F483352

General Info

Members Datasets Scaffolds Average Seq Length
848 426 1694 256

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10015987|rootH1_100159872
Length 307
Sequence VSASRSSAPDDLCRTRSGDNKVFSKTPVRSPRTGVLLGGGPHRRFAPRVLAKRIIPCLDVTDGRVVKGVNFVDLIDAGDPVEAAMAYNAQQADELVFLDITASSDNRDTMVDVVRRTAEHCFIPLTVGGGIRSVENMHEMLMAGADKVGVNTSAVNNPGLVDAGAKAFGSQCIVVAIDAKREGPGKWGVYTHGGRTPVGIDAVEWAKEVWRRGAGEILLTSMDADGTQAGYDLALTAAVSEAVGIPVIASGGAGNLDHMVEVLERGKADAVLAASIFHFGKHTVGEAKRHFAERGIPVRPPFGAASA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
224 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
230 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
231 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
290 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
337 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
338 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
339 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
340 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
349 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
358 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
371 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
372 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
373 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
377 2597490337 Halobacterium salinarum DSM 3754 Isolate Nodule
378 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
379 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
380 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
381 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
382 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
383 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
384 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
385 2738541337 Pelomonas sp. BT06 Isolate Unclassified
386 2738543024 Aminobacter sp. AP02 Isolate Unclassified
387 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
388 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
389 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
390 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
391 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
392 2818991436 Collimonas arenae 515 Isolate Unclassified
393 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
394 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
395 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
396 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
397 2842711865 Duganella sp. R-73148 Isolate Unclassified
398 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
399 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
400 2857553236 Duganella sp. R-74557 Isolate Unclassified
401 2857558681 Duganella sp. R-74565 Isolate Unclassified
402 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
403 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
404 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
405 2885266251 Ralstonia sp. SET104 Isolate Nodule
406 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
407 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
408 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
409 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
410 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
411 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
412 2904424332 Duganella sp. 1411 Isolate Rhizosphere
413 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
414 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
415 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
416 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
417 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
418 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
419 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
420 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
421 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
422 641522639 Methylobacterium sp. 4-46 Isolate Nodule
423 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
424 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
425 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
426 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0.35
Isolates 5.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.45
Nodule 0.71
Rhizoplane 1.53
Rhizosphere 73.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10015987 3300003323 Bacteria 2887
2 JGI25156J39149_1001747 3300002705 Bacteria 8685
3 JGI25162J39368_1000040 3300002737 Bacteria 175938
4 JGI25154J39366_1000782 3300002738 Bacteria 14066
5 JGI25154J39366_1000843 3300002738 Bacteria 13310
6 JGI25158J39367_1001690 3300002739 Bacteria 3788
7 JGI25163J39215_1003955 3300002771 Bacteria 1102
8 JGI25164J39214_1006860 3300002772 Bacteria 1176
9 JGI25150J39212_1001343 3300002774 Bacteria 6997
10 JGI25159J45721_1001570 3300002987 Bacteria 9357
11 JGI25159J45721_1015311 3300002987 Bacteria 1688
12 JGI25165J46597_1000051 3300003214 Bacteria 241012
13 JGI25153J46596_10008965 3300003215 Bacteria 4714
14 rootH2_10050624 3300003320 Bacteria 7561
15 rootH1_10197647 3300003323 Bacteria 1997
16 JGI25161J50226_1005224 3300003374 Bacteria 2562
17 Ga0006562J51391_1024424 3300003578 Bacteria 3783
18 Ga0055538_1000025 3300003751 Bacteria 241012
19 Ga0055539_1000032 3300003752 Bacteria 241012
20 Ga0055533_1000042 3300003756 Bacteria 241012
21 Ga0055533_1005999 3300003756 Bacteria 1863
22 Ga0055525_1000050 3300003759 Bacteria 241012
23 Ga0055542_1001269 3300003762 Bacteria 13689
24 Ga0055526_1000007 3300003771 Bacteria 321998
25 Ga0055526_1008377 3300003771 Bacteria 5173
26 Ga0055537_1000236 3300003773 Bacteria 40412
27 Ga0055537_1000441 3300003773 Bacteria 26555
28 Ga0055537_1006072 3300003773 Bacteria 3129
29 Ga0055524_1000245 3300003775 Bacteria 56692
30 Ga0055524_1000545 3300003775 Bacteria 28475
31 Ga0055534_1000243 3300003784 Bacteria 38818
32 Ga0055534_1004167 3300003784 Bacteria 4276
33 Ga0055528_1000136 3300003790 Bacteria 58873
34 Ga0055530_10000064 3300003791 Bacteria 94475
35 Ga0055530_10012116 3300003791 Bacteria 3033
36 Ga0055531_10000073 3300003794 Bacteria 109510
37 Ga0055531_10000105 3300003794 Bacteria 91871
38 Ga0055531_10002452 3300003794 Bacteria 12393
39 Ga0055541_1000023 3300003841 Bacteria 241012
40 Ga0055541_1000458 3300003841 Bacteria 11711
41 Ga0055543_1002680 3300004625 Bacteria 5711
42 Ga0065165_1000034 3300005262 Bacteria 214644
43 Ga0065165_1000315 3300005262 Bacteria 78877
44 Ga0065704_10000192 3300005289 Bacteria 216848
45 Ga0070658_10000068 3300005327 Bacteria 102788
46 Ga0070658_10006402 3300005327 Bacteria 9543
47 Ga0070658_10008492 3300005327 Bacteria 8257
48 Ga0070658_10084478 3300005327 Bacteria 2610
49 Ga0070676_10041200 3300005328 Bacteria 2677
50 Ga0070683_100008384 3300005329 Bacteria 8777
51 Ga0070683_100016095 3300005329 Bacteria 6583
52 Ga0070683_100045733 3300005329 Bacteria 4041
53 Ga0068869_100249819 3300005334 Bacteria 1416
54 Ga0070680_100001683 3300005336 Bacteria 16198
55 Ga0070680_100348943 3300005336 Bacteria 1258
56 Ga0070682_100046152 3300005337 Bacteria 2703
57 Ga0070682_100188032 3300005337 Bacteria 1448
58 Ga0068868_100004786 3300005338 Bacteria 9503
59 Ga0068868_100052559 3300005338 Bacteria 3208
60 Ga0068868_100170283 3300005338 Bacteria 1803
61 Ga0070660_100002033 3300005339 Bacteria 13954
62 Ga0070660_100023602 3300005339 Bacteria 4557
63 Ga0070661_100001882 3300005344 Bacteria 14532
64 Ga0070661_100080210 3300005344 Bacteria 2409
65 Ga0070661_100239180 3300005344 Bacteria 1397
66 Ga0070668_100476870 3300005347 Bacteria 1077
67 Ga0070675_100247866 3300005354 Bacteria 1558
68 Ga0070675_100267311 3300005354 Bacteria 1500
69 Ga0070674_100026376 3300005356 Bacteria 3794
70 Ga0070673_100017507 3300005364 Bacteria 5099
71 Ga0070659_100022966 3300005366 Bacteria 4768
72 Ga0070659_100073804 3300005366 Bacteria 2716
73 Ga0070659_100091312 3300005366 Bacteria 2441
74 Ga0070667_100397399 3300005367 Bacteria 1254
75 Ga0070708_100055295 3300005445 Bacteria 3529
76 Ga0070663_100052302 3300005455 Bacteria 2913
77 Ga0070663_100128730 3300005455 Bacteria 1920
78 Ga0070663_100435395 3300005455 Bacteria 1078
79 Ga0070662_100001446 3300005457 Bacteria 14637
80 Ga0070681_10039109 3300005458 Bacteria 4755
81 Ga0068867_100001603 3300005459 Bacteria 15717
82 Ga0068867_100035645 3300005459 Bacteria 3610
83 Ga0068867_100044568 3300005459 Bacteria 3250
84 Ga0068867_100128203 3300005459 Bacteria 1969
85 Ga0070706_100006247 3300005467 Bacteria 11266
86 Ga0070706_100020056 3300005467 Bacteria 6160
87 Ga0070707_100196034 3300005468 Bacteria 1969
88 Ga0070679_100005037 3300005530 Bacteria 12195
89 Ga0070679_100012797 3300005530 Bacteria 8027
90 Ga0070679_100425456 3300005530 Bacteria 1273
91 Ga0070684_100063774 3300005535 Bacteria 3231
92 Ga0070697_100012905 3300005536 Bacteria 6546
93 Ga0068853_100002549 3300005539 Bacteria 13684
94 Ga0068853_100034960 3300005539 Bacteria 4267
95 Ga0068853_100046741 3300005539 Bacteria 3712
96 Ga0070672_100045238 3300005543 Bacteria 3403
97 Ga0070665_100166441 3300005548 Bacteria 2207
98 Ga0068855_100005593 3300005563 Bacteria 15339
99 Ga0068855_100085917 3300005563 Bacteria 3639
100 Ga0068855_100214884 3300005563 Bacteria 2159
101 Ga0068855_100537922 3300005563 Bacteria 1266
102 Ga0070664_100006182 3300005564 Bacteria 9677
103 Ga0068857_100013486 3300005577 Bacteria 7119
104 Ga0068854_100001347 3300005578 Bacteria 14808
105 Ga0068854_100120124 3300005578 Bacteria 1994
106 Ga0068856_100007858 3300005614 Bacteria 10417
107 Ga0068856_100053971 3300005614 Bacteria 3963
108 Ga0068856_100055400 3300005614 Bacteria 3913
109 Ga0068856_100081610 3300005614 Bacteria 3208
110 Ga0068856_100117890 3300005614 Bacteria 2656
111 Ga0068856_100402400 3300005614 Bacteria 1389
112 Ga0068856_100591675 3300005614 Bacteria 1131
113 Ga0068852_100000358 3300005616 Bacteria 30765
114 Ga0068852_100007231 3300005616 Bacteria 8098
115 Ga0068852_100008312 3300005616 Bacteria 7638
116 Ga0068852_100028614 3300005616 Bacteria 4565
117 Ga0068852_100066376 3300005616 Bacteria 3150
118 Ga0068852_100084982 3300005616 Bacteria 2818
119 Ga0068852_100442071 3300005616 Bacteria 1286
120 Ga0068864_100297587 3300005618 Bacteria 1510
121 Ga0068851_10027534 3300005834 Bacteria 2802
122 Ga0068851_10251267 3300005834 Bacteria 1003
123 Ga0068863_100164712 3300005841 Bacteria 2125
124 Ga0068858_100465005 3300005842 Bacteria 1220
125 Ga0070717_10061096 3300006028 Bacteria 3122
126 Ga0070717_10361059 3300006028 Bacteria 1300
127 Ga0075368_10030451 3300006042 Bacteria 2090
128 Ga0075364_10022381 3300006051 Bacteria 3991
129 Ga0075367_10001026 3300006178 Bacteria 11507
130 Ga0097621_100004772 3300006237 Bacteria 9486
131 Ga0075370_10010786 3300006353 Bacteria 4790
132 Ga0075370_10206492 3300006353 Bacteria 1159
133 Ga0068871_100017444 3300006358 Bacteria 5434
134 Ga0075431_100110493 3300006847 Bacteria 2837
135 Ga0068865_100033018 3300006881 Bacteria 3463
136 Ga0075436_100292479 3300006914 Bacteria 1166
137 Ga0105240_10002141 3300009093 Bacteria 32242
138 Ga0105240_10269716 3300009093 Bacteria 1960
139 Ga0105240_10291143 3300009093 Bacteria 1872
140 Ga0105243_10000049 3300009148 Bacteria 145575
141 Ga0105241_10257161 3300009174 Bacteria 1483
142 Ga0105242_10626447 3300009176 Bacteria 1043
143 Ga0105238_10060084 3300009551 Bacteria 3807
144 Ga0105238_10378928 3300009551 Bacteria 1406
145 Ga0105239_10276065 3300010375 Bacteria 1891
146 Ga0105239_10656184 3300010375 Bacteria 1198
147 Ga0157373_10009556 3300013100 Bacteria 7158
148 Ga0157373_10043541 3300013100 Bacteria 3207
149 Ga0157373_10201976 3300013100 Bacteria 1401
150 Ga0157373_10417777 3300013100 Bacteria 963
151 Ga0157371_10003962 3300013102 Bacteria 13135
152 Ga0157371_10006514 3300013102 Bacteria 9609
153 Ga0157371_10007842 3300013102 Bacteria 8570
154 Ga0157371_10044125 3300013102 Bacteria 3175
155 Ga0157371_10088842 3300013102 Bacteria 2188
156 Ga0157370_10004189 3300013104 Bacteria 16690
157 Ga0157370_10005551 3300013104 Bacteria 14141
158 Ga0157370_10020929 3300013104 Bacteria 6524
159 Ga0157370_10072428 3300013104 Bacteria 3251
160 Ga0157370_10090519 3300013104 Bacteria 2873
161 Ga0157369_10001072 3300013105 Bacteria 34302
162 Ga0157369_10002003 3300013105 Bacteria 24533
163 Ga0157369_10015476 3300013105 Bacteria 8595
164 Ga0157369_10043085 3300013105 Bacteria 4921
165 Ga0157369_10492411 3300013105 Bacteria 1268
166 Ga0171462_1013 3300013250 Bacteria 202864
167 Ga0157378_10026218 3300013297 Bacteria 5138
168 Ga0157378_10210823 3300013297 Bacteria 1842
169 Ga0157372_10004382 3300013307 Bacteria 15061
170 Ga0157372_10081127 3300013307 Bacteria 3671
171 Ga0157372_10124827 3300013307 Bacteria 2959
172 Ga0163163_10248684 3300014325 Bacteria 1828
173 Ga0157377_10067421 3300014745 Bacteria 2060
174 Ga0157376_10216357 3300014969 Bacteria 1772
175 Ga0182006_1000023 3300015261 Bacteria 275031
176 Ga0182007_10000082 3300015262 Bacteria 71660
177 Ga0182007_10000738 3300015262 Bacteria 18494
178 Ga0182005_1000047 3300015265 Bacteria 126754
179 Ga0182005_1000405 3300015265 Bacteria 23552
180 Ga0163161_10001177 3300017792 Bacteria 19637
181 Ga0213872_10000024 3300021361 Bacteria 155437
182 Ga0213872_10010012 3300021361 Bacteria 4524
183 Ga0209436_102173 3300025208 Bacteria 6125
184 Ga0209784_100010 3300025224 Bacteria 683664
185 Ga0209566_100008 3300025225 Bacteria 683664
186 Ga0209566_100235 3300025225 Bacteria 53611
187 Ga0209674_100019 3300025226 Bacteria 683664
188 Ga0209674_100189 3300025226 Bacteria 66805
189 Ga0209563_100021 3300025230 Bacteria 683764
190 Ga0209563_107681 3300025230 Bacteria 1753
191 Ga0207427_100432 3300025231 Bacteria 23437
192 Ga0209437_100019 3300025233 Bacteria 683764
193 Ga0207425_1000036 3300025245 Bacteria 225783
194 Ga0207425_1007318 3300025245 Bacteria 2924
195 Ga0209646_1000119 3300025246 Bacteria 147427
196 Ga0209646_1000125 3300025246 Bacteria 135847
197 Ga0209677_100011 3300025253 Bacteria 683664
198 Ga0209677_103667 3300025253 Bacteria 4831
199 Ga0209148_1000451 3300025254 Bacteria 45012
200 Ga0209759_1001696 3300025256 Bacteria 11450
201 Ga0209233_1000025 3300025261 Bacteria 683764
202 Ga0209565_1000007 3300025263 Bacteria 784361
203 Ga0209565_1000082 3300025263 Bacteria 154452
204 Ga0209565_1001293 3300025263 Bacteria 11598
205 Ga0209565_1002903 3300025263 Bacteria 5858
206 Ga0209673_1000381 3300025273 Bacteria 80068
207 Ga0209673_1001016 3300025273 Bacteria 33837
208 Ga0209673_1018228 3300025273 Bacteria 2561
209 Ga0209130_1000016 3300025284 Bacteria 395540
210 Ga0209130_1000045 3300025284 Bacteria 240278
211 Ga0209130_1003201 3300025284 Bacteria 7226
212 Ga0209130_1033060 3300025284 Bacteria 1050
213 Ga0209675_1000166 3300025291 Bacteria 80138
214 Ga0209675_1002921 3300025291 Bacteria 8455
215 Ga0209025_1000932 3300025294 Bacteria 44615
216 Ga0209564_1000010 3300025295 Bacteria 885399
217 Ga0209564_1000710 3300025295 Bacteria 48541
218 Ga0209564_1006015 3300025295 Bacteria 6699
219 Ga0209564_1007914 3300025295 Bacteria 5364
220 Ga0209758_1007609 3300025297 Bacteria 7308
221 Ga0209050_1000010 3300025298 Bacteria 980454
222 Ga0209050_1000086 3300025298 Bacteria 262009
223 Ga0209050_1000549 3300025298 Bacteria 62089
224 Ga0209050_1003427 3300025298 Bacteria 11705
225 Ga0209050_1016110 3300025298 Bacteria 3081
226 Ga0209050_1022518 3300025298 Bacteria 2254
227 Ga0209256_1000008 3300025299 Bacteria 975723
228 Ga0209256_1000380 3300025299 Bacteria 70995
229 Ga0209256_1001189 3300025299 Bacteria 29208
230 Ga0209256_1007190 3300025299 Bacteria 5585
231 Ga0207426_1004949 3300025302 Bacteria 6281
232 Ga0207426_1027608 3300025302 Bacteria 1890
233 Ga0209051_1005335 3300025303 Bacteria 7558
234 Ga0209051_1060749 3300025303 Bacteria 1191
235 Ga0209257_1000027 3300025304 Bacteria 703541
236 Ga0209257_1000047 3300025304 Bacteria 460507
237 Ga0209257_1000087 3300025304 Bacteria 282503
238 Ga0209257_1000758 3300025304 Bacteria 48724
239 Ga0209257_1004536 3300025304 Bacteria 10641
240 Ga0209257_1017996 3300025304 Bacteria 2746
241 Ga0209257_1065859 3300025304 Bacteria 971
242 Ga0207647_10006567 3300025904 Bacteria 8449
243 Ga0207705_10000124 3300025909 Bacteria 85292
244 Ga0207705_10002001 3300025909 Bacteria 15842
245 Ga0207705_10003314 3300025909 Bacteria 12245
246 Ga0207705_10009518 3300025909 Bacteria 7071
247 Ga0207705_10036010 3300025909 Bacteria 3543
248 Ga0207705_10049500 3300025909 Bacteria 3024
249 Ga0207705_10136230 3300025909 Bacteria 1831
250 Ga0207684_10003787 3300025910 Bacteria 14597
251 Ga0207684_10005345 3300025910 Bacteria 11869
252 Ga0207707_10006462 3300025912 Bacteria 10235
253 Ga0207707_10233962 3300025912 Bacteria 1598
254 Ga0207695_10001916 3300025913 Bacteria 32377
255 Ga0207695_10419923 3300025913 Bacteria 1222
256 Ga0207671_10065042 3300025914 Bacteria 2712
257 Ga0207660_10003417 3300025917 Bacteria 10358
258 Ga0207660_10280589 3300025917 Bacteria 1322
259 Ga0207657_10001711 3300025919 Bacteria 23648
260 Ga0207657_10005837 3300025919 Bacteria 12826
261 Ga0207657_10006696 3300025919 Bacteria 11910
262 Ga0207657_10022472 3300025919 Bacteria 5898
263 Ga0207649_10007919 3300025920 Bacteria 5783
264 Ga0207649_10019063 3300025920 Bacteria 3917
265 Ga0207649_10070711 3300025920 Bacteria 2227
266 Ga0207649_10300559 3300025920 Bacteria 1173
267 Ga0207649_10365423 3300025920 Bacteria 1072
268 Ga0207652_10003472 3300025921 Bacteria 12998
269 Ga0207652_10051424 3300025921 Bacteria 3532
270 Ga0207652_10072632 3300025921 Bacteria 2992
271 Ga0207652_10327225 3300025921 Bacteria 1384
272 Ga0207652_10382602 3300025921 Bacteria 1270
273 Ga0207646_10007230 3300025922 Bacteria 11322
274 Ga0207646_10182204 3300025922 Bacteria 1897
275 Ga0207646_10674083 3300025922 Bacteria 926
276 Ga0207659_10058296 3300025926 Bacteria 2772
277 Ga0207690_10000640 3300025932 Bacteria 22410
278 Ga0207690_10061721 3300025932 Bacteria 2549
279 Ga0207706_10003725 3300025933 Bacteria 14537
280 Ga0207709_10000097 3300025935 Bacteria 136507
281 Ga0207669_10023854 3300025937 Bacteria 3276
282 Ga0207704_10002333 3300025938 Bacteria 8526
283 Ga0207665_10227252 3300025939 Bacteria 1370
284 Ga0207691_10072003 3300025940 Bacteria 3118
285 Ga0207689_10000210 3300025942 Bacteria 51572
286 Ga0207689_10174808 3300025942 Bacteria 1771
287 Ga0207661_10015660 3300025944 Bacteria 5587
288 Ga0207661_10169442 3300025944 Bacteria 1900
289 Ga0207679_10000726 3300025945 Bacteria 21877
290 Ga0207667_10003114 3300025949 Bacteria 20524
291 Ga0207667_10018162 3300025949 Bacteria 7896
292 Ga0207667_10041610 3300025949 Bacteria 4886
293 Ga0207667_10063401 3300025949 Bacteria 3862
294 Ga0207667_10139637 3300025949 Bacteria 2495
295 Ga0207667_10861802 3300025949 Bacteria 900
296 Ga0207640_10000964 3300025981 Bacteria 15982
297 Ga0207640_10048289 3300025981 Bacteria 2750
298 Ga0207640_10414767 3300025981 Bacteria 1100
299 Ga0207658_10300956 3300025986 Bacteria 1382
300 Ga0207677_10002753 3300026023 Bacteria 9281
301 Ga0207677_10042952 3300026023 Bacteria 3002
302 Ga0207677_10075484 3300026023 Bacteria 2396
303 Ga0207677_10166499 3300026023 Bacteria 1718
304 Ga0207703_10158910 3300026035 Bacteria 1978
305 Ga0207639_10003417 3300026041 Bacteria 10681
306 Ga0207639_10036461 3300026041 Bacteria 3644
307 Ga0207639_10062357 3300026041 Bacteria 2883
308 Ga0207639_10063862 3300026041 Bacteria 2852
309 Ga0207639_10096969 3300026041 Bacteria 2373
310 Ga0207639_10216388 3300026041 Bacteria 1652
311 Ga0207639_10244202 3300026041 Bacteria 1563
312 Ga0207678_10315756 3300026067 Bacteria 1344
313 Ga0207702_10000625 3300026078 Bacteria 38874
314 Ga0207702_10061656 3300026078 Bacteria 3200
315 Ga0207702_10064378 3300026078 Bacteria 3137
316 Ga0207702_10093783 3300026078 Bacteria 2633
317 Ga0207702_10172263 3300026078 Bacteria 1986
318 Ga0207641_10393577 3300026088 Bacteria 1329
319 Ga0207648_10003807 3300026089 Bacteria 15768
320 Ga0207648_10020786 3300026089 Bacteria 5909
321 Ga0207648_10033839 3300026089 Bacteria 4506
322 Ga0207648_10050196 3300026089 Bacteria 3649
323 Ga0207676_10401277 3300026095 Bacteria 1281
324 Ga0207683_10053454 3300026121 Bacteria 3542
325 Ga0207698_10000067 3300026142 Bacteria 70181
326 Ga0207698_10001225 3300026142 Bacteria 14990
327 Ga0207698_10140862 3300026142 Bacteria 2078
328 Ga0207698_10564615 3300026142 Bacteria 1117
329 Ga0209813_10000036 3300027866 Bacteria 58545
330 Ga0207428_10214951 3300027907 Bacteria 1443
331 Ga0268266_10080979 3300028379 Bacteria 2830
332 Ga0265337_1027544 3300028556 Bacteria 1712
333 Ga0265319_1021900 3300028563 Bacteria 2339
334 Ga0265318_10029226 3300028577 Bacteria 2150
335 Ga0265318_10105275 3300028577 Bacteria 1037
336 Ga0265336_10040714 3300028666 Bacteria 1422
337 Ga0307517_10031004 3300028786 Bacteria 6243
338 Ga0307515_10022699 3300028794 Bacteria 11044
339 Ga0316177_1204721 3300030731 Bacteria 2356
340 Ga0265330_10000003 3300031235 Archaea 392850
341 Ga0265328_10000007 3300031239 Bacteria 224310
342 Ga0265320_10001237 3300031240 Bacteria 18762
343 Ga0265320_10027218 3300031240 Bacteria 2984
344 Ga0265325_10025806 3300031241 Bacteria 3188
345 Ga0265340_10023903 3300031247 Archaea 3110
346 Ga0265339_10056511 3300031249 Archaea 2125
347 Ga0265331_10010335 3300031250 Bacteria 5171
348 Ga0265331_10020675 3300031250 Bacteria 3376
349 Ga0265331_10105838 3300031250 Bacteria 1292
350 Ga0265327_10007906 3300031251 Bacteria 8060
351 Ga0265327_10011866 3300031251 Bacteria 5953
352 Ga0265316_10002008 3300031344 Archaea 21445
353 Ga0307513_10051934 3300031456 Bacteria 4417
354 Ga0307408_100000017 3300031548 Bacteria 355890
355 Ga0307408_100000021 3300031548 Bacteria 312158
356 Ga0307408_100000029 3300031548 Bacteria 227806
357 Ga0307408_100036159 3300031548 Bacteria 3471
358 Ga0307408_100045674 3300031548 Bacteria 3129
359 Ga0307408_100537397 3300031548 Bacteria 1029
360 Ga0265313_10005994 3300031595 Bacteria 8783
361 Ga0265313_10137433 3300031595 Bacteria 1054
362 Ga0316579_10031269 3300031691 Bacteria 2436
363 Ga0316579_10033419 3300031691 Bacteria 2362
364 Ga0265314_10023239 3300031711 Bacteria 4732
365 Ga0265314_10119946 3300031711 Bacteria 1657
366 Ga0265314_10199968 3300031711 Bacteria 1182
367 Ga0265342_10000068 3300031712 Archaea 110846
368 Ga0265342_10021823 3300031712 Archaea 4081
369 Ga0265342_10031893 3300031712 Archaea 3253
370 Ga0316576_10017373 3300031727 Bacteria 4885
371 Ga0316576_10017770 3300031727 Bacteria 4841
372 Ga0316578_10041569 3300031728 Bacteria 2663
373 Ga0316578_10328640 3300031728 Bacteria 912
374 Ga0307405_10004498 3300031731 Bacteria 6598
375 Ga0307405_10093752 3300031731 Bacteria 1995
376 Ga0316577_10000005 3300031733 Bacteria 43786
377 Ga0316577_10006115 3300031733 Bacteria 6343
378 Ga0316577_10092258 3300031733 Bacteria 1695
379 Ga0307413_10004455 3300031824 Bacteria 6099
380 Ga0307413_10112104 3300031824 Bacteria 1828
381 Ga0307413_10178798 3300031824 Bacteria 1510
382 Ga0307413_10180480 3300031824 Bacteria 1504
383 Ga0307410_10000060 3300031852 Bacteria 38643
384 Ga0307410_10107476 3300031852 Bacteria 2012
385 Ga0307406_10044481 3300031901 Bacteria 2783
386 Ga0307406_10211374 3300031901 Bacteria 1435
387 Ga0307406_10455573 3300031901 Bacteria 1027
388 Ga0307407_10000127 3300031903 Bacteria 23831
389 Ga0307407_10020467 3300031903 Bacteria 3391
390 Ga0307407_10045110 3300031903 Bacteria 2489
391 Ga0307407_10189905 3300031903 Bacteria 1368
392 Ga0307412_10000037 3300031911 Bacteria 192170
393 Ga0307412_10002397 3300031911 Bacteria 10415
394 Ga0307412_10062330 3300031911 Bacteria 2510
395 Ga0307412_10102474 3300031911 Bacteria 2027
396 Ga0307412_10107832 3300031911 Bacteria 1983
397 Ga0307412_10176774 3300031911 Bacteria 1601
398 Ga0307412_10427220 3300031911 Bacteria 1085
399 Ga0307409_100000021 3300031995 Bacteria 54572
400 Ga0307409_100001401 3300031995 Bacteria 11788
401 Ga0307409_100013413 3300031995 Bacteria 5274
402 Ga0307416_100000256 3300032002 Bacteria 28439
403 Ga0307416_100003131 3300032002 Bacteria 9683
404 Ga0307416_100085761 3300032002 Bacteria 2681
405 Ga0307416_100091691 3300032002 Bacteria 2610
406 Ga0307414_10000015 3300032004 Bacteria 268602
407 Ga0307414_10022625 3300032004 Bacteria 3969
408 Ga0307414_10049920 3300032004 Bacteria 2895
409 Ga0307414_10096888 3300032004 Bacteria 2208
410 Ga0307414_10377810 3300032004 Bacteria 1224
411 Ga0307414_10434058 3300032004 Bacteria 1148
412 Ga0307414_10624735 3300032004 Bacteria 969
413 Ga0307411_10002554 3300032005 Bacteria 8117
414 Ga0307411_10052013 3300032005 Bacteria 2676
415 Ga0307411_10231558 3300032005 Bacteria 1440
416 Ga0307415_100062314 3300032126 Bacteria 2586
417 Ga0307415_100129490 3300032126 Bacteria 1907
418 Ga0307415_100167425 3300032126 Bacteria 1710
419 Ga0373950_0003923 3300034818 Bacteria 2159
420 Ga0373959_0043423 3300034820 Bacteria 950
421 Ga0373940_0004154 3300035088 Bacteria 3037
422 Ga0373932_0007834 3300035112 Bacteria 2550
423 Ga0373939_0000012 3300035114 Bacteria 67223
424 Ga0373941_0062088 3300035115 Bacteria 1219
425 Ga0373960_0002596 3300035121 Bacteria 4080
426 Ga0373960_0056083 3300035121 Bacteria 1182
427 Ga0373946_0144678 3300035171 Bacteria 1105
428 Ga0373962_0013769 3300035242 Bacteria 2053
429 Ga0373931_0001221 3300035691 Bacteria 10994
430 Ga0373931_0054807 3300035691 Bacteria 2132
431 Ga0373937_0221650 3300036401 Bacteria 1780
432 Ga0316582_0015261 3300036647 Bacteria 4387
433 Ga0316582_0035596 3300036647 Bacteria 3076
434 Ga0316582_0081835 3300036647 Bacteria 2110
435 Ga0316582_0150903 3300036647 Bacteria 1571
436 Ga0316584_0001705 3300036712 Bacteria 13469
437 Ga0316584_0024370 3300036712 Bacteria 4428
438 Ga0316584_0029083 3300036712 Bacteria 4079
439 Ga0316584_0065259 3300036712 Bacteria 2727
440 Ga0316584_0098934 3300036712 Bacteria 2184
441 Ga0316584_0302646 3300036712 Bacteria 1157
442 Ga0395899_0025590 3300037312 Bacteria 4454
443 Ga0395899_0178600 3300037312 Bacteria 1491
444 Ga0395900_0121609 3300037418 Bacteria 2678
445 Ga0395900_0132761 3300037418 Bacteria 2551
446 Ga0395900_0162442 3300037418 Bacteria 2278
447 Ga0395900_0384153 3300037418 Bacteria 1371
448 Ga0395900_0510083 3300037418 Bacteria 1152
449 Ga0395898_0212860 3300037466 Bacteria 1843
450 Ga0395905_0013332 3300037471 Bacteria 7879
451 Ga0395905_0055988 3300037471 Bacteria 3691
452 Ga0395905_0099738 3300037471 Bacteria 2727
453 Ga0316581_0009290 3300037588 Bacteria 2700
454 Ga0316581_0018105 3300037588 Bacteria 2042
455 Ga0395901_0030541 3300038443 Bacteria 5551
456 Ga0395901_0118720 3300038443 Bacteria 2779
457 Ga0400483_016212 3300039062 Bacteria 18792
458 Ga0400483_102702 3300039062 Bacteria 5345
459 Ga0400483_180833 3300039062 Bacteria 2136
460 Ga0400483_192590 3300039062 Bacteria 14783
461 Ga0436361_0224368 3300039447 Bacteria 99317
462 Ga0436362_1002824 3300039453 Bacteria 3171
463 Ga0439453_0003984 3300041408 Bacteria 2168
464 Ga0439465_0035505 3300041413 Bacteria 1598
465 Ga0451849_0296662 3300041505 Bacteria 1882
466 Ga0451843_0077392 3300041509 Bacteria 2502
467 Ga0451853_3488129 3300041512 Bacteria 1306
468 Ga0439431_0008649 3300041997 Bacteria 2290
469 Ga0439445_0049126 3300042004 Bacteria 1135
470 Ga0439462_0023322 3300042015 Bacteria 1622
471 Ga0450890_000001 3300042127 Bacteria 192635
472 Ga0450891_002701 3300042129 Bacteria 1763
473 Ga0450892_000061 3300042130 Bacteria 12112
474 Ga0439434_0111084 3300042435 Bacteria 888
475 Ga0450893_0028936 3300042532 Bacteria 981
476 Ga0451577_0002436 3300042876 Archaea 22189
477 Ga0451577_0019946 3300042876 Archaea 6158
478 Ga0451577_0260376 3300042876 Bacteria 1571
479 Ga0453683_0001847 3300044673 Bacteria 17391
480 Ga0453683_0018503 3300044673 Bacteria 4474
481 Ga0453683_0108033 3300044673 Bacteria 1749
482 Ga0466965_0008880 3300044683 Bacteria 4658
483 Ga0466961_0280837 3300044693 Bacteria 1019
484 Ga0453684_0000050 3300044712 Archaea 558429
485 Ga0453684_0000597 3300044712 Archaea 134014
486 Ga0453684_0005953 3300044712 Archaea 23645
487 Ga0453684_0006998 3300044712 Archaea 21094
488 Ga0453684_0011404 3300044712 Bacteria 14915
489 Ga0453684_0018796 3300044712 Archaea 10575
490 Ga0453684_0034822 3300044712 Archaea 6977
491 Ga0453684_0094771 3300044712 Archaea 3671
492 Ga0453684_0173046 3300044712 Archaea 2542
493 Ga0453684_0289883 3300044712 Bacteria 1864
494 Ga0453684_0383067 3300044712 Archaea 1579
495 Ga0453684_0572483 3300044712 Bacteria 1241
496 Ga0466960_0203862 3300044901 Bacteria 1082
497 Ga0466959_0040583 3300045049 Bacteria 3438
498 Ga0451576_0000586 3300045051 Bacteria 77149
499 Ga0451576_0007631 3300045051 Bacteria 12870
500 Ga0451576_0009304 3300045051 Archaea 11409
501 Ga0451576_0011237 3300045051 Bacteria 10199
502 Ga0451576_0184805 3300045051 Bacteria 2176
503 Ga0495627_000004 3300046453 Bacteria 640612
504 Ga0495592_0010239 3300046454 Bacteria 7069
505 Ga0495638_0028580 3300046460 Bacteria 3599
506 Ga0495638_0263448 3300046460 Bacteria 944
507 Ga0495651_0006882 3300046462 Bacteria 8689
508 Ga0495653_0002868 3300046463 Bacteria 13781
509 Ga0495650_0000128 3300046471 Bacteria 177256
510 Ga0495650_0002873 3300046471 Bacteria 13135
511 Ga0495605_0000018 3300046474 Bacteria 270187
512 Ga0495605_0001131 3300046474 Bacteria 17689
513 Ga0495584_0021167 3300046491 Bacteria 3302
514 Ga0495584_0081848 3300046491 Bacteria 1625
515 Ga0495607_0002432 3300046501 Bacteria 15195
516 Ga0495607_0007691 3300046501 Bacteria 7428
517 Ga0495583_0000115 3300046506 Bacteria 135762
518 Ga0495583_0001058 3300046506 Bacteria 30795
519 Ga0495583_0067571 3300046506 Bacteria 1578
520 Ga0495606_0000228 3300046507 Bacteria 99761
521 Ga0495606_0000288 3300046507 Bacteria 87389
522 Ga0495606_0000790 3300046507 Bacteria 48364
523 Ga0495606_0001799 3300046507 Bacteria 27290
524 Ga0495608_0007317 3300046511 Bacteria 7801
525 Ga0495608_0023636 3300046511 Bacteria 4210
526 Ga0495610_0018280 3300046512 Bacteria 3964
527 Ga0495610_0035550 3300046512 Bacteria 2556
528 Ga0495618_0080496 3300046514 Bacteria 2078
529 Ga0495628_0001227 3300046516 Bacteria 23459
530 Ga0495628_0002006 3300046516 Bacteria 18454
531 Ga0495637_0000142 3300046520 Bacteria 54212
532 Ga0495637_0000731 3300046520 Bacteria 22394
533 Ga0495643_0000082 3300046522 Bacteria 159651
534 Ga0495643_0207375 3300046522 Bacteria 937
535 Ga0495648_0000732 3300046524 Bacteria 35084
536 Ga0495648_0013009 3300046524 Bacteria 6177
537 Ga0495648_0088915 3300046524 Bacteria 1735
538 Ga0495648_0135341 3300046524 Bacteria 1304
539 Ga0495642_0039791 3300046528 Bacteria 1908
540 Ga0495652_0014687 3300046529 Bacteria 7022
541 Ga0495654_0000014 3300046530 Bacteria 312126
542 Ga0495609_0000434 3300046538 Bacteria 34673
543 Ga0495609_0000537 3300046538 Bacteria 30126
544 Ga0495609_0002203 3300046538 Bacteria 12207
545 Ga0495621_0005796 3300046539 Bacteria 3570
546 Ga0495597_0000321 3300046542 Bacteria 43353
547 Ga0495645_0028629 3300046543 Bacteria 4049
548 Ga0495645_0049548 3300046543 Bacteria 3058
549 Ga0495622_0000034 3300046557 Bacteria 123671
550 Ga0495622_0078600 3300046557 Bacteria 1519
551 Ga0495633_0000100 3300046558 Bacteria 116284
552 Ga0495633_0000217 3300046558 Bacteria 71892
553 Ga0495633_0012689 3300046558 Bacteria 4470
554 Ga0495633_0197310 3300046558 Bacteria 924
555 Ga0495656_0020157 3300046615 Bacteria 2583
556 Ga0495668_0000231 3300046616 Bacteria 79433
557 Ga0495668_0000308 3300046616 Bacteria 67599
558 Ga0495668_0054396 3300046616 Bacteria 2212
559 Ga0495625_0046579 3300046660 Bacteria 3128
560 Ga0495625_0205171 3300046660 Bacteria 1298
561 Ga0495659_0000272 3300046664 Bacteria 21144
562 Ga0495661_0005558 3300046665 Bacteria 8940
563 Ga0495661_0152463 3300046665 Bacteria 1247
564 Ga0495657_0145258 3300046675 Bacteria 1476
565 Ga0495646_0004004 3300046680 Bacteria 9228
566 Ga0495646_0069647 3300046680 Bacteria 2074
567 Ga0495669_0001487 3300046684 Bacteria 9657
568 Ga0495624_0077378 3300046690 Bacteria 2063
569 Ga0495671_0058521 3300046692 Bacteria 1906
570 Ga0495649_0046175 3300046694 Bacteria 2372
571 Ga0495649_0106751 3300046694 Bacteria 1486
572 Ga0495649_0111838 3300046694 Bacteria 1448
573 Ga0495649_0152287 3300046694 Bacteria 1214
574 Ga0495600_0001954 3300046809 Bacteria 11584
575 Ga0495660_0028809 3300046810 Bacteria 3135
576 Ga0495604_0044258 3300047317 Bacteria 3479
577 Ga0495604_0044839 3300047317 Bacteria 3453
578 Ga0495636_0002097 3300047318 Bacteria 7669
579 Ga0495636_0027842 3300047318 Bacteria 2302
580 Ga0495672_0000081 3300047320 Bacteria 159863
581 Ga0495672_0034660 3300047320 Bacteria 3116
582 Ga0495683_0014292 3300047323 Bacteria 4135
583 Ga0495687_000172 3300047443 Bacteria 95963
584 Ga0495687_000323 3300047443 Bacteria 62186
585 Ga0495687_000446 3300047443 Bacteria 50964
586 Ga0495687_000699 3300047443 Bacteria 37523
587 Ga0495677_0010342 3300047445 Bacteria 3427
588 Ga0495685_000034 3300047447 Bacteria 56654
589 Ga0495685_005609 3300047447 Bacteria 4100
590 Ga0495673_0000008 3300047469 Bacteria 752462
591 Ga0495673_0008115 3300047469 Bacteria 5943
592 Ga0495681_0013190 3300047470 Bacteria 4811
593 Ga0495681_0022454 3300047470 Bacteria 3375
594 Ga0495686_0000604 3300047472 Bacteria 49704
595 Ga0495686_0000677 3300047472 Bacteria 46044
596 Ga0495686_0006562 3300047472 Bacteria 8878
597 Ga0495686_0014303 3300047472 Bacteria 5466
598 Ga0495686_0037907 3300047472 Bacteria 3086
599 Ga0495686_0056991 3300047472 Bacteria 2439
600 Ga0495602_0128770 3300048088 Bacteria 2022
601 Ga0496101_0284360 3300048904 Bacteria 1293
602 Ga0496102_0031911 3300048905 Bacteria 4729
603 Ga0496102_0116510 3300048905 Bacteria 2493
604 Ga0496103_0001821 3300048906 Bacteria 13881
605 Ga0496104_0175888 3300048907 Bacteria 2051
606 Ga0496105_0022519 3300048908 Bacteria 5104
607 Ga0496108_0196008 3300048911 Bacteria 1752
608 Ga0496110_0348147 3300048913 Bacteria 1350
609 Ga0496112_0000200 3300048915 Bacteria 39289
610 Ga0496114_0002554 3300048917 Bacteria 13899
611 Ga0496114_0442897 3300048917 Bacteria 1150
612 Ga0496115_0010435 3300048918 Bacteria 6941
613 Ga0496116_0021069 3300048919 Bacteria 4927
614 Ga0496116_0059847 3300048919 Bacteria 2474
615 Ga0496116_0079691 3300048919 Bacteria 2036
616 Ga0496117_0000075 3300048920 Bacteria 232451
617 Ga0496117_0021543 3300048920 Bacteria 5209
618 Ga0496118_0000055 3300048921 Bacteria 232451
619 Ga0496119_0018246 3300048922 Bacteria 5237
620 Ga0496120_0059824 3300048923 Bacteria 2134
621 Ga0496120_0062601 3300048923 Bacteria 2072
622 Ga0496121_0028678 3300048924 Bacteria 5176
623 Ga0496121_0054149 3300048924 Bacteria 3355
624 Ga0496122_0003176 3300048925 Bacteria 21923
625 Ga0496122_0003599 3300048925 Bacteria 20191
626 Ga0496122_0049349 3300048925 Bacteria 3225
627 Ga0496122_0276732 3300048925 Bacteria 920
628 Ga0496123_0001626 3300048926 Bacteria 30247
629 Ga0496123_0053057 3300048926 Bacteria 2683
630 Ga0496123_0055289 3300048926 Bacteria 2605
631 Ga0496124_0002918 3300048927 Bacteria 21559
632 Ga0496124_0022595 3300048927 Bacteria 5760
633 Ga0496124_0032120 3300048927 Bacteria 4641
634 Ga0496124_0044471 3300048927 Bacteria 3810
635 Ga0496124_0049085 3300048927 Bacteria 3602
636 Ga0496124_0158652 3300048927 Bacteria 1766
637 Ga0496124_0163571 3300048927 Bacteria 1732
638 Ga0496124_0323381 3300048927 Bacteria 1103
639 Ga0496125_0002758 3300048928 Bacteria 22227
640 Ga0496125_0025532 3300048928 Bacteria 5408
641 Ga0496125_0120648 3300048928 Bacteria 1871
642 Ga0496125_0242657 3300048928 Bacteria 1142
643 Ga0496126_0005903 3300048929 Bacteria 13809
644 Ga0495678_000027 3300049459 Bacteria 222075
645 Ga0495678_000346 3300049459 Bacteria 48212
646 Ga0495678_000549 3300049459 Bacteria 36201
647 Ga0495682_0000999 3300049460 Bacteria 16865
648 Ga0501300_009813 3300049523 Bacteria 1396
649 Ga0501031_0000002 3300049568 Bacteria 217588
650 Ga0501031_0002629 3300049568 Bacteria 11429
651 Ga0501031_0036952 3300049568 Bacteria 3187
652 Ga0501031_0058606 3300049568 Bacteria 2509
653 Ga0501031_0123349 3300049568 Bacteria 1692
654 Ga0501032_0000004 3300049569 Bacteria 310855
655 Ga0501032_0000851 3300049569 Bacteria 24758
656 Ga0501032_0002674 3300049569 Bacteria 13907
657 Ga0501032_0005458 3300049569 Bacteria 9438
658 Ga0501032_0067334 3300049569 Bacteria 2392
659 Ga0501033_0000016 3300049570 Bacteria 217458
660 Ga0501033_0009280 3300049570 Bacteria 7579
661 Ga0501033_0014684 3300049570 Bacteria 5945
662 Ga0501033_0051714 3300049570 Bacteria 3045
663 Ga0501033_0099319 3300049570 Bacteria 2125
664 Ga0501033_0140160 3300049570 Bacteria 1748
665 Ga0501033_0197852 3300049570 Bacteria 1436
666 Ga0501034_0000011 3300049571 Bacteria 310855
667 Ga0501034_0009670 3300049571 Bacteria 10085
668 Ga0501034_0012065 3300049571 Bacteria 8933
669 Ga0501034_0027699 3300049571 Bacteria 5762
670 Ga0501034_0108886 3300049571 Bacteria 2762
671 Ga0501034_0171146 3300049571 Bacteria 2139
672 Ga0501034_0179352 3300049571 Bacteria 2083
673 Ga0501034_0551747 3300049571 Bacteria 1062
674 Ga0501036_0000001 3300049572 Bacteria 310855
675 Ga0501036_0004087 3300049572 Bacteria 11744
676 Ga0501036_0006219 3300049572 Bacteria 9684
677 Ga0501036_0121271 3300049572 Bacteria 2208
678 Ga0501037_0000006 3300049573 Bacteria 217461
679 Ga0501037_0005227 3300049573 Bacteria 9438
680 Ga0501038_0000003 3300049574 Bacteria 310855
681 Ga0501038_0002842 3300049574 Bacteria 16112
682 Ga0501038_0003593 3300049574 Bacteria 14430
683 Ga0501038_0004599 3300049574 Bacteria 12837
684 Ga0501038_0022177 3300049574 Bacteria 5691
685 Ga0501038_0047786 3300049574 Bacteria 3706
686 Ga0501038_0165298 3300049574 Bacteria 1795
687 Ga0501039_0000004 3300049575 Bacteria 310855
688 Ga0501039_0007003 3300049575 Bacteria 8585
689 Ga0501039_0007282 3300049575 Bacteria 8427
690 Ga0501039_0425002 3300049575 Bacteria 1044
691 Ga0501040_0006407 3300049576 Bacteria 7644
692 Ga0501042_0002271 3300049578 Bacteria 11737
693 Ga0501042_0359116 3300049578 Bacteria 1054
694 Ga0501043_0000590 3300049579 Bacteria 32162
695 Ga0501043_0000765 3300049579 Bacteria 28587
696 Ga0501043_0010344 3300049579 Bacteria 7313
697 Ga0501043_0011693 3300049579 Bacteria 6871
698 Ga0501043_0076329 3300049579 Bacteria 2632
699 Ga0501043_0108233 3300049579 Bacteria 2183
700 Ga0501043_0193196 3300049579 Bacteria 1582
701 Ga0501046_0000766 3300049580 Bacteria 31118
702 Ga0501046_0003768 3300049580 Bacteria 13880
703 Ga0501046_0014305 3300049580 Bacteria 6700
704 Ga0501046_0062502 3300049580 Bacteria 2909
705 Ga0501046_0068161 3300049580 Bacteria 2769
706 Ga0501046_0071668 3300049580 Bacteria 2692
707 Ga0501047_0004204 3300049581 Bacteria 13561
708 Ga0501047_0004747 3300049581 Bacteria 12779
709 Ga0501047_0008050 3300049581 Bacteria 9947
710 Ga0501047_0050498 3300049581 Bacteria 4017
711 Ga0501047_0145161 3300049581 Bacteria 2250
712 Ga0501047_0199936 3300049581 Bacteria 1859
713 Ga0501047_0222918 3300049581 Bacteria 1741
714 Ga0501047_0293142 3300049581 Bacteria 1470
715 Ga0501047_0677411 3300049581 Bacteria 849
716 Ga0501048_0010447 3300049582 Bacteria 6931
717 Ga0501068_0001005 3300049584 Bacteria 14851
718 Ga0501068_0107214 3300049584 Bacteria 1735
719 Ga0501070_0001202 3300049586 Bacteria 23186
720 Ga0501070_0006268 3300049586 Bacteria 10122
721 Ga0501070_0029248 3300049586 Bacteria 4621
722 Ga0501070_0136969 3300049586 Bacteria 2021
723 Ga0501070_0152654 3300049586 Bacteria 1905
724 Ga0501070_0360567 3300049586 Bacteria 1179
725 Ga0501071_0018859 3300049587 Bacteria 4784
726 Ga0501072_0283309 3300049588 Bacteria 1318
727 Ga0501074_0113274 3300049590 Bacteria 1941
728 Ga0501227_002649 3300049665 Bacteria 3930
729 Ga0501235_003859 3300049669 Bacteria 3236
730 Ga0501255_006884 3300049684 Bacteria 1188
731 Ga0501221_005452 3300049704 Bacteria 2125
732 Ga0501229_000089 3300049706 Bacteria 9401
733 Ga0501080_0341145 3300049742 Bacteria 1354
734 Ga0501083_0001331 3300049744 Bacteria 16739
735 Ga0501083_0012979 3300049744 Bacteria 5822
736 Ga0501083_0019716 3300049744 Bacteria 4695
737 Ga0501035_0000009 3300049822 Bacteria 310827
738 Ga0501035_0007618 3300049822 Bacteria 10114
739 Ga0501035_0019171 3300049822 Bacteria 6297
740 Ga0501035_0021368 3300049822 Bacteria 5949
741 Ga0501035_0022903 3300049822 Bacteria 5736
742 Ga0501035_0031102 3300049822 Bacteria 4862
743 Ga0501035_0141338 3300049822 Bacteria 2093
744 Ga0501035_0269564 3300049822 Bacteria 1441
745 Ga0501035_0308436 3300049822 Bacteria 1332
746 Ga0501035_0326442 3300049822 Bacteria 1288
747 Ga0501044_0000005 3300049823 Bacteria 310855
748 Ga0501044_0001129 3300049823 Bacteria 31721
749 Ga0501044_0015367 3300049823 Bacteria 8243
750 Ga0501044_0135637 3300049823 Bacteria 2452
751 Ga0501044_0274376 3300049823 Bacteria 1621
752 Ga0501044_0317040 3300049823 Bacteria 1484
753 Ga0501044_0403104 3300049823 Bacteria 1280
754 Ga0501045_0001357 3300049824 Bacteria 16252
755 Ga0501045_0067175 3300049824 Bacteria 2633
756 Ga0501045_0296068 3300049824 Bacteria 1204
757 nmdc:mga00v17_56432_c1 3300050491 Bacteria 2401
758 nmdc:mga0yw44_326227_c1 3300050492 Bacteria 1031
759 nmdc:mga06z11_111_c1 3300050494 Bacteria 33603
760 nmdc:mga04h51_792_c1 3300050495 Bacteria 7342
761 nmdc:mga07m45_11236_c1 3300050496 Bacteria 4701
762 nmdc:mga07m45_52477_c1 3300050496 Bacteria 2302
763 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
764 nmdc:mga08x19_269931_c1 3300050514 Bacteria 1177
765 Ga0495601_0141857 3300053077 Bacteria 1567
766 Ga0495619_0139103 3300053085 Bacteria 1671
767 Ga0500643_002099 3300053087 Bacteria 10607
768 Ga0500643_009425 3300053087 Bacteria 3734
769 Ga0500644_0001257 3300053088 Bacteria 6924
770 Ga0500651_0050675 3300053093 Bacteria 2604
771 Ga0500566_0067402 3300053094 Bacteria 2015
772 Ga0500641_0001555 3300053096 Bacteria 8178
773 Ga0500562_030580 3300053108 Bacteria 1419
774 Ga0500593_000072 3300053117 Bacteria 37884
775 Ga0500595_000001 3300053119 Bacteria 1088438
776 Ga0500595_002650 3300053119 Bacteria 8710
777 Ga0500597_030230 3300053120 Bacteria 2224
778 Ga0500568_0000005 3300053139 Bacteria 614296
779 Ga0500574_019371 3300053141 Bacteria 1693
780 Ga0500616_0000001 3300053153 Bacteria 1986011
781 Ga0500616_0000303 3300053153 Bacteria 71156
782 Ga0500616_0039890 3300053153 Bacteria 2528
783 Ga0500616_0051292 3300053153 Bacteria 2174
784 Ga0500616_0087096 3300053153 Bacteria 1556
785 Ga0500619_016163 3300053154 Bacteria 2047
786 Ga0500622_0007953 3300053156 Bacteria 5970
787 Ga0500624_000085 3300053157 Bacteria 47798
788 Ga0500636_0000930 3300053177 Bacteria 15732
789 Ga0500636_0013262 3300053177 Bacteria 4837
790 Ga0500637_0000023 3300053178 Bacteria 61044
791 Ga0500645_000073 3300053730 Bacteria 79133
792 Ga0500645_000109 3300053730 Bacteria 65892
793 Ga0500596_003980 3300053735 Bacteria 2750
794 Ga0587077_035495 3300059493 Bacteria 974
795 Ga0587076_029599 3300059645 Bacteria 962
796 Ga0501082_0032692 3300060353 Bacteria 4487
797 Ga0530510_0061521 3300061734 Bacteria 2718
798 2599021528 2597490337 Archaea 2364912
799 2512644051 2512564014 Bacteria 4639632
800 2601666853 2600255292 Bacteria 6300551
801 2643777584 2643221551 Bacteria 3750538
802 2643796032 2643221555 Bacteria 3749717
803 2644125570 2643221622 Bacteria 4212502
804 2723601528 2721755693 Bacteria 6126117
805 2730137651 2728369359 Bacteria 5621728
806 2739058161 2738541337 Bacteria 6183410
807 2739310294 2738543024 Bacteria 5603683
808 2753767841 2751185897 Bacteria 5322941
809 2753811262 2751185905 Bacteria 6142767
810 2776915707 2775507049 Bacteria 6284736
811 2788436433 2786546940 Bacteria 6396474
812 2802440481 2802428803 Bacteria 5806948
813 2819543789 2818991436 Bacteria 5376622
814 2819716406 2818991466 Bacteria 4748179
815 2829747132 2829745981 Bacteria 5406054
816 2841914991 2841911363 Bacteria 6173697
817 2841921888 2841917233 Bacteria 6173500
818 2842715844 2842711865 Bacteria 7155354
819 2854683983 2854681122 Bacteria 4548679
820 2857552754 2857547612 Bacteria 6179999
821 2857558116 2857553236 Bacteria 6166726
822 2857558765 2857558681 Bacteria 6617694
823 2879165306 2879163058 Bacteria 4223965
824 2882806850 2882806704 Bacteria 3007728
825 2885086334 2885080285 Bacteria 6355622
826 2885269466 2885266251 Bacteria 4796748
827 2885429876 2885429604 Bacteria 3642894
828 2889277621 2889276214 Bacteria 5979355
829 2895884360 2895880812 Bacteria 11255272
830 2899262429 2899259804 Bacteria 3320927
831 2899275931 2899275550 Bacteria 3958688
832 2899805054 2899803654 Bacteria 5577784
833 2904428349 2904424332 Bacteria 7633521
834 2917702960 2917699015 Bacteria 7043791
835 2919711343 2919709256 Bacteria 4318106
836 2928528787 2928526807 Bacteria 4760224
837 2928970341 2928968154 Bacteria 4633371
838 2932415675 2932410948 Bacteria 6312192
839 2932421665 2932416698 Bacteria 6315112
840 2939706225 2939702853 Bacteria 5139229
841 2996710481 2996706504 Bacteria 5757485
842 3000018850 3000017691 Bacteria 3772574
843 641646871 641522639 Bacteria 7737025
844 643605083 643348564 Bacteria 8839022
845 648168111 648028048 Bacteria 5394884
846 8054566007 8054563764 Bacteria 5592885
847 8057134898 8057132660 Bacteria 4061191
848 rootH1_10015987
849 JGI25156J39149_1001747
850 JGI25162J39368_1000040
851 JGI25154J39366_1000782
852 JGI25154J39366_1000843
853 JGI25158J39367_1001690
854 JGI25163J39215_1003955
855 JGI25164J39214_1006860
856 JGI25150J39212_1001343
857 JGI25159J45721_1001570
858 JGI25159J45721_1015311
859 JGI25165J46597_1000051
860 JGI25153J46596_10008965
861 rootH2_10050624
862 rootH1_10197647
863 JGI25161J50226_1005224
864 Ga0006562J51391_1024424
865 Ga0055538_1000025
866 Ga0055539_1000032
867 Ga0055533_1000042
868 Ga0055533_1005999
869 Ga0055525_1000050
870 Ga0055542_1001269
871 Ga0055526_1000007
872 Ga0055526_1008377
873 Ga0055537_1000236
874 Ga0055537_1000441
875 Ga0055537_1006072
876 Ga0055524_1000245
877 Ga0055524_1000545
878 Ga0055534_1000243
879 Ga0055534_1004167
880 Ga0055528_1000136
881 Ga0055530_10000064
882 Ga0055530_10012116
883 Ga0055531_10000073
884 Ga0055531_10000105
885 Ga0055531_10002452
886 Ga0055541_1000023
887 Ga0055541_1000458
888 Ga0055543_1002680
889 Ga0065165_1000034
890 Ga0065165_1000315
891 Ga0065704_10000192
892 Ga0070658_10000068
893 Ga0070658_10006402
894 Ga0070658_10008492
895 Ga0070658_10084478
896 Ga0070676_10041200
897 Ga0070683_100008384
898 Ga0070683_100016095
899 Ga0070683_100045733
900 Ga0068869_100249819
901 Ga0070680_100001683
902 Ga0070680_100348943
903 Ga0070682_100046152
904 Ga0070682_100188032
905 Ga0068868_100004786
906 Ga0068868_100052559
907 Ga0068868_100170283
908 Ga0070660_100002033
909 Ga0070660_100023602
910 Ga0070661_100001882
911 Ga0070661_100080210
912 Ga0070661_100239180
913 Ga0070668_100476870
914 Ga0070675_100247866
915 Ga0070675_100267311
916 Ga0070674_100026376
917 Ga0070673_100017507
918 Ga0070659_100022966
919 Ga0070659_100073804
920 Ga0070659_100091312
921 Ga0070667_100397399
922 Ga0070708_100055295
923 Ga0070663_100052302
924 Ga0070663_100128730
925 Ga0070663_100435395
926 Ga0070662_100001446
927 Ga0070681_10039109
928 Ga0068867_100001603
929 Ga0068867_100035645
930 Ga0068867_100044568
931 Ga0068867_100128203
932 Ga0070706_100006247
933 Ga0070706_100020056
934 Ga0070707_100196034
935 Ga0070679_100005037
936 Ga0070679_100012797
937 Ga0070679_100425456
938 Ga0070684_100063774
939 Ga0070697_100012905
940 Ga0068853_100002549
941 Ga0068853_100034960
942 Ga0068853_100046741
943 Ga0070672_100045238
944 Ga0070665_100166441
945 Ga0068855_100005593
946 Ga0068855_100085917
947 Ga0068855_100214884
948 Ga0068855_100537922
949 Ga0070664_100006182
950 Ga0068857_100013486
951 Ga0068854_100001347
952 Ga0068854_100120124
953 Ga0068856_100007858
954 Ga0068856_100053971
955 Ga0068856_100055400
956 Ga0068856_100081610
957 Ga0068856_100117890
958 Ga0068856_100402400
959 Ga0068856_100591675
960 Ga0068852_100000358
961 Ga0068852_100007231
962 Ga0068852_100008312
963 Ga0068852_100028614
964 Ga0068852_100066376
965 Ga0068852_100084982
966 Ga0068852_100442071
967 Ga0068864_100297587
968 Ga0068851_10027534
969 Ga0068851_10251267
970 Ga0068863_100164712
971 Ga0068858_100465005
972 Ga0070717_10061096
973 Ga0070717_10361059
974 Ga0075368_10030451
975 Ga0075364_10022381
976 Ga0075367_10001026
977 Ga0097621_100004772
978 Ga0075370_10010786
979 Ga0075370_10206492
980 Ga0068871_100017444
981 Ga0075431_100110493
982 Ga0068865_100033018
983 Ga0075436_100292479
984 Ga0105240_10002141
985 Ga0105240_10269716
986 Ga0105240_10291143
987 Ga0105243_10000049
988 Ga0105241_10257161
989 Ga0105242_10626447
990 Ga0105238_10060084
991 Ga0105238_10378928
992 Ga0105239_10276065
993 Ga0105239_10656184
994 Ga0157373_10009556
995 Ga0157373_10043541
996 Ga0157373_10201976
997 Ga0157373_10417777
998 Ga0157371_10003962
999 Ga0157371_10006514
1000 Ga0157371_10007842
1001 Ga0157371_10044125
1002 Ga0157371_10088842
1003 Ga0157370_10004189
1004 Ga0157370_10005551
1005 Ga0157370_10020929
1006 Ga0157370_10072428
1007 Ga0157370_10090519
1008 Ga0157369_10001072
1009 Ga0157369_10002003
1010 Ga0157369_10015476
1011 Ga0157369_10043085
1012 Ga0157369_10492411
1013 Ga0171462_1013
1014 Ga0157378_10026218
1015 Ga0157378_10210823
1016 Ga0157372_10004382
1017 Ga0157372_10081127
1018 Ga0157372_10124827
1019 Ga0163163_10248684
1020 Ga0157377_10067421
1021 Ga0157376_10216357
1022 Ga0182006_1000023
1023 Ga0182007_10000082
1024 Ga0182007_10000738
1025 Ga0182005_1000047
1026 Ga0182005_1000405
1027 Ga0163161_10001177
1028 Ga0213872_10000024
1029 Ga0213872_10010012
1030 Ga0209436_102173
1031 Ga0209784_100010
1032 Ga0209566_100008
1033 Ga0209566_100235
1034 Ga0209674_100019
1035 Ga0209674_100189
1036 Ga0209563_100021
1037 Ga0209563_107681
1038 Ga0207427_100432
1039 Ga0209437_100019
1040 Ga0207425_1000036
1041 Ga0207425_1007318
1042 Ga0209646_1000119
1043 Ga0209646_1000125
1044 Ga0209677_100011
1045 Ga0209677_103667
1046 Ga0209148_1000451
1047 Ga0209759_1001696
1048 Ga0209233_1000025
1049 Ga0209565_1000007
1050 Ga0209565_1000082
1051 Ga0209565_1001293
1052 Ga0209565_1002903
1053 Ga0209673_1000381
1054 Ga0209673_1001016
1055 Ga0209673_1018228
1056 Ga0209130_1000016
1057 Ga0209130_1000045
1058 Ga0209130_1003201
1059 Ga0209130_1033060
1060 Ga0209675_1000166
1061 Ga0209675_1002921
1062 Ga0209025_1000932
1063 Ga0209564_1000010
1064 Ga0209564_1000710
1065 Ga0209564_1006015
1066 Ga0209564_1007914
1067 Ga0209758_1007609
1068 Ga0209050_1000010
1069 Ga0209050_1000086
1070 Ga0209050_1000549
1071 Ga0209050_1003427
1072 Ga0209050_1016110
1073 Ga0209050_1022518
1074 Ga0209256_1000008
1075 Ga0209256_1000380
1076 Ga0209256_1001189
1077 Ga0209256_1007190
1078 Ga0207426_1004949
1079 Ga0207426_1027608
1080 Ga0209051_1005335
1081 Ga0209051_1060749
1082 Ga0209257_1000027
1083 Ga0209257_1000047
1084 Ga0209257_1000087
1085 Ga0209257_1000758
1086 Ga0209257_1004536
1087 Ga0209257_1017996
1088 Ga0209257_1065859
1089 Ga0207647_10006567
1090 Ga0207705_10000124
1091 Ga0207705_10002001
1092 Ga0207705_10003314
1093 Ga0207705_10009518
1094 Ga0207705_10036010
1095 Ga0207705_10049500
1096 Ga0207705_10136230
1097 Ga0207684_10003787
1098 Ga0207684_10005345
1099 Ga0207707_10006462
1100 Ga0207707_10233962
1101 Ga0207695_10001916
1102 Ga0207695_10419923
1103 Ga0207671_10065042
1104 Ga0207660_10003417
1105 Ga0207660_10280589
1106 Ga0207657_10001711
1107 Ga0207657_10005837
1108 Ga0207657_10006696
1109 Ga0207657_10022472
1110 Ga0207649_10007919
1111 Ga0207649_10019063
1112 Ga0207649_10070711
1113 Ga0207649_10300559
1114 Ga0207649_10365423
1115 Ga0207652_10003472
1116 Ga0207652_10051424
1117 Ga0207652_10072632
1118 Ga0207652_10327225
1119 Ga0207652_10382602
1120 Ga0207646_10007230
1121 Ga0207646_10182204
1122 Ga0207646_10674083
1123 Ga0207659_10058296
1124 Ga0207690_10000640
1125 Ga0207690_10061721
1126 Ga0207706_10003725
1127 Ga0207709_10000097
1128 Ga0207669_10023854
1129 Ga0207704_10002333
1130 Ga0207665_10227252
1131 Ga0207691_10072003
1132 Ga0207689_10000210
1133 Ga0207689_10174808
1134 Ga0207661_10015660
1135 Ga0207661_10169442
1136 Ga0207679_10000726
1137 Ga0207667_10003114
1138 Ga0207667_10018162
1139 Ga0207667_10041610
1140 Ga0207667_10063401
1141 Ga0207667_10139637
1142 Ga0207667_10861802
1143 Ga0207640_10000964
1144 Ga0207640_10048289
1145 Ga0207640_10414767
1146 Ga0207658_10300956
1147 Ga0207677_10002753
1148 Ga0207677_10042952
1149 Ga0207677_10075484
1150 Ga0207677_10166499
1151 Ga0207703_10158910
1152 Ga0207639_10003417
1153 Ga0207639_10036461
1154 Ga0207639_10062357
1155 Ga0207639_10063862
1156 Ga0207639_10096969
1157 Ga0207639_10216388
1158 Ga0207639_10244202
1159 Ga0207678_10315756
1160 Ga0207702_10000625
1161 Ga0207702_10061656
1162 Ga0207702_10064378
1163 Ga0207702_10093783
1164 Ga0207702_10172263
1165 Ga0207641_10393577
1166 Ga0207648_10003807
1167 Ga0207648_10020786
1168 Ga0207648_10033839
1169 Ga0207648_10050196
1170 Ga0207676_10401277
1171 Ga0207683_10053454
1172 Ga0207698_10000067
1173 Ga0207698_10001225
1174 Ga0207698_10140862
1175 Ga0207698_10564615
1176 Ga0209813_10000036
1177 Ga0207428_10214951
1178 Ga0268266_10080979
1179 Ga0265337_1027544
1180 Ga0265319_1021900
1181 Ga0265318_10029226
1182 Ga0265318_10105275
1183 Ga0265336_10040714
1184 Ga0307517_10031004
1185 Ga0307515_10022699
1186 Ga0316177_1204721
1187 Ga0265330_10000003
1188 Ga0265328_10000007
1189 Ga0265320_10001237
1190 Ga0265320_10027218
1191 Ga0265325_10025806
1192 Ga0265340_10023903
1193 Ga0265339_10056511
1194 Ga0265331_10010335
1195 Ga0265331_10020675
1196 Ga0265331_10105838
1197 Ga0265327_10007906
1198 Ga0265327_10011866
1199 Ga0265316_10002008
1200 Ga0307513_10051934
1201 Ga0307408_100000017
1202 Ga0307408_100000021
1203 Ga0307408_100000029
1204 Ga0307408_100036159
1205 Ga0307408_100045674
1206 Ga0307408_100537397
1207 Ga0265313_10005994
1208 Ga0265313_10137433
1209 Ga0316579_10031269
1210 Ga0316579_10033419
1211 Ga0265314_10023239
1212 Ga0265314_10119946
1213 Ga0265314_10199968
1214 Ga0265342_10000068
1215 Ga0265342_10021823
1216 Ga0265342_10031893
1217 Ga0316576_10017373
1218 Ga0316576_10017770
1219 Ga0316578_10041569
1220 Ga0316578_10328640
1221 Ga0307405_10004498
1222 Ga0307405_10093752
1223 Ga0316577_10000005
1224 Ga0316577_10006115
1225 Ga0316577_10092258
1226 Ga0307413_10004455
1227 Ga0307413_10112104
1228 Ga0307413_10178798
1229 Ga0307413_10180480
1230 Ga0307410_10000060
1231 Ga0307410_10107476
1232 Ga0307406_10044481
1233 Ga0307406_10211374
1234 Ga0307406_10455573
1235 Ga0307407_10000127
1236 Ga0307407_10020467
1237 Ga0307407_10045110
1238 Ga0307407_10189905
1239 Ga0307412_10000037
1240 Ga0307412_10002397
1241 Ga0307412_10062330
1242 Ga0307412_10102474
1243 Ga0307412_10107832
1244 Ga0307412_10176774
1245 Ga0307412_10427220
1246 Ga0307409_100000021
1247 Ga0307409_100001401
1248 Ga0307409_100013413
1249 Ga0307416_100000256
1250 Ga0307416_100003131
1251 Ga0307416_100085761
1252 Ga0307416_100091691
1253 Ga0307414_10000015
1254 Ga0307414_10022625
1255 Ga0307414_10049920
1256 Ga0307414_10096888
1257 Ga0307414_10377810
1258 Ga0307414_10434058
1259 Ga0307414_10624735
1260 Ga0307411_10002554
1261 Ga0307411_10052013
1262 Ga0307411_10231558
1263 Ga0307415_100062314
1264 Ga0307415_100129490
1265 Ga0307415_100167425
1266 Ga0373950_0003923
1267 Ga0373959_0043423
1268 Ga0373940_0004154
1269 Ga0373932_0007834
1270 Ga0373939_0000012
1271 Ga0373941_0062088
1272 Ga0373960_0002596
1273 Ga0373960_0056083
1274 Ga0373946_0144678
1275 Ga0373962_0013769
1276 Ga0373931_0001221
1277 Ga0373931_0054807
1278 Ga0373937_0221650
1279 Ga0316582_0015261
1280 Ga0316582_0035596
1281 Ga0316582_0081835
1282 Ga0316582_0150903
1283 Ga0316584_0001705
1284 Ga0316584_0024370
1285 Ga0316584_0029083
1286 Ga0316584_0065259
1287 Ga0316584_0098934
1288 Ga0316584_0302646
1289 Ga0395899_0025590
1290 Ga0395899_0178600
1291 Ga0395900_0121609
1292 Ga0395900_0132761
1293 Ga0395900_0162442
1294 Ga0395900_0384153
1295 Ga0395900_0510083
1296 Ga0395898_0212860
1297 Ga0395905_0013332
1298 Ga0395905_0055988
1299 Ga0395905_0099738
1300 Ga0316581_0009290
1301 Ga0316581_0018105
1302 Ga0395901_0030541
1303 Ga0395901_0118720
1304 Ga0400483_016212
1305 Ga0400483_102702
1306 Ga0400483_180833
1307 Ga0400483_192590
1308 Ga0436361_0224368
1309 Ga0436362_1002824
1310 Ga0439453_0003984
1311 Ga0439465_0035505
1312 Ga0451849_0296662
1313 Ga0451843_0077392
1314 Ga0451853_3488129
1315 Ga0439431_0008649
1316 Ga0439445_0049126
1317 Ga0439462_0023322
1318 Ga0450890_000001
1319 Ga0450891_002701
1320 Ga0450892_000061
1321 Ga0439434_0111084
1322 Ga0450893_0028936
1323 Ga0451577_0002436
1324 Ga0451577_0019946
1325 Ga0451577_0260376
1326 Ga0453683_0001847
1327 Ga0453683_0018503
1328 Ga0453683_0108033
1329 Ga0466965_0008880
1330 Ga0466961_0280837
1331 Ga0453684_0000050
1332 Ga0453684_0000597
1333 Ga0453684_0005953
1334 Ga0453684_0006998
1335 Ga0453684_0011404
1336 Ga0453684_0018796
1337 Ga0453684_0034822
1338 Ga0453684_0094771
1339 Ga0453684_0173046
1340 Ga0453684_0289883
1341 Ga0453684_0383067
1342 Ga0453684_0572483
1343 Ga0466960_0203862
1344 Ga0466959_0040583
1345 Ga0451576_0000586
1346 Ga0451576_0007631
1347 Ga0451576_0009304
1348 Ga0451576_0011237
1349 Ga0451576_0184805
1350 Ga0495627_000004
1351 Ga0495592_0010239
1352 Ga0495638_0028580
1353 Ga0495638_0263448
1354 Ga0495651_0006882
1355 Ga0495653_0002868
1356 Ga0495650_0000128
1357 Ga0495650_0002873
1358 Ga0495605_0000018
1359 Ga0495605_0001131
1360 Ga0495584_0021167
1361 Ga0495584_0081848
1362 Ga0495607_0002432
1363 Ga0495607_0007691
1364 Ga0495583_0000115
1365 Ga0495583_0001058
1366 Ga0495583_0067571
1367 Ga0495606_0000228
1368 Ga0495606_0000288
1369 Ga0495606_0000790
1370 Ga0495606_0001799
1371 Ga0495608_0007317
1372 Ga0495608_0023636
1373 Ga0495610_0018280
1374 Ga0495610_0035550
1375 Ga0495618_0080496
1376 Ga0495628_0001227
1377 Ga0495628_0002006
1378 Ga0495637_0000142
1379 Ga0495637_0000731
1380 Ga0495643_0000082
1381 Ga0495643_0207375
1382 Ga0495648_0000732
1383 Ga0495648_0013009
1384 Ga0495648_0088915
1385 Ga0495648_0135341
1386 Ga0495642_0039791
1387 Ga0495652_0014687
1388 Ga0495654_0000014
1389 Ga0495609_0000434
1390 Ga0495609_0000537
1391 Ga0495609_0002203
1392 Ga0495621_0005796
1393 Ga0495597_0000321
1394 Ga0495645_0028629
1395 Ga0495645_0049548
1396 Ga0495622_0000034
1397 Ga0495622_0078600
1398 Ga0495633_0000100
1399 Ga0495633_0000217
1400 Ga0495633_0012689
1401 Ga0495633_0197310
1402 Ga0495656_0020157
1403 Ga0495668_0000231
1404 Ga0495668_0000308
1405 Ga0495668_0054396
1406 Ga0495625_0046579
1407 Ga0495625_0205171
1408 Ga0495659_0000272
1409 Ga0495661_0005558
1410 Ga0495661_0152463
1411 Ga0495657_0145258
1412 Ga0495646_0004004
1413 Ga0495646_0069647
1414 Ga0495669_0001487
1415 Ga0495624_0077378
1416 Ga0495671_0058521
1417 Ga0495649_0046175
1418 Ga0495649_0106751
1419 Ga0495649_0111838
1420 Ga0495649_0152287
1421 Ga0495600_0001954
1422 Ga0495660_0028809
1423 Ga0495604_0044258
1424 Ga0495604_0044839
1425 Ga0495636_0002097
1426 Ga0495636_0027842
1427 Ga0495672_0000081
1428 Ga0495672_0034660
1429 Ga0495683_0014292
1430 Ga0495687_000172
1431 Ga0495687_000323
1432 Ga0495687_000446
1433 Ga0495687_000699
1434 Ga0495677_0010342
1435 Ga0495685_000034
1436 Ga0495685_005609
1437 Ga0495673_0000008
1438 Ga0495673_0008115
1439 Ga0495681_0013190
1440 Ga0495681_0022454
1441 Ga0495686_0000604
1442 Ga0495686_0000677
1443 Ga0495686_0006562
1444 Ga0495686_0014303
1445 Ga0495686_0037907
1446 Ga0495686_0056991
1447 Ga0495602_0128770
1448 Ga0496101_0284360
1449 Ga0496102_0031911
1450 Ga0496102_0116510
1451 Ga0496103_0001821
1452 Ga0496104_0175888
1453 Ga0496105_0022519
1454 Ga0496108_0196008
1455 Ga0496110_0348147
1456 Ga0496112_0000200
1457 Ga0496114_0002554
1458 Ga0496114_0442897
1459 Ga0496115_0010435
1460 Ga0496116_0021069
1461 Ga0496116_0059847
1462 Ga0496116_0079691
1463 Ga0496117_0000075
1464 Ga0496117_0021543
1465 Ga0496118_0000055
1466 Ga0496119_0018246
1467 Ga0496120_0059824
1468 Ga0496120_0062601
1469 Ga0496121_0028678
1470 Ga0496121_0054149
1471 Ga0496122_0003176
1472 Ga0496122_0003599
1473 Ga0496122_0049349
1474 Ga0496122_0276732
1475 Ga0496123_0001626
1476 Ga0496123_0053057
1477 Ga0496123_0055289
1478 Ga0496124_0002918
1479 Ga0496124_0022595
1480 Ga0496124_0032120
1481 Ga0496124_0044471
1482 Ga0496124_0049085
1483 Ga0496124_0158652
1484 Ga0496124_0163571
1485 Ga0496124_0323381
1486 Ga0496125_0002758
1487 Ga0496125_0025532
1488 Ga0496125_0120648
1489 Ga0496125_0242657
1490 Ga0496126_0005903
1491 Ga0495678_000027
1492 Ga0495678_000346
1493 Ga0495678_000549
1494 Ga0495682_0000999
1495 Ga0501300_009813
1496 Ga0501031_0000002
1497 Ga0501031_0002629
1498 Ga0501031_0036952
1499 Ga0501031_0058606
1500 Ga0501031_0123349
1501 Ga0501032_0000004
1502 Ga0501032_0000851
1503 Ga0501032_0002674
1504 Ga0501032_0005458
1505 Ga0501032_0067334
1506 Ga0501033_0000016
1507 Ga0501033_0009280
1508 Ga0501033_0014684
1509 Ga0501033_0051714
1510 Ga0501033_0099319
1511 Ga0501033_0140160
1512 Ga0501033_0197852
1513 Ga0501034_0000011
1514 Ga0501034_0009670
1515 Ga0501034_0012065
1516 Ga0501034_0027699
1517 Ga0501034_0108886
1518 Ga0501034_0171146
1519 Ga0501034_0179352
1520 Ga0501034_0551747
1521 Ga0501036_0000001
1522 Ga0501036_0004087
1523 Ga0501036_0006219
1524 Ga0501036_0121271
1525 Ga0501037_0000006
1526 Ga0501037_0005227
1527 Ga0501038_0000003
1528 Ga0501038_0002842
1529 Ga0501038_0003593
1530 Ga0501038_0004599
1531 Ga0501038_0022177
1532 Ga0501038_0047786
1533 Ga0501038_0165298
1534 Ga0501039_0000004
1535 Ga0501039_0007003
1536 Ga0501039_0007282
1537 Ga0501039_0425002
1538 Ga0501040_0006407
1539 Ga0501042_0002271
1540 Ga0501042_0359116
1541 Ga0501043_0000590
1542 Ga0501043_0000765
1543 Ga0501043_0010344
1544 Ga0501043_0011693
1545 Ga0501043_0076329
1546 Ga0501043_0108233
1547 Ga0501043_0193196
1548 Ga0501046_0000766
1549 Ga0501046_0003768
1550 Ga0501046_0014305
1551 Ga0501046_0062502
1552 Ga0501046_0068161
1553 Ga0501046_0071668
1554 Ga0501047_0004204
1555 Ga0501047_0004747
1556 Ga0501047_0008050
1557 Ga0501047_0050498
1558 Ga0501047_0145161
1559 Ga0501047_0199936
1560 Ga0501047_0222918
1561 Ga0501047_0293142
1562 Ga0501047_0677411
1563 Ga0501048_0010447
1564 Ga0501068_0001005
1565 Ga0501068_0107214
1566 Ga0501070_0001202
1567 Ga0501070_0006268
1568 Ga0501070_0029248
1569 Ga0501070_0136969
1570 Ga0501070_0152654
1571 Ga0501070_0360567
1572 Ga0501071_0018859
1573 Ga0501072_0283309
1574 Ga0501074_0113274
1575 Ga0501227_002649
1576 Ga0501235_003859
1577 Ga0501255_006884
1578 Ga0501221_005452
1579 Ga0501229_000089
1580 Ga0501080_0341145
1581 Ga0501083_0001331
1582 Ga0501083_0012979
1583 Ga0501083_0019716
1584 Ga0501035_0000009
1585 Ga0501035_0007618
1586 Ga0501035_0019171
1587 Ga0501035_0021368
1588 Ga0501035_0022903
1589 Ga0501035_0031102
1590 Ga0501035_0141338
1591 Ga0501035_0269564
1592 Ga0501035_0308436
1593 Ga0501035_0326442
1594 Ga0501044_0000005
1595 Ga0501044_0001129
1596 Ga0501044_0015367
1597 Ga0501044_0135637
1598 Ga0501044_0274376
1599 Ga0501044_0317040
1600 Ga0501044_0403104
1601 Ga0501045_0001357
1602 Ga0501045_0067175
1603 Ga0501045_0296068
1604 nmdc:mga00v17_56432_c1
1605 nmdc:mga0yw44_326227_c1
1606 nmdc:mga06z11_111_c1
1607 nmdc:mga04h51_792_c1
1608 nmdc:mga07m45_11236_c1
1609 nmdc:mga07m45_52477_c1
1610 nmdc:mga08x19_18_c1
1611 nmdc:mga08x19_269931_c1
1612 Ga0495601_0141857
1613 Ga0495619_0139103
1614 Ga0500643_002099
1615 Ga0500643_009425
1616 Ga0500644_0001257
1617 Ga0500651_0050675
1618 Ga0500566_0067402
1619 Ga0500641_0001555
1620 Ga0500562_030580
1621 Ga0500593_000072
1622 Ga0500595_000001
1623 Ga0500595_002650
1624 Ga0500597_030230
1625 Ga0500568_0000005
1626 Ga0500574_019371
1627 Ga0500616_0000001
1628 Ga0500616_0000303
1629 Ga0500616_0039890
1630 Ga0500616_0051292
1631 Ga0500616_0087096
1632 Ga0500619_016163
1633 Ga0500622_0007953
1634 Ga0500624_000085
1635 Ga0500636_0000930
1636 Ga0500636_0013262
1637 Ga0500637_0000023
1638 Ga0500645_000073
1639 Ga0500645_000109
1640 Ga0500596_003980
1641 Ga0587077_035495
1642 Ga0587076_029599
1643 Ga0501082_0032692
1644 Ga0530510_0061521
1645 2599021528
1646 2512644051
1647 2601666853
1648 2643777584
1649 2643796032
1650 2644125570
1651 2723601528
1652 2730137651
1653 2739058161
1654 2739310294
1655 2753767841
1656 2753811262
1657 2776915707
1658 2788436433
1659 2802440481
1660 2819543789
1661 2819716406
1662 2829747132
1663 2841914991
1664 2841921888
1665 2842715844
1666 2854683983
1667 2857552754
1668 2857558116
1669 2857558765
1670 2879165306
1671 2882806850
1672 2885086334
1673 2885269466
1674 2885429876
1675 2889277621
1676 2895884360
1677 2899262429
1678 2899275931
1679 2899805054
1680 2904428349
1681 2917702960
1682 2919711343
1683 2928528787
1684 2928970341
1685 2932415675
1686 2932421665
1687 2939706225
1688 2996710481
1689 3000018850
1690 641646871
1691 643605083
1692 648168111
1693 8054566007
1694 8057134898

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

53

283

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9717 1 256
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9679 3 256
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9649 1 256
1gpw-assembly2.cif.gz_C structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. 0.9645 1 256
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9639 3 256
ID Description Score Start End Superfamily
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9793 1 256 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9756 1 256 3.20.20.70
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9653 1 251 3.20.20.70
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9577 1 251 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9456 1 256 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A352GHN9-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 1 143 256 GO:0000105
GO:0000107
AF-A0A4Y7X5H6-F1-model_v4 deleted 1 166 256
AF-A0A257Y9L3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.9999 113 256 GO:0000105
GO:0000107
AF-A0A3P7EQJ5-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) 0.9994 64 255 GO:0000105
GO:0000107
GO:0016829
AF-A0A3N5HSG4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.9989 175 256 GO:0000105
GO:0000107

Map