 Ga0207704_10074612 Ga0207704_100746123 324
539 3300025941 Ga0207711_10005840 Ga0207711_100058406 324
540 3300025941 Ga0207711_10011905 Ga0207711_100119057 324
541 3300026035 Ga0207703_10112543 Ga0207703_101125433 324
542 3300026041 Ga0207639_10006884 Ga0207639_100068844 324
543 3300026075 Ga0207708_10000662 Ga0207708_1000066222 324
544 3300026088 Ga0207641_10359129 Ga0207641_103591292 324
545 3300026088 Ga0207641_10404695 Ga0207641_104046952 324
546 3300026089 Ga0207648_10004215 Ga0207648_100042154 324
547 3300026089 Ga0207648_10053166 Ga0207648_100531662 324
548 3300026095 Ga0207676_10215670 Ga0207676_102156702 324
549 3300026116 Ga0207674_10330240 Ga0207674_103302401 324
550 3300026118 Ga0207675_100396165 Ga0207675_1003961652 324
551 3300026121 Ga0207683_10377638 Ga0207683_103776382 324
552 3300027866 Ga0209813_10011555 Ga0209813_100115553 324
553 3300027907 Ga0207428_10036666 Ga0207428_100366663 324
554 3300027907 Ga0207428_10039625 Ga0207428_100396254 324
555 3300028379 Ga0268266_10008573 Ga0268266_1000857311 324
556 3300031911 Ga0307412_10000059 Ga0307412_10000059131 324
557 3300031995 Ga0307409_100019267 Ga0307409_1000192673 324
558 3300032005 Ga0307411_10003927 Ga0307411_100039276 324
559 3300032126 Ga0307415_100170684 Ga0307415_1001706841 324
560 3300033442 Ga0315911_1000006 Ga0315911_1000006137 324
561 3300039447 Ga0436361_0207335 Ga0436361_0207335_24020_25090 324
562 3300039447 Ga0436361_0505993 Ga0436361_0505993_84_1082 324
563 3300039450 Ga0436363_0511569 Ga0436363_0511569_535_1527 324
564 3300041407 Ga0439447_000346 Ga0439447_000346_12859_13833 324
565 3300041407 Ga0439447_002025 Ga0439447_002025_3206_4180 324
566 3300041411 Ga0439466_0007575 Ga0439466_0007575_2579_3553 324
567 3300041411 Ga0439466_0010466 Ga0439466_0010466_1842_2816 324
568 3300041411 Ga0439466_0021018 Ga0439466_0021018_994_1968 324
569 3300042006 Ga0439432_008458 Ga0439432_008458_2094_3068 324
570 3300042122 Ga0450920_002005 Ga0450920_002005_730_1704 324
571 3300042124 Ga0450922_000480 Ga0450922_000480_248_1222 324
572 3300042138 Ga0450903_000556 Ga0450903_000556_6613_7587 324
573 3300042145 Ga0450906_003883 Ga0450906_003883_2165_3139 324
574 3300042146 Ga0450907_000486 Ga0450907_000486_7855_8829 324
575 3300042184 Ga0450908_001794 Ga0450908_001794_2842_3834 324
576 3300042184 Ga0450908_006952 Ga0450908_006952_759_1733 324
577 3300042436 Ga0439435_0008367 Ga0439435_0008367_654_1646 324
578 3300045051 Ga0451576_0401455 Ga0451576_0401455_268_1260 324
579 3300046452 Ga0495617_000993 Ga0495617_000993_7271_8245 324
580 3300046452 Ga0495617_002201 Ga0495617_002201_2034_3008 324
581 3300046454 Ga0495592_0082496 Ga0495592_0082496_239_1231 324
582 3300046455 Ga0495603_0005483 Ga0495603_0005483_1702_2676 324
583 3300046455 Ga0495603_0032139 Ga0495603_0032139_378_1370 324
584 3300046457 Ga0495590_0001284 Ga0495590_0001284_4299_5273 324
585 3300046459 Ga0495629_0006111 Ga0495629_0006111_7669_8661 324
586 3300046459 Ga0495629_0018154 Ga0495629_0018154_978_1970 324
587 3300046460 Ga0495638_0013563 Ga0495638_0013563_3612_4586 324
588 3300046460 Ga0495638_0074556 Ga0495638_0074556_616_1590 324
589 3300046461 Ga0495641_0021072 Ga0495641_0021072_1022_2014 324
590 3300046463 Ga0495653_0003309 Ga0495653_0003309_11568_12560 324
591 3300046471 Ga0495650_0003886 Ga0495650_0003886_79_1053 324
592 3300046472 Ga0495580_0000252 Ga0495580_0000252_31468_32466 324
593 3300046472 Ga0495580_0007518 Ga0495580_0007518_7571_8563 324
594 3300046472 Ga0495580_0093257 Ga0495580_0093257_344_1357 324
595 3300046473 Ga0495582_0005918 Ga0495582_0005918_239_1231 324
596 3300046474 Ga0495605_0000372 Ga0495605_0000372_27609_28583 324
597 3300046474 Ga0495605_0005589 Ga0495605_0005589_4708_5721 324
598 3300046477 Ga0495664_0002646 Ga0495664_0002646_7662_8654 324
599 3300046491 Ga0495584_0029936 Ga0495584_0029936_1437_2411 324
600 3300046492 Ga0495585_0020091 Ga0495585_0020091_1011_1985 324
601 3300046492 Ga0495585_0041128 Ga0495585_0041128_621_1634 324
602 3300046506 Ga0495583_0021470 Ga0495583_0021470_1597_2610 324
603 3300046512 Ga0495610_0000246 Ga0495610_0000246_20971_21981 324
604 3300046512 Ga0495610_0024122 Ga0495610_0024122_533_1507 324
605 3300046513 Ga0495616_0024999 Ga0495616_0024999_1061_2035 324
606 3300046514 Ga0495618_0006549 Ga0495618_0006549_5772_6764 324
607 3300046516 Ga0495628_0006201 Ga0495628_0006201_5348_6340 324
608 3300046516 Ga0495628_0008228 Ga0495628_0008228_289_1281 324
609 3300046516 Ga0495628_0094662 Ga0495628_0094662_90_1082 324
610 3300046516 Ga0495628_0196974 Ga0495628_0196974_471_1484 324
611 3300046517 Ga0495630_0058285 Ga0495630_0058285_378_1370 324
612 3300046519 Ga0495632_0000809 Ga0495632_0000809_16119_17093 324
613 3300046520 Ga0495637_0006366 Ga0495637_0006366_87_1061 324
614 3300046520 Ga0495637_0119285 Ga0495637_0119285_14_988 324
615 3300046522 Ga0495643_0004454 Ga0495643_0004454_2720_3694 324
616 3300046523 Ga0495644_0033310 Ga0495644_0033310_83_1057 324
617 3300046524 Ga0495648_0007247 Ga0495648_0007247_7638_8630 324
618 3300046524 Ga0495648_0008085 Ga0495648_0008085_2076_3050 324
619 3300046524 Ga0495648_0011605 Ga0495648_0011605_418_1410 324
620 3300046524 Ga0495648_0018705 Ga0495648_0018705_2042_3016 324
621 3300046524 Ga0495648_0043689 Ga0495648_0043689_843_1817 324
622 3300046526 Ga0495666_0002673 Ga0495666_0002673_7697_8689 324
623 3300046526 Ga0495666_0070289 Ga0495666_0070289_669_1643 324
624 3300046528 Ga0495642_0000082 Ga0495642_0000082_9746_10720 324
625 3300046528 Ga0495642_0000219 Ga0495642_0000219_26915_27889 324
626 3300046529 Ga0495652_0009463 Ga0495652_0009463_278_1270 324
627 3300046530 Ga0495654_0003562 Ga0495654_0003562_4761_5735 324
628 3300046530 Ga0495654_0039244 Ga0495654_0039244_1329_2303 324
629 3300046531 Ga0495665_0026911 Ga0495665_0026911_307_1299 324
630 3300046533 Ga0495640_0006909 Ga0495640_0006909_7669_8661 324
631 3300046535 Ga0495586_0000805 Ga0495586_0000805_16816_17808 324
632 3300046536 Ga0495587_0003814 Ga0495587_0003814_8987_9961 324
633 3300046536 Ga0495587_0004637 Ga0495587_0004637_7666_8658 324
634 3300046538 Ga0495609_0008211 Ga0495609_0008211_3614_4588 324
635 3300046538 Ga0495609_0038168 Ga0495609_0038168_767_1741 324
636 3300046543 Ga0495645_0004684 Ga0495645_0004684_7696_8688 324
637 3300046557 Ga0495622_0061191 Ga0495622_0061191_662_1636 324
638 3300046615 Ga0495656_0004525 Ga0495656_0004525_2131_3105 324
639 3300046616 Ga0495668_0003879 Ga0495668_0003879_3781_4755 324
640 3300046642 Ga0495634_0005677 Ga0495634_0005677_7696_8688 324
641 3300046648 Ga0495611_0029008 Ga0495611_0029008_1321_2295 324
642 3300046660 Ga0495625_0063839 Ga0495625_0063839_374_1366 324
643 3300046663 Ga0495635_0000974 Ga0495635_0000974_3097_4071 324
644 3300046663 Ga0495635_0044272 Ga0495635_0044272_1253_2245 324
645 3300046664 Ga0495659_0001444 Ga0495659_0001444_4476_5450 324
646 3300046665 Ga0495661_0001499 Ga0495661_0001499_18163_19155 324
647 3300046665 Ga0495661_0051148 Ga0495661_0051148_890_1864 324
648 3300046674 Ga0495588_0025851 Ga0495588_0025851_298_1290 324
649 3300046674 Ga0495588_0042741 Ga0495588_0042741_378_1352 324
650 3300046678 Ga0495599_0007249 Ga0495599_0007249_5440_6432 324
651 3300046679 Ga0495623_0005517 Ga0495623_0005517_52_1026 324
652 3300046679 Ga0495623_0089020 Ga0495623_0089020_225_1217 324
653 3300046680 Ga0495646_0004219 Ga0495646_0004219_7689_8681 324
654 3300046680 Ga0495646_0012597 Ga0495646_0012597_4239_5231 324
655 3300046680 Ga0495646_0102156 Ga0495646_0102156_425_1399 324
656 3300046684 Ga0495669_0006789 Ga0495669_0006789_3588_4562 324
657 3300046684 Ga0495669_0009604 Ga0495669_0009604_790_1764 324
658 3300046689 Ga0495613_0001260 Ga0495613_0001260_18093_19085 324
659 3300046690 Ga0495624_0038155 Ga0495624_0038155_307_1299 324
660 3300046691 Ga0495670_0003663 Ga0495670_0003663_4626_5600 324
661 3300046692 Ga0495671_0001167 Ga0495671_0001167_11309_12283 324
662 3300046692 Ga0495671_0001456 Ga0495671_0001456_2692_3666 324
663 3300046692 Ga0495671_0010679 Ga0495671_0010679_3136_4110 324
664 3300046692 Ga0495671_0020484 Ga0495671_0020484_110_1105 324
665 3300046694 Ga0495649_0006496 Ga0495649_0006496_3896_4870 324
666 3300046794 Ga0495589_0001146 Ga0495589_0001146_9971_10984 324
667 3300046794 Ga0495589_0006667 Ga0495589_0006667_235_1209 324
668 3300046794 Ga0495589_0018707 Ga0495589_0018707_1006_1980 324
669 3300046810 Ga0495660_0102350 Ga0495660_0102350_87_1061 324
670 3300047315 Ga0495581_0016945 Ga0495581_0016945_378_1370 324
671 3300047317 Ga0495604_0010223 Ga0495604_0010223_4654_5646 324
672 3300047317 Ga0495604_0050243 Ga0495604_0050243_1331_2323 324
673 3300047317 Ga0495604_0158188 Ga0495604_0158188_594_1586 324
674 3300047319 Ga0495674_0003114 Ga0495674_0003114_5358_6350 324
675 3300047319 Ga0495674_0010538 Ga0495674_0010538_7571_8563 324
676 3300047319 Ga0495674_0020423 Ga0495674_0020423_4640_5638 324
677 3300047319 Ga0495674_0021838 Ga0495674_0021838_3438_4430 324
678 3300047319 Ga0495674_0027237 Ga0495674_0027237_2140_3132 324
679 3300047319 Ga0495674_0061922 Ga0495674_0061922_753_1727 324
680 3300047319 Ga0495674_0139306 Ga0495674_0139306_712_1725 324
681 3300047320 Ga0495672_0002429 Ga0495672_0002429_7041_8036 324
682 3300047320 Ga0495672_0010762 Ga0495672_0010762_1144_2118 324
683 3300047320 Ga0495672_0011778 Ga0495672_0011778_4263_5237 324
684 3300047320 Ga0495672_0039068 Ga0495672_0039068_1076_2050 324
685 3300047320 Ga0495672_0050685 Ga0495672_0050685_1441_2415 324
686 3300047321 Ga0495676_0001386 Ga0495676_0001386_17363_18355 324
687 3300047322 Ga0495680_0002757 Ga0495680_0002757_16559_17551 324
688 3300047443 Ga0495687_001526 Ga0495687_001526_5113_6087 324
689 3300047443 Ga0495687_015557 Ga0495687_015557_2076_3050 324
690 3300047444 Ga0495675_0020643 Ga0495675_0020643_2329_3321 324
691 3300047444 Ga0495675_0034600 Ga0495675_0034600_906_1898 324
692 3300047445 Ga0495677_0000486 Ga0495677_0000486_48_1022 324
693 3300047446 Ga0495679_000759 Ga0495679_000759_378_1370 324
694 3300047446 Ga0495679_005581 Ga0495679_005581_12_986 324
695 3300047469 Ga0495673_0006732 Ga0495673_0006732_3597_4571 324
696 3300047469 Ga0495673_0022344 Ga0495673_0022344_1739_2713 324
697 3300047470 Ga0495681_0025362 Ga0495681_0025362_531_1523 324
698 3300047471 Ga0495684_0135617 Ga0495684_0135617_595_1587 324
699 3300047673 Ga0495593_0003926 Ga0495593_0003926_7689_8681 324
700 3300047673 Ga0495593_0037760 Ga0495593_0037760_641_1615 324
701 3300048088 Ga0495602_0072821 Ga0495602_0072821_275_1267 324
702 3300048088 Ga0495602_0220922 Ga0495602_0220922_216_1208 324
703 3300048089 Ga0495614_0000330 Ga0495614_0000330_17498_18490 324
704 3300048091 Ga0495626_0000394 Ga0495626_0000394_5857_6831 324
705 3300048091 Ga0495626_0018689 Ga0495626_0018689_23_1033 324
706 3300048907 Ga0496104_0074268 Ga0496104_0074268_1632_2624 324
707 3300048907 Ga0496104_0162243 Ga0496104_0162243_893_1885 324
708 3300048907 Ga0496104_0307143 Ga0496104_0307143_134_1147 324
709 3300048908 Ga0496105_0000318 Ga0496105_0000318_1245_2237 324
710 3300048911 Ga0496108_0021149 Ga0496108_0021149_1311_2303 324
711 3300048915 Ga0496112_0011547 Ga0496112_0011547_3672_4664 324
712 3300048915 Ga0496112_0015563 Ga0496112_0015563_1091_2083 324
713 3300048916 Ga0496113_0033553 Ga0496113_0033553_1154_2146 324
714 3300048918 Ga0496115_0194941 Ga0496115_0194941_26_1018 324
715 3300048919 Ga0496116_0048592 Ga0496116_0048592_1435_2421 324
716 3300048920 Ga0496117_0088194 Ga0496117_0088194_634_1620 324
717 3300048920 Ga0496117_0155064 Ga0496117_0155064_105_1079 324
718 3300048921 Ga0496118_0015867 Ga0496118_0015867_957_1931 324
719 3300048922 Ga0496119_0107677 Ga0496119_0107677_227_1219 324
720 3300048924 Ga0496121_0000557 Ga0496121_0000557_40486_41478 324
721 3300048929 Ga0496126_0138896 Ga0496126_0138896_58_1032 324
722 3300049459 Ga0495678_037804 Ga0495678_037804_905_1879 324
723 3300049460 Ga0495682_0005771 Ga0495682_0005771_4020_4994 324
724 3300049460 Ga0495682_0092839 Ga0495682_0092839_76_1050 324
725 3300049522 Ga0501299_000069 Ga0501299_000069_2850_3842 324
726 3300049571 Ga0501034_0000163 Ga0501034_0000163_10279_11271 324
727 3300049705 Ga0501225_0003702 Ga0501225_0003702_2964_3956 324
728 3300050493 nmdc:mga0k408_181516_c1 nmdc:mga0k408_181516_c1_82_1101 324
729 3300050507 nmdc:mga05p37_23905_c1 nmdc:mga05p37_23905_c1_2592_3614 324
730 3300050507 nmdc:mga05p37_308638_c1 nmdc:mga05p37_308638_c1_659_1651 324
731 3300050509 nmdc:mga0qj67_97_c1 nmdc:mga0qj67_97_c1_26730_27722 324
732 3300050510 nmdc:mga06r32_259_c2 nmdc:mga06r32_259_c2_41217_42209 324
733 3300050511 nmdc:mga08y16_38592_c1 nmdc:mga08y16_38592_c1_1572_2564 324
734 3300050515 nmdc:mga0a205_34474_c1 nmdc:mga0a205_34474_c1_3289_4281 324
735 3300059421 Ga0590071_000355 Ga0590071_000355_7902_8900 325
736 3300059423 Ga0590074_000726 Ga0590074_000726_1104_2102 325
737 3300059424 Ga0590075_000518 Ga0590075_000518_5960_6958 325
738 3300059426 Ga0590077_000860 Ga0590077_000860_1883_2881 325
739 3300048917 Ga0496114_0276775 Ga0496114_0276775_326_1327 326
740 3300025942 Ga0207689_10059717 Ga0207689_100597173 327
741 3300050494 nmdc:mga06z11_24340_c1 nmdc:mga06z11_24340_c1_234_1277 327
742 3300050495 nmdc:mga04h51_12817_c1 nmdc:mga04h51_12817_c1_401_1444 327
743 iso_pu_bacteria 2919437846 2919438384 327
744 3300044658 Ga0466972_0000062 Ga0466972_0000062_37058_38071 328
745 3300003322 rootL2_10054155 rootL2_100541551 330
746 3300003323 rootH1_10022382 rootH1_1002238218 330
747 3300005339 Ga0070660_100096678 Ga0070660_1000966783 330
748 3300005577 Ga0068857_100001455 Ga0068857_1000014553 330
749 3300005618 Ga0068864_100104881 Ga0068864_1001048812 330
750 3300013100 Ga0157373_10106174 Ga0157373_101061742 330
751 3300013307 Ga0157372_10266096 Ga0157372_102660961 330
752 3300014325 Ga0163163_10083413 Ga0163163_100834133 330
753 3300014326 Ga0157380_10010043 Ga0157380_100100437 330
754 3300025912 Ga0207707_10049058 Ga0207707_100490582 330
755 3300025919 Ga0207657_10027304 Ga0207657_100273043 330
756 3300025921 Ga0207652_10020364 Ga0207652_100203646 330
757 3300025945 Ga0207679_10155418 Ga0207679_101554182 330
758 3300026116 Ga0207674_10005253 Ga0207674_100052531 330
759 3300005331 Ga0070670_100007156 Ga0070670_1000071567 331
760 3300025925 Ga0207650_10011278 Ga0207650_100112782 331
761 3300046694 Ga0495649_0021042 Ga0495649_0021042_1310_2332 331
762 3300053153 Ga0500616_0007172 Ga0500616_0007172_5328_6368 331
763 3300031456 Ga0307513_10086539 Ga0307513_100865393 332
764 3300048903 Ga0496100_0031403 Ga0496100_0031403_1918_2940 333
765 3300048904 Ga0496101_0030709 Ga0496101_0030709_1762_2784 333
766 3300048911 Ga0496108_0058871 Ga0496108_0058871_141_1163 333
767 3300048912 Ga0496109_0072044 Ga0496109_0072044_1332_2354 333
768 3300048915 Ga0496112_0000460 Ga0496112_0000460_10018_11040 333
769 3300050494 nmdc:mga06z11_149602_c1 nmdc:mga06z11_149602_c1_190_1272 333
770 3300017792 Ga0163161_10008691 Ga0163161_100086912 337
771 3300046528 Ga0495642_0040338 Ga0495642_0040338_599_1669 338
772 3300046557 Ga0495622_0091649 Ga0495622_0091649_79_1095 338
773 3300046694 Ga0495649_0084045 Ga0495649_0084045_599_1669 338
774 3300047323 Ga0495683_0057592 Ga0495683_0057592_235_1305 338
775 3300047443 Ga0495687_042633 Ga0495687_042633_234_1304 338
776 3300048920 Ga0496117_0012410 Ga0496117_0012410_2811_3881 338
777 3300048921 Ga0496118_0005967 Ga0496118_0005967_4291_5361 338
778 iso_pu_bacteria 642555112 642596905 338
779 3300005440 Ga0070705_100012955 Ga0070705_1000129553 342
780 3300006237 Ga0097621_100170431 Ga0097621_1001704312 342
781 3300048905 Ga0496102_0217046 Ga0496102_0217046_22_1086 342
782 3300048909 Ga0496106_0119250 Ga0496106_0119250_967_2031 342
783 3300046506 Ga0495583_0003084 Ga0495583_0003084_485_1516 343
784 3300046512 Ga0495610_0028336 Ga0495610_0028336_465_1514 343
785 3300050510 nmdc:mga06r32_64078_c1 nmdc:mga06r32_64078_c1_811_2010 343
786 3300046558 Ga0495633_0040377 Ga0495633_0040377_835_1869 344
787 3300046678 Ga0495599_0015627 Ga0495599_0015627_2815_3912 345
788 3300041405 Ga0439438_013233 Ga0439438_013233_1148_2191 346
789 3300050512 nmdc:mga0n895_65424_c1 nmdc:mga0n895_65424_c1_760_1908 347
790 3300050513 nmdc:mga0rr50_2086_c1 nmdc:mga0rr50_2086_c1_6217_7365 347
791 3300050515 nmdc:mga0a205_50343_c1 nmdc:mga0a205_50343_c1_2253_3401 347
792 3300013102 Ga0157371_10000500 Ga0157371_1000050032 349
793 3300046453 Ga0495627_058047 Ga0495627_058047_13_1065 349
794 3300046474 Ga0495605_0002542 Ga0495605_0002542_2958_4010 349
795 3300047320 Ga0495672_0092397 Ga0495672_0092397_521_1570 349
796 3300047469 Ga0495673_0000319 Ga0495673_0000319_7576_8625 349
797 2124908027 MRS2a_Contig_5159 MRS2a_00058310 351
798 3300009036 Ga0105244_10020167 Ga0105244_100201675 351
799 3300013104 Ga0157370_10076008 Ga0157370_100760084 351
800 3300041407 Ga0439447_021135 Ga0439447_021135_604_1659 351
801 3300042006 Ga0439432_008378 Ga0439432_008378_609_1664 351
802 3300042146 Ga0450907_000058 Ga0450907_000058_8695_9750 351
803 3300042435 Ga0439434_0001657 Ga0439434_0001657_3435_4490 351
804 3300046453 Ga0495627_010450 Ga0495627_010450_1764_2819 351
805 3300046458 Ga0495591_000568 Ga0495591_000568_25432_26487 351
806 3300046458 Ga0495591_013404 Ga0495591_013404_1839_2897 351
807 3300046460 Ga0495638_0028740 Ga0495638_0028740_2181_3239 351
808 3300046471 Ga0495650_0058957 Ga0495650_0058957_14_1072 351
809 3300046474 Ga0495605_0009349 Ga0495605_0009349_35_1093 351
810 3300046474 Ga0495605_0025618 Ga0495605_0025618_1190_2248 351
811 3300046491 Ga0495584_0000140 Ga0495584_0000140_10504_11559 351
812 3300046492 Ga0495585_0004195 Ga0495585_0004195_3562_4617 351
813 3300046501 Ga0495607_0012901 Ga0495607_0012901_3024_4082 351
814 3300046506 Ga0495583_0000958 Ga0495583_0000958_23806_24864 351
815 3300046507 Ga0495606_0001909 Ga0495606_0001909_11767_12825 351
816 3300046515 Ga0495620_0001486 Ga0495620_0001486_6542_7600 351
817 3300046519 Ga0495632_0035261 Ga0495632_0035261_1483_2541 351
818 3300046529 Ga0495652_0097404 Ga0495652_0097404_373_1431 351
819 3300046530 Ga0495654_0008233 Ga0495654_0008233_2777_3835 351
820 3300046538 Ga0495609_0000316 Ga0495609_0000316_41752_42810 351
821 3300046538 Ga0495609_0001746 Ga0495609_0001746_12601_13659 351
822 3300046542 Ga0495597_0068080 Ga0495597_0068080_12_1067 351
823 3300046557 Ga0495622_0018725 Ga0495622_0018725_482_1537 351
824 3300046642 Ga0495634_0001713 Ga0495634_0001713_3448_4506 351
825 3300046648 Ga0495611_0083002 Ga0495611_0083002_308_1363 351
826 3300046660 Ga0495625_0054522 Ga0495625_0054522_1361_2419 351
827 3300046680 Ga0495646_0060890 Ga0495646_0060890_851_1909 351
828 3300046691 Ga0495670_0015669 Ga0495670_0015669_83_1138 351
829 3300046692 Ga0495671_0045519 Ga0495671_0045519_78_1133 351
830 3300046810 Ga0495660_0070405 Ga0495660_0070405_13_1071 351
831 3300047317 Ga0495604_0050064 Ga0495604_0050064_1937_2995 351
832 3300047320 Ga0495672_0006877 Ga0495672_0006877_2028_3083 351
833 3300047323 Ga0495683_0018642 Ga0495683_0018642_75_1130 351
834 3300047444 Ga0495675_0021758 Ga0495675_0021758_2526_3584 351
835 3300047446 Ga0495679_003633 Ga0495679_003633_4500_5558 351
836 3300047469 Ga0495673_0006070 Ga0495673_0006070_970_2028 351
837 3300047469 Ga0495673_0010237 Ga0495673_0010237_3935_4993 351
838 3300048091 Ga0495626_0000340 Ga0495626_0000340_14344_15402 351
839 3300048091 Ga0495626_0008878 Ga0495626_0008878_1433_2491 351
840 3300048905 Ga0496102_0002794 Ga0496102_0002794_10545_11603 351
841 3300048906 Ga0496103_0002417 Ga0496103_0002417_10545_11603 351
842 3300048913 Ga0496110_0070576 Ga0496110_0070576_481_1536 351
843 3300048919 Ga0496116_0056833 Ga0496116_0056833_328_1386 351
844 3300048920 Ga0496117_0006453 Ga0496117_0006453_10536_11594 351
845 3300048921 Ga0496118_0016993 Ga0496118_0016993_5361_6419 351
846 3300048928 Ga0496125_0060939 Ga0496125_0060939_1860_2915 351
847 3300049460 Ga0495682_0006897 Ga0495682_0006897_2588_3643 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

59

335

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wuy-assembly1.cif.gz_A crystal structure of nit6803 0.9635 28 308
3wuy-assembly1.cif.gz_A crystal structure of nit6803 0.9405 28 308
6zby-assembly1.cif.gz_E cryo-em structure of the nitrilase from pseudomonas fluorescens ebc191 at 3.3 angstroms 0.9324 29 333
6zby-assembly1.cif.gz_E cryo-em structure of the nitrilase from pseudomonas fluorescens ebc191 at 3.3 angstroms 0.8991 29 333
3iw3-assembly1.cif.gz_B crystal structure of hyperthermophilic nitrilase 0.889 31 300
ID Description Score Start End Superfamily
3wuyB00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9633 28 308 3.60.110.10
3wuyB00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9403 28 308 3.60.110.10
af_P40447_2_198_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9152 33 211 3.60.110.10
1j31B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8805 31 317 3.60.110.10
af_P32961_18_309_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8759 29 308 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A4Q2YQU3-F1-model_v4 Aliphatic nitrilase 0.9859 31 247 GO:0000257
AF-A0A1Z4GUH3-F1-model_v4 deleted 0.9855 29 218
AF-A0A6P0DSL0-F1-model_v4 Aliphatic nitrilase 0.9851 104 235 GO:0000257
AF-A0A520IJG1-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9817 33 211 GO:0000257
AF-A0A853LZT2-F1-model_v4 CN hydrolase domain-containing protein 0.9801 39 143 GO:0003824

Feature Viewer

pLDDT pTM Quality
84.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map