F483345

General Info

Members Datasets Scaffolds Average Seq Length
847 465 1694 202

Family's Representative Sequence

Representative Sequence 3300059649|Ga0587102_016746|Ga0587102_016746_81_758
Length 225
Sequence MSNIETKTSRGLLGKKLGMTQVWDENNKLIPVTVIEITPNVVTQVRTPEADGYNAVQIAYGQIDPRKVNKPAAGHFDKAGVTPRRHLTEVRTADAAEYAAGQELTVDGTFEIGQLVDVVGTSKGQGFAGVMKRHNFQGVSASHGAHRNHRKPGSIGASSTPSRVFKGMRMAGRMGGERVTVLNLKVQAVDAEKGLLLVKGAVPGPRGGIVLVRTAAKAAPIAKEA

Samples

Sample ID Description Type Environment
1 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
222 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
239 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
240 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
241 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
242 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
248 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
361 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
362 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
380 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
381 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
392 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
395 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
396 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
397 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
398 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
399 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
428 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
429 2643221572 Leifsonia sp. Root60 Isolate Unclassified
430 2643221616 Leifsonia sp. Root227 Isolate Unclassified
431 2643221619 Agromyces sp. Root81 Isolate Unclassified
432 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
433 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
434 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
435 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
436 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
437 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
438 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
439 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
440 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
441 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
442 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
443 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
444 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
445 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
446 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
447 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
448 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
449 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
450 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
451 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
452 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
453 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
454 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
455 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
456 2928153084 Leifsonia sp. 563 Isolate Unclassified
457 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
458 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
459 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
460 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
461 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
462 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
463 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
464 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
465 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.28
Metatranscriptomes 15.23
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 10.63
Nodule 0
Rhizoplane 5.08
Rhizosphere 74.14
Stem 0
Stem Tuber 0.12
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587102_016746 3300059649 Bacteria 791
2 LJQas_1013126 3300000549 Bacteria 976
3 JGI24740J21852_10008552 3300001979 Bacteria 4069
4 JGI24740J21852_10069279 3300001979 Bacteria 949
5 JGI24739J22299_10005224 3300001989 Bacteria 4947
6 JGI24743J22301_10000788 3300001991 Bacteria 3983
7 JGI24750J21931_1003131 3300002070 Bacteria 1986
8 JGI24738J21930_10001633 3300002075 Bacteria 6156
9 JGI24749J21850_1002100 3300002076 Bacteria 2810
10 JGI24744J21845_10001898 3300002077 Bacteria 4211
11 JGI24742J22300_10004109 3300002244 Bacteria 2371
12 JGI25162J39368_1006149 3300002737 Bacteria 2144
13 JGI25164J39214_1000440 3300002772 Bacteria 22554
14 Ga0006778J45830_1014960 3300003162 Bacteria 1358
15 Ga0006778J45830_1015738 3300003162 Bacteria 1141
16 Ga0006759J45824_1054624 3300003163 Bacteria 879
17 JGI25165J46597_1000061 3300003214 Bacteria 208362
18 Ga0006758J48902_1010827 3300003300 Bacteria 1368
19 Ga0006554J51385_1032262 3300003567 Bacteria 1450
20 Ga0007410J51695_1063952 3300003574 Bacteria 1107
21 Ga0007416J51690_1008299 3300003577 Bacteria 2260
22 Ga0006562J51391_1024272 3300003578 Bacteria 2938
23 Ga0006562J51391_1024273 3300003578 Bacteria 2580
24 Ga0055539_1000555 3300003752 Bacteria 10815
25 Ga0055533_1000001 3300003756 Bacteria 1863437
26 Ga0055525_1001039 3300003759 Bacteria 7247
27 Ga0055527_1000017 3300003760 Bacteria 242362
28 Ga0055542_1000044 3300003762 Bacteria 206982
29 Ga0055542_1008279 3300003762 Bacteria 2045
30 Ga0055529_1000484 3300003763 Bacteria 37191
31 Ga0055541_1002835 3300003841 Bacteria 3358
32 Ga0058859_10128905 3300004798 Bacteria 1177
33 Ga0058861_10015007 3300004800 Bacteria 1321
34 Ga0058860_10093343 3300004801 Bacteria 969
35 Ga0065714_10097178 3300005288 Bacteria 1742
36 Ga0070658_10009122 3300005327 Bacteria 7974
37 Ga0070658_10082338 3300005327 Bacteria 2644
38 Ga0070658_10522104 3300005327 Bacteria 1027
39 Ga0070683_100270463 3300005329 Bacteria 1616
40 Ga0070690_100286553 3300005330 Bacteria 1177
41 Ga0070670_100064167 3300005331 Bacteria 3152
42 Ga0070670_100414814 3300005331 Bacteria 1190
43 Ga0070677_10318614 3300005333 Bacteria 796
44 Ga0070682_100038470 3300005337 Bacteria 2934
45 Ga0070682_100193084 3300005337 Bacteria 1431
46 Ga0068868_100516086 3300005338 Bacteria 1048
47 Ga0068868_100644456 3300005338 Bacteria 943
48 Ga0070660_100057825 3300005339 Bacteria 3005
49 Ga0070691_10012309 3300005341 Bacteria 3917
50 Ga0070687_100416894 3300005343 Bacteria 884
51 Ga0070661_100040530 3300005344 Bacteria 3398
52 Ga0070661_100269446 3300005344 Bacteria 1318
53 Ga0070692_10002505 3300005345 Bacteria 7150
54 Ga0070668_100061631 3300005347 Bacteria 2906
55 Ga0070675_100065082 3300005354 Bacteria 3014
56 Ga0070671_100053010 3300005355 Bacteria 3372
57 Ga0070671_100213030 3300005355 Bacteria 1639
58 Ga0070674_100008878 3300005356 Bacteria 6000
59 Ga0070674_100142664 3300005356 Bacteria 1799
60 Ga0070673_100437479 3300005364 Bacteria 1175
61 Ga0070688_100085354 3300005365 Bacteria 2052
62 Ga0070659_100003025 3300005366 Bacteria 11966
63 Ga0070667_100042795 3300005367 Bacteria 3800
64 Ga0070667_100324088 3300005367 Bacteria 1391
65 Ga0070709_10014845 3300005434 Bacteria 4416
66 Ga0070710_10162241 3300005437 Bacteria 1387
67 Ga0070701_10001181 3300005438 Bacteria 9570
68 Ga0070705_100013335 3300005440 Bacteria 4200
69 Ga0070700_100003597 3300005441 Bacteria 8014
70 Ga0070708_100079179 3300005445 Bacteria 2972
71 Ga0070708_100444472 3300005445 Bacteria 1223
72 Ga0070663_100219379 3300005455 Bacteria 1492
73 Ga0070678_100636026 3300005456 Bacteria 956
74 Ga0070681_10369506 3300005458 Bacteria 1345
75 Ga0068867_100007380 3300005459 Bacteria 7777
76 Ga0070685_10010240 3300005466 Bacteria 4866
77 Ga0070685_10258617 3300005466 Bacteria 1157
78 Ga0070707_100017376 3300005468 Bacteria 6762
79 Ga0070707_100030934 3300005468 Bacteria 5098
80 Ga0070698_100006774 3300005471 Bacteria 12422
81 Ga0070699_100264880 3300005518 Bacteria 1537
82 Ga0070679_100536765 3300005530 Bacteria 1113
83 Ga0070684_100057591 3300005535 Bacteria 3393
84 Ga0070684_100215069 3300005535 Bacteria 1752
85 Ga0070684_100522199 3300005535 Bacteria 1100
86 Ga0068853_100068961 3300005539 Bacteria 3075
87 Ga0068853_100228621 3300005539 Bacteria 1701
88 Ga0068853_101091278 3300005539 Bacteria 769
89 Ga0070672_100002167 3300005543 Bacteria 12376
90 Ga0070672_100547262 3300005543 Bacteria 1005
91 Ga0070686_100071401 3300005544 Bacteria 2273
92 Ga0070665_100002964 3300005548 Bacteria 18335
93 Ga0070665_100083091 3300005548 Bacteria 3208
94 Ga0070704_100490909 3300005549 Bacteria 1064
95 Ga0068855_100047986 3300005563 Bacteria 5042
96 Ga0068855_101193777 3300005563 Bacteria 791
97 Ga0070664_100481909 3300005564 Bacteria 1141
98 Ga0068857_100172828 3300005577 Bacteria 1964
99 Ga0068857_100373134 3300005577 Bacteria 1324
100 Ga0068856_100275878 3300005614 Bacteria 1698
101 Ga0068856_100650461 3300005614 Bacteria 1075
102 Ga0068856_101037760 3300005614 Bacteria 838
103 Ga0068852_100002721 3300005616 Bacteria 12219
104 Ga0068852_100678152 3300005616 Bacteria 1040
105 Ga0068864_100374260 3300005618 Bacteria 1348
106 Ga0068861_100072369 3300005719 Bacteria 2674
107 Ga0068861_100198465 3300005719 Bacteria 1682
108 Ga0068851_10000022 3300005834 Bacteria 129607
109 Ga0068870_10000658 3300005840 Bacteria 13168
110 Ga0068858_100034623 3300005842 Bacteria 4685
111 Ga0068860_100171309 3300005843 Bacteria 2097
112 Ga0068862_100401189 3300005844 Bacteria 1283
113 Ga0068862_100831809 3300005844 Bacteria 904
114 Ga0081455_10407445 3300005937 Bacteria 942
115 Ga0075365_10014071 3300006038 Bacteria 4805
116 Ga0075365_10037200 3300006038 Bacteria 3158
117 Ga0075365_10055431 3300006038 Bacteria 2631
118 Ga0075365_10070695 3300006038 Bacteria 2348
119 Ga0075365_10235679 3300006038 Bacteria 1285
120 Ga0075365_10382117 3300006038 Bacteria 993
121 Ga0075368_10001331 3300006042 Bacteria 7845
122 Ga0075368_10111040 3300006042 Bacteria 1130
123 Ga0075368_10179314 3300006042 Bacteria 893
124 Ga0075363_100124422 3300006048 Bacteria 1442
125 Ga0075364_10036458 3300006051 Bacteria 3179
126 Ga0075364_10055289 3300006051 Bacteria 2597
127 Ga0075364_10334727 3300006051 Bacteria 1031
128 Ga0070715_10017201 3300006163 Bacteria 2733
129 Ga0070712_100383540 3300006175 Bacteria 1157
130 Ga0075367_10020722 3300006178 Bacteria 3666
131 Ga0075369_10008212 3300006186 Bacteria 4009
132 Ga0075370_10005554 3300006353 Bacteria 6282
133 Ga0075370_10100380 3300006353 Bacteria 1675
134 Ga0075428_100002072 3300006844 Bacteria 21635
135 Ga0075428_100482172 3300006844 Bacteria 1327
136 Ga0075431_100004313 3300006847 Bacteria 13937
137 Ga0075434_101017278 3300006871 Bacteria 842
138 Ga0075429_100006773 3300006880 Bacteria 9938
139 Ga0068865_100006802 3300006881 Bacteria 7000
140 Ga0105244_10090974 3300009036 Bacteria 1500
141 Ga0105244_10100399 3300009036 Bacteria 1416
142 Ga0105240_11344846 3300009093 Bacteria 752
143 Ga0111539_10032544 3300009094 Bacteria 6331
144 Ga0111539_10055228 3300009094 Bacteria 4722
145 Ga0105245_10212872 3300009098 Bacteria 1861
146 Ga0105245_10461716 3300009098 Bacteria 1280
147 Ga0105245_10754417 3300009098 Bacteria 1009
148 Ga0105245_10798567 3300009098 Bacteria 982
149 Ga0105247_10140257 3300009101 Bacteria 1583
150 Ga0105247_10145933 3300009101 Bacteria 1555
151 Ga0114129_10006606 3300009147 Bacteria 16463
152 Ga0114129_11006428 3300009147 Bacteria 1049
153 Ga0105243_10002648 3300009148 Bacteria 14867
154 Ga0105243_10008981 3300009148 Bacteria 7639
155 Ga0105243_10042092 3300009148 Bacteria 3574
156 Ga0105243_10051867 3300009148 Bacteria 3246
157 Ga0105241_10170069 3300009174 Bacteria 1799
158 Ga0105248_10129268 3300009177 Bacteria 2850
159 Ga0105248_10266117 3300009177 Bacteria 1930
160 Ga0105237_10232698 3300009545 Bacteria 1843
161 Ga0105238_10027288 3300009551 Bacteria 5817
162 Ga0105238_10117861 3300009551 Bacteria 2635
163 Ga0105238_10130008 3300009551 Bacteria 2496
164 Ga0105238_10214305 3300009551 Bacteria 1902
165 Ga0105238_10316946 3300009551 Bacteria 1545
166 Ga0105238_10317308 3300009551 Bacteria 1544
167 Ga0105249_10383208 3300009553 Bacteria 1432
168 Ga0105249_10452815 3300009553 Bacteria 1322
169 Ga0105249_10457219 3300009553 Bacteria 1316
170 Ga0105239_10169748 3300010375 Bacteria 2439
171 Ga0105246_10171636 3300011119 Bacteria 1661
172 Ga0105246_10556484 3300011119 Bacteria 984
173 Ga0154014_157137 3300013052 Bacteria 1591
174 Ga0157371_10013796 3300013102 Bacteria 6121
175 Ga0157370_10010513 3300013104 Bacteria 9746
176 Ga0157370_10463378 3300013104 Bacteria 1165
177 Ga0157369_10041722 3300013105 Bacteria 5008
178 Ga0157369_10053397 3300013105 Bacteria 4369
179 Ga0157369_10195188 3300013105 Bacteria 2126
180 Ga0157369_10395883 3300013105 Bacteria 1433
181 Ga0157374_10146984 3300013296 Bacteria 2290
182 Ga0157374_10819915 3300013296 Bacteria 947
183 Ga0157378_10041297 3300013297 Bacteria 4091
184 Ga0163162_10109166 3300013306 Bacteria 2864
185 Ga0163162_10177320 3300013306 Bacteria 2257
186 Ga0163162_10593655 3300013306 Bacteria 1234
187 Ga0157372_10038906 3300013307 Bacteria 5249
188 Ga0157372_10330752 3300013307 Bacteria 1774
189 Ga0157375_10008009 3300013308 Bacteria 9253
190 Ga0157375_11200083 3300013308 Bacteria 890
191 Ga0157375_11287770 3300013308 Bacteria 859
192 Ga0163163_10942435 3300014325 Bacteria 927
193 Ga0157380_10035348 3300014326 Bacteria 3859
194 Ga0157380_10067392 3300014326 Bacteria 2882
195 Ga0157377_10014555 3300014745 Bacteria 4003
196 Ga0157379_10053997 3300014968 Bacteria 3590
197 Ga0157379_10472479 3300014968 Bacteria 1160
198 Ga0163161_10503530 3300017792 Bacteria 987
199 Ga0197907_10046073 3300020069 Bacteria 1218
200 Ga0197907_10060462 3300020069 Bacteria 860
201 Ga0197907_10886560 3300020069 Bacteria 1153
202 Ga0206356_11091742 3300020070 Bacteria 1663
203 Ga0206356_11808489 3300020070 Bacteria 1047
204 Ga0206349_1003097 3300020075 Bacteria 876
205 Ga0206349_1024628 3300020075 Bacteria 1190
206 Ga0206349_1123513 3300020075 Bacteria 1985
207 Ga0206349_1802703 3300020075 Bacteria 1021
208 Ga0206355_1042401 3300020076 Bacteria 3015
209 Ga0206355_1111929 3300020076 Bacteria 2509
210 Ga0206355_1365351 3300020076 Bacteria 1077
211 Ga0206355_1391308 3300020076 Bacteria 2624
212 Ga0206355_1440951 3300020076 Bacteria 1976
213 Ga0206351_10066836 3300020077 Bacteria 3116
214 Ga0206351_10123606 3300020077 Bacteria 4376
215 Ga0206351_10145003 3300020077 Bacteria 730
216 Ga0206351_10167011 3300020077 Bacteria 1477
217 Ga0206351_10319390 3300020077 Bacteria 1436
218 Ga0206351_10488924 3300020077 Bacteria 1584
219 Ga0206351_10696424 3300020077 Bacteria 1857
220 Ga0206352_10030486 3300020078 Bacteria 1608
221 Ga0206352_10447415 3300020078 Bacteria 913
222 Ga0206352_10509679 3300020078 Bacteria 1283
223 Ga0206352_10520377 3300020078 Bacteria 868
224 Ga0206352_10553411 3300020078 Bacteria 826
225 Ga0206350_10419393 3300020080 Bacteria 1593
226 Ga0206350_10808887 3300020080 Bacteria 1718
227 Ga0206350_11166112 3300020080 Bacteria 1796
228 Ga0206354_11221512 3300020081 Bacteria 3581
229 Ga0206354_11337275 3300020081 Bacteria 1260
230 Ga0206354_11551758 3300020081 Bacteria 1972
231 Ga0206354_11673908 3300020081 Bacteria 1332
232 Ga0206353_10020316 3300020082 Bacteria 799
233 Ga0206353_10299232 3300020082 Bacteria 1275
234 Ga0206353_10684920 3300020082 Bacteria 1280
235 Ga0206353_11035842 3300020082 Bacteria 4726
236 Ga0206353_11048344 3300020082 Bacteria 1595
237 Ga0154015_1615289 3300020610 Bacteria 1024
238 Ga0154015_1673430 3300020610 Bacteria 1371
239 Ga0224712_10019628 3300022467 Bacteria 2282
240 Ga0224712_10049005 3300022467 Bacteria 1633
241 Ga0224712_10135445 3300022467 Bacteria 1079
242 Ga0224712_10151363 3300022467 Bacteria 1028
243 Ga0209566_100066 3300025225 Bacteria 186951
244 Ga0209674_100001 3300025226 Bacteria 4013750
245 Ga0209672_100039 3300025228 Bacteria 283064
246 Ga0209147_101471 3300025229 Bacteria 8442
247 Ga0209563_100001 3300025230 Bacteria 4013775
248 Ga0207427_100042 3300025231 Bacteria 254170
249 Ga0209437_100510 3300025233 Bacteria 27572
250 Ga0209677_100001 3300025253 Bacteria 4013787
251 Ga0209148_1000004 3300025254 Bacteria 1844481
252 Ga0209148_1002314 3300025254 Bacteria 6797
253 Ga0209233_1000001 3300025261 Bacteria 2992747
254 Ga0209455_1000339 3300025272 Bacteria 44474
255 Ga0207426_1005083 3300025302 Bacteria 6146
256 Ga0207697_10069640 3300025315 Bacteria 1473
257 Ga0207656_10000005 3300025321 Bacteria 490514
258 Ga0207655_1000386 3300025728 Bacteria 61740
259 Ga0207692_10059815 3300025898 Bacteria 1969
260 Ga0207710_10101987 3300025900 Bacteria 1354
261 Ga0207688_10042994 3300025901 Bacteria 2515
262 Ga0207647_10021649 3300025904 Bacteria 4288
263 Ga0207647_10066401 3300025904 Bacteria 2187
264 Ga0207699_10004645 3300025906 Bacteria 6571
265 Ga0207643_10001355 3300025908 Bacteria 14144
266 Ga0207643_10081010 3300025908 Bacteria 1881
267 Ga0207643_10086083 3300025908 Bacteria 1826
268 Ga0207705_10000001 3300025909 Bacteria 2061880
269 Ga0207705_10469937 3300025909 Bacteria 976
270 Ga0207684_10567328 3300025910 Bacteria 970
271 Ga0207654_10000001 3300025911 Bacteria 1816198
272 Ga0207695_10275058 3300025913 Bacteria 1579
273 Ga0207695_10466061 3300025913 Bacteria 1146
274 Ga0207671_10000016 3300025914 Bacteria 435413
275 Ga0207693_10513900 3300025915 Bacteria 935
276 Ga0207663_10484041 3300025916 Bacteria 959
277 Ga0207657_10005997 3300025919 Bacteria 12644
278 Ga0207646_10082391 3300025922 Bacteria 2877
279 Ga0207646_10413128 3300025922 Bacteria 1218
280 Ga0207694_10000057 3300025924 Bacteria 146441
281 Ga0207694_10351614 3300025924 Bacteria 1220
282 Ga0207687_10091182 3300025927 Bacteria 2222
283 Ga0207700_10010456 3300025928 Bacteria 5857
284 Ga0207664_10315268 3300025929 Bacteria 1379
285 Ga0207644_10059624 3300025931 Bacteria 2760
286 Ga0207644_10257841 3300025931 Bacteria 1393
287 Ga0207690_10003803 3300025932 Bacteria 8937
288 Ga0207690_10162227 3300025932 Bacteria 1667
289 Ga0207686_10053497 3300025934 Bacteria 2524
290 Ga0207709_10002586 3300025935 Bacteria 11269
291 Ga0207709_10005029 3300025935 Bacteria 7555
292 Ga0207709_10234010 3300025935 Bacteria 1332
293 Ga0207670_10022974 3300025936 Bacteria 3874
294 Ga0207669_10006873 3300025937 Bacteria 5232
295 Ga0207704_10004632 3300025938 Bacteria 6304
296 Ga0207704_10192143 3300025938 Bacteria 1486
297 Ga0207704_10521982 3300025938 Bacteria 961
298 Ga0207665_10228495 3300025939 Bacteria 1367
299 Ga0207665_10557078 3300025939 Bacteria 891
300 Ga0207691_10003431 3300025940 Bacteria 15416
301 Ga0207691_10334124 3300025940 Bacteria 1298
302 Ga0207711_10022131 3300025941 Bacteria 5314
303 Ga0207711_10056556 3300025941 Bacteria 3371
304 Ga0207711_10515531 3300025941 Bacteria 1115
305 Ga0207661_10093790 3300025944 Bacteria 2506
306 Ga0207661_10104106 3300025944 Bacteria 2389
307 Ga0207661_10327399 3300025944 Bacteria 1378
308 Ga0207679_10309283 3300025945 Bacteria 1365
309 Ga0207667_10021165 3300025949 Bacteria 7212
310 Ga0207667_10069574 3300025949 Bacteria 3663
311 Ga0207712_10103556 3300025961 Bacteria 2121
312 Ga0207712_10132600 3300025961 Bacteria 1901
313 Ga0207712_10312334 3300025961 Bacteria 1294
314 Ga0207668_10113821 3300025972 Bacteria 2035
315 Ga0207640_10186285 3300025981 Bacteria 1561
316 Ga0207658_10066284 3300025986 Bacteria 2715
317 Ga0207677_10014347 3300026023 Bacteria 4625
318 Ga0207677_10300821 3300026023 Bacteria 1325
319 Ga0207703_10001453 3300026035 Bacteria 21613
320 Ga0207639_10140158 3300026041 Bacteria 2013
321 Ga0207678_10112359 3300026067 Bacteria 2324
322 Ga0207678_10129044 3300026067 Bacteria 2156
323 Ga0207678_10363398 3300026067 Bacteria 1249
324 Ga0207708_10004001 3300026075 Bacteria 10846
325 Ga0207708_10472740 3300026075 Bacteria 1047
326 Ga0207708_10632077 3300026075 Bacteria 910
327 Ga0207702_10029018 3300026078 Bacteria 4601
328 Ga0207702_10318905 3300026078 Bacteria 1480
329 Ga0207641_10523141 3300026088 Bacteria 1154
330 Ga0207648_10007281 3300026089 Bacteria 10910
331 Ga0207648_10162771 3300026089 Bacteria 1971
332 Ga0207648_10668234 3300026089 Bacteria 961
333 Ga0207674_10243892 3300026116 Bacteria 1744
334 Ga0207675_100003879 3300026118 Bacteria 14536
335 Ga0207675_100207116 3300026118 Bacteria 1885
336 Ga0207675_100250965 3300026118 Bacteria 1712
337 Ga0207683_10245423 3300026121 Bacteria 1633
338 Ga0207683_10339209 3300026121 Bacteria 1378
339 Ga0207698_10072778 3300026142 Bacteria 2733
340 Ga0207698_10139001 3300026142 Bacteria 2089
341 Ga0207698_10221183 3300026142 Bacteria 1711
342 Ga0209813_10025212 3300027866 Bacteria 1708
343 Ga0207428_10104159 3300027907 Bacteria 2190
344 Ga0268266_10004141 3300028379 Bacteria 14003
345 Ga0268265_10376927 3300028380 Bacteria 1304
346 Ga0268264_10224841 3300028381 Bacteria 1730
347 Ga0307515_10331775 3300028794 Bacteria 1179
348 Ga0307515_10368052 3300028794 Bacteria 1075
349 Ga0265338_10060425 3300028800 Bacteria 3330
350 Ga0265338_10118850 3300028800 Bacteria 2111
351 Ga0265763_1000738 3300030763 Bacteria 2129
352 Ga0265327_10033416 3300031251 Bacteria 2866
353 Ga0307408_100177399 3300031548 Bacteria 1706
354 Ga0307408_100809254 3300031548 Bacteria 851
355 Ga0307514_10006548 3300031649 Bacteria 10128
356 Ga0307514_10024614 3300031649 Bacteria 4870
357 Ga0307514_10149159 3300031649 Bacteria 1573
358 Ga0316576_10003670 3300031727 Bacteria 9058
359 Ga0307413_10307598 3300031824 Bacteria 1205
360 Ga0307518_10084820 3300031838 Bacteria 2283
361 Ga0307406_10483628 3300031901 Bacteria 1000
362 Ga0307412_10097411 3300031911 Bacteria 2072
363 Ga0307412_10517311 3300031911 Bacteria 996
364 Ga0307409_100627899 3300031995 Bacteria 1065
365 Ga0307416_100788112 3300032002 Bacteria 1045
366 Ga0307415_100365735 3300032126 Bacteria 1219
367 Ga0307415_100591415 3300032126 Bacteria 986
368 Ga0316580_10012020 3300032139 Bacteria 2633
369 Ga0316593_10001768 3300032168 Bacteria 4909
370 Ga0316593_10011221 3300032168 Bacteria 2597
371 Ga0316592_1000035 3300033524 Bacteria 10782
372 Ga0316592_1007346 3300033524 Bacteria 2151
373 Ga0316588_1022822 3300033528 Bacteria 1432
374 Ga0316596_1000039 3300033541 Bacteria 13805
375 Ga0316596_1036862 3300033541 Bacteria 1279
376 Ga0316596_1050009 3300033541 Bacteria 1106
377 Ga0373934_0033978 3300035086 Bacteria 2003
378 Ga0373923_0042085 3300035111 Bacteria 1886
379 Ga0373953_0022775 3300035117 Bacteria 2365
380 Ga0373933_0090081 3300035724 Bacteria 1891
381 Ga0373947_0190591 3300035725 Bacteria 1338
382 Ga0373937_0180779 3300036401 Bacteria 1980
383 Ga0373925_0843222 3300037068 Bacteria 755
384 Ga0395899_0055173 3300037312 Bacteria 2939
385 Ga0395899_0147713 3300037312 Bacteria 1668
386 Ga0395899_0407942 3300037312 Bacteria 898
387 Ga0395900_0019000 3300037418 Bacteria 7009
388 Ga0395900_0029990 3300037418 Bacteria 5582
389 Ga0395900_0098493 3300037418 Bacteria 3004
390 Ga0395900_0135952 3300037418 Bacteria 2518
391 Ga0395900_0449310 3300037418 Bacteria 1245
392 Ga0395898_0001389 3300037466 Bacteria 34645
393 Ga0395898_0032908 3300037466 Bacteria 5175
394 Ga0395898_0105586 3300037466 Bacteria 2701
395 Ga0436364_0798468 3300037853 Bacteria 1264
396 Ga0436364_1185744 3300037853 Bacteria 1401
397 Ga0395901_0002011 3300038443 Bacteria 20930
398 Ga0395901_0092911 3300038443 Bacteria 3158
399 Ga0395901_0141720 3300038443 Bacteria 2526
400 Ga0395901_0191537 3300038443 Bacteria 2144
401 Ga0400488_12167 3300038741 Bacteria 2941
402 Ga0400486_17728 3300038742 Bacteria 12468
403 Ga0400483_010286 3300039062 Unclassified 2846
404 Ga0400483_225782 3300039062 Bacteria 2798
405 Ga0400489_17074 3300039093 Bacteria 1808
406 Ga0400487_11344 3300039110 Bacteria 1887
407 Ga0436361_0828474 3300039447 Bacteria 680
408 Ga0439436_0117008 3300041404 Bacteria 745
409 Ga0451794_45758 3300041446 Bacteria 1145
410 Ga0451794_52680 3300041446 Bacteria 818
411 Ga0451791_1290856 3300041451 Bacteria 959
412 Ga0451797_0075534 3300041453 Bacteria 2601
413 Ga0451797_1309826 3300041453 Bacteria 1030
414 Ga0451795_0504698 3300041456 Bacteria 1029
415 Ga0451802_0335101 3300041460 Bacteria 1555
416 Ga0451837_1472954 3300041494 Bacteria 760
417 Ga0451853_1842940 3300041512 Bacteria 1031
418 Ga0451853_3260622 3300041512 Bacteria 1368
419 Ga0450907_022650 3300042146 Bacteria 1059
420 Ga0439446_0190492 3300042156 Bacteria 689
421 Ga0439435_0100161 3300042436 Bacteria 890
422 Ga0451577_0845330 3300042876 Bacteria 826
423 Ga0466969_0012041 3300044656 Bacteria 4570
424 Ga0466969_0049679 3300044656 Bacteria 2069
425 Ga0466969_0134807 3300044656 Bacteria 1144
426 Ga0466969_0283761 3300044656 Bacteria 749
427 Ga0466972_0028315 3300044658 Bacteria 2764
428 Ga0466972_0131344 3300044658 Bacteria 1180
429 Ga0466965_0000003 3300044683 Bacteria 265985
430 Ga0466965_0053028 3300044683 Bacteria 2015
431 Ga0466965_0225475 3300044683 Bacteria 999
432 Ga0466965_0318708 3300044683 Bacteria 846
433 Ga0466966_0016362 3300044684 Bacteria 4901
434 Ga0466966_0023287 3300044684 Bacteria 4056
435 Ga0466966_0107405 3300044684 Bacteria 1722
436 Ga0466966_0159367 3300044684 Bacteria 1374
437 Ga0466966_0366169 3300044684 Bacteria 866
438 Ga0466961_0005839 3300044693 Bacteria 7798
439 Ga0466961_0020007 3300044693 Bacteria 4306
440 Ga0466961_0057729 3300044693 Bacteria 2470
441 Ga0466961_0344478 3300044693 Bacteria 907
442 Ga0466961_0500708 3300044693 Bacteria 733
443 Ga0466963_0002887 3300044694 Bacteria 9706
444 Ga0466963_0146612 3300044694 Bacteria 1638
445 Ga0466963_0436818 3300044694 Bacteria 923
446 Ga0466964_0025045 3300044706 Bacteria 2328
447 Ga0466964_0032622 3300044706 Bacteria 2070
448 Ga0466971_0022329 3300044719 Bacteria 2819
449 Ga0466971_0033256 3300044719 Bacteria 2311
450 Ga0466971_0081823 3300044719 Bacteria 1473
451 Ga0466971_0280716 3300044719 Bacteria 797
452 Ga0466968_0112112 3300044735 Bacteria 1227
453 Ga0466970_0008985 3300044765 Bacteria 5040
454 Ga0466970_0036988 3300044765 Bacteria 2586
455 Ga0466970_0109833 3300044765 Bacteria 1505
456 Ga0466970_0131961 3300044765 Bacteria 1372
457 Ga0466970_0194518 3300044765 Bacteria 1127
458 Ga0466970_0380549 3300044765 Bacteria 803
459 Ga0466957_0178229 3300044842 Bacteria 1387
460 Ga0466960_0009001 3300044901 Bacteria 4105
461 Ga0466960_0011509 3300044901 Bacteria 3704
462 Ga0466960_0115719 3300044901 Bacteria 1398
463 Ga0466960_0354094 3300044901 Bacteria 838
464 Ga0466959_0032262 3300045049 Bacteria 3877
465 Ga0466958_0021743 3300045836 Bacteria 3752
466 Ga0466958_0023373 3300045836 Bacteria 3628
467 Ga0466967_0033394 3300045976 Bacteria 4355
468 Ga0466967_0260669 3300045976 Bacteria 1658
469 Ga0495627_076047 3300046453 Bacteria 977
470 Ga0495592_0252589 3300046454 Bacteria 1164
471 Ga0495590_0000902 3300046457 Bacteria 13285
472 Ga0495638_0072386 3300046460 Bacteria 2106
473 Ga0495650_0002639 3300046471 Bacteria 14025
474 Ga0495650_0058416 3300046471 Bacteria 1557
475 Ga0495608_0293292 3300046511 Bacteria 1008
476 Ga0495616_0081047 3300046513 Bacteria 1553
477 Ga0495618_0060932 3300046514 Bacteria 2393
478 Ga0495620_0039375 3300046515 Bacteria 2089
479 Ga0495620_0107632 3300046515 Bacteria 1107
480 Ga0495628_0060116 3300046516 Bacteria 2982
481 Ga0495644_0042323 3300046523 Bacteria 1715
482 Ga0495654_0146643 3300046530 Bacteria 1047
483 Ga0495587_0153829 3300046536 Bacteria 1310
484 Ga0495598_0026155 3300046537 Bacteria 1598
485 Ga0495633_0143640 3300046558 Bacteria 1103
486 Ga0495667_0126297 3300046559 Bacteria 1650
487 Ga0495668_0173577 3300046616 Bacteria 1181
488 Ga0495634_0084645 3300046642 Bacteria 2067
489 Ga0495611_0116440 3300046648 Bacteria 1246
490 Ga0495647_0151347 3300046681 Bacteria 995
491 Ga0495613_0354933 3300046689 Bacteria 1006
492 Ga0495624_0216869 3300046690 Bacteria 1161
493 Ga0495670_0077662 3300046691 Bacteria 1688
494 Ga0495671_0066424 3300046692 Bacteria 1775
495 Ga0495649_0062055 3300046694 Bacteria 2009
496 Ga0495600_0008792 3300046809 Bacteria 6218
497 Ga0495604_0291433 3300047317 Bacteria 1099
498 Ga0495604_0379238 3300047317 Bacteria 934
499 Ga0495604_0385815 3300047317 Bacteria 925
500 Ga0495680_0339020 3300047322 Bacteria 1049
501 Ga0495681_0059391 3300047470 Bacteria 1768
502 Ga0495686_0050944 3300047472 Bacteria 2600
503 Ga0495615_0053845 3300048090 Bacteria 1043
504 Ga0495626_0010797 3300048091 Bacteria 4853
505 Ga0496100_0092693 3300048903 Bacteria 2065
506 Ga0496100_0171128 3300048903 Bacteria 1564
507 Ga0496101_0061689 3300048904 Bacteria 2723
508 Ga0496101_0101341 3300048904 Bacteria 2156
509 Ga0496101_0407127 3300048904 Bacteria 1071
510 Ga0496102_0025544 3300048905 Bacteria 5259
511 Ga0496102_0061946 3300048905 Bacteria 3425
512 Ga0496102_0271808 3300048905 Bacteria 1598
513 Ga0496102_0547081 3300048905 Bacteria 1080
514 Ga0496103_0033058 3300048906 Bacteria 3159
515 Ga0496103_0124216 3300048906 Bacteria 1645
516 Ga0496103_0188937 3300048906 Bacteria 1324
517 Ga0496104_0003769 3300048907 Bacteria 13107
518 Ga0496104_0052939 3300048907 Bacteria 3834
519 Ga0496105_0118221 3300048908 Bacteria 2186
520 Ga0496105_0148364 3300048908 Bacteria 1928
521 Ga0496106_0202122 3300048909 Bacteria 1581
522 Ga0496106_0731505 3300048909 Bacteria 787
523 Ga0496107_0060713 3300048910 Bacteria 2736
524 Ga0496108_0028389 3300048911 Bacteria 4629
525 Ga0496108_0052644 3300048911 Bacteria 3412
526 Ga0496108_0163578 3300048911 Bacteria 1924
527 Ga0496109_0025845 3300048912 Bacteria 5233
528 Ga0496109_0042506 3300048912 Bacteria 4117
529 Ga0496109_0347382 3300048912 Bacteria 1401
530 Ga0496109_0786264 3300048912 Bacteria 890
531 Ga0496110_0495907 3300048913 Bacteria 1112
532 Ga0496110_0787044 3300048913 Bacteria 855
533 Ga0496111_0315603 3300048914 Bacteria 1158
534 Ga0496113_0302273 3300048916 Bacteria 1281
535 Ga0496114_0002463 3300048917 Bacteria 14129
536 Ga0496114_0044687 3300048917 Bacteria 3676
537 Ga0496114_0461579 3300048917 Bacteria 1124
538 Ga0496115_0035538 3300048918 Bacteria 3942
539 Ga0496115_0058315 3300048918 Bacteria 3106
540 Ga0496115_0078202 3300048918 Bacteria 2691
541 Ga0496117_0004445 3300048920 Bacteria 15459
542 Ga0496117_0008690 3300048920 Bacteria 9601
543 Ga0496117_0010175 3300048920 Bacteria 8627
544 Ga0496117_0027176 3300048920 Bacteria 4464
545 Ga0496117_0333976 3300048920 Bacteria 789
546 Ga0496118_0000116 3300048921 Bacteria 145054
547 Ga0496118_0043816 3300048921 Bacteria 3512
548 Ga0496118_0048793 3300048921 Bacteria 3265
549 Ga0496118_0116874 3300048921 Bacteria 1751
550 Ga0496118_0118944 3300048921 Bacteria 1729
551 Ga0496118_0120100 3300048921 Bacteria 1716
552 Ga0496119_0006250 3300048922 Bacteria 11123
553 Ga0496119_0018839 3300048922 Bacteria 5114
554 Ga0496119_0055862 3300048922 Bacteria 2395
555 Ga0496120_0011067 3300048923 Bacteria 6226
556 Ga0496120_0013513 3300048923 Bacteria 5495
557 Ga0496121_0000497 3300048924 Bacteria 75061
558 Ga0496121_0093682 3300048924 Bacteria 2338
559 Ga0496121_0200342 3300048924 Bacteria 1423
560 Ga0496122_0000799 3300048925 Bacteria 60347
561 Ga0496122_0005147 3300048925 Bacteria 15769
562 Ga0496122_0027445 3300048925 Bacteria 4866
563 Ga0496122_0097576 3300048925 Bacteria 1977
564 Ga0496122_0154998 3300048925 Bacteria 1407
565 Ga0496122_0187091 3300048925 Bacteria 1227
566 Ga0496122_0256351 3300048925 Bacteria 974
567 Ga0496123_0000009 3300048926 Bacteria 509486
568 Ga0496123_0019848 3300048926 Bacteria 5277
569 Ga0496123_0020571 3300048926 Bacteria 5159
570 Ga0496123_0069268 3300048926 Bacteria 2216
571 Ga0496124_0000160 3300048927 Bacteria 136959
572 Ga0496124_0133887 3300048927 Bacteria 1965
573 Ga0496124_0151033 3300048927 Bacteria 1822
574 Ga0496125_0007012 3300048928 Bacteria 12054
575 Ga0496125_0189474 3300048928 Bacteria 1360
576 Ga0496126_0002563 3300048929 Bacteria 24311
577 Ga0496126_0008050 3300048929 Bacteria 11433
578 Ga0496126_0020288 3300048929 Bacteria 6523
579 Ga0496126_0052594 3300048929 Bacteria 3700
580 Ga0496126_0232132 3300048929 Bacteria 1545
581 Ga0496126_0344806 3300048929 Bacteria 1219
582 Ga0501306_026071 3300049127 Bacteria 844
583 Ga0501308_002476 3300049128 Bacteria 1623
584 Ga0501309_038557 3300049129 Bacteria 725
585 Ga0501310_013724 3300049130 Bacteria 943
586 Ga0501305_007556 3300049161 Bacteria 1383
587 Ga0501305_011985 3300049161 Bacteria 1179
588 Ga0501311_016870 3300049527 Bacteria 956
589 Ga0501311_021403 3300049527 Bacteria 882
590 Ga0501311_030208 3300049527 Bacteria 781
591 Ga0501313_000773 3300049529 Bacteria 2423
592 Ga0501314_003375 3300049530 Bacteria 1286
593 Ga0501315_000132 3300049531 Bacteria 4114
594 Ga0501315_001879 3300049531 Bacteria 1886
595 Ga0501315_004112 3300049531 Bacteria 1501
596 Ga0501316_021657 3300049532 Bacteria 814
597 Ga0501317_002934 3300049533 Bacteria 1658
598 Ga0501317_027561 3300049533 Bacteria 807
599 Ga0501318_000232 3300049534 Bacteria 3094
600 Ga0501318_003607 3300049534 Bacteria 1431
601 Ga0501318_003938 3300049534 Bacteria 1396
602 Ga0501318_008163 3300049534 Bacteria 1113
603 Ga0501318_011829 3300049534 Bacteria 992
604 Ga0501319_004044 3300049535 Bacteria 1007
605 Ga0501320_001908 3300049536 Bacteria 1600
606 Ga0501321_015946 3300049537 Bacteria 889
607 Ga0501323_004565 3300049539 Bacteria 1473
608 Ga0501323_005042 3300049539 Bacteria 1426
609 Ga0501324_008301 3300049540 Bacteria 913
610 Ga0501325_001400 3300049541 Bacteria 1471
611 Ga0501031_0002157 3300049568 Bacteria 12414
612 Ga0501031_0012276 3300049568 Bacteria 5584
613 Ga0501031_0090099 3300049568 Bacteria 2000
614 Ga0501032_0000438 3300049569 Bacteria 34232
615 Ga0501032_0003386 3300049569 Bacteria 12226
616 Ga0501032_0014681 3300049569 Bacteria 5545
617 Ga0501032_0146108 3300049569 Bacteria 1556
618 Ga0501032_0221183 3300049569 Bacteria 1232
619 Ga0501033_0001612 3300049570 Bacteria 19830
620 Ga0501033_0004858 3300049570 Bacteria 10708
621 Ga0501033_0180757 3300049570 Bacteria 1512
622 Ga0501033_0195274 3300049570 Bacteria 1447
623 Ga0501034_0001245 3300049571 Bacteria 34615
624 Ga0501034_0008687 3300049571 Bacteria 10701
625 Ga0501034_0078739 3300049571 Bacteria 3299
626 Ga0501034_0165599 3300049571 Bacteria 2179
627 Ga0501034_0189207 3300049571 Bacteria 2021
628 Ga0501034_0205003 3300049571 Bacteria 1928
629 Ga0501034_0219005 3300049571 Bacteria 1856
630 Ga0501034_0324382 3300049571 Bacteria 1472
631 Ga0501034_0332899 3300049571 Bacteria 1449
632 Ga0501034_0354295 3300049571 Bacteria 1395
633 Ga0501034_1214490 3300049571 Bacteria 632
634 Ga0501036_0003863 3300049572 Bacteria 12020
635 Ga0501036_0289957 3300049572 Bacteria 1369
636 Ga0501037_0000998 3300049573 Bacteria 20981
637 Ga0501037_0001422 3300049573 Bacteria 17565
638 Ga0501037_0050605 3300049573 Bacteria 3040
639 Ga0501037_0160548 3300049573 Bacteria 1602
640 Ga0501037_0215816 3300049573 Bacteria 1351
641 Ga0501037_0514945 3300049573 Bacteria 810
642 Ga0501038_0000265 3300049574 Bacteria 44237
643 Ga0501038_0211901 3300049574 Bacteria 1549
644 Ga0501038_0245848 3300049574 Bacteria 1419
645 Ga0501038_0460261 3300049574 Bacteria 977
646 Ga0501039_0000814 3300049575 Bacteria 22509
647 Ga0501039_0049467 3300049575 Bacteria 3249
648 Ga0501039_0437871 3300049575 Bacteria 1027
649 Ga0501039_0600589 3300049575 Bacteria 863
650 Ga0501040_0028795 3300049576 Bacteria 3746
651 Ga0501041_0194826 3300049577 Bacteria 1270
652 Ga0501043_0001438 3300049579 Bacteria 20808
653 Ga0501043_0035007 3300049579 Bacteria 3949
654 Ga0501043_0048230 3300049579 Bacteria 3348
655 Ga0501043_0171199 3300049579 Bacteria 1694
656 Ga0501046_0001551 3300049580 Bacteria 21926
657 Ga0501046_0014149 3300049580 Bacteria 6739
658 Ga0501046_0023204 3300049580 Bacteria 5106
659 Ga0501046_0127364 3300049580 Bacteria 1933
660 Ga0501046_0197467 3300049580 Bacteria 1498
661 Ga0501047_0000855 3300049581 Bacteria 31151
662 Ga0501047_0032467 3300049581 Bacteria 5039
663 Ga0501047_0095036 3300049581 Bacteria 2859
664 Ga0501047_0413796 3300049581 Bacteria 1180
665 Ga0501047_0732246 3300049581 Bacteria 805
666 Ga0501048_0000857 3300049582 Bacteria 22424
667 Ga0501048_0016304 3300049582 Bacteria 5476
668 Ga0501048_0022961 3300049582 Bacteria 4560
669 Ga0501048_0458772 3300049582 Bacteria 913
670 Ga0501048_0660944 3300049582 Bacteria 750
671 Ga0501067_0007970 3300049583 Bacteria 5883
672 Ga0501067_0099814 3300049583 Bacteria 1612
673 Ga0501067_0216235 3300049583 Bacteria 1067
674 Ga0501068_0042645 3300049584 Bacteria 2728
675 Ga0501068_0051682 3300049584 Bacteria 2486
676 Ga0501068_0096970 3300049584 Bacteria 1824
677 Ga0501069_0000702 3300049585 Bacteria 15604
678 Ga0501069_0027937 3300049585 Bacteria 3093
679 Ga0501069_0032649 3300049585 Bacteria 2866
680 Ga0501070_0000874 3300049586 Bacteria 27417
681 Ga0501070_0001773 3300049586 Bacteria 19097
682 Ga0501070_0015639 3300049586 Bacteria 6379
683 Ga0501070_0016910 3300049586 Bacteria 6121
684 Ga0501070_0018992 3300049586 Bacteria 5765
685 Ga0501070_0122178 3300049586 Bacteria 2152
686 Ga0501070_0398067 3300049586 Bacteria 1114
687 Ga0501071_0000119 3300049587 Bacteria 31338
688 Ga0501072_0100863 3300049588 Bacteria 2294
689 Ga0501073_0000030 3300049589 Bacteria 115949
690 Ga0501073_0002543 3300049589 Bacteria 13627
691 Ga0501073_0083492 3300049589 Bacteria 2223
692 Ga0501073_0137037 3300049589 Bacteria 1696
693 Ga0501073_0162413 3300049589 Bacteria 1547
694 Ga0501074_0000257 3300049590 Bacteria 30059
695 Ga0501074_0391445 3300049590 Bacteria 986
696 Ga0501075_0390994 3300049591 Bacteria 1060
697 Ga0501076_0155730 3300049592 Bacteria 1860
698 Ga0501080_0000208 3300049742 Bacteria 43436
699 Ga0501080_0002067 3300049742 Bacteria 17401
700 Ga0501080_0147468 3300049742 Bacteria 2175
701 Ga0501083_0000801 3300049744 Bacteria 20607
702 Ga0501083_0038919 3300049744 Bacteria 3231
703 Ga0501083_0112793 3300049744 Bacteria 1786
704 Ga0501035_0001522 3300049822 Bacteria 23684
705 Ga0501035_0013885 3300049822 Bacteria 7432
706 Ga0501035_0028774 3300049822 Bacteria 5070
707 Ga0501035_0114379 3300049822 Bacteria 2363
708 Ga0501035_0174316 3300049822 Bacteria 1856
709 Ga0501035_0216432 3300049822 Bacteria 1637
710 Ga0501044_0001222 3300049823 Bacteria 30539
711 Ga0501044_0001531 3300049823 Bacteria 27116
712 Ga0501044_0002854 3300049823 Bacteria 19664
713 Ga0501044_0021477 3300049823 Bacteria 6884
714 Ga0501044_0066267 3300049823 Bacteria 3683
715 Ga0501044_0068387 3300049823 Bacteria 3618
716 Ga0501044_0212892 3300049823 Bacteria 1886
717 Ga0501045_0012578 3300049824 Bacteria 5959
718 nmdc:mga03683_129785_c1 3300050489 Bacteria 1127
719 nmdc:mga03n38_32256_c1 3300050490 Bacteria 2218
720 nmdc:mga00v17_22122_c1 3300050491 Bacteria 3665
721 nmdc:mga00v17_85414_c1 3300050491 Bacteria 1976
722 nmdc:mga00v17_958_c1 3300050491 Bacteria 15464
723 nmdc:mga0yw44_150507_c1 3300050492 Bacteria 1518
724 nmdc:mga0yw44_18094_c1 3300050492 Bacteria 3853
725 nmdc:mga0yw44_37084_c2 3300050492 Bacteria 2584
726 nmdc:mga0yw44_479862_c1 3300050492 Bacteria 843
727 nmdc:mga0yw44_82709_c1 3300050492 Bacteria 2015
728 nmdc:mga0yw44_92830_c1 3300050492 Bacteria 1911
729 nmdc:mga06z11_105066_c1 3300050494 Bacteria 1556
730 nmdc:mga06z11_14649_c1 3300050494 Bacteria 3480
731 nmdc:mga04h51_6102_c1 3300050495 Bacteria 3108
732 nmdc:mga07m45_8187_c1 3300050496 Bacteria 5365
733 nmdc:mga08y16_356382_c1 3300050511 Bacteria 1502
734 nmdc:mga08y16_39303_c1 3300050511 Bacteria 4965
735 nmdc:mga0sz30_14040_c1 3300050516 Bacteria 3146
736 Ga0495601_0452352 3300053077 Bacteria 830
737 Ga0500635_0000108 3300053080 Bacteria 49899
738 Ga0500635_0149496 3300053080 Bacteria 890
739 Ga0495619_0362900 3300053085 Bacteria 1002
740 Ga0500643_001952 3300053087 Bacteria 11184
741 Ga0500651_0004271 3300053093 Bacteria 7981
742 Ga0500651_0103083 3300053093 Bacteria 1748
743 Ga0500556_0000020 3300053104 Bacteria 185929
744 Ga0500556_0000151 3300053104 Bacteria 57882
745 Ga0500562_027074 3300053108 Bacteria 1503
746 Ga0500593_000975 3300053117 Bacteria 10477
747 Ga0500652_086635 3300053131 Bacteria 1306
748 Ga0500559_0000050 3300053136 Bacteria 93262
749 Ga0500559_0000164 3300053136 Bacteria 52626
750 Ga0500559_0103196 3300053136 Bacteria 1315
751 Ga0500568_0000029 3300053139 Bacteria 159927
752 Ga0500568_0000038 3300053139 Bacteria 134267
753 Ga0500568_0000117 3300053139 Bacteria 71510
754 Ga0500568_0002756 3300053139 Bacteria 10167
755 Ga0500568_0010878 3300053139 Bacteria 4243
756 Ga0500568_0086837 3300053139 Bacteria 1182
757 Ga0500573_0000070 3300053140 Bacteria 60574
758 Ga0500573_0011156 3300053140 Bacteria 5026
759 Ga0500573_0025500 3300053140 Bacteria 3399
760 Ga0500573_0074233 3300053140 Bacteria 1937
761 Ga0500573_0155954 3300053140 Bacteria 1246
762 Ga0500577_0028573 3300053142 Bacteria 1922
763 Ga0500577_0191262 3300053142 Bacteria 881
764 Ga0500588_0061596 3300053146 Bacteria 1204
765 Ga0500590_049090 3300053148 Bacteria 2148
766 Ga0500616_0000027 3300053153 Bacteria 441053
767 Ga0500616_0000117 3300053153 Bacteria 145655
768 Ga0500616_0261757 3300053153 Bacteria 734
769 Ga0500645_021457 3300053730 Bacteria 1993
770 Ga0501084_0000487 3300054114 Bacteria 30390
771 Ga0501084_0060093 3300054114 Bacteria 3182
772 Ga0587084_016213 3300059477 Bacteria 1061
773 Ga0587086_005069 3300059507 Bacteria 1408
774 Ga0587086_005675 3300059507 Bacteria 1361
775 Ga0587088_009820 3300059508 Bacteria 1387
776 Ga0587090_007734 3300059510 Bacteria 1420
777 Ga0587090_008186 3300059510 Bacteria 1395
778 Ga0587092_011530 3300059512 Bacteria 1231
779 Ga0587106_028551 3300059605 Bacteria 881
780 Ga0587129_000824 3300059608 Bacteria 1524
781 Ga0587099_000526 3300059622 Bacteria 2252
782 Ga0587113_004834 3300059625 Bacteria 1089
783 Ga0587117_007597 3300059627 Bacteria 1247
784 Ga0587128_004713 3300059630 Bacteria 1599
785 Ga0587128_015284 3300059630 Bacteria 1110
786 Ga0587062_006064 3300059639 Bacteria 1360
787 Ga0587067_023162 3300059640 Bacteria 1087
788 Ga0587068_024042 3300059641 Bacteria 1018
789 Ga0587069_003532 3300059642 Bacteria 1695
790 Ga0587072_067019 3300059643 Bacteria 751
791 Ga0587075_005375 3300059644 Bacteria 1530
792 Ga0587075_015418 3300059644 Bacteria 1074
793 Ga0587076_036316 3300059645 Bacteria 900
794 Ga0587105_002249 3300059651 Bacteria 1087
795 Ga0587114_001341 3300059655 Bacteria 2036
796 Ga0587114_006650 3300059655 Bacteria 1300
797 Ga0587096_00235 3300060247 Bacteria 1341
798 Ga0587071_010694 3300060344 Bacteria 1536
799 Ga0587071_014086 3300060344 Bacteria 1386
800 Ga0587071_029649 3300060344 Bacteria 1047
801 Ga0587111_0008255 3300060346 Bacteria 1720
802 Ga0587111_0013567 3300060346 Bacteria 1459
803 Ga0501082_0165960 3300060353 Bacteria 1919
804 Ga0501082_0378087 3300060353 Bacteria 1236
805 Ga0501082_0538034 3300060353 Bacteria 1022
806 Ga0466962_0015867 3300061719 Bacteria 3635
807 Ga0466962_0057650 3300061719 Bacteria 1854
808 Ga0466962_0145126 3300061719 Bacteria 1150
809 Ga0530510_0561568 3300061734 Bacteria 867
810 2555228831 2554235227 Bacteria 3637389
811 2643876453 2643221572 Bacteria 3614809
812 2644096402 2643221616 Bacteria 4066575
813 2644112000 2643221619 Bacteria 4158469
814 2644182391 2643221632 Bacteria 3406696
815 2644383508 2643221669 Bacteria 3611286
816 2644455931 2643221681 Bacteria 3707866
817 2644538523 2643221697 Bacteria 3575694
818 2645720827 2643221961 Bacteria 3919167
819 2645723836 2643221962 Bacteria 3874254
820 2655033297 2654587600 Bacteria 3911798
821 2774396389 2773857762 Bacteria 5971770
822 2809198045 2808606439 Bacteria 5952208
823 2812353264 2811994878 Bacteria 5992952
824 2844843375 2844841374 Bacteria 3917147
825 2844849808 2844849076 Bacteria 4091819
826 2844854311 2844852863 Bacteria 3849151
827 2852644343 2852643534 Bacteria 3013378
828 2857730667 2857729791 Bacteria 4040535
829 2857734547 2857733635 Bacteria 3532004
830 2857738244 2857737099 Bacteria 3104305
831 2884766402 2884763398 Bacteria 4091164
832 2891969108 2891968417 Bacteria 5821697
833 2895660628 2895660088 Bacteria 3782833
834 2897564322 2897561785 Bacteria 3256946
835 2919055353 2919055335 Bacteria 3875751
836 2919525429 2919523602 Bacteria 3788128
837 2928121473 2928121344 Bacteria 3972376
838 2928153512 2928153084 Bacteria 4020257
839 2939662724 2939660829 Bacteria 3784848
840 2966922544 2966921586 Bacteria 3092803
841 2984592307 2984592036 Bacteria 3670284
842 2990092163 2990088156 Bacteria 6657676
843 8002811561 8002811521 Bacteria 2942897
844 8033689347 8033684223 Bacteria 6906479
845 8046353821 8046352972 Bacteria 3613806
846 8055035300 8055034563 Bacteria 3562128
847 8056039392 8056037122 Bacteria 3854319
848 Ga0587102_016746
849 LJQas_1013126
850 JGI24740J21852_10008552
851 JGI24740J21852_10069279
852 JGI24739J22299_10005224
853 JGI24743J22301_10000788
854 JGI24750J21931_1003131
855 JGI24738J21930_10001633
856 JGI24749J21850_1002100
857 JGI24744J21845_10001898
858 JGI24742J22300_10004109
859 JGI25162J39368_1006149
860 JGI25164J39214_1000440
861 Ga0006778J45830_1014960
862 Ga0006778J45830_1015738
863 Ga0006759J45824_1054624
864 JGI25165J46597_1000061
865 Ga0006758J48902_1010827
866 Ga0006554J51385_1032262
867 Ga0007410J51695_1063952
868 Ga0007416J51690_1008299
869 Ga0006562J51391_1024272
870 Ga0006562J51391_1024273
871 Ga0055539_1000555
872 Ga0055533_1000001
873 Ga0055525_1001039
874 Ga0055527_1000017
875 Ga0055542_1000044
876 Ga0055542_1008279
877 Ga0055529_1000484
878 Ga0055541_1002835
879 Ga0058859_10128905
880 Ga0058861_10015007
881 Ga0058860_10093343
882 Ga0065714_10097178
883 Ga0070658_10009122
884 Ga0070658_10082338
885 Ga0070658_10522104
886 Ga0070683_100270463
887 Ga0070690_100286553
888 Ga0070670_100064167
889 Ga0070670_100414814
890 Ga0070677_10318614
891 Ga0070682_100038470
892 Ga0070682_100193084
893 Ga0068868_100516086
894 Ga0068868_100644456
895 Ga0070660_100057825
896 Ga0070691_10012309
897 Ga0070687_100416894
898 Ga0070661_100040530
899 Ga0070661_100269446
900 Ga0070692_10002505
901 Ga0070668_100061631
902 Ga0070675_100065082
903 Ga0070671_100053010
904 Ga0070671_100213030
905 Ga0070674_100008878
906 Ga0070674_100142664
907 Ga0070673_100437479
908 Ga0070688_100085354
909 Ga0070659_100003025
910 Ga0070667_100042795
911 Ga0070667_100324088
912 Ga0070709_10014845
913 Ga0070710_10162241
914 Ga0070701_10001181
915 Ga0070705_100013335
916 Ga0070700_100003597
917 Ga0070708_100079179
918 Ga0070708_100444472
919 Ga0070663_100219379
920 Ga0070678_100636026
921 Ga0070681_10369506
922 Ga0068867_100007380
923 Ga0070685_10010240
924 Ga0070685_10258617
925 Ga0070707_100017376
926 Ga0070707_100030934
927 Ga0070698_100006774
928 Ga0070699_100264880
929 Ga0070679_100536765
930 Ga0070684_100057591
931 Ga0070684_100215069
932 Ga0070684_100522199
933 Ga0068853_100068961
934 Ga0068853_100228621
935 Ga0068853_101091278
936 Ga0070672_100002167
937 Ga0070672_100547262
938 Ga0070686_100071401
939 Ga0070665_100002964
940 Ga0070665_100083091
941 Ga0070704_100490909
942 Ga0068855_100047986
943 Ga0068855_101193777
944 Ga0070664_100481909
945 Ga0068857_100172828
946 Ga0068857_100373134
947 Ga0068856_100275878
948 Ga0068856_100650461
949 Ga0068856_101037760
950 Ga0068852_100002721
951 Ga0068852_100678152
952 Ga0068864_100374260
953 Ga0068861_100072369
954 Ga0068861_100198465
955 Ga0068851_10000022
956 Ga0068870_10000658
957 Ga0068858_100034623
958 Ga0068860_100171309
959 Ga0068862_100401189
960 Ga0068862_100831809
961 Ga0081455_10407445
962 Ga0075365_10014071
963 Ga0075365_10037200
964 Ga0075365_10055431
965 Ga0075365_10070695
966 Ga0075365_10235679
967 Ga0075365_10382117
968 Ga0075368_10001331
969 Ga0075368_10111040
970 Ga0075368_10179314
971 Ga0075363_100124422
972 Ga0075364_10036458
973 Ga0075364_10055289
974 Ga0075364_10334727
975 Ga0070715_10017201
976 Ga0070712_100383540
977 Ga0075367_10020722
978 Ga0075369_10008212
979 Ga0075370_10005554
980 Ga0075370_10100380
981 Ga0075428_100002072
982 Ga0075428_100482172
983 Ga0075431_100004313
984 Ga0075434_101017278
985 Ga0075429_100006773
986 Ga0068865_100006802
987 Ga0105244_10090974
988 Ga0105244_10100399
989 Ga0105240_11344846
990 Ga0111539_10032544
991 Ga0111539_10055228
992 Ga0105245_10212872
993 Ga0105245_10461716
994 Ga0105245_10754417
995 Ga0105245_10798567
996 Ga0105247_10140257
997 Ga0105247_10145933
998 Ga0114129_10006606
999 Ga0114129_11006428
1000 Ga0105243_10002648
1001 Ga0105243_10008981
1002 Ga0105243_10042092
1003 Ga0105243_10051867
1004 Ga0105241_10170069
1005 Ga0105248_10129268
1006 Ga0105248_10266117
1007 Ga0105237_10232698
1008 Ga0105238_10027288
1009 Ga0105238_10117861
1010 Ga0105238_10130008
1011 Ga0105238_10214305
1012 Ga0105238_10316946
1013 Ga0105238_10317308
1014 Ga0105249_10383208
1015 Ga0105249_10452815
1016 Ga0105249_10457219
1017 Ga0105239_10169748
1018 Ga0105246_10171636
1019 Ga0105246_10556484
1020 Ga0154014_157137
1021 Ga0157371_10013796
1022 Ga0157370_10010513
1023 Ga0157370_10463378
1024 Ga0157369_10041722
1025 Ga0157369_10053397
1026 Ga0157369_10195188
1027 Ga0157369_10395883
1028 Ga0157374_10146984
1029 Ga0157374_10819915
1030 Ga0157378_10041297
1031 Ga0163162_10109166
1032 Ga0163162_10177320
1033 Ga0163162_10593655
1034 Ga0157372_10038906
1035 Ga0157372_10330752
1036 Ga0157375_10008009
1037 Ga0157375_11200083
1038 Ga0157375_11287770
1039 Ga0163163_10942435
1040 Ga0157380_10035348
1041 Ga0157380_10067392
1042 Ga0157377_10014555
1043 Ga0157379_10053997
1044 Ga0157379_10472479
1045 Ga0163161_10503530
1046 Ga0197907_10046073
1047 Ga0197907_10060462
1048 Ga0197907_10886560
1049 Ga0206356_11091742
1050 Ga0206356_11808489
1051 Ga0206349_1003097
1052 Ga0206349_1024628
1053 Ga0206349_1123513
1054 Ga0206349_1802703
1055 Ga0206355_1042401
1056 Ga0206355_1111929
1057 Ga0206355_1365351
1058 Ga0206355_1391308
1059 Ga0206355_1440951
1060 Ga0206351_10066836
1061 Ga0206351_10123606
1062 Ga0206351_10145003
1063 Ga0206351_10167011
1064 Ga0206351_10319390
1065 Ga0206351_10488924
1066 Ga0206351_10696424
1067 Ga0206352_10030486
1068 Ga0206352_10447415
1069 Ga0206352_10509679
1070 Ga0206352_10520377
1071 Ga0206352_10553411
1072 Ga0206350_10419393
1073 Ga0206350_10808887
1074 Ga0206350_11166112
1075 Ga0206354_11221512
1076 Ga0206354_11337275
1077 Ga0206354_11551758
1078 Ga0206354_11673908
1079 Ga0206353_10020316
1080 Ga0206353_10299232
1081 Ga0206353_10684920
1082 Ga0206353_11035842
1083 Ga0206353_11048344
1084 Ga0154015_1615289
1085 Ga0154015_1673430
1086 Ga0224712_10019628
1087 Ga0224712_10049005
1088 Ga0224712_10135445
1089 Ga0224712_10151363
1090 Ga0209566_100066
1091 Ga0209674_100001
1092 Ga0209672_100039
1093 Ga0209147_101471
1094 Ga0209563_100001
1095 Ga0207427_100042
1096 Ga0209437_100510
1097 Ga0209677_100001
1098 Ga0209148_1000004
1099 Ga0209148_1002314
1100 Ga0209233_1000001
1101 Ga0209455_1000339
1102 Ga0207426_1005083
1103 Ga0207697_10069640
1104 Ga0207656_10000005
1105 Ga0207655_1000386
1106 Ga0207692_10059815
1107 Ga0207710_10101987
1108 Ga0207688_10042994
1109 Ga0207647_10021649
1110 Ga0207647_10066401
1111 Ga0207699_10004645
1112 Ga0207643_10001355
1113 Ga0207643_10081010
1114 Ga0207643_10086083
1115 Ga0207705_10000001
1116 Ga0207705_10469937
1117 Ga0207684_10567328
1118 Ga0207654_10000001
1119 Ga0207695_10275058
1120 Ga0207695_10466061
1121 Ga0207671_10000016
1122 Ga0207693_10513900
1123 Ga0207663_10484041
1124 Ga0207657_10005997
1125 Ga0207646_10082391
1126 Ga0207646_10413128
1127 Ga0207694_10000057
1128 Ga0207694_10351614
1129 Ga0207687_10091182
1130 Ga0207700_10010456
1131 Ga0207664_10315268
1132 Ga0207644_10059624
1133 Ga0207644_10257841
1134 Ga0207690_10003803
1135 Ga0207690_10162227
1136 Ga0207686_10053497
1137 Ga0207709_10002586
1138 Ga0207709_10005029
1139 Ga0207709_10234010
1140 Ga0207670_10022974
1141 Ga0207669_10006873
1142 Ga0207704_10004632
1143 Ga0207704_10192143
1144 Ga0207704_10521982
1145 Ga0207665_10228495
1146 Ga0207665_10557078
1147 Ga0207691_10003431
1148 Ga0207691_10334124
1149 Ga0207711_10022131
1150 Ga0207711_10056556
1151 Ga0207711_10515531
1152 Ga0207661_10093790
1153 Ga0207661_10104106
1154 Ga0207661_10327399
1155 Ga0207679_10309283
1156 Ga0207667_10021165
1157 Ga0207667_10069574
1158 Ga0207712_10103556
1159 Ga0207712_10132600
1160 Ga0207712_10312334
1161 Ga0207668_10113821
1162 Ga0207640_10186285
1163 Ga0207658_10066284
1164 Ga0207677_10014347
1165 Ga0207677_10300821
1166 Ga0207703_10001453
1167 Ga0207639_10140158
1168 Ga0207678_10112359
1169 Ga0207678_10129044
1170 Ga0207678_10363398
1171 Ga0207708_10004001
1172 Ga0207708_10472740
1173 Ga0207708_10632077
1174 Ga0207702_10029018
1175 Ga0207702_10318905
1176 Ga0207641_10523141
1177 Ga0207648_10007281
1178 Ga0207648_10162771
1179 Ga0207648_10668234
1180 Ga0207674_10243892
1181 Ga0207675_100003879
1182 Ga0207675_100207116
1183 Ga0207675_100250965
1184 Ga0207683_10245423
1185 Ga0207683_10339209
1186 Ga0207698_10072778
1187 Ga0207698_10139001
1188 Ga0207698_10221183
1189 Ga0209813_10025212
1190 Ga0207428_10104159
1191 Ga0268266_10004141
1192 Ga0268265_10376927
1193 Ga0268264_10224841
1194 Ga0307515_10331775
1195 Ga0307515_10368052
1196 Ga0265338_10060425
1197 Ga0265338_10118850
1198 Ga0265763_1000738
1199 Ga0265327_10033416
1200 Ga0307408_100177399
1201 Ga0307408_100809254
1202 Ga0307514_10006548
1203 Ga0307514_10024614
1204 Ga0307514_10149159
1205 Ga0316576_10003670
1206 Ga0307413_10307598
1207 Ga0307518_10084820
1208 Ga0307406_10483628
1209 Ga0307412_10097411
1210 Ga0307412_10517311
1211 Ga0307409_100627899
1212 Ga0307416_100788112
1213 Ga0307415_100365735
1214 Ga0307415_100591415
1215 Ga0316580_10012020
1216 Ga0316593_10001768
1217 Ga0316593_10011221
1218 Ga0316592_1000035
1219 Ga0316592_1007346
1220 Ga0316588_1022822
1221 Ga0316596_1000039
1222 Ga0316596_1036862
1223 Ga0316596_1050009
1224 Ga0373934_0033978
1225 Ga0373923_0042085
1226 Ga0373953_0022775
1227 Ga0373933_0090081
1228 Ga0373947_0190591
1229 Ga0373937_0180779
1230 Ga0373925_0843222
1231 Ga0395899_0055173
1232 Ga0395899_0147713
1233 Ga0395899_0407942
1234 Ga0395900_0019000
1235 Ga0395900_0029990
1236 Ga0395900_0098493
1237 Ga0395900_0135952
1238 Ga0395900_0449310
1239 Ga0395898_0001389
1240 Ga0395898_0032908
1241 Ga0395898_0105586
1242 Ga0436364_0798468
1243 Ga0436364_1185744
1244 Ga0395901_0002011
1245 Ga0395901_0092911
1246 Ga0395901_0141720
1247 Ga0395901_0191537
1248 Ga0400488_12167
1249 Ga0400486_17728
1250 Ga0400483_010286
1251 Ga0400483_225782
1252 Ga0400489_17074
1253 Ga0400487_11344
1254 Ga0436361_0828474
1255 Ga0439436_0117008
1256 Ga0451794_45758
1257 Ga0451794_52680
1258 Ga0451791_1290856
1259 Ga0451797_0075534
1260 Ga0451797_1309826
1261 Ga0451795_0504698
1262 Ga0451802_0335101
1263 Ga0451837_1472954
1264 Ga0451853_1842940
1265 Ga0451853_3260622
1266 Ga0450907_022650
1267 Ga0439446_0190492
1268 Ga0439435_0100161
1269 Ga0451577_0845330
1270 Ga0466969_0012041
1271 Ga0466969_0049679
1272 Ga0466969_0134807
1273 Ga0466969_0283761
1274 Ga0466972_0028315
1275 Ga0466972_0131344
1276 Ga0466965_0000003
1277 Ga0466965_0053028
1278 Ga0466965_0225475
1279 Ga0466965_0318708
1280 Ga0466966_0016362
1281 Ga0466966_0023287
1282 Ga0466966_0107405
1283 Ga0466966_0159367
1284 Ga0466966_0366169
1285 Ga0466961_0005839
1286 Ga0466961_0020007
1287 Ga0466961_0057729
1288 Ga0466961_0344478
1289 Ga0466961_0500708
1290 Ga0466963_0002887
1291 Ga0466963_0146612
1292 Ga0466963_0436818
1293 Ga0466964_0025045
1294 Ga0466964_0032622
1295 Ga0466971_0022329
1296 Ga0466971_0033256
1297 Ga0466971_0081823
1298 Ga0466971_0280716
1299 Ga0466968_0112112
1300 Ga0466970_0008985
1301 Ga0466970_0036988
1302 Ga0466970_0109833
1303 Ga0466970_0131961
1304 Ga0466970_0194518
1305 Ga0466970_0380549
1306 Ga0466957_0178229
1307 Ga0466960_0009001
1308 Ga0466960_0011509
1309 Ga0466960_0115719
1310 Ga0466960_0354094
1311 Ga0466959_0032262
1312 Ga0466958_0021743
1313 Ga0466958_0023373
1314 Ga0466967_0033394
1315 Ga0466967_0260669
1316 Ga0495627_076047
1317 Ga0495592_0252589
1318 Ga0495590_0000902
1319 Ga0495638_0072386
1320 Ga0495650_0002639
1321 Ga0495650_0058416
1322 Ga0495608_0293292
1323 Ga0495616_0081047
1324 Ga0495618_0060932
1325 Ga0495620_0039375
1326 Ga0495620_0107632
1327 Ga0495628_0060116
1328 Ga0495644_0042323
1329 Ga0495654_0146643
1330 Ga0495587_0153829
1331 Ga0495598_0026155
1332 Ga0495633_0143640
1333 Ga0495667_0126297
1334 Ga0495668_0173577
1335 Ga0495634_0084645
1336 Ga0495611_0116440
1337 Ga0495647_0151347
1338 Ga0495613_0354933
1339 Ga0495624_0216869
1340 Ga0495670_0077662
1341 Ga0495671_0066424
1342 Ga0495649_0062055
1343 Ga0495600_0008792
1344 Ga0495604_0291433
1345 Ga0495604_0379238
1346 Ga0495604_0385815
1347 Ga0495680_0339020
1348 Ga0495681_0059391
1349 Ga0495686_0050944
1350 Ga0495615_0053845
1351 Ga0495626_0010797
1352 Ga0496100_0092693
1353 Ga0496100_0171128
1354 Ga0496101_0061689
1355 Ga0496101_0101341
1356 Ga0496101_0407127
1357 Ga0496102_0025544
1358 Ga0496102_0061946
1359 Ga0496102_0271808
1360 Ga0496102_0547081
1361 Ga0496103_0033058
1362 Ga0496103_0124216
1363 Ga0496103_0188937
1364 Ga0496104_0003769
1365 Ga0496104_0052939
1366 Ga0496105_0118221
1367 Ga0496105_0148364
1368 Ga0496106_0202122
1369 Ga0496106_0731505
1370 Ga0496107_0060713
1371 Ga0496108_0028389
1372 Ga0496108_0052644
1373 Ga0496108_0163578
1374 Ga0496109_0025845
1375 Ga0496109_0042506
1376 Ga0496109_0347382
1377 Ga0496109_0786264
1378 Ga0496110_0495907
1379 Ga0496110_0787044
1380 Ga0496111_0315603
1381 Ga0496113_0302273
1382 Ga0496114_0002463
1383 Ga0496114_0044687
1384 Ga0496114_0461579
1385 Ga0496115_0035538
1386 Ga0496115_0058315
1387 Ga0496115_0078202
1388 Ga0496117_0004445
1389 Ga0496117_0008690
1390 Ga0496117_0010175
1391 Ga0496117_0027176
1392 Ga0496117_0333976
1393 Ga0496118_0000116
1394 Ga0496118_0043816
1395 Ga0496118_0048793
1396 Ga0496118_0116874
1397 Ga0496118_0118944
1398 Ga0496118_0120100
1399 Ga0496119_0006250
1400 Ga0496119_0018839
1401 Ga0496119_0055862
1402 Ga0496120_0011067
1403 Ga0496120_0013513
1404 Ga0496121_0000497
1405 Ga0496121_0093682
1406 Ga0496121_0200342
1407 Ga0496122_0000799
1408 Ga0496122_0005147
1409 Ga0496122_0027445
1410 Ga0496122_0097576
1411 Ga0496122_0154998
1412 Ga0496122_0187091
1413 Ga0496122_0256351
1414 Ga0496123_0000009
1415 Ga0496123_0019848
1416 Ga0496123_0020571
1417 Ga0496123_0069268
1418 Ga0496124_0000160
1419 Ga0496124_0133887
1420 Ga0496124_0151033
1421 Ga0496125_0007012
1422 Ga0496125_0189474
1423 Ga0496126_0002563
1424 Ga0496126_0008050
1425 Ga0496126_0020288
1426 Ga0496126_0052594
1427 Ga0496126_0232132
1428 Ga0496126_0344806
1429 Ga0501306_026071
1430 Ga0501308_002476
1431 Ga0501309_038557
1432 Ga0501310_013724
1433 Ga0501305_007556
1434 Ga0501305_011985
1435 Ga0501311_016870
1436 Ga0501311_021403
1437 Ga0501311_030208
1438 Ga0501313_000773
1439 Ga0501314_003375
1440 Ga0501315_000132
1441 Ga0501315_001879
1442 Ga0501315_004112
1443 Ga0501316_021657
1444 Ga0501317_002934
1445 Ga0501317_027561
1446 Ga0501318_000232
1447 Ga0501318_003607
1448 Ga0501318_003938
1449 Ga0501318_008163
1450 Ga0501318_011829
1451 Ga0501319_004044
1452 Ga0501320_001908
1453 Ga0501321_015946
1454 Ga0501323_004565
1455 Ga0501323_005042
1456 Ga0501324_008301
1457 Ga0501325_001400
1458 Ga0501031_0002157
1459 Ga0501031_0012276
1460 Ga0501031_0090099
1461 Ga0501032_0000438
1462 Ga0501032_0003386
1463 Ga0501032_0014681
1464 Ga0501032_0146108
1465 Ga0501032_0221183
1466 Ga0501033_0001612
1467 Ga0501033_0004858
1468 Ga0501033_0180757
1469 Ga0501033_0195274
1470 Ga0501034_0001245
1471 Ga0501034_0008687
1472 Ga0501034_0078739
1473 Ga0501034_0165599
1474 Ga0501034_0189207
1475 Ga0501034_0205003
1476 Ga0501034_0219005
1477 Ga0501034_0324382
1478 Ga0501034_0332899
1479 Ga0501034_0354295
1480 Ga0501034_1214490
1481 Ga0501036_0003863
1482 Ga0501036_0289957
1483 Ga0501037_0000998
1484 Ga0501037_0001422
1485 Ga0501037_0050605
1486 Ga0501037_0160548
1487 Ga0501037_0215816
1488 Ga0501037_0514945
1489 Ga0501038_0000265
1490 Ga0501038_0211901
1491 Ga0501038_0245848
1492 Ga0501038_0460261
1493 Ga0501039_0000814
1494 Ga0501039_0049467
1495 Ga0501039_0437871
1496 Ga0501039_0600589
1497 Ga0501040_0028795
1498 Ga0501041_0194826
1499 Ga0501043_0001438
1500 Ga0501043_0035007
1501 Ga0501043_0048230
1502 Ga0501043_0171199
1503 Ga0501046_0001551
1504 Ga0501046_0014149
1505 Ga0501046_0023204
1506 Ga0501046_0127364
1507 Ga0501046_0197467
1508 Ga0501047_0000855
1509 Ga0501047_0032467
1510 Ga0501047_0095036
1511 Ga0501047_0413796
1512 Ga0501047_0732246
1513 Ga0501048_0000857
1514 Ga0501048_0016304
1515 Ga0501048_0022961
1516 Ga0501048_0458772
1517 Ga0501048_0660944
1518 Ga0501067_0007970
1519 Ga0501067_0099814
1520 Ga0501067_0216235
1521 Ga0501068_0042645
1522 Ga0501068_0051682
1523 Ga0501068_0096970
1524 Ga0501069_0000702
1525 Ga0501069_0027937
1526 Ga0501069_0032649
1527 Ga0501070_0000874
1528 Ga0501070_0001773
1529 Ga0501070_0015639
1530 Ga0501070_0016910
1531 Ga0501070_0018992
1532 Ga0501070_0122178
1533 Ga0501070_0398067
1534 Ga0501071_0000119
1535 Ga0501072_0100863
1536 Ga0501073_0000030
1537 Ga0501073_0002543
1538 Ga0501073_0083492
1539 Ga0501073_0137037
1540 Ga0501073_0162413
1541 Ga0501074_0000257
1542 Ga0501074_0391445
1543 Ga0501075_0390994
1544 Ga0501076_0155730
1545 Ga0501080_0000208
1546 Ga0501080_0002067
1547 Ga0501080_0147468
1548 Ga0501083_0000801
1549 Ga0501083_0038919
1550 Ga0501083_0112793
1551 Ga0501035_0001522
1552 Ga0501035_0013885
1553 Ga0501035_0028774
1554 Ga0501035_0114379
1555 Ga0501035_0174316
1556 Ga0501035_0216432
1557 Ga0501044_0001222
1558 Ga0501044_0001531
1559 Ga0501044_0002854
1560 Ga0501044_0021477
1561 Ga0501044_0066267
1562 Ga0501044_0068387
1563 Ga0501044_0212892
1564 Ga0501045_0012578
1565 nmdc:mga03683_129785_c1
1566 nmdc:mga03n38_32256_c1
1567 nmdc:mga00v17_22122_c1
1568 nmdc:mga00v17_85414_c1
1569 nmdc:mga00v17_958_c1
1570 nmdc:mga0yw44_150507_c1
1571 nmdc:mga0yw44_18094_c1
1572 nmdc:mga0yw44_37084_c2
1573 nmdc:mga0yw44_479862_c1
1574 nmdc:mga0yw44_82709_c1
1575 nmdc:mga0yw44_92830_c1
1576 nmdc:mga06z11_105066_c1
1577 nmdc:mga06z11_14649_c1
1578 nmdc:mga04h51_6102_c1
1579 nmdc:mga07m45_8187_c1
1580 nmdc:mga08y16_356382_c1
1581 nmdc:mga08y16_39303_c1
1582 nmdc:mga0sz30_14040_c1
1583 Ga0495601_0452352
1584 Ga0500635_0000108
1585 Ga0500635_0149496
1586 Ga0495619_0362900
1587 Ga0500643_001952
1588 Ga0500651_0004271
1589 Ga0500651_0103083
1590 Ga0500556_0000020
1591 Ga0500556_0000151
1592 Ga0500562_027074
1593 Ga0500593_000975
1594 Ga0500652_086635
1595 Ga0500559_0000050
1596 Ga0500559_0000164
1597 Ga0500559_0103196
1598 Ga0500568_0000029
1599 Ga0500568_0000038
1600 Ga0500568_0000117
1601 Ga0500568_0002756
1602 Ga0500568_0010878
1603 Ga0500568_0086837
1604 Ga0500573_0000070
1605 Ga0500573_0011156
1606 Ga0500573_0025500
1607 Ga0500573_0074233
1608 Ga0500573_0155954
1609 Ga0500577_0028573
1610 Ga0500577_0191262
1611 Ga0500588_0061596
1612 Ga0500590_049090
1613 Ga0500616_0000027
1614 Ga0500616_0000117
1615 Ga0500616_0261757
1616 Ga0500645_021457
1617 Ga0501084_0000487
1618 Ga0501084_0060093
1619 Ga0587084_016213
1620 Ga0587086_005069
1621 Ga0587086_005675
1622 Ga0587088_009820
1623 Ga0587090_007734
1624 Ga0587090_008186
1625 Ga0587092_011530
1626 Ga0587106_028551
1627 Ga0587129_000824
1628 Ga0587099_000526
1629 Ga0587113_004834
1630 Ga0587117_007597
1631 Ga0587128_004713
1632 Ga0587128_015284
1633 Ga0587062_006064
1634 Ga0587067_023162
1635 Ga0587068_024042
1636 Ga0587069_003532
1637 Ga0587072_067019
1638 Ga0587075_005375
1639 Ga0587075_015418
1640 Ga0587076_036316
1641 Ga0587105_002249
1642 Ga0587114_001341
1643 Ga0587114_006650
1644 Ga0587096_00235
1645 Ga0587071_010694
1646 Ga0587071_014086
1647 Ga0587071_029649
1648 Ga0587111_0008255
1649 Ga0587111_0013567
1650 Ga0501082_0165960
1651 Ga0501082_0378087
1652 Ga0501082_0538034
1653 Ga0466962_0015867
1654 Ga0466962_0057650
1655 Ga0466962_0145126
1656 Ga0530510_0561568
1657 2555228831
1658 2643876453
1659 2644096402
1660 2644112000
1661 2644182391
1662 2644383508
1663 2644455931
1664 2644538523
1665 2645720827
1666 2645723836
1667 2655033297
1668 2774396389
1669 2809198045
1670 2812353264
1671 2844843375
1672 2844849808
1673 2844854311
1674 2852644343
1675 2857730667
1676 2857734547
1677 2857738244
1678 2884766402
1679 2891969108
1680 2895660628
1681 2897564322
1682 2919055353
1683 2919525429
1684 2928121473
1685 2928153512
1686 2939662724
1687 2966922544
1688 2984592307
1689 2990092163
1690 8002811561
1691 8033689347
1692 8046353821
1693 8055035300
1694 8056039392

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

85

195

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9445 9 194
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9363 10 194
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.934 9 194
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9333 9 194
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.9313 9 194
ID Description Score Start End Superfamily
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9756 40 100 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9665 40 103 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9602 40 100 3.30.160.810
af_Q54I61_95_160_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9472 39 101 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9443 40 103 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A087B7P6-F1-model_v4 deleted 0.9912 7 108
AF-A0A564VPD5-F1-model_v4 deleted 0.9907 6 122
AF-A0A564VPD5-F1-model_v4 deleted 0.9741 6 122
AF-A0A074TMK2-F1-model_v4 deleted 0.9688 19 104
AF-A0A0F9AEA2-F1-model_v4 50S ribosomal protein L3 0.9598 11 112 GO:0003735
GO:0006412
GO:0022625

Map