F483352
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 848 | 426 | 1694 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10015987|rootH1_100159872 |
| Length | 307 |
| Sequence | VSASRSSAPDDLCRTRSGDNKVFSKTPVRSPRTGVLLGGGPHRRFAPRVLAKRIIPCLDVTDGRVVKGVNFVDLIDAGDPVEAAMAYNAQQADELVFLDITASSDNRDTMVDVVRRTAEHCFIPLTVGGGIRSVENMHEMLMAGADKVGVNTSAVNNPGLVDAGAKAFGSQCIVVAIDAKREGPGKWGVYTHGGRTPVGIDAVEWAKEVWRRGAGEILLTSMDADGTQAGYDLALTAAVSEAVGIPVIASGGAGNLDHMVEVLERGKADAVLAASIFHFGKHTVGEAKRHFAERGIPVRPPFGAASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 100 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 186 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 211 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 222 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 223 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 224 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 229 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 230 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 231 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 339 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 340 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 357 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 359 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 360 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 363 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 368 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 369 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 373 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 377 | 2597490337 | Halobacterium salinarum DSM 3754 | Isolate | Nodule |
| 378 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 379 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 380 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 381 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 382 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 383 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 384 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 385 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 386 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 387 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 388 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 389 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 390 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 391 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 392 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 393 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 394 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 395 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 396 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 397 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 398 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 399 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 400 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 401 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 402 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 403 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 404 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 405 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 406 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 407 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 408 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 409 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 410 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 411 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 412 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 413 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 414 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 415 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 416 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 417 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 418 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 419 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 420 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 421 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 422 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 423 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 424 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 425 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 426 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.75 |
| Metatranscriptomes | 0.35 |
| Isolates | 5.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.45 |
| Nodule | 0.71 |
| Rhizoplane | 1.53 |
| Rhizosphere | 73.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10015987 | 3300003323 | Bacteria | 2887 |
| 2 | JGI25156J39149_1001747 | 3300002705 | Bacteria | 8685 |
| 3 | JGI25162J39368_1000040 | 3300002737 | Bacteria | 175938 |
| 4 | JGI25154J39366_1000782 | 3300002738 | Bacteria | 14066 |
| 5 | JGI25154J39366_1000843 | 3300002738 | Bacteria | 13310 |
| 6 | JGI25158J39367_1001690 | 3300002739 | Bacteria | 3788 |
| 7 | JGI25163J39215_1003955 | 3300002771 | Bacteria | 1102 |
| 8 | JGI25164J39214_1006860 | 3300002772 | Bacteria | 1176 |
| 9 | JGI25150J39212_1001343 | 3300002774 | Bacteria | 6997 |
| 10 | JGI25159J45721_1001570 | 3300002987 | Bacteria | 9357 |
| 11 | JGI25159J45721_1015311 | 3300002987 | Bacteria | 1688 |
| 12 | JGI25165J46597_1000051 | 3300003214 | Bacteria | 241012 |
| 13 | JGI25153J46596_10008965 | 3300003215 | Bacteria | 4714 |
| 14 | rootH2_10050624 | 3300003320 | Bacteria | 7561 |
| 15 | rootH1_10197647 | 3300003323 | Bacteria | 1997 |
| 16 | JGI25161J50226_1005224 | 3300003374 | Bacteria | 2562 |
| 17 | Ga0006562J51391_1024424 | 3300003578 | Bacteria | 3783 |
| 18 | Ga0055538_1000025 | 3300003751 | Bacteria | 241012 |
| 19 | Ga0055539_1000032 | 3300003752 | Bacteria | 241012 |
| 20 | Ga0055533_1000042 | 3300003756 | Bacteria | 241012 |
| 21 | Ga0055533_1005999 | 3300003756 | Bacteria | 1863 |
| 22 | Ga0055525_1000050 | 3300003759 | Bacteria | 241012 |
| 23 | Ga0055542_1001269 | 3300003762 | Bacteria | 13689 |
| 24 | Ga0055526_1000007 | 3300003771 | Bacteria | 321998 |
| 25 | Ga0055526_1008377 | 3300003771 | Bacteria | 5173 |
| 26 | Ga0055537_1000236 | 3300003773 | Bacteria | 40412 |
| 27 | Ga0055537_1000441 | 3300003773 | Bacteria | 26555 |
| 28 | Ga0055537_1006072 | 3300003773 | Bacteria | 3129 |
| 29 | Ga0055524_1000245 | 3300003775 | Bacteria | 56692 |
| 30 | Ga0055524_1000545 | 3300003775 | Bacteria | 28475 |
| 31 | Ga0055534_1000243 | 3300003784 | Bacteria | 38818 |
| 32 | Ga0055534_1004167 | 3300003784 | Bacteria | 4276 |
| 33 | Ga0055528_1000136 | 3300003790 | Bacteria | 58873 |
| 34 | Ga0055530_10000064 | 3300003791 | Bacteria | 94475 |
| 35 | Ga0055530_10012116 | 3300003791 | Bacteria | 3033 |
| 36 | Ga0055531_10000073 | 3300003794 | Bacteria | 109510 |
| 37 | Ga0055531_10000105 | 3300003794 | Bacteria | 91871 |
| 38 | Ga0055531_10002452 | 3300003794 | Bacteria | 12393 |
| 39 | Ga0055541_1000023 | 3300003841 | Bacteria | 241012 |
| 40 | Ga0055541_1000458 | 3300003841 | Bacteria | 11711 |
| 41 | Ga0055543_1002680 | 3300004625 | Bacteria | 5711 |
| 42 | Ga0065165_1000034 | 3300005262 | Bacteria | 214644 |
| 43 | Ga0065165_1000315 | 3300005262 | Bacteria | 78877 |
| 44 | Ga0065704_10000192 | 3300005289 | Bacteria | 216848 |
| 45 | Ga0070658_10000068 | 3300005327 | Bacteria | 102788 |
| 46 | Ga0070658_10006402 | 3300005327 | Bacteria | 9543 |
| 47 | Ga0070658_10008492 | 3300005327 | Bacteria | 8257 |
| 48 | Ga0070658_10084478 | 3300005327 | Bacteria | 2610 |
| 49 | Ga0070676_10041200 | 3300005328 | Bacteria | 2677 |
| 50 | Ga0070683_100008384 | 3300005329 | Bacteria | 8777 |
| 51 | Ga0070683_100016095 | 3300005329 | Bacteria | 6583 |
| 52 | Ga0070683_100045733 | 3300005329 | Bacteria | 4041 |
| 53 | Ga0068869_100249819 | 3300005334 | Bacteria | 1416 |
| 54 | Ga0070680_100001683 | 3300005336 | Bacteria | 16198 |
| 55 | Ga0070680_100348943 | 3300005336 | Bacteria | 1258 |
| 56 | Ga0070682_100046152 | 3300005337 | Bacteria | 2703 |
| 57 | Ga0070682_100188032 | 3300005337 | Bacteria | 1448 |
| 58 | Ga0068868_100004786 | 3300005338 | Bacteria | 9503 |
| 59 | Ga0068868_100052559 | 3300005338 | Bacteria | 3208 |
| 60 | Ga0068868_100170283 | 3300005338 | Bacteria | 1803 |
| 61 | Ga0070660_100002033 | 3300005339 | Bacteria | 13954 |
| 62 | Ga0070660_100023602 | 3300005339 | Bacteria | 4557 |
| 63 | Ga0070661_100001882 | 3300005344 | Bacteria | 14532 |
| 64 | Ga0070661_100080210 | 3300005344 | Bacteria | 2409 |
| 65 | Ga0070661_100239180 | 3300005344 | Bacteria | 1397 |
| 66 | Ga0070668_100476870 | 3300005347 | Bacteria | 1077 |
| 67 | Ga0070675_100247866 | 3300005354 | Bacteria | 1558 |
| 68 | Ga0070675_100267311 | 3300005354 | Bacteria | 1500 |
| 69 | Ga0070674_100026376 | 3300005356 | Bacteria | 3794 |
| 70 | Ga0070673_100017507 | 3300005364 | Bacteria | 5099 |
| 71 | Ga0070659_100022966 | 3300005366 | Bacteria | 4768 |
| 72 | Ga0070659_100073804 | 3300005366 | Bacteria | 2716 |
| 73 | Ga0070659_100091312 | 3300005366 | Bacteria | 2441 |
| 74 | Ga0070667_100397399 | 3300005367 | Bacteria | 1254 |
| 75 | Ga0070708_100055295 | 3300005445 | Bacteria | 3529 |
| 76 | Ga0070663_100052302 | 3300005455 | Bacteria | 2913 |
| 77 | Ga0070663_100128730 | 3300005455 | Bacteria | 1920 |
| 78 | Ga0070663_100435395 | 3300005455 | Bacteria | 1078 |
| 79 | Ga0070662_100001446 | 3300005457 | Bacteria | 14637 |
| 80 | Ga0070681_10039109 | 3300005458 | Bacteria | 4755 |
| 81 | Ga0068867_100001603 | 3300005459 | Bacteria | 15717 |
| 82 | Ga0068867_100035645 | 3300005459 | Bacteria | 3610 |
| 83 | Ga0068867_100044568 | 3300005459 | Bacteria | 3250 |
| 84 | Ga0068867_100128203 | 3300005459 | Bacteria | 1969 |
| 85 | Ga0070706_100006247 | 3300005467 | Bacteria | 11266 |
| 86 | Ga0070706_100020056 | 3300005467 | Bacteria | 6160 |
| 87 | Ga0070707_100196034 | 3300005468 | Bacteria | 1969 |
| 88 | Ga0070679_100005037 | 3300005530 | Bacteria | 12195 |
| 89 | Ga0070679_100012797 | 3300005530 | Bacteria | 8027 |
| 90 | Ga0070679_100425456 | 3300005530 | Bacteria | 1273 |
| 91 | Ga0070684_100063774 | 3300005535 | Bacteria | 3231 |
| 92 | Ga0070697_100012905 | 3300005536 | Bacteria | 6546 |
| 93 | Ga0068853_100002549 | 3300005539 | Bacteria | 13684 |
| 94 | Ga0068853_100034960 | 3300005539 | Bacteria | 4267 |
| 95 | Ga0068853_100046741 | 3300005539 | Bacteria | 3712 |
| 96 | Ga0070672_100045238 | 3300005543 | Bacteria | 3403 |
| 97 | Ga0070665_100166441 | 3300005548 | Bacteria | 2207 |
| 98 | Ga0068855_100005593 | 3300005563 | Bacteria | 15339 |
| 99 | Ga0068855_100085917 | 3300005563 | Bacteria | 3639 |
| 100 | Ga0068855_100214884 | 3300005563 | Bacteria | 2159 |
| 101 | Ga0068855_100537922 | 3300005563 | Bacteria | 1266 |
| 102 | Ga0070664_100006182 | 3300005564 | Bacteria | 9677 |
| 103 | Ga0068857_100013486 | 3300005577 | Bacteria | 7119 |
| 104 | Ga0068854_100001347 | 3300005578 | Bacteria | 14808 |
| 105 | Ga0068854_100120124 | 3300005578 | Bacteria | 1994 |
| 106 | Ga0068856_100007858 | 3300005614 | Bacteria | 10417 |
| 107 | Ga0068856_100053971 | 3300005614 | Bacteria | 3963 |
| 108 | Ga0068856_100055400 | 3300005614 | Bacteria | 3913 |
| 109 | Ga0068856_100081610 | 3300005614 | Bacteria | 3208 |
| 110 | Ga0068856_100117890 | 3300005614 | Bacteria | 2656 |
| 111 | Ga0068856_100402400 | 3300005614 | Bacteria | 1389 |
| 112 | Ga0068856_100591675 | 3300005614 | Bacteria | 1131 |
| 113 | Ga0068852_100000358 | 3300005616 | Bacteria | 30765 |
| 114 | Ga0068852_100007231 | 3300005616 | Bacteria | 8098 |
| 115 | Ga0068852_100008312 | 3300005616 | Bacteria | 7638 |
| 116 | Ga0068852_100028614 | 3300005616 | Bacteria | 4565 |
| 117 | Ga0068852_100066376 | 3300005616 | Bacteria | 3150 |
| 118 | Ga0068852_100084982 | 3300005616 | Bacteria | 2818 |
| 119 | Ga0068852_100442071 | 3300005616 | Bacteria | 1286 |
| 120 | Ga0068864_100297587 | 3300005618 | Bacteria | 1510 |
| 121 | Ga0068851_10027534 | 3300005834 | Bacteria | 2802 |
| 122 | Ga0068851_10251267 | 3300005834 | Bacteria | 1003 |
| 123 | Ga0068863_100164712 | 3300005841 | Bacteria | 2125 |
| 124 | Ga0068858_100465005 | 3300005842 | Bacteria | 1220 |
| 125 | Ga0070717_10061096 | 3300006028 | Bacteria | 3122 |
| 126 | Ga0070717_10361059 | 3300006028 | Bacteria | 1300 |
| 127 | Ga0075368_10030451 | 3300006042 | Bacteria | 2090 |
| 128 | Ga0075364_10022381 | 3300006051 | Bacteria | 3991 |
| 129 | Ga0075367_10001026 | 3300006178 | Bacteria | 11507 |
| 130 | Ga0097621_100004772 | 3300006237 | Bacteria | 9486 |
| 131 | Ga0075370_10010786 | 3300006353 | Bacteria | 4790 |
| 132 | Ga0075370_10206492 | 3300006353 | Bacteria | 1159 |
| 133 | Ga0068871_100017444 | 3300006358 | Bacteria | 5434 |
| 134 | Ga0075431_100110493 | 3300006847 | Bacteria | 2837 |
| 135 | Ga0068865_100033018 | 3300006881 | Bacteria | 3463 |
| 136 | Ga0075436_100292479 | 3300006914 | Bacteria | 1166 |
| 137 | Ga0105240_10002141 | 3300009093 | Bacteria | 32242 |
| 138 | Ga0105240_10269716 | 3300009093 | Bacteria | 1960 |
| 139 | Ga0105240_10291143 | 3300009093 | Bacteria | 1872 |
| 140 | Ga0105243_10000049 | 3300009148 | Bacteria | 145575 |
| 141 | Ga0105241_10257161 | 3300009174 | Bacteria | 1483 |
| 142 | Ga0105242_10626447 | 3300009176 | Bacteria | 1043 |
| 143 | Ga0105238_10060084 | 3300009551 | Bacteria | 3807 |
| 144 | Ga0105238_10378928 | 3300009551 | Bacteria | 1406 |
| 145 | Ga0105239_10276065 | 3300010375 | Bacteria | 1891 |
| 146 | Ga0105239_10656184 | 3300010375 | Bacteria | 1198 |
| 147 | Ga0157373_10009556 | 3300013100 | Bacteria | 7158 |
| 148 | Ga0157373_10043541 | 3300013100 | Bacteria | 3207 |
| 149 | Ga0157373_10201976 | 3300013100 | Bacteria | 1401 |
| 150 | Ga0157373_10417777 | 3300013100 | Bacteria | 963 |
| 151 | Ga0157371_10003962 | 3300013102 | Bacteria | 13135 |
| 152 | Ga0157371_10006514 | 3300013102 | Bacteria | 9609 |
| 153 | Ga0157371_10007842 | 3300013102 | Bacteria | 8570 |
| 154 | Ga0157371_10044125 | 3300013102 | Bacteria | 3175 |
| 155 | Ga0157371_10088842 | 3300013102 | Bacteria | 2188 |
| 156 | Ga0157370_10004189 | 3300013104 | Bacteria | 16690 |
| 157 | Ga0157370_10005551 | 3300013104 | Bacteria | 14141 |
| 158 | Ga0157370_10020929 | 3300013104 | Bacteria | 6524 |
| 159 | Ga0157370_10072428 | 3300013104 | Bacteria | 3251 |
| 160 | Ga0157370_10090519 | 3300013104 | Bacteria | 2873 |
| 161 | Ga0157369_10001072 | 3300013105 | Bacteria | 34302 |
| 162 | Ga0157369_10002003 | 3300013105 | Bacteria | 24533 |
| 163 | Ga0157369_10015476 | 3300013105 | Bacteria | 8595 |
| 164 | Ga0157369_10043085 | 3300013105 | Bacteria | 4921 |
| 165 | Ga0157369_10492411 | 3300013105 | Bacteria | 1268 |
| 166 | Ga0171462_1013 | 3300013250 | Bacteria | 202864 |
| 167 | Ga0157378_10026218 | 3300013297 | Bacteria | 5138 |
| 168 | Ga0157378_10210823 | 3300013297 | Bacteria | 1842 |
| 169 | Ga0157372_10004382 | 3300013307 | Bacteria | 15061 |
| 170 | Ga0157372_10081127 | 3300013307 | Bacteria | 3671 |
| 171 | Ga0157372_10124827 | 3300013307 | Bacteria | 2959 |
| 172 | Ga0163163_10248684 | 3300014325 | Bacteria | 1828 |
| 173 | Ga0157377_10067421 | 3300014745 | Bacteria | 2060 |
| 174 | Ga0157376_10216357 | 3300014969 | Bacteria | 1772 |
| 175 | Ga0182006_1000023 | 3300015261 | Bacteria | 275031 |
| 176 | Ga0182007_10000082 | 3300015262 | Bacteria | 71660 |
| 177 | Ga0182007_10000738 | 3300015262 | Bacteria | 18494 |
| 178 | Ga0182005_1000047 | 3300015265 | Bacteria | 126754 |
| 179 | Ga0182005_1000405 | 3300015265 | Bacteria | 23552 |
| 180 | Ga0163161_10001177 | 3300017792 | Bacteria | 19637 |
| 181 | Ga0213872_10000024 | 3300021361 | Bacteria | 155437 |
| 182 | Ga0213872_10010012 | 3300021361 | Bacteria | 4524 |
| 183 | Ga0209436_102173 | 3300025208 | Bacteria | 6125 |
| 184 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 185 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 186 | Ga0209566_100235 | 3300025225 | Bacteria | 53611 |
| 187 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 188 | Ga0209674_100189 | 3300025226 | Bacteria | 66805 |
| 189 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 190 | Ga0209563_107681 | 3300025230 | Bacteria | 1753 |
| 191 | Ga0207427_100432 | 3300025231 | Bacteria | 23437 |
| 192 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 193 | Ga0207425_1000036 | 3300025245 | Bacteria | 225783 |
| 194 | Ga0207425_1007318 | 3300025245 | Bacteria | 2924 |
| 195 | Ga0209646_1000119 | 3300025246 | Bacteria | 147427 |
| 196 | Ga0209646_1000125 | 3300025246 | Bacteria | 135847 |
| 197 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 198 | Ga0209677_103667 | 3300025253 | Bacteria | 4831 |
| 199 | Ga0209148_1000451 | 3300025254 | Bacteria | 45012 |
| 200 | Ga0209759_1001696 | 3300025256 | Bacteria | 11450 |
| 201 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 202 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 203 | Ga0209565_1000082 | 3300025263 | Bacteria | 154452 |
| 204 | Ga0209565_1001293 | 3300025263 | Bacteria | 11598 |
| 205 | Ga0209565_1002903 | 3300025263 | Bacteria | 5858 |
| 206 | Ga0209673_1000381 | 3300025273 | Bacteria | 80068 |
| 207 | Ga0209673_1001016 | 3300025273 | Bacteria | 33837 |
| 208 | Ga0209673_1018228 | 3300025273 | Bacteria | 2561 |
| 209 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 210 | Ga0209130_1000045 | 3300025284 | Bacteria | 240278 |
| 211 | Ga0209130_1003201 | 3300025284 | Bacteria | 7226 |
| 212 | Ga0209130_1033060 | 3300025284 | Bacteria | 1050 |
| 213 | Ga0209675_1000166 | 3300025291 | Bacteria | 80138 |
| 214 | Ga0209675_1002921 | 3300025291 | Bacteria | 8455 |
| 215 | Ga0209025_1000932 | 3300025294 | Bacteria | 44615 |
| 216 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 217 | Ga0209564_1000710 | 3300025295 | Bacteria | 48541 |
| 218 | Ga0209564_1006015 | 3300025295 | Bacteria | 6699 |
| 219 | Ga0209564_1007914 | 3300025295 | Bacteria | 5364 |
| 220 | Ga0209758_1007609 | 3300025297 | Bacteria | 7308 |
| 221 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 222 | Ga0209050_1000086 | 3300025298 | Bacteria | 262009 |
| 223 | Ga0209050_1000549 | 3300025298 | Bacteria | 62089 |
| 224 | Ga0209050_1003427 | 3300025298 | Bacteria | 11705 |
| 225 | Ga0209050_1016110 | 3300025298 | Bacteria | 3081 |
| 226 | Ga0209050_1022518 | 3300025298 | Bacteria | 2254 |
| 227 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 228 | Ga0209256_1000380 | 3300025299 | Bacteria | 70995 |
| 229 | Ga0209256_1001189 | 3300025299 | Bacteria | 29208 |
| 230 | Ga0209256_1007190 | 3300025299 | Bacteria | 5585 |
| 231 | Ga0207426_1004949 | 3300025302 | Bacteria | 6281 |
| 232 | Ga0207426_1027608 | 3300025302 | Bacteria | 1890 |
| 233 | Ga0209051_1005335 | 3300025303 | Bacteria | 7558 |
| 234 | Ga0209051_1060749 | 3300025303 | Bacteria | 1191 |
| 235 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 236 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 237 | Ga0209257_1000087 | 3300025304 | Bacteria | 282503 |
| 238 | Ga0209257_1000758 | 3300025304 | Bacteria | 48724 |
| 239 | Ga0209257_1004536 | 3300025304 | Bacteria | 10641 |
| 240 | Ga0209257_1017996 | 3300025304 | Bacteria | 2746 |
| 241 | Ga0209257_1065859 | 3300025304 | Bacteria | 971 |
| 242 | Ga0207647_10006567 | 3300025904 | Bacteria | 8449 |
| 243 | Ga0207705_10000124 | 3300025909 | Bacteria | 85292 |
| 244 | Ga0207705_10002001 | 3300025909 | Bacteria | 15842 |
| 245 | Ga0207705_10003314 | 3300025909 | Bacteria | 12245 |
| 246 | Ga0207705_10009518 | 3300025909 | Bacteria | 7071 |
| 247 | Ga0207705_10036010 | 3300025909 | Bacteria | 3543 |
| 248 | Ga0207705_10049500 | 3300025909 | Bacteria | 3024 |
| 249 | Ga0207705_10136230 | 3300025909 | Bacteria | 1831 |
| 250 | Ga0207684_10003787 | 3300025910 | Bacteria | 14597 |
| 251 | Ga0207684_10005345 | 3300025910 | Bacteria | 11869 |
| 252 | Ga0207707_10006462 | 3300025912 | Bacteria | 10235 |
| 253 | Ga0207707_10233962 | 3300025912 | Bacteria | 1598 |
| 254 | Ga0207695_10001916 | 3300025913 | Bacteria | 32377 |
| 255 | Ga0207695_10419923 | 3300025913 | Bacteria | 1222 |
| 256 | Ga0207671_10065042 | 3300025914 | Bacteria | 2712 |
| 257 | Ga0207660_10003417 | 3300025917 | Bacteria | 10358 |
| 258 | Ga0207660_10280589 | 3300025917 | Bacteria | 1322 |
| 259 | Ga0207657_10001711 | 3300025919 | Bacteria | 23648 |
| 260 | Ga0207657_10005837 | 3300025919 | Bacteria | 12826 |
| 261 | Ga0207657_10006696 | 3300025919 | Bacteria | 11910 |
| 262 | Ga0207657_10022472 | 3300025919 | Bacteria | 5898 |
| 263 | Ga0207649_10007919 | 3300025920 | Bacteria | 5783 |
| 264 | Ga0207649_10019063 | 3300025920 | Bacteria | 3917 |
| 265 | Ga0207649_10070711 | 3300025920 | Bacteria | 2227 |
| 266 | Ga0207649_10300559 | 3300025920 | Bacteria | 1173 |
| 267 | Ga0207649_10365423 | 3300025920 | Bacteria | 1072 |
| 268 | Ga0207652_10003472 | 3300025921 | Bacteria | 12998 |
| 269 | Ga0207652_10051424 | 3300025921 | Bacteria | 3532 |
| 270 | Ga0207652_10072632 | 3300025921 | Bacteria | 2992 |
| 271 | Ga0207652_10327225 | 3300025921 | Bacteria | 1384 |
| 272 | Ga0207652_10382602 | 3300025921 | Bacteria | 1270 |
| 273 | Ga0207646_10007230 | 3300025922 | Bacteria | 11322 |
| 274 | Ga0207646_10182204 | 3300025922 | Bacteria | 1897 |
| 275 | Ga0207646_10674083 | 3300025922 | Bacteria | 926 |
| 276 | Ga0207659_10058296 | 3300025926 | Bacteria | 2772 |
| 277 | Ga0207690_10000640 | 3300025932 | Bacteria | 22410 |
| 278 | Ga0207690_10061721 | 3300025932 | Bacteria | 2549 |
| 279 | Ga0207706_10003725 | 3300025933 | Bacteria | 14537 |
| 280 | Ga0207709_10000097 | 3300025935 | Bacteria | 136507 |
| 281 | Ga0207669_10023854 | 3300025937 | Bacteria | 3276 |
| 282 | Ga0207704_10002333 | 3300025938 | Bacteria | 8526 |
| 283 | Ga0207665_10227252 | 3300025939 | Bacteria | 1370 |
| 284 | Ga0207691_10072003 | 3300025940 | Bacteria | 3118 |
| 285 | Ga0207689_10000210 | 3300025942 | Bacteria | 51572 |
| 286 | Ga0207689_10174808 | 3300025942 | Bacteria | 1771 |
| 287 | Ga0207661_10015660 | 3300025944 | Bacteria | 5587 |
| 288 | Ga0207661_10169442 | 3300025944 | Bacteria | 1900 |
| 289 | Ga0207679_10000726 | 3300025945 | Bacteria | 21877 |
| 290 | Ga0207667_10003114 | 3300025949 | Bacteria | 20524 |
| 291 | Ga0207667_10018162 | 3300025949 | Bacteria | 7896 |
| 292 | Ga0207667_10041610 | 3300025949 | Bacteria | 4886 |
| 293 | Ga0207667_10063401 | 3300025949 | Bacteria | 3862 |
| 294 | Ga0207667_10139637 | 3300025949 | Bacteria | 2495 |
| 295 | Ga0207667_10861802 | 3300025949 | Bacteria | 900 |
| 296 | Ga0207640_10000964 | 3300025981 | Bacteria | 15982 |
| 297 | Ga0207640_10048289 | 3300025981 | Bacteria | 2750 |
| 298 | Ga0207640_10414767 | 3300025981 | Bacteria | 1100 |
| 299 | Ga0207658_10300956 | 3300025986 | Bacteria | 1382 |
| 300 | Ga0207677_10002753 | 3300026023 | Bacteria | 9281 |
| 301 | Ga0207677_10042952 | 3300026023 | Bacteria | 3002 |
| 302 | Ga0207677_10075484 | 3300026023 | Bacteria | 2396 |
| 303 | Ga0207677_10166499 | 3300026023 | Bacteria | 1718 |
| 304 | Ga0207703_10158910 | 3300026035 | Bacteria | 1978 |
| 305 | Ga0207639_10003417 | 3300026041 | Bacteria | 10681 |
| 306 | Ga0207639_10036461 | 3300026041 | Bacteria | 3644 |
| 307 | Ga0207639_10062357 | 3300026041 | Bacteria | 2883 |
| 308 | Ga0207639_10063862 | 3300026041 | Bacteria | 2852 |
| 309 | Ga0207639_10096969 | 3300026041 | Bacteria | 2373 |
| 310 | Ga0207639_10216388 | 3300026041 | Bacteria | 1652 |
| 311 | Ga0207639_10244202 | 3300026041 | Bacteria | 1563 |
| 312 | Ga0207678_10315756 | 3300026067 | Bacteria | 1344 |
| 313 | Ga0207702_10000625 | 3300026078 | Bacteria | 38874 |
| 314 | Ga0207702_10061656 | 3300026078 | Bacteria | 3200 |
| 315 | Ga0207702_10064378 | 3300026078 | Bacteria | 3137 |
| 316 | Ga0207702_10093783 | 3300026078 | Bacteria | 2633 |
| 317 | Ga0207702_10172263 | 3300026078 | Bacteria | 1986 |
| 318 | Ga0207641_10393577 | 3300026088 | Bacteria | 1329 |
| 319 | Ga0207648_10003807 | 3300026089 | Bacteria | 15768 |
| 320 | Ga0207648_10020786 | 3300026089 | Bacteria | 5909 |
| 321 | Ga0207648_10033839 | 3300026089 | Bacteria | 4506 |
| 322 | Ga0207648_10050196 | 3300026089 | Bacteria | 3649 |
| 323 | Ga0207676_10401277 | 3300026095 | Bacteria | 1281 |
| 324 | Ga0207683_10053454 | 3300026121 | Bacteria | 3542 |
| 325 | Ga0207698_10000067 | 3300026142 | Bacteria | 70181 |
| 326 | Ga0207698_10001225 | 3300026142 | Bacteria | 14990 |
| 327 | Ga0207698_10140862 | 3300026142 | Bacteria | 2078 |
| 328 | Ga0207698_10564615 | 3300026142 | Bacteria | 1117 |
| 329 | Ga0209813_10000036 | 3300027866 | Bacteria | 58545 |
| 330 | Ga0207428_10214951 | 3300027907 | Bacteria | 1443 |
| 331 | Ga0268266_10080979 | 3300028379 | Bacteria | 2830 |
| 332 | Ga0265337_1027544 | 3300028556 | Bacteria | 1712 |
| 333 | Ga0265319_1021900 | 3300028563 | Bacteria | 2339 |
| 334 | Ga0265318_10029226 | 3300028577 | Bacteria | 2150 |
| 335 | Ga0265318_10105275 | 3300028577 | Bacteria | 1037 |
| 336 | Ga0265336_10040714 | 3300028666 | Bacteria | 1422 |
| 337 | Ga0307517_10031004 | 3300028786 | Bacteria | 6243 |
| 338 | Ga0307515_10022699 | 3300028794 | Bacteria | 11044 |
| 339 | Ga0316177_1204721 | 3300030731 | Bacteria | 2356 |
| 340 | Ga0265330_10000003 | 3300031235 | Archaea | 392850 |
| 341 | Ga0265328_10000007 | 3300031239 | Bacteria | 224310 |
| 342 | Ga0265320_10001237 | 3300031240 | Bacteria | 18762 |
| 343 | Ga0265320_10027218 | 3300031240 | Bacteria | 2984 |
| 344 | Ga0265325_10025806 | 3300031241 | Bacteria | 3188 |
| 345 | Ga0265340_10023903 | 3300031247 | Archaea | 3110 |
| 346 | Ga0265339_10056511 | 3300031249 | Archaea | 2125 |
| 347 | Ga0265331_10010335 | 3300031250 | Bacteria | 5171 |
| 348 | Ga0265331_10020675 | 3300031250 | Bacteria | 3376 |
| 349 | Ga0265331_10105838 | 3300031250 | Bacteria | 1292 |
| 350 | Ga0265327_10007906 | 3300031251 | Bacteria | 8060 |
| 351 | Ga0265327_10011866 | 3300031251 | Bacteria | 5953 |
| 352 | Ga0265316_10002008 | 3300031344 | Archaea | 21445 |
| 353 | Ga0307513_10051934 | 3300031456 | Bacteria | 4417 |
| 354 | Ga0307408_100000017 | 3300031548 | Bacteria | 355890 |
| 355 | Ga0307408_100000021 | 3300031548 | Bacteria | 312158 |
| 356 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 357 | Ga0307408_100036159 | 3300031548 | Bacteria | 3471 |
| 358 | Ga0307408_100045674 | 3300031548 | Bacteria | 3129 |
| 359 | Ga0307408_100537397 | 3300031548 | Bacteria | 1029 |
| 360 | Ga0265313_10005994 | 3300031595 | Bacteria | 8783 |
| 361 | Ga0265313_10137433 | 3300031595 | Bacteria | 1054 |
| 362 | Ga0316579_10031269 | 3300031691 | Bacteria | 2436 |
| 363 | Ga0316579_10033419 | 3300031691 | Bacteria | 2362 |
| 364 | Ga0265314_10023239 | 3300031711 | Bacteria | 4732 |
| 365 | Ga0265314_10119946 | 3300031711 | Bacteria | 1657 |
| 366 | Ga0265314_10199968 | 3300031711 | Bacteria | 1182 |
| 367 | Ga0265342_10000068 | 3300031712 | Archaea | 110846 |
| 368 | Ga0265342_10021823 | 3300031712 | Archaea | 4081 |
| 369 | Ga0265342_10031893 | 3300031712 | Archaea | 3253 |
| 370 | Ga0316576_10017373 | 3300031727 | Bacteria | 4885 |
| 371 | Ga0316576_10017770 | 3300031727 | Bacteria | 4841 |
| 372 | Ga0316578_10041569 | 3300031728 | Bacteria | 2663 |
| 373 | Ga0316578_10328640 | 3300031728 | Bacteria | 912 |
| 374 | Ga0307405_10004498 | 3300031731 | Bacteria | 6598 |
| 375 | Ga0307405_10093752 | 3300031731 | Bacteria | 1995 |
| 376 | Ga0316577_10000005 | 3300031733 | Bacteria | 43786 |
| 377 | Ga0316577_10006115 | 3300031733 | Bacteria | 6343 |
| 378 | Ga0316577_10092258 | 3300031733 | Bacteria | 1695 |
| 379 | Ga0307413_10004455 | 3300031824 | Bacteria | 6099 |
| 380 | Ga0307413_10112104 | 3300031824 | Bacteria | 1828 |
| 381 | Ga0307413_10178798 | 3300031824 | Bacteria | 1510 |
| 382 | Ga0307413_10180480 | 3300031824 | Bacteria | 1504 |
| 383 | Ga0307410_10000060 | 3300031852 | Bacteria | 38643 |
| 384 | Ga0307410_10107476 | 3300031852 | Bacteria | 2012 |
| 385 | Ga0307406_10044481 | 3300031901 | Bacteria | 2783 |
| 386 | Ga0307406_10211374 | 3300031901 | Bacteria | 1435 |
| 387 | Ga0307406_10455573 | 3300031901 | Bacteria | 1027 |
| 388 | Ga0307407_10000127 | 3300031903 | Bacteria | 23831 |
| 389 | Ga0307407_10020467 | 3300031903 | Bacteria | 3391 |
| 390 | Ga0307407_10045110 | 3300031903 | Bacteria | 2489 |
| 391 | Ga0307407_10189905 | 3300031903 | Bacteria | 1368 |
| 392 | Ga0307412_10000037 | 3300031911 | Bacteria | 192170 |
| 393 | Ga0307412_10002397 | 3300031911 | Bacteria | 10415 |
| 394 | Ga0307412_10062330 | 3300031911 | Bacteria | 2510 |
| 395 | Ga0307412_10102474 | 3300031911 | Bacteria | 2027 |
| 396 | Ga0307412_10107832 | 3300031911 | Bacteria | 1983 |
| 397 | Ga0307412_10176774 | 3300031911 | Bacteria | 1601 |
| 398 | Ga0307412_10427220 | 3300031911 | Bacteria | 1085 |
| 399 | Ga0307409_100000021 | 3300031995 | Bacteria | 54572 |
| 400 | Ga0307409_100001401 | 3300031995 | Bacteria | 11788 |
| 401 | Ga0307409_100013413 | 3300031995 | Bacteria | 5274 |
| 402 | Ga0307416_100000256 | 3300032002 | Bacteria | 28439 |
| 403 | Ga0307416_100003131 | 3300032002 | Bacteria | 9683 |
| 404 | Ga0307416_100085761 | 3300032002 | Bacteria | 2681 |
| 405 | Ga0307416_100091691 | 3300032002 | Bacteria | 2610 |
| 406 | Ga0307414_10000015 | 3300032004 | Bacteria | 268602 |
| 407 | Ga0307414_10022625 | 3300032004 | Bacteria | 3969 |
| 408 | Ga0307414_10049920 | 3300032004 | Bacteria | 2895 |
| 409 | Ga0307414_10096888 | 3300032004 | Bacteria | 2208 |
| 410 | Ga0307414_10377810 | 3300032004 | Bacteria | 1224 |
| 411 | Ga0307414_10434058 | 3300032004 | Bacteria | 1148 |
| 412 | Ga0307414_10624735 | 3300032004 | Bacteria | 969 |
| 413 | Ga0307411_10002554 | 3300032005 | Bacteria | 8117 |
| 414 | Ga0307411_10052013 | 3300032005 | Bacteria | 2676 |
| 415 | Ga0307411_10231558 | 3300032005 | Bacteria | 1440 |
| 416 | Ga0307415_100062314 | 3300032126 | Bacteria | 2586 |
| 417 | Ga0307415_100129490 | 3300032126 | Bacteria | 1907 |
| 418 | Ga0307415_100167425 | 3300032126 | Bacteria | 1710 |
| 419 | Ga0373950_0003923 | 3300034818 | Bacteria | 2159 |
| 420 | Ga0373959_0043423 | 3300034820 | Bacteria | 950 |
| 421 | Ga0373940_0004154 | 3300035088 | Bacteria | 3037 |
| 422 | Ga0373932_0007834 | 3300035112 | Bacteria | 2550 |
| 423 | Ga0373939_0000012 | 3300035114 | Bacteria | 67223 |
| 424 | Ga0373941_0062088 | 3300035115 | Bacteria | 1219 |
| 425 | Ga0373960_0002596 | 3300035121 | Bacteria | 4080 |
| 426 | Ga0373960_0056083 | 3300035121 | Bacteria | 1182 |
| 427 | Ga0373946_0144678 | 3300035171 | Bacteria | 1105 |
| 428 | Ga0373962_0013769 | 3300035242 | Bacteria | 2053 |
| 429 | Ga0373931_0001221 | 3300035691 | Bacteria | 10994 |
| 430 | Ga0373931_0054807 | 3300035691 | Bacteria | 2132 |
| 431 | Ga0373937_0221650 | 3300036401 | Bacteria | 1780 |
| 432 | Ga0316582_0015261 | 3300036647 | Bacteria | 4387 |
| 433 | Ga0316582_0035596 | 3300036647 | Bacteria | 3076 |
| 434 | Ga0316582_0081835 | 3300036647 | Bacteria | 2110 |
| 435 | Ga0316582_0150903 | 3300036647 | Bacteria | 1571 |
| 436 | Ga0316584_0001705 | 3300036712 | Bacteria | 13469 |
| 437 | Ga0316584_0024370 | 3300036712 | Bacteria | 4428 |
| 438 | Ga0316584_0029083 | 3300036712 | Bacteria | 4079 |
| 439 | Ga0316584_0065259 | 3300036712 | Bacteria | 2727 |
| 440 | Ga0316584_0098934 | 3300036712 | Bacteria | 2184 |
| 441 | Ga0316584_0302646 | 3300036712 | Bacteria | 1157 |
| 442 | Ga0395899_0025590 | 3300037312 | Bacteria | 4454 |
| 443 | Ga0395899_0178600 | 3300037312 | Bacteria | 1491 |
| 444 | Ga0395900_0121609 | 3300037418 | Bacteria | 2678 |
| 445 | Ga0395900_0132761 | 3300037418 | Bacteria | 2551 |
| 446 | Ga0395900_0162442 | 3300037418 | Bacteria | 2278 |
| 447 | Ga0395900_0384153 | 3300037418 | Bacteria | 1371 |
| 448 | Ga0395900_0510083 | 3300037418 | Bacteria | 1152 |
| 449 | Ga0395898_0212860 | 3300037466 | Bacteria | 1843 |
| 450 | Ga0395905_0013332 | 3300037471 | Bacteria | 7879 |
| 451 | Ga0395905_0055988 | 3300037471 | Bacteria | 3691 |
| 452 | Ga0395905_0099738 | 3300037471 | Bacteria | 2727 |
| 453 | Ga0316581_0009290 | 3300037588 | Bacteria | 2700 |
| 454 | Ga0316581_0018105 | 3300037588 | Bacteria | 2042 |
| 455 | Ga0395901_0030541 | 3300038443 | Bacteria | 5551 |
| 456 | Ga0395901_0118720 | 3300038443 | Bacteria | 2779 |
| 457 | Ga0400483_016212 | 3300039062 | Bacteria | 18792 |
| 458 | Ga0400483_102702 | 3300039062 | Bacteria | 5345 |
| 459 | Ga0400483_180833 | 3300039062 | Bacteria | 2136 |
| 460 | Ga0400483_192590 | 3300039062 | Bacteria | 14783 |
| 461 | Ga0436361_0224368 | 3300039447 | Bacteria | 99317 |
| 462 | Ga0436362_1002824 | 3300039453 | Bacteria | 3171 |
| 463 | Ga0439453_0003984 | 3300041408 | Bacteria | 2168 |
| 464 | Ga0439465_0035505 | 3300041413 | Bacteria | 1598 |
| 465 | Ga0451849_0296662 | 3300041505 | Bacteria | 1882 |
| 466 | Ga0451843_0077392 | 3300041509 | Bacteria | 2502 |
| 467 | Ga0451853_3488129 | 3300041512 | Bacteria | 1306 |
| 468 | Ga0439431_0008649 | 3300041997 | Bacteria | 2290 |
| 469 | Ga0439445_0049126 | 3300042004 | Bacteria | 1135 |
| 470 | Ga0439462_0023322 | 3300042015 | Bacteria | 1622 |
| 471 | Ga0450890_000001 | 3300042127 | Bacteria | 192635 |
| 472 | Ga0450891_002701 | 3300042129 | Bacteria | 1763 |
| 473 | Ga0450892_000061 | 3300042130 | Bacteria | 12112 |
| 474 | Ga0439434_0111084 | 3300042435 | Bacteria | 888 |
| 475 | Ga0450893_0028936 | 3300042532 | Bacteria | 981 |
| 476 | Ga0451577_0002436 | 3300042876 | Archaea | 22189 |
| 477 | Ga0451577_0019946 | 3300042876 | Archaea | 6158 |
| 478 | Ga0451577_0260376 | 3300042876 | Bacteria | 1571 |
| 479 | Ga0453683_0001847 | 3300044673 | Bacteria | 17391 |
| 480 | Ga0453683_0018503 | 3300044673 | Bacteria | 4474 |
| 481 | Ga0453683_0108033 | 3300044673 | Bacteria | 1749 |
| 482 | Ga0466965_0008880 | 3300044683 | Bacteria | 4658 |
| 483 | Ga0466961_0280837 | 3300044693 | Bacteria | 1019 |
| 484 | Ga0453684_0000050 | 3300044712 | Archaea | 558429 |
| 485 | Ga0453684_0000597 | 3300044712 | Archaea | 134014 |
| 486 | Ga0453684_0005953 | 3300044712 | Archaea | 23645 |
| 487 | Ga0453684_0006998 | 3300044712 | Archaea | 21094 |
| 488 | Ga0453684_0011404 | 3300044712 | Bacteria | 14915 |
| 489 | Ga0453684_0018796 | 3300044712 | Archaea | 10575 |
| 490 | Ga0453684_0034822 | 3300044712 | Archaea | 6977 |
| 491 | Ga0453684_0094771 | 3300044712 | Archaea | 3671 |
| 492 | Ga0453684_0173046 | 3300044712 | Archaea | 2542 |
| 493 | Ga0453684_0289883 | 3300044712 | Bacteria | 1864 |
| 494 | Ga0453684_0383067 | 3300044712 | Archaea | 1579 |
| 495 | Ga0453684_0572483 | 3300044712 | Bacteria | 1241 |
| 496 | Ga0466960_0203862 | 3300044901 | Bacteria | 1082 |
| 497 | Ga0466959_0040583 | 3300045049 | Bacteria | 3438 |
| 498 | Ga0451576_0000586 | 3300045051 | Bacteria | 77149 |
| 499 | Ga0451576_0007631 | 3300045051 | Bacteria | 12870 |
| 500 | Ga0451576_0009304 | 3300045051 | Archaea | 11409 |
| 501 | Ga0451576_0011237 | 3300045051 | Bacteria | 10199 |
| 502 | Ga0451576_0184805 | 3300045051 | Bacteria | 2176 |
| 503 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 504 | Ga0495592_0010239 | 3300046454 | Bacteria | 7069 |
| 505 | Ga0495638_0028580 | 3300046460 | Bacteria | 3599 |
| 506 | Ga0495638_0263448 | 3300046460 | Bacteria | 944 |
| 507 | Ga0495651_0006882 | 3300046462 | Bacteria | 8689 |
| 508 | Ga0495653_0002868 | 3300046463 | Bacteria | 13781 |
| 509 | Ga0495650_0000128 | 3300046471 | Bacteria | 177256 |
| 510 | Ga0495650_0002873 | 3300046471 | Bacteria | 13135 |
| 511 | Ga0495605_0000018 | 3300046474 | Bacteria | 270187 |
| 512 | Ga0495605_0001131 | 3300046474 | Bacteria | 17689 |
| 513 | Ga0495584_0021167 | 3300046491 | Bacteria | 3302 |
| 514 | Ga0495584_0081848 | 3300046491 | Bacteria | 1625 |
| 515 | Ga0495607_0002432 | 3300046501 | Bacteria | 15195 |
| 516 | Ga0495607_0007691 | 3300046501 | Bacteria | 7428 |
| 517 | Ga0495583_0000115 | 3300046506 | Bacteria | 135762 |
| 518 | Ga0495583_0001058 | 3300046506 | Bacteria | 30795 |
| 519 | Ga0495583_0067571 | 3300046506 | Bacteria | 1578 |
| 520 | Ga0495606_0000228 | 3300046507 | Bacteria | 99761 |
| 521 | Ga0495606_0000288 | 3300046507 | Bacteria | 87389 |
| 522 | Ga0495606_0000790 | 3300046507 | Bacteria | 48364 |
| 523 | Ga0495606_0001799 | 3300046507 | Bacteria | 27290 |
| 524 | Ga0495608_0007317 | 3300046511 | Bacteria | 7801 |
| 525 | Ga0495608_0023636 | 3300046511 | Bacteria | 4210 |
| 526 | Ga0495610_0018280 | 3300046512 | Bacteria | 3964 |
| 527 | Ga0495610_0035550 | 3300046512 | Bacteria | 2556 |
| 528 | Ga0495618_0080496 | 3300046514 | Bacteria | 2078 |
| 529 | Ga0495628_0001227 | 3300046516 | Bacteria | 23459 |
| 530 | Ga0495628_0002006 | 3300046516 | Bacteria | 18454 |
| 531 | Ga0495637_0000142 | 3300046520 | Bacteria | 54212 |
| 532 | Ga0495637_0000731 | 3300046520 | Bacteria | 22394 |
| 533 | Ga0495643_0000082 | 3300046522 | Bacteria | 159651 |
| 534 | Ga0495643_0207375 | 3300046522 | Bacteria | 937 |
| 535 | Ga0495648_0000732 | 3300046524 | Bacteria | 35084 |
| 536 | Ga0495648_0013009 | 3300046524 | Bacteria | 6177 |
| 537 | Ga0495648_0088915 | 3300046524 | Bacteria | 1735 |
| 538 | Ga0495648_0135341 | 3300046524 | Bacteria | 1304 |
| 539 | Ga0495642_0039791 | 3300046528 | Bacteria | 1908 |
| 540 | Ga0495652_0014687 | 3300046529 | Bacteria | 7022 |
| 541 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 542 | Ga0495609_0000434 | 3300046538 | Bacteria | 34673 |
| 543 | Ga0495609_0000537 | 3300046538 | Bacteria | 30126 |
| 544 | Ga0495609_0002203 | 3300046538 | Bacteria | 12207 |
| 545 | Ga0495621_0005796 | 3300046539 | Bacteria | 3570 |
| 546 | Ga0495597_0000321 | 3300046542 | Bacteria | 43353 |
| 547 | Ga0495645_0028629 | 3300046543 | Bacteria | 4049 |
| 548 | Ga0495645_0049548 | 3300046543 | Bacteria | 3058 |
| 549 | Ga0495622_0000034 | 3300046557 | Bacteria | 123671 |
| 550 | Ga0495622_0078600 | 3300046557 | Bacteria | 1519 |
| 551 | Ga0495633_0000100 | 3300046558 | Bacteria | 116284 |
| 552 | Ga0495633_0000217 | 3300046558 | Bacteria | 71892 |
| 553 | Ga0495633_0012689 | 3300046558 | Bacteria | 4470 |
| 554 | Ga0495633_0197310 | 3300046558 | Bacteria | 924 |
| 555 | Ga0495656_0020157 | 3300046615 | Bacteria | 2583 |
| 556 | Ga0495668_0000231 | 3300046616 | Bacteria | 79433 |
| 557 | Ga0495668_0000308 | 3300046616 | Bacteria | 67599 |
| 558 | Ga0495668_0054396 | 3300046616 | Bacteria | 2212 |
| 559 | Ga0495625_0046579 | 3300046660 | Bacteria | 3128 |
| 560 | Ga0495625_0205171 | 3300046660 | Bacteria | 1298 |
| 561 | Ga0495659_0000272 | 3300046664 | Bacteria | 21144 |
| 562 | Ga0495661_0005558 | 3300046665 | Bacteria | 8940 |
| 563 | Ga0495661_0152463 | 3300046665 | Bacteria | 1247 |
| 564 | Ga0495657_0145258 | 3300046675 | Bacteria | 1476 |
| 565 | Ga0495646_0004004 | 3300046680 | Bacteria | 9228 |
| 566 | Ga0495646_0069647 | 3300046680 | Bacteria | 2074 |
| 567 | Ga0495669_0001487 | 3300046684 | Bacteria | 9657 |
| 568 | Ga0495624_0077378 | 3300046690 | Bacteria | 2063 |
| 569 | Ga0495671_0058521 | 3300046692 | Bacteria | 1906 |
| 570 | Ga0495649_0046175 | 3300046694 | Bacteria | 2372 |
| 571 | Ga0495649_0106751 | 3300046694 | Bacteria | 1486 |
| 572 | Ga0495649_0111838 | 3300046694 | Bacteria | 1448 |
| 573 | Ga0495649_0152287 | 3300046694 | Bacteria | 1214 |
| 574 | Ga0495600_0001954 | 3300046809 | Bacteria | 11584 |
| 575 | Ga0495660_0028809 | 3300046810 | Bacteria | 3135 |
| 576 | Ga0495604_0044258 | 3300047317 | Bacteria | 3479 |
| 577 | Ga0495604_0044839 | 3300047317 | Bacteria | 3453 |
| 578 | Ga0495636_0002097 | 3300047318 | Bacteria | 7669 |
| 579 | Ga0495636_0027842 | 3300047318 | Bacteria | 2302 |
| 580 | Ga0495672_0000081 | 3300047320 | Bacteria | 159863 |
| 581 | Ga0495672_0034660 | 3300047320 | Bacteria | 3116 |
| 582 | Ga0495683_0014292 | 3300047323 | Bacteria | 4135 |
| 583 | Ga0495687_000172 | 3300047443 | Bacteria | 95963 |
| 584 | Ga0495687_000323 | 3300047443 | Bacteria | 62186 |
| 585 | Ga0495687_000446 | 3300047443 | Bacteria | 50964 |
| 586 | Ga0495687_000699 | 3300047443 | Bacteria | 37523 |
| 587 | Ga0495677_0010342 | 3300047445 | Bacteria | 3427 |
| 588 | Ga0495685_000034 | 3300047447 | Bacteria | 56654 |
| 589 | Ga0495685_005609 | 3300047447 | Bacteria | 4100 |
| 590 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 591 | Ga0495673_0008115 | 3300047469 | Bacteria | 5943 |
| 592 | Ga0495681_0013190 | 3300047470 | Bacteria | 4811 |
| 593 | Ga0495681_0022454 | 3300047470 | Bacteria | 3375 |
| 594 | Ga0495686_0000604 | 3300047472 | Bacteria | 49704 |
| 595 | Ga0495686_0000677 | 3300047472 | Bacteria | 46044 |
| 596 | Ga0495686_0006562 | 3300047472 | Bacteria | 8878 |
| 597 | Ga0495686_0014303 | 3300047472 | Bacteria | 5466 |
| 598 | Ga0495686_0037907 | 3300047472 | Bacteria | 3086 |
| 599 | Ga0495686_0056991 | 3300047472 | Bacteria | 2439 |
| 600 | Ga0495602_0128770 | 3300048088 | Bacteria | 2022 |
| 601 | Ga0496101_0284360 | 3300048904 | Bacteria | 1293 |
| 602 | Ga0496102_0031911 | 3300048905 | Bacteria | 4729 |
| 603 | Ga0496102_0116510 | 3300048905 | Bacteria | 2493 |
| 604 | Ga0496103_0001821 | 3300048906 | Bacteria | 13881 |
| 605 | Ga0496104_0175888 | 3300048907 | Bacteria | 2051 |
| 606 | Ga0496105_0022519 | 3300048908 | Bacteria | 5104 |
| 607 | Ga0496108_0196008 | 3300048911 | Bacteria | 1752 |
| 608 | Ga0496110_0348147 | 3300048913 | Bacteria | 1350 |
| 609 | Ga0496112_0000200 | 3300048915 | Bacteria | 39289 |
| 610 | Ga0496114_0002554 | 3300048917 | Bacteria | 13899 |
| 611 | Ga0496114_0442897 | 3300048917 | Bacteria | 1150 |
| 612 | Ga0496115_0010435 | 3300048918 | Bacteria | 6941 |
| 613 | Ga0496116_0021069 | 3300048919 | Bacteria | 4927 |
| 614 | Ga0496116_0059847 | 3300048919 | Bacteria | 2474 |
| 615 | Ga0496116_0079691 | 3300048919 | Bacteria | 2036 |
| 616 | Ga0496117_0000075 | 3300048920 | Bacteria | 232451 |
| 617 | Ga0496117_0021543 | 3300048920 | Bacteria | 5209 |
| 618 | Ga0496118_0000055 | 3300048921 | Bacteria | 232451 |
| 619 | Ga0496119_0018246 | 3300048922 | Bacteria | 5237 |
| 620 | Ga0496120_0059824 | 3300048923 | Bacteria | 2134 |
| 621 | Ga0496120_0062601 | 3300048923 | Bacteria | 2072 |
| 622 | Ga0496121_0028678 | 3300048924 | Bacteria | 5176 |
| 623 | Ga0496121_0054149 | 3300048924 | Bacteria | 3355 |
| 624 | Ga0496122_0003176 | 3300048925 | Bacteria | 21923 |
| 625 | Ga0496122_0003599 | 3300048925 | Bacteria | 20191 |
| 626 | Ga0496122_0049349 | 3300048925 | Bacteria | 3225 |
| 627 | Ga0496122_0276732 | 3300048925 | Bacteria | 920 |
| 628 | Ga0496123_0001626 | 3300048926 | Bacteria | 30247 |
| 629 | Ga0496123_0053057 | 3300048926 | Bacteria | 2683 |
| 630 | Ga0496123_0055289 | 3300048926 | Bacteria | 2605 |
| 631 | Ga0496124_0002918 | 3300048927 | Bacteria | 21559 |
| 632 | Ga0496124_0022595 | 3300048927 | Bacteria | 5760 |
| 633 | Ga0496124_0032120 | 3300048927 | Bacteria | 4641 |
| 634 | Ga0496124_0044471 | 3300048927 | Bacteria | 3810 |
| 635 | Ga0496124_0049085 | 3300048927 | Bacteria | 3602 |
| 636 | Ga0496124_0158652 | 3300048927 | Bacteria | 1766 |
| 637 | Ga0496124_0163571 | 3300048927 | Bacteria | 1732 |
| 638 | Ga0496124_0323381 | 3300048927 | Bacteria | 1103 |
| 639 | Ga0496125_0002758 | 3300048928 | Bacteria | 22227 |
| 640 | Ga0496125_0025532 | 3300048928 | Bacteria | 5408 |
| 641 | Ga0496125_0120648 | 3300048928 | Bacteria | 1871 |
| 642 | Ga0496125_0242657 | 3300048928 | Bacteria | 1142 |
| 643 | Ga0496126_0005903 | 3300048929 | Bacteria | 13809 |
| 644 | Ga0495678_000027 | 3300049459 | Bacteria | 222075 |
| 645 | Ga0495678_000346 | 3300049459 | Bacteria | 48212 |
| 646 | Ga0495678_000549 | 3300049459 | Bacteria | 36201 |
| 647 | Ga0495682_0000999 | 3300049460 | Bacteria | 16865 |
| 648 | Ga0501300_009813 | 3300049523 | Bacteria | 1396 |
| 649 | Ga0501031_0000002 | 3300049568 | Bacteria | 217588 |
| 650 | Ga0501031_0002629 | 3300049568 | Bacteria | 11429 |
| 651 | Ga0501031_0036952 | 3300049568 | Bacteria | 3187 |
| 652 | Ga0501031_0058606 | 3300049568 | Bacteria | 2509 |
| 653 | Ga0501031_0123349 | 3300049568 | Bacteria | 1692 |
| 654 | Ga0501032_0000004 | 3300049569 | Bacteria | 310855 |
| 655 | Ga0501032_0000851 | 3300049569 | Bacteria | 24758 |
| 656 | Ga0501032_0002674 | 3300049569 | Bacteria | 13907 |
| 657 | Ga0501032_0005458 | 3300049569 | Bacteria | 9438 |
| 658 | Ga0501032_0067334 | 3300049569 | Bacteria | 2392 |
| 659 | Ga0501033_0000016 | 3300049570 | Bacteria | 217458 |
| 660 | Ga0501033_0009280 | 3300049570 | Bacteria | 7579 |
| 661 | Ga0501033_0014684 | 3300049570 | Bacteria | 5945 |
| 662 | Ga0501033_0051714 | 3300049570 | Bacteria | 3045 |
| 663 | Ga0501033_0099319 | 3300049570 | Bacteria | 2125 |
| 664 | Ga0501033_0140160 | 3300049570 | Bacteria | 1748 |
| 665 | Ga0501033_0197852 | 3300049570 | Bacteria | 1436 |
| 666 | Ga0501034_0000011 | 3300049571 | Bacteria | 310855 |
| 667 | Ga0501034_0009670 | 3300049571 | Bacteria | 10085 |
| 668 | Ga0501034_0012065 | 3300049571 | Bacteria | 8933 |
| 669 | Ga0501034_0027699 | 3300049571 | Bacteria | 5762 |
| 670 | Ga0501034_0108886 | 3300049571 | Bacteria | 2762 |
| 671 | Ga0501034_0171146 | 3300049571 | Bacteria | 2139 |
| 672 | Ga0501034_0179352 | 3300049571 | Bacteria | 2083 |
| 673 | Ga0501034_0551747 | 3300049571 | Bacteria | 1062 |
| 674 | Ga0501036_0000001 | 3300049572 | Bacteria | 310855 |
| 675 | Ga0501036_0004087 | 3300049572 | Bacteria | 11744 |
| 676 | Ga0501036_0006219 | 3300049572 | Bacteria | 9684 |
| 677 | Ga0501036_0121271 | 3300049572 | Bacteria | 2208 |
| 678 | Ga0501037_0000006 | 3300049573 | Bacteria | 217461 |
| 679 | Ga0501037_0005227 | 3300049573 | Bacteria | 9438 |
| 680 | Ga0501038_0000003 | 3300049574 | Bacteria | 310855 |
| 681 | Ga0501038_0002842 | 3300049574 | Bacteria | 16112 |
| 682 | Ga0501038_0003593 | 3300049574 | Bacteria | 14430 |
| 683 | Ga0501038_0004599 | 3300049574 | Bacteria | 12837 |
| 684 | Ga0501038_0022177 | 3300049574 | Bacteria | 5691 |
| 685 | Ga0501038_0047786 | 3300049574 | Bacteria | 3706 |
| 686 | Ga0501038_0165298 | 3300049574 | Bacteria | 1795 |
| 687 | Ga0501039_0000004 | 3300049575 | Bacteria | 310855 |
| 688 | Ga0501039_0007003 | 3300049575 | Bacteria | 8585 |
| 689 | Ga0501039_0007282 | 3300049575 | Bacteria | 8427 |
| 690 | Ga0501039_0425002 | 3300049575 | Bacteria | 1044 |
| 691 | Ga0501040_0006407 | 3300049576 | Bacteria | 7644 |
| 692 | Ga0501042_0002271 | 3300049578 | Bacteria | 11737 |
| 693 | Ga0501042_0359116 | 3300049578 | Bacteria | 1054 |
| 694 | Ga0501043_0000590 | 3300049579 | Bacteria | 32162 |
| 695 | Ga0501043_0000765 | 3300049579 | Bacteria | 28587 |
| 696 | Ga0501043_0010344 | 3300049579 | Bacteria | 7313 |
| 697 | Ga0501043_0011693 | 3300049579 | Bacteria | 6871 |
| 698 | Ga0501043_0076329 | 3300049579 | Bacteria | 2632 |
| 699 | Ga0501043_0108233 | 3300049579 | Bacteria | 2183 |
| 700 | Ga0501043_0193196 | 3300049579 | Bacteria | 1582 |
| 701 | Ga0501046_0000766 | 3300049580 | Bacteria | 31118 |
| 702 | Ga0501046_0003768 | 3300049580 | Bacteria | 13880 |
| 703 | Ga0501046_0014305 | 3300049580 | Bacteria | 6700 |
| 704 | Ga0501046_0062502 | 3300049580 | Bacteria | 2909 |
| 705 | Ga0501046_0068161 | 3300049580 | Bacteria | 2769 |
| 706 | Ga0501046_0071668 | 3300049580 | Bacteria | 2692 |
| 707 | Ga0501047_0004204 | 3300049581 | Bacteria | 13561 |
| 708 | Ga0501047_0004747 | 3300049581 | Bacteria | 12779 |
| 709 | Ga0501047_0008050 | 3300049581 | Bacteria | 9947 |
| 710 | Ga0501047_0050498 | 3300049581 | Bacteria | 4017 |
| 711 | Ga0501047_0145161 | 3300049581 | Bacteria | 2250 |
| 712 | Ga0501047_0199936 | 3300049581 | Bacteria | 1859 |
| 713 | Ga0501047_0222918 | 3300049581 | Bacteria | 1741 |
| 714 | Ga0501047_0293142 | 3300049581 | Bacteria | 1470 |
| 715 | Ga0501047_0677411 | 3300049581 | Bacteria | 849 |
| 716 | Ga0501048_0010447 | 3300049582 | Bacteria | 6931 |
| 717 | Ga0501068_0001005 | 3300049584 | Bacteria | 14851 |
| 718 | Ga0501068_0107214 | 3300049584 | Bacteria | 1735 |
| 719 | Ga0501070_0001202 | 3300049586 | Bacteria | 23186 |
| 720 | Ga0501070_0006268 | 3300049586 | Bacteria | 10122 |
| 721 | Ga0501070_0029248 | 3300049586 | Bacteria | 4621 |
| 722 | Ga0501070_0136969 | 3300049586 | Bacteria | 2021 |
| 723 | Ga0501070_0152654 | 3300049586 | Bacteria | 1905 |
| 724 | Ga0501070_0360567 | 3300049586 | Bacteria | 1179 |
| 725 | Ga0501071_0018859 | 3300049587 | Bacteria | 4784 |
| 726 | Ga0501072_0283309 | 3300049588 | Bacteria | 1318 |
| 727 | Ga0501074_0113274 | 3300049590 | Bacteria | 1941 |
| 728 | Ga0501227_002649 | 3300049665 | Bacteria | 3930 |
| 729 | Ga0501235_003859 | 3300049669 | Bacteria | 3236 |
| 730 | Ga0501255_006884 | 3300049684 | Bacteria | 1188 |
| 731 | Ga0501221_005452 | 3300049704 | Bacteria | 2125 |
| 732 | Ga0501229_000089 | 3300049706 | Bacteria | 9401 |
| 733 | Ga0501080_0341145 | 3300049742 | Bacteria | 1354 |
| 734 | Ga0501083_0001331 | 3300049744 | Bacteria | 16739 |
| 735 | Ga0501083_0012979 | 3300049744 | Bacteria | 5822 |
| 736 | Ga0501083_0019716 | 3300049744 | Bacteria | 4695 |
| 737 | Ga0501035_0000009 | 3300049822 | Bacteria | 310827 |
| 738 | Ga0501035_0007618 | 3300049822 | Bacteria | 10114 |
| 739 | Ga0501035_0019171 | 3300049822 | Bacteria | 6297 |
| 740 | Ga0501035_0021368 | 3300049822 | Bacteria | 5949 |
| 741 | Ga0501035_0022903 | 3300049822 | Bacteria | 5736 |
| 742 | Ga0501035_0031102 | 3300049822 | Bacteria | 4862 |
| 743 | Ga0501035_0141338 | 3300049822 | Bacteria | 2093 |
| 744 | Ga0501035_0269564 | 3300049822 | Bacteria | 1441 |
| 745 | Ga0501035_0308436 | 3300049822 | Bacteria | 1332 |
| 746 | Ga0501035_0326442 | 3300049822 | Bacteria | 1288 |
| 747 | Ga0501044_0000005 | 3300049823 | Bacteria | 310855 |
| 748 | Ga0501044_0001129 | 3300049823 | Bacteria | 31721 |
| 749 | Ga0501044_0015367 | 3300049823 | Bacteria | 8243 |
| 750 | Ga0501044_0135637 | 3300049823 | Bacteria | 2452 |
| 751 | Ga0501044_0274376 | 3300049823 | Bacteria | 1621 |
| 752 | Ga0501044_0317040 | 3300049823 | Bacteria | 1484 |
| 753 | Ga0501044_0403104 | 3300049823 | Bacteria | 1280 |
| 754 | Ga0501045_0001357 | 3300049824 | Bacteria | 16252 |
| 755 | Ga0501045_0067175 | 3300049824 | Bacteria | 2633 |
| 756 | Ga0501045_0296068 | 3300049824 | Bacteria | 1204 |
| 757 | nmdc:mga00v17_56432_c1 | 3300050491 | Bacteria | 2401 |
| 758 | nmdc:mga0yw44_326227_c1 | 3300050492 | Bacteria | 1031 |
| 759 | nmdc:mga06z11_111_c1 | 3300050494 | Bacteria | 33603 |
| 760 | nmdc:mga04h51_792_c1 | 3300050495 | Bacteria | 7342 |
| 761 | nmdc:mga07m45_11236_c1 | 3300050496 | Bacteria | 4701 |
| 762 | nmdc:mga07m45_52477_c1 | 3300050496 | Bacteria | 2302 |
| 763 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 764 | nmdc:mga08x19_269931_c1 | 3300050514 | Bacteria | 1177 |
| 765 | Ga0495601_0141857 | 3300053077 | Bacteria | 1567 |
| 766 | Ga0495619_0139103 | 3300053085 | Bacteria | 1671 |
| 767 | Ga0500643_002099 | 3300053087 | Bacteria | 10607 |
| 768 | Ga0500643_009425 | 3300053087 | Bacteria | 3734 |
| 769 | Ga0500644_0001257 | 3300053088 | Bacteria | 6924 |
| 770 | Ga0500651_0050675 | 3300053093 | Bacteria | 2604 |
| 771 | Ga0500566_0067402 | 3300053094 | Bacteria | 2015 |
| 772 | Ga0500641_0001555 | 3300053096 | Bacteria | 8178 |
| 773 | Ga0500562_030580 | 3300053108 | Bacteria | 1419 |
| 774 | Ga0500593_000072 | 3300053117 | Bacteria | 37884 |
| 775 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 776 | Ga0500595_002650 | 3300053119 | Bacteria | 8710 |
| 777 | Ga0500597_030230 | 3300053120 | Bacteria | 2224 |
| 778 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 779 | Ga0500574_019371 | 3300053141 | Bacteria | 1693 |
| 780 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 781 | Ga0500616_0000303 | 3300053153 | Bacteria | 71156 |
| 782 | Ga0500616_0039890 | 3300053153 | Bacteria | 2528 |
| 783 | Ga0500616_0051292 | 3300053153 | Bacteria | 2174 |
| 784 | Ga0500616_0087096 | 3300053153 | Bacteria | 1556 |
| 785 | Ga0500619_016163 | 3300053154 | Bacteria | 2047 |
| 786 | Ga0500622_0007953 | 3300053156 | Bacteria | 5970 |
| 787 | Ga0500624_000085 | 3300053157 | Bacteria | 47798 |
| 788 | Ga0500636_0000930 | 3300053177 | Bacteria | 15732 |
| 789 | Ga0500636_0013262 | 3300053177 | Bacteria | 4837 |
| 790 | Ga0500637_0000023 | 3300053178 | Bacteria | 61044 |
| 791 | Ga0500645_000073 | 3300053730 | Bacteria | 79133 |
| 792 | Ga0500645_000109 | 3300053730 | Bacteria | 65892 |
| 793 | Ga0500596_003980 | 3300053735 | Bacteria | 2750 |
| 794 | Ga0587077_035495 | 3300059493 | Bacteria | 974 |
| 795 | Ga0587076_029599 | 3300059645 | Bacteria | 962 |
| 796 | Ga0501082_0032692 | 3300060353 | Bacteria | 4487 |
| 797 | Ga0530510_0061521 | 3300061734 | Bacteria | 2718 |
| 798 | 2599021528 | 2597490337 | Archaea | 2364912 |
| 799 | 2512644051 | 2512564014 | Bacteria | 4639632 |
| 800 | 2601666853 | 2600255292 | Bacteria | 6300551 |
| 801 | 2643777584 | 2643221551 | Bacteria | 3750538 |
| 802 | 2643796032 | 2643221555 | Bacteria | 3749717 |
| 803 | 2644125570 | 2643221622 | Bacteria | 4212502 |
| 804 | 2723601528 | 2721755693 | Bacteria | 6126117 |
| 805 | 2730137651 | 2728369359 | Bacteria | 5621728 |
| 806 | 2739058161 | 2738541337 | Bacteria | 6183410 |
| 807 | 2739310294 | 2738543024 | Bacteria | 5603683 |
| 808 | 2753767841 | 2751185897 | Bacteria | 5322941 |
| 809 | 2753811262 | 2751185905 | Bacteria | 6142767 |
| 810 | 2776915707 | 2775507049 | Bacteria | 6284736 |
| 811 | 2788436433 | 2786546940 | Bacteria | 6396474 |
| 812 | 2802440481 | 2802428803 | Bacteria | 5806948 |
| 813 | 2819543789 | 2818991436 | Bacteria | 5376622 |
| 814 | 2819716406 | 2818991466 | Bacteria | 4748179 |
| 815 | 2829747132 | 2829745981 | Bacteria | 5406054 |
| 816 | 2841914991 | 2841911363 | Bacteria | 6173697 |
| 817 | 2841921888 | 2841917233 | Bacteria | 6173500 |
| 818 | 2842715844 | 2842711865 | Bacteria | 7155354 |
| 819 | 2854683983 | 2854681122 | Bacteria | 4548679 |
| 820 | 2857552754 | 2857547612 | Bacteria | 6179999 |
| 821 | 2857558116 | 2857553236 | Bacteria | 6166726 |
| 822 | 2857558765 | 2857558681 | Bacteria | 6617694 |
| 823 | 2879165306 | 2879163058 | Bacteria | 4223965 |
| 824 | 2882806850 | 2882806704 | Bacteria | 3007728 |
| 825 | 2885086334 | 2885080285 | Bacteria | 6355622 |
| 826 | 2885269466 | 2885266251 | Bacteria | 4796748 |
| 827 | 2885429876 | 2885429604 | Bacteria | 3642894 |
| 828 | 2889277621 | 2889276214 | Bacteria | 5979355 |
| 829 | 2895884360 | 2895880812 | Bacteria | 11255272 |
| 830 | 2899262429 | 2899259804 | Bacteria | 3320927 |
| 831 | 2899275931 | 2899275550 | Bacteria | 3958688 |
| 832 | 2899805054 | 2899803654 | Bacteria | 5577784 |
| 833 | 2904428349 | 2904424332 | Bacteria | 7633521 |
| 834 | 2917702960 | 2917699015 | Bacteria | 7043791 |
| 835 | 2919711343 | 2919709256 | Bacteria | 4318106 |
| 836 | 2928528787 | 2928526807 | Bacteria | 4760224 |
| 837 | 2928970341 | 2928968154 | Bacteria | 4633371 |
| 838 | 2932415675 | 2932410948 | Bacteria | 6312192 |
| 839 | 2932421665 | 2932416698 | Bacteria | 6315112 |
| 840 | 2939706225 | 2939702853 | Bacteria | 5139229 |
| 841 | 2996710481 | 2996706504 | Bacteria | 5757485 |
| 842 | 3000018850 | 3000017691 | Bacteria | 3772574 |
| 843 | 641646871 | 641522639 | Bacteria | 7737025 |
| 844 | 643605083 | 643348564 | Bacteria | 8839022 |
| 845 | 648168111 | 648028048 | Bacteria | 5394884 |
| 846 | 8054566007 | 8054563764 | Bacteria | 5592885 |
| 847 | 8057134898 | 8057132660 | Bacteria | 4061191 |
| 848 | rootH1_10015987 | |||
| 849 | JGI25156J39149_1001747 | |||
| 850 | JGI25162J39368_1000040 | |||
| 851 | JGI25154J39366_1000782 | |||
| 852 | JGI25154J39366_1000843 | |||
| 853 | JGI25158J39367_1001690 | |||
| 854 | JGI25163J39215_1003955 | |||
| 855 | JGI25164J39214_1006860 | |||
| 856 | JGI25150J39212_1001343 | |||
| 857 | JGI25159J45721_1001570 | |||
| 858 | JGI25159J45721_1015311 | |||
| 859 | JGI25165J46597_1000051 | |||
| 860 | JGI25153J46596_10008965 | |||
| 861 | rootH2_10050624 | |||
| 862 | rootH1_10197647 | |||
| 863 | JGI25161J50226_1005224 | |||
| 864 | Ga0006562J51391_1024424 | |||
| 865 | Ga0055538_1000025 | |||
| 866 | Ga0055539_1000032 | |||
| 867 | Ga0055533_1000042 | |||
| 868 | Ga0055533_1005999 | |||
| 869 | Ga0055525_1000050 | |||
| 870 | Ga0055542_1001269 | |||
| 871 | Ga0055526_1000007 | |||
| 872 | Ga0055526_1008377 | |||
| 873 | Ga0055537_1000236 | |||
| 874 | Ga0055537_1000441 | |||
| 875 | Ga0055537_1006072 | |||
| 876 | Ga0055524_1000245 | |||
| 877 | Ga0055524_1000545 | |||
| 878 | Ga0055534_1000243 | |||
| 879 | Ga0055534_1004167 | |||
| 880 | Ga0055528_1000136 | |||
| 881 | Ga0055530_10000064 | |||
| 882 | Ga0055530_10012116 | |||
| 883 | Ga0055531_10000073 | |||
| 884 | Ga0055531_10000105 | |||
| 885 | Ga0055531_10002452 | |||
| 886 | Ga0055541_1000023 | |||
| 887 | Ga0055541_1000458 | |||
| 888 | Ga0055543_1002680 | |||
| 889 | Ga0065165_1000034 | |||
| 890 | Ga0065165_1000315 | |||
| 891 | Ga0065704_10000192 | |||
| 892 | Ga0070658_10000068 | |||
| 893 | Ga0070658_10006402 | |||
| 894 | Ga0070658_10008492 | |||
| 895 | Ga0070658_10084478 | |||
| 896 | Ga0070676_10041200 | |||
| 897 | Ga0070683_100008384 | |||
| 898 | Ga0070683_100016095 | |||
| 899 | Ga0070683_100045733 | |||
| 900 | Ga0068869_100249819 | |||
| 901 | Ga0070680_100001683 | |||
| 902 | Ga0070680_100348943 | |||
| 903 | Ga0070682_100046152 | |||
| 904 | Ga0070682_100188032 | |||
| 905 | Ga0068868_100004786 | |||
| 906 | Ga0068868_100052559 | |||
| 907 | Ga0068868_100170283 | |||
| 908 | Ga0070660_100002033 | |||
| 909 | Ga0070660_100023602 | |||
| 910 | Ga0070661_100001882 | |||
| 911 | Ga0070661_100080210 | |||
| 912 | Ga0070661_100239180 | |||
| 913 | Ga0070668_100476870 | |||
| 914 | Ga0070675_100247866 | |||
| 915 | Ga0070675_100267311 | |||
| 916 | Ga0070674_100026376 | |||
| 917 | Ga0070673_100017507 | |||
| 918 | Ga0070659_100022966 | |||
| 919 | Ga0070659_100073804 | |||
| 920 | Ga0070659_100091312 | |||
| 921 | Ga0070667_100397399 | |||
| 922 | Ga0070708_100055295 | |||
| 923 | Ga0070663_100052302 | |||
| 924 | Ga0070663_100128730 | |||
| 925 | Ga0070663_100435395 | |||
| 926 | Ga0070662_100001446 | |||
| 927 | Ga0070681_10039109 | |||
| 928 | Ga0068867_100001603 | |||
| 929 | Ga0068867_100035645 | |||
| 930 | Ga0068867_100044568 | |||
| 931 | Ga0068867_100128203 | |||
| 932 | Ga0070706_100006247 | |||
| 933 | Ga0070706_100020056 | |||
| 934 | Ga0070707_100196034 | |||
| 935 | Ga0070679_100005037 | |||
| 936 | Ga0070679_100012797 | |||
| 937 | Ga0070679_100425456 | |||
| 938 | Ga0070684_100063774 | |||
| 939 | Ga0070697_100012905 | |||
| 940 | Ga0068853_100002549 | |||
| 941 | Ga0068853_100034960 | |||
| 942 | Ga0068853_100046741 | |||
| 943 | Ga0070672_100045238 | |||
| 944 | Ga0070665_100166441 | |||
| 945 | Ga0068855_100005593 | |||
| 946 | Ga0068855_100085917 | |||
| 947 | Ga0068855_100214884 | |||
| 948 | Ga0068855_100537922 | |||
| 949 | Ga0070664_100006182 | |||
| 950 | Ga0068857_100013486 | |||
| 951 | Ga0068854_100001347 | |||
| 952 | Ga0068854_100120124 | |||
| 953 | Ga0068856_100007858 | |||
| 954 | Ga0068856_100053971 | |||
| 955 | Ga0068856_100055400 | |||
| 956 | Ga0068856_100081610 | |||
| 957 | Ga0068856_100117890 | |||
| 958 | Ga0068856_100402400 | |||
| 959 | Ga0068856_100591675 | |||
| 960 | Ga0068852_100000358 | |||
| 961 | Ga0068852_100007231 | |||
| 962 | Ga0068852_100008312 | |||
| 963 | Ga0068852_100028614 | |||
| 964 | Ga0068852_100066376 | |||
| 965 | Ga0068852_100084982 | |||
| 966 | Ga0068852_100442071 | |||
| 967 | Ga0068864_100297587 | |||
| 968 | Ga0068851_10027534 | |||
| 969 | Ga0068851_10251267 | |||
| 970 | Ga0068863_100164712 | |||
| 971 | Ga0068858_100465005 | |||
| 972 | Ga0070717_10061096 | |||
| 973 | Ga0070717_10361059 | |||
| 974 | Ga0075368_10030451 | |||
| 975 | Ga0075364_10022381 | |||
| 976 | Ga0075367_10001026 | |||
| 977 | Ga0097621_100004772 | |||
| 978 | Ga0075370_10010786 | |||
| 979 | Ga0075370_10206492 | |||
| 980 | Ga0068871_100017444 | |||
| 981 | Ga0075431_100110493 | |||
| 982 | Ga0068865_100033018 | |||
| 983 | Ga0075436_100292479 | |||
| 984 | Ga0105240_10002141 | |||
| 985 | Ga0105240_10269716 | |||
| 986 | Ga0105240_10291143 | |||
| 987 | Ga0105243_10000049 | |||
| 988 | Ga0105241_10257161 | |||
| 989 | Ga0105242_10626447 | |||
| 990 | Ga0105238_10060084 | |||
| 991 | Ga0105238_10378928 | |||
| 992 | Ga0105239_10276065 | |||
| 993 | Ga0105239_10656184 | |||
| 994 | Ga0157373_10009556 | |||
| 995 | Ga0157373_10043541 | |||
| 996 | Ga0157373_10201976 | |||
| 997 | Ga0157373_10417777 | |||
| 998 | Ga0157371_10003962 | |||
| 999 | Ga0157371_10006514 | |||
| 1000 | Ga0157371_10007842 | |||
| 1001 | Ga0157371_10044125 | |||
| 1002 | Ga0157371_10088842 | |||
| 1003 | Ga0157370_10004189 | |||
| 1004 | Ga0157370_10005551 | |||
| 1005 | Ga0157370_10020929 | |||
| 1006 | Ga0157370_10072428 | |||
| 1007 | Ga0157370_10090519 | |||
| 1008 | Ga0157369_10001072 | |||
| 1009 | Ga0157369_10002003 | |||
| 1010 | Ga0157369_10015476 | |||
| 1011 | Ga0157369_10043085 | |||
| 1012 | Ga0157369_10492411 | |||
| 1013 | Ga0171462_1013 | |||
| 1014 | Ga0157378_10026218 | |||
| 1015 | Ga0157378_10210823 | |||
| 1016 | Ga0157372_10004382 | |||
| 1017 | Ga0157372_10081127 | |||
| 1018 | Ga0157372_10124827 | |||
| 1019 | Ga0163163_10248684 | |||
| 1020 | Ga0157377_10067421 | |||
| 1021 | Ga0157376_10216357 | |||
| 1022 | Ga0182006_1000023 | |||
| 1023 | Ga0182007_10000082 | |||
| 1024 | Ga0182007_10000738 | |||
| 1025 | Ga0182005_1000047 | |||
| 1026 | Ga0182005_1000405 | |||
| 1027 | Ga0163161_10001177 | |||
| 1028 | Ga0213872_10000024 | |||
| 1029 | Ga0213872_10010012 | |||
| 1030 | Ga0209436_102173 | |||
| 1031 | Ga0209784_100010 | |||
| 1032 | Ga0209566_100008 | |||
| 1033 | Ga0209566_100235 | |||
| 1034 | Ga0209674_100019 | |||
| 1035 | Ga0209674_100189 | |||
| 1036 | Ga0209563_100021 | |||
| 1037 | Ga0209563_107681 | |||
| 1038 | Ga0207427_100432 | |||
| 1039 | Ga0209437_100019 | |||
| 1040 | Ga0207425_1000036 | |||
| 1041 | Ga0207425_1007318 | |||
| 1042 | Ga0209646_1000119 | |||
| 1043 | Ga0209646_1000125 | |||
| 1044 | Ga0209677_100011 | |||
| 1045 | Ga0209677_103667 | |||
| 1046 | Ga0209148_1000451 | |||
| 1047 | Ga0209759_1001696 | |||
| 1048 | Ga0209233_1000025 | |||
| 1049 | Ga0209565_1000007 | |||
| 1050 | Ga0209565_1000082 | |||
| 1051 | Ga0209565_1001293 | |||
| 1052 | Ga0209565_1002903 | |||
| 1053 | Ga0209673_1000381 | |||
| 1054 | Ga0209673_1001016 | |||
| 1055 | Ga0209673_1018228 | |||
| 1056 | Ga0209130_1000016 | |||
| 1057 | Ga0209130_1000045 | |||
| 1058 | Ga0209130_1003201 | |||
| 1059 | Ga0209130_1033060 | |||
| 1060 | Ga0209675_1000166 | |||
| 1061 | Ga0209675_1002921 | |||
| 1062 | Ga0209025_1000932 | |||
| 1063 | Ga0209564_1000010 | |||
| 1064 | Ga0209564_1000710 | |||
| 1065 | Ga0209564_1006015 | |||
| 1066 | Ga0209564_1007914 | |||
| 1067 | Ga0209758_1007609 | |||
| 1068 | Ga0209050_1000010 | |||
| 1069 | Ga0209050_1000086 | |||
| 1070 | Ga0209050_1000549 | |||
| 1071 | Ga0209050_1003427 | |||
| 1072 | Ga0209050_1016110 | |||
| 1073 | Ga0209050_1022518 | |||
| 1074 | Ga0209256_1000008 | |||
| 1075 | Ga0209256_1000380 | |||
| 1076 | Ga0209256_1001189 | |||
| 1077 | Ga0209256_1007190 | |||
| 1078 | Ga0207426_1004949 | |||
| 1079 | Ga0207426_1027608 | |||
| 1080 | Ga0209051_1005335 | |||
| 1081 | Ga0209051_1060749 | |||
| 1082 | Ga0209257_1000027 | |||
| 1083 | Ga0209257_1000047 | |||
| 1084 | Ga0209257_1000087 | |||
| 1085 | Ga0209257_1000758 | |||
| 1086 | Ga0209257_1004536 | |||
| 1087 | Ga0209257_1017996 | |||
| 1088 | Ga0209257_1065859 | |||
| 1089 | Ga0207647_10006567 | |||
| 1090 | Ga0207705_10000124 | |||
| 1091 | Ga0207705_10002001 | |||
| 1092 | Ga0207705_10003314 | |||
| 1093 | Ga0207705_10009518 | |||
| 1094 | Ga0207705_10036010 | |||
| 1095 | Ga0207705_10049500 | |||
| 1096 | Ga0207705_10136230 | |||
| 1097 | Ga0207684_10003787 | |||
| 1098 | Ga0207684_10005345 | |||
| 1099 | Ga0207707_10006462 | |||
| 1100 | Ga0207707_10233962 | |||
| 1101 | Ga0207695_10001916 | |||
| 1102 | Ga0207695_10419923 | |||
| 1103 | Ga0207671_10065042 | |||
| 1104 | Ga0207660_10003417 | |||
| 1105 | Ga0207660_10280589 | |||
| 1106 | Ga0207657_10001711 | |||
| 1107 | Ga0207657_10005837 | |||
| 1108 | Ga0207657_10006696 | |||
| 1109 | Ga0207657_10022472 | |||
| 1110 | Ga0207649_10007919 | |||
| 1111 | Ga0207649_10019063 | |||
| 1112 | Ga0207649_10070711 | |||
| 1113 | Ga0207649_10300559 | |||
| 1114 | Ga0207649_10365423 | |||
| 1115 | Ga0207652_10003472 | |||
| 1116 | Ga0207652_10051424 | |||
| 1117 | Ga0207652_10072632 | |||
| 1118 | Ga0207652_10327225 | |||
| 1119 | Ga0207652_10382602 | |||
| 1120 | Ga0207646_10007230 | |||
| 1121 | Ga0207646_10182204 | |||
| 1122 | Ga0207646_10674083 | |||
| 1123 | Ga0207659_10058296 | |||
| 1124 | Ga0207690_10000640 | |||
| 1125 | Ga0207690_10061721 | |||
| 1126 | Ga0207706_10003725 | |||
| 1127 | Ga0207709_10000097 | |||
| 1128 | Ga0207669_10023854 | |||
| 1129 | Ga0207704_10002333 | |||
| 1130 | Ga0207665_10227252 | |||
| 1131 | Ga0207691_10072003 | |||
| 1132 | Ga0207689_10000210 | |||
| 1133 | Ga0207689_10174808 | |||
| 1134 | Ga0207661_10015660 | |||
| 1135 | Ga0207661_10169442 | |||
| 1136 | Ga0207679_10000726 | |||
| 1137 | Ga0207667_10003114 | |||
| 1138 | Ga0207667_10018162 | |||
| 1139 | Ga0207667_10041610 | |||
| 1140 | Ga0207667_10063401 | |||
| 1141 | Ga0207667_10139637 | |||
| 1142 | Ga0207667_10861802 | |||
| 1143 | Ga0207640_10000964 | |||
| 1144 | Ga0207640_10048289 | |||
| 1145 | Ga0207640_10414767 | |||
| 1146 | Ga0207658_10300956 | |||
| 1147 | Ga0207677_10002753 | |||
| 1148 | Ga0207677_10042952 | |||
| 1149 | Ga0207677_10075484 | |||
| 1150 | Ga0207677_10166499 | |||
| 1151 | Ga0207703_10158910 | |||
| 1152 | Ga0207639_10003417 | |||
| 1153 | Ga0207639_10036461 | |||
| 1154 | Ga0207639_10062357 | |||
| 1155 | Ga0207639_10063862 | |||
| 1156 | Ga0207639_10096969 | |||
| 1157 | Ga0207639_10216388 | |||
| 1158 | Ga0207639_10244202 | |||
| 1159 | Ga0207678_10315756 | |||
| 1160 | Ga0207702_10000625 | |||
| 1161 | Ga0207702_10061656 | |||
| 1162 | Ga0207702_10064378 | |||
| 1163 | Ga0207702_10093783 | |||
| 1164 | Ga0207702_10172263 | |||
| 1165 | Ga0207641_10393577 | |||
| 1166 | Ga0207648_10003807 | |||
| 1167 | Ga0207648_10020786 | |||
| 1168 | Ga0207648_10033839 | |||
| 1169 | Ga0207648_10050196 | |||
| 1170 | Ga0207676_10401277 | |||
| 1171 | Ga0207683_10053454 | |||
| 1172 | Ga0207698_10000067 | |||
| 1173 | Ga0207698_10001225 | |||
| 1174 | Ga0207698_10140862 | |||
| 1175 | Ga0207698_10564615 | |||
| 1176 | Ga0209813_10000036 | |||
| 1177 | Ga0207428_10214951 | |||
| 1178 | Ga0268266_10080979 | |||
| 1179 | Ga0265337_1027544 | |||
| 1180 | Ga0265319_1021900 | |||
| 1181 | Ga0265318_10029226 | |||
| 1182 | Ga0265318_10105275 | |||
| 1183 | Ga0265336_10040714 | |||
| 1184 | Ga0307517_10031004 | |||
| 1185 | Ga0307515_10022699 | |||
| 1186 | Ga0316177_1204721 | |||
| 1187 | Ga0265330_10000003 | |||
| 1188 | Ga0265328_10000007 | |||
| 1189 | Ga0265320_10001237 | |||
| 1190 | Ga0265320_10027218 | |||
| 1191 | Ga0265325_10025806 | |||
| 1192 | Ga0265340_10023903 | |||
| 1193 | Ga0265339_10056511 | |||
| 1194 | Ga0265331_10010335 | |||
| 1195 | Ga0265331_10020675 | |||
| 1196 | Ga0265331_10105838 | |||
| 1197 | Ga0265327_10007906 | |||
| 1198 | Ga0265327_10011866 | |||
| 1199 | Ga0265316_10002008 | |||
| 1200 | Ga0307513_10051934 | |||
| 1201 | Ga0307408_100000017 | |||
| 1202 | Ga0307408_100000021 | |||
| 1203 | Ga0307408_100000029 | |||
| 1204 | Ga0307408_100036159 | |||
| 1205 | Ga0307408_100045674 | |||
| 1206 | Ga0307408_100537397 | |||
| 1207 | Ga0265313_10005994 | |||
| 1208 | Ga0265313_10137433 | |||
| 1209 | Ga0316579_10031269 | |||
| 1210 | Ga0316579_10033419 | |||
| 1211 | Ga0265314_10023239 | |||
| 1212 | Ga0265314_10119946 | |||
| 1213 | Ga0265314_10199968 | |||
| 1214 | Ga0265342_10000068 | |||
| 1215 | Ga0265342_10021823 | |||
| 1216 | Ga0265342_10031893 | |||
| 1217 | Ga0316576_10017373 | |||
| 1218 | Ga0316576_10017770 | |||
| 1219 | Ga0316578_10041569 | |||
| 1220 | Ga0316578_10328640 | |||
| 1221 | Ga0307405_10004498 | |||
| 1222 | Ga0307405_10093752 | |||
| 1223 | Ga0316577_10000005 | |||
| 1224 | Ga0316577_10006115 | |||
| 1225 | Ga0316577_10092258 | |||
| 1226 | Ga0307413_10004455 | |||
| 1227 | Ga0307413_10112104 | |||
| 1228 | Ga0307413_10178798 | |||
| 1229 | Ga0307413_10180480 | |||
| 1230 | Ga0307410_10000060 | |||
| 1231 | Ga0307410_10107476 | |||
| 1232 | Ga0307406_10044481 | |||
| 1233 | Ga0307406_10211374 | |||
| 1234 | Ga0307406_10455573 | |||
| 1235 | Ga0307407_10000127 | |||
| 1236 | Ga0307407_10020467 | |||
| 1237 | Ga0307407_10045110 | |||
| 1238 | Ga0307407_10189905 | |||
| 1239 | Ga0307412_10000037 | |||
| 1240 | Ga0307412_10002397 | |||
| 1241 | Ga0307412_10062330 | |||
| 1242 | Ga0307412_10102474 | |||
| 1243 | Ga0307412_10107832 | |||
| 1244 | Ga0307412_10176774 | |||
| 1245 | Ga0307412_10427220 | |||
| 1246 | Ga0307409_100000021 | |||
| 1247 | Ga0307409_100001401 | |||
| 1248 | Ga0307409_100013413 | |||
| 1249 | Ga0307416_100000256 | |||
| 1250 | Ga0307416_100003131 | |||
| 1251 | Ga0307416_100085761 | |||
| 1252 | Ga0307416_100091691 | |||
| 1253 | Ga0307414_10000015 | |||
| 1254 | Ga0307414_10022625 | |||
| 1255 | Ga0307414_10049920 | |||
| 1256 | Ga0307414_10096888 | |||
| 1257 | Ga0307414_10377810 | |||
| 1258 | Ga0307414_10434058 | |||
| 1259 | Ga0307414_10624735 | |||
| 1260 | Ga0307411_10002554 | |||
| 1261 | Ga0307411_10052013 | |||
| 1262 | Ga0307411_10231558 | |||
| 1263 | Ga0307415_100062314 | |||
| 1264 | Ga0307415_100129490 | |||
| 1265 | Ga0307415_100167425 | |||
| 1266 | Ga0373950_0003923 | |||
| 1267 | Ga0373959_0043423 | |||
| 1268 | Ga0373940_0004154 | |||
| 1269 | Ga0373932_0007834 | |||
| 1270 | Ga0373939_0000012 | |||
| 1271 | Ga0373941_0062088 | |||
| 1272 | Ga0373960_0002596 | |||
| 1273 | Ga0373960_0056083 | |||
| 1274 | Ga0373946_0144678 | |||
| 1275 | Ga0373962_0013769 | |||
| 1276 | Ga0373931_0001221 | |||
| 1277 | Ga0373931_0054807 | |||
| 1278 | Ga0373937_0221650 | |||
| 1279 | Ga0316582_0015261 | |||
| 1280 | Ga0316582_0035596 | |||
| 1281 | Ga0316582_0081835 | |||
| 1282 | Ga0316582_0150903 | |||
| 1283 | Ga0316584_0001705 | |||
| 1284 | Ga0316584_0024370 | |||
| 1285 | Ga0316584_0029083 | |||
| 1286 | Ga0316584_0065259 | |||
| 1287 | Ga0316584_0098934 | |||
| 1288 | Ga0316584_0302646 | |||
| 1289 | Ga0395899_0025590 | |||
| 1290 | Ga0395899_0178600 | |||
| 1291 | Ga0395900_0121609 | |||
| 1292 | Ga0395900_0132761 | |||
| 1293 | Ga0395900_0162442 | |||
| 1294 | Ga0395900_0384153 | |||
| 1295 | Ga0395900_0510083 | |||
| 1296 | Ga0395898_0212860 | |||
| 1297 | Ga0395905_0013332 | |||
| 1298 | Ga0395905_0055988 | |||
| 1299 | Ga0395905_0099738 | |||
| 1300 | Ga0316581_0009290 | |||
| 1301 | Ga0316581_0018105 | |||
| 1302 | Ga0395901_0030541 | |||
| 1303 | Ga0395901_0118720 | |||
| 1304 | Ga0400483_016212 | |||
| 1305 | Ga0400483_102702 | |||
| 1306 | Ga0400483_180833 | |||
| 1307 | Ga0400483_192590 | |||
| 1308 | Ga0436361_0224368 | |||
| 1309 | Ga0436362_1002824 | |||
| 1310 | Ga0439453_0003984 | |||
| 1311 | Ga0439465_0035505 | |||
| 1312 | Ga0451849_0296662 | |||
| 1313 | Ga0451843_0077392 | |||
| 1314 | Ga0451853_3488129 | |||
| 1315 | Ga0439431_0008649 | |||
| 1316 | Ga0439445_0049126 | |||
| 1317 | Ga0439462_0023322 | |||
| 1318 | Ga0450890_000001 | |||
| 1319 | Ga0450891_002701 | |||
| 1320 | Ga0450892_000061 | |||
| 1321 | Ga0439434_0111084 | |||
| 1322 | Ga0450893_0028936 | |||
| 1323 | Ga0451577_0002436 | |||
| 1324 | Ga0451577_0019946 | |||
| 1325 | Ga0451577_0260376 | |||
| 1326 | Ga0453683_0001847 | |||
| 1327 | Ga0453683_0018503 | |||
| 1328 | Ga0453683_0108033 | |||
| 1329 | Ga0466965_0008880 | |||
| 1330 | Ga0466961_0280837 | |||
| 1331 | Ga0453684_0000050 | |||
| 1332 | Ga0453684_0000597 | |||
| 1333 | Ga0453684_0005953 | |||
| 1334 | Ga0453684_0006998 | |||
| 1335 | Ga0453684_0011404 | |||
| 1336 | Ga0453684_0018796 | |||
| 1337 | Ga0453684_0034822 | |||
| 1338 | Ga0453684_0094771 | |||
| 1339 | Ga0453684_0173046 | |||
| 1340 | Ga0453684_0289883 | |||
| 1341 | Ga0453684_0383067 | |||
| 1342 | Ga0453684_0572483 | |||
| 1343 | Ga0466960_0203862 | |||
| 1344 | Ga0466959_0040583 | |||
| 1345 | Ga0451576_0000586 | |||
| 1346 | Ga0451576_0007631 | |||
| 1347 | Ga0451576_0009304 | |||
| 1348 | Ga0451576_0011237 | |||
| 1349 | Ga0451576_0184805 | |||
| 1350 | Ga0495627_000004 | |||
| 1351 | Ga0495592_0010239 | |||
| 1352 | Ga0495638_0028580 | |||
| 1353 | Ga0495638_0263448 | |||
| 1354 | Ga0495651_0006882 | |||
| 1355 | Ga0495653_0002868 | |||
| 1356 | Ga0495650_0000128 | |||
| 1357 | Ga0495650_0002873 | |||
| 1358 | Ga0495605_0000018 | |||
| 1359 | Ga0495605_0001131 | |||
| 1360 | Ga0495584_0021167 | |||
| 1361 | Ga0495584_0081848 | |||
| 1362 | Ga0495607_0002432 | |||
| 1363 | Ga0495607_0007691 | |||
| 1364 | Ga0495583_0000115 | |||
| 1365 | Ga0495583_0001058 | |||
| 1366 | Ga0495583_0067571 | |||
| 1367 | Ga0495606_0000228 | |||
| 1368 | Ga0495606_0000288 | |||
| 1369 | Ga0495606_0000790 | |||
| 1370 | Ga0495606_0001799 | |||
| 1371 | Ga0495608_0007317 | |||
| 1372 | Ga0495608_0023636 | |||
| 1373 | Ga0495610_0018280 | |||
| 1374 | Ga0495610_0035550 | |||
| 1375 | Ga0495618_0080496 | |||
| 1376 | Ga0495628_0001227 | |||
| 1377 | Ga0495628_0002006 | |||
| 1378 | Ga0495637_0000142 | |||
| 1379 | Ga0495637_0000731 | |||
| 1380 | Ga0495643_0000082 | |||
| 1381 | Ga0495643_0207375 | |||
| 1382 | Ga0495648_0000732 | |||
| 1383 | Ga0495648_0013009 | |||
| 1384 | Ga0495648_0088915 | |||
| 1385 | Ga0495648_0135341 | |||
| 1386 | Ga0495642_0039791 | |||
| 1387 | Ga0495652_0014687 | |||
| 1388 | Ga0495654_0000014 | |||
| 1389 | Ga0495609_0000434 | |||
| 1390 | Ga0495609_0000537 | |||
| 1391 | Ga0495609_0002203 | |||
| 1392 | Ga0495621_0005796 | |||
| 1393 | Ga0495597_0000321 | |||
| 1394 | Ga0495645_0028629 | |||
| 1395 | Ga0495645_0049548 | |||
| 1396 | Ga0495622_0000034 | |||
| 1397 | Ga0495622_0078600 | |||
| 1398 | Ga0495633_0000100 | |||
| 1399 | Ga0495633_0000217 | |||
| 1400 | Ga0495633_0012689 | |||
| 1401 | Ga0495633_0197310 | |||
| 1402 | Ga0495656_0020157 | |||
| 1403 | Ga0495668_0000231 | |||
| 1404 | Ga0495668_0000308 | |||
| 1405 | Ga0495668_0054396 | |||
| 1406 | Ga0495625_0046579 | |||
| 1407 | Ga0495625_0205171 | |||
| 1408 | Ga0495659_0000272 | |||
| 1409 | Ga0495661_0005558 | |||
| 1410 | Ga0495661_0152463 | |||
| 1411 | Ga0495657_0145258 | |||
| 1412 | Ga0495646_0004004 | |||
| 1413 | Ga0495646_0069647 | |||
| 1414 | Ga0495669_0001487 | |||
| 1415 | Ga0495624_0077378 | |||
| 1416 | Ga0495671_0058521 | |||
| 1417 | Ga0495649_0046175 | |||
| 1418 | Ga0495649_0106751 | |||
| 1419 | Ga0495649_0111838 | |||
| 1420 | Ga0495649_0152287 | |||
| 1421 | Ga0495600_0001954 | |||
| 1422 | Ga0495660_0028809 | |||
| 1423 | Ga0495604_0044258 | |||
| 1424 | Ga0495604_0044839 | |||
| 1425 | Ga0495636_0002097 | |||
| 1426 | Ga0495636_0027842 | |||
| 1427 | Ga0495672_0000081 | |||
| 1428 | Ga0495672_0034660 | |||
| 1429 | Ga0495683_0014292 | |||
| 1430 | Ga0495687_000172 | |||
| 1431 | Ga0495687_000323 | |||
| 1432 | Ga0495687_000446 | |||
| 1433 | Ga0495687_000699 | |||
| 1434 | Ga0495677_0010342 | |||
| 1435 | Ga0495685_000034 | |||
| 1436 | Ga0495685_005609 | |||
| 1437 | Ga0495673_0000008 | |||
| 1438 | Ga0495673_0008115 | |||
| 1439 | Ga0495681_0013190 | |||
| 1440 | Ga0495681_0022454 | |||
| 1441 | Ga0495686_0000604 | |||
| 1442 | Ga0495686_0000677 | |||
| 1443 | Ga0495686_0006562 | |||
| 1444 | Ga0495686_0014303 | |||
| 1445 | Ga0495686_0037907 | |||
| 1446 | Ga0495686_0056991 | |||
| 1447 | Ga0495602_0128770 | |||
| 1448 | Ga0496101_0284360 | |||
| 1449 | Ga0496102_0031911 | |||
| 1450 | Ga0496102_0116510 | |||
| 1451 | Ga0496103_0001821 | |||
| 1452 | Ga0496104_0175888 | |||
| 1453 | Ga0496105_0022519 | |||
| 1454 | Ga0496108_0196008 | |||
| 1455 | Ga0496110_0348147 | |||
| 1456 | Ga0496112_0000200 | |||
| 1457 | Ga0496114_0002554 | |||
| 1458 | Ga0496114_0442897 | |||
| 1459 | Ga0496115_0010435 | |||
| 1460 | Ga0496116_0021069 | |||
| 1461 | Ga0496116_0059847 | |||
| 1462 | Ga0496116_0079691 | |||
| 1463 | Ga0496117_0000075 | |||
| 1464 | Ga0496117_0021543 | |||
| 1465 | Ga0496118_0000055 | |||
| 1466 | Ga0496119_0018246 | |||
| 1467 | Ga0496120_0059824 | |||
| 1468 | Ga0496120_0062601 | |||
| 1469 | Ga0496121_0028678 | |||
| 1470 | Ga0496121_0054149 | |||
| 1471 | Ga0496122_0003176 | |||
| 1472 | Ga0496122_0003599 | |||
| 1473 | Ga0496122_0049349 | |||
| 1474 | Ga0496122_0276732 | |||
| 1475 | Ga0496123_0001626 | |||
| 1476 | Ga0496123_0053057 | |||
| 1477 | Ga0496123_0055289 | |||
| 1478 | Ga0496124_0002918 | |||
| 1479 | Ga0496124_0022595 | |||
| 1480 | Ga0496124_0032120 | |||
| 1481 | Ga0496124_0044471 | |||
| 1482 | Ga0496124_0049085 | |||
| 1483 | Ga0496124_0158652 | |||
| 1484 | Ga0496124_0163571 | |||
| 1485 | Ga0496124_0323381 | |||
| 1486 | Ga0496125_0002758 | |||
| 1487 | Ga0496125_0025532 | |||
| 1488 | Ga0496125_0120648 | |||
| 1489 | Ga0496125_0242657 | |||
| 1490 | Ga0496126_0005903 | |||
| 1491 | Ga0495678_000027 | |||
| 1492 | Ga0495678_000346 | |||
| 1493 | Ga0495678_000549 | |||
| 1494 | Ga0495682_0000999 | |||
| 1495 | Ga0501300_009813 | |||
| 1496 | Ga0501031_0000002 | |||
| 1497 | Ga0501031_0002629 | |||
| 1498 | Ga0501031_0036952 | |||
| 1499 | Ga0501031_0058606 | |||
| 1500 | Ga0501031_0123349 | |||
| 1501 | Ga0501032_0000004 | |||
| 1502 | Ga0501032_0000851 | |||
| 1503 | Ga0501032_0002674 | |||
| 1504 | Ga0501032_0005458 | |||
| 1505 | Ga0501032_0067334 | |||
| 1506 | Ga0501033_0000016 | |||
| 1507 | Ga0501033_0009280 | |||
| 1508 | Ga0501033_0014684 | |||
| 1509 | Ga0501033_0051714 | |||
| 1510 | Ga0501033_0099319 | |||
| 1511 | Ga0501033_0140160 | |||
| 1512 | Ga0501033_0197852 | |||
| 1513 | Ga0501034_0000011 | |||
| 1514 | Ga0501034_0009670 | |||
| 1515 | Ga0501034_0012065 | |||
| 1516 | Ga0501034_0027699 | |||
| 1517 | Ga0501034_0108886 | |||
| 1518 | Ga0501034_0171146 | |||
| 1519 | Ga0501034_0179352 | |||
| 1520 | Ga0501034_0551747 | |||
| 1521 | Ga0501036_0000001 | |||
| 1522 | Ga0501036_0004087 | |||
| 1523 | Ga0501036_0006219 | |||
| 1524 | Ga0501036_0121271 | |||
| 1525 | Ga0501037_0000006 | |||
| 1526 | Ga0501037_0005227 | |||
| 1527 | Ga0501038_0000003 | |||
| 1528 | Ga0501038_0002842 | |||
| 1529 | Ga0501038_0003593 | |||
| 1530 | Ga0501038_0004599 | |||
| 1531 | Ga0501038_0022177 | |||
| 1532 | Ga0501038_0047786 | |||
| 1533 | Ga0501038_0165298 | |||
| 1534 | Ga0501039_0000004 | |||
| 1535 | Ga0501039_0007003 | |||
| 1536 | Ga0501039_0007282 | |||
| 1537 | Ga0501039_0425002 | |||
| 1538 | Ga0501040_0006407 | |||
| 1539 | Ga0501042_0002271 | |||
| 1540 | Ga0501042_0359116 | |||
| 1541 | Ga0501043_0000590 | |||
| 1542 | Ga0501043_0000765 | |||
| 1543 | Ga0501043_0010344 | |||
| 1544 | Ga0501043_0011693 | |||
| 1545 | Ga0501043_0076329 | |||
| 1546 | Ga0501043_0108233 | |||
| 1547 | Ga0501043_0193196 | |||
| 1548 | Ga0501046_0000766 | |||
| 1549 | Ga0501046_0003768 | |||
| 1550 | Ga0501046_0014305 | |||
| 1551 | Ga0501046_0062502 | |||
| 1552 | Ga0501046_0068161 | |||
| 1553 | Ga0501046_0071668 | |||
| 1554 | Ga0501047_0004204 | |||
| 1555 | Ga0501047_0004747 | |||
| 1556 | Ga0501047_0008050 | |||
| 1557 | Ga0501047_0050498 | |||
| 1558 | Ga0501047_0145161 | |||
| 1559 | Ga0501047_0199936 | |||
| 1560 | Ga0501047_0222918 | |||
| 1561 | Ga0501047_0293142 | |||
| 1562 | Ga0501047_0677411 | |||
| 1563 | Ga0501048_0010447 | |||
| 1564 | Ga0501068_0001005 | |||
| 1565 | Ga0501068_0107214 | |||
| 1566 | Ga0501070_0001202 | |||
| 1567 | Ga0501070_0006268 | |||
| 1568 | Ga0501070_0029248 | |||
| 1569 | Ga0501070_0136969 | |||
| 1570 | Ga0501070_0152654 | |||
| 1571 | Ga0501070_0360567 | |||
| 1572 | Ga0501071_0018859 | |||
| 1573 | Ga0501072_0283309 | |||
| 1574 | Ga0501074_0113274 | |||
| 1575 | Ga0501227_002649 | |||
| 1576 | Ga0501235_003859 | |||
| 1577 | Ga0501255_006884 | |||
| 1578 | Ga0501221_005452 | |||
| 1579 | Ga0501229_000089 | |||
| 1580 | Ga0501080_0341145 | |||
| 1581 | Ga0501083_0001331 | |||
| 1582 | Ga0501083_0012979 | |||
| 1583 | Ga0501083_0019716 | |||
| 1584 | Ga0501035_0000009 | |||
| 1585 | Ga0501035_0007618 | |||
| 1586 | Ga0501035_0019171 | |||
| 1587 | Ga0501035_0021368 | |||
| 1588 | Ga0501035_0022903 | |||
| 1589 | Ga0501035_0031102 | |||
| 1590 | Ga0501035_0141338 | |||
| 1591 | Ga0501035_0269564 | |||
| 1592 | Ga0501035_0308436 | |||
| 1593 | Ga0501035_0326442 | |||
| 1594 | Ga0501044_0000005 | |||
| 1595 | Ga0501044_0001129 | |||
| 1596 | Ga0501044_0015367 | |||
| 1597 | Ga0501044_0135637 | |||
| 1598 | Ga0501044_0274376 | |||
| 1599 | Ga0501044_0317040 | |||
| 1600 | Ga0501044_0403104 | |||
| 1601 | Ga0501045_0001357 | |||
| 1602 | Ga0501045_0067175 | |||
| 1603 | Ga0501045_0296068 | |||
| 1604 | nmdc:mga00v17_56432_c1 | |||
| 1605 | nmdc:mga0yw44_326227_c1 | |||
| 1606 | nmdc:mga06z11_111_c1 | |||
| 1607 | nmdc:mga04h51_792_c1 | |||
| 1608 | nmdc:mga07m45_11236_c1 | |||
| 1609 | nmdc:mga07m45_52477_c1 | |||
| 1610 | nmdc:mga08x19_18_c1 | |||
| 1611 | nmdc:mga08x19_269931_c1 | |||
| 1612 | Ga0495601_0141857 | |||
| 1613 | Ga0495619_0139103 | |||
| 1614 | Ga0500643_002099 | |||
| 1615 | Ga0500643_009425 | |||
| 1616 | Ga0500644_0001257 | |||
| 1617 | Ga0500651_0050675 | |||
| 1618 | Ga0500566_0067402 | |||
| 1619 | Ga0500641_0001555 | |||
| 1620 | Ga0500562_030580 | |||
| 1621 | Ga0500593_000072 | |||
| 1622 | Ga0500595_000001 | |||
| 1623 | Ga0500595_002650 | |||
| 1624 | Ga0500597_030230 | |||
| 1625 | Ga0500568_0000005 | |||
| 1626 | Ga0500574_019371 | |||
| 1627 | Ga0500616_0000001 | |||
| 1628 | Ga0500616_0000303 | |||
| 1629 | Ga0500616_0039890 | |||
| 1630 | Ga0500616_0051292 | |||
| 1631 | Ga0500616_0087096 | |||
| 1632 | Ga0500619_016163 | |||
| 1633 | Ga0500622_0007953 | |||
| 1634 | Ga0500624_000085 | |||
| 1635 | Ga0500636_0000930 | |||
| 1636 | Ga0500636_0013262 | |||
| 1637 | Ga0500637_0000023 | |||
| 1638 | Ga0500645_000073 | |||
| 1639 | Ga0500645_000109 | |||
| 1640 | Ga0500596_003980 | |||
| 1641 | Ga0587077_035495 | |||
| 1642 | Ga0587076_029599 | |||
| 1643 | Ga0501082_0032692 | |||
| 1644 | Ga0530510_0061521 | |||
| 1645 | 2599021528 | |||
| 1646 | 2512644051 | |||
| 1647 | 2601666853 | |||
| 1648 | 2643777584 | |||
| 1649 | 2643796032 | |||
| 1650 | 2644125570 | |||
| 1651 | 2723601528 | |||
| 1652 | 2730137651 | |||
| 1653 | 2739058161 | |||
| 1654 | 2739310294 | |||
| 1655 | 2753767841 | |||
| 1656 | 2753811262 | |||
| 1657 | 2776915707 | |||
| 1658 | 2788436433 | |||
| 1659 | 2802440481 | |||
| 1660 | 2819543789 | |||
| 1661 | 2819716406 | |||
| 1662 | 2829747132 | |||
| 1663 | 2841914991 | |||
| 1664 | 2841921888 | |||
| 1665 | 2842715844 | |||
| 1666 | 2854683983 | |||
| 1667 | 2857552754 | |||
| 1668 | 2857558116 | |||
| 1669 | 2857558765 | |||
| 1670 | 2879165306 | |||
| 1671 | 2882806850 | |||
| 1672 | 2885086334 | |||
| 1673 | 2885269466 | |||
| 1674 | 2885429876 | |||
| 1675 | 2889277621 | |||
| 1676 | 2895884360 | |||
| 1677 | 2899262429 | |||
| 1678 | 2899275931 | |||
| 1679 | 2899805054 | |||
| 1680 | 2904428349 | |||
| 1681 | 2917702960 | |||
| 1682 | 2919711343 | |||
| 1683 | 2928528787 | |||
| 1684 | 2928970341 | |||
| 1685 | 2932415675 | |||
| 1686 | 2932421665 | |||
| 1687 | 2939706225 | |||
| 1688 | 2996710481 | |||
| 1689 | 3000018850 | |||
| 1690 | 641646871 | |||
| 1691 | 643605083 | |||
| 1692 | 648168111 | |||
| 1693 | 8054566007 | |||
| 1694 | 8057134898 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4evz-assembly1.cif.gz_A | structure of hisf-luca | 0.9717 | 1 | 256 |
| 6vdg-assembly1.cif.gz_A | crystal structure of the y182a hisf mutant from thermotoga maritima | 0.9679 | 3 | 256 |
| 2wjz-assembly2.cif.gz_E | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.9649 | 1 | 256 |
| 1gpw-assembly2.cif.gz_C | structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. | 0.9645 | 1 | 256 |
| 6vdg-assembly1.cif.gz_A | crystal structure of the y182a hisf mutant from thermotoga maritima | 0.9639 | 3 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9793 | 1 | 256 | 3.20.20.70 |
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9756 | 1 | 256 | 3.20.20.70 |
| af_Q2FUU3_1_249_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9653 | 1 | 251 | 3.20.20.70 |
| af_Q2FUU3_1_249_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9577 | 1 | 251 | 3.20.20.70 |
| af_P60664_1_258_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9456 | 1 | 256 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352GHN9-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) | 1 | 143 | 256 |
GO:0000105
GO:0000107 |
| AF-A0A4Y7X5H6-F1-model_v4 | deleted | 1 | 166 | 256 |
|
| AF-A0A257Y9L3-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) | 0.9999 | 113 | 256 |
GO:0000105
GO:0000107 |
| AF-A0A3P7EQJ5-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) | 0.9994 | 64 | 255 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A3N5HSG4-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) | 0.9989 | 175 | 256 |
GO:0000105
GO:0000107 |