F483365

General Info

Members Datasets Scaffolds Average Seq Length
848 673 1696 193

Family's Representative Sequence

Representative Sequence 3300009765|Ga0123341_1000032|Ga0123341_100003224
Length 215
Sequence MPLDTFFALVLFAFTTSITPGPNNMMLFASGVNFGFRRTVPHMFGIGVGFFSLLHAVPVAYTVLKFAGGAYLVWIAWKIASSRSLSEGKSGVKPMSFFAAAAFQWVNPKAWVMAVTAMATYTNPQLYLVSVLIVGLAFAAVNIPSVSTWAGFGSALREWLSDPVRLKWFNISMAVLLVASLWPMLNRAIAGFVSISQRMPRTAAKAGKPQANQMR

Samples

Sample ID Description Type Environment
1 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
33 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
36 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
37 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
38 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
68 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
69 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
74 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
75 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
76 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
77 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
78 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
162 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
163 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
164 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
165 2509276019 Ensifer aridi TW10 Isolate Nodule
166 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
167 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
168 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
169 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
170 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
171 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
172 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
173 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
174 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
175 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
176 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
177 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
178 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
179 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
180 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
181 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
182 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
183 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
184 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
185 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
186 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
187 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
188 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
189 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
190 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
191 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
192 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
193 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
194 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
195 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
196 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
197 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
198 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
199 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
200 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
201 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
202 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
203 2516143018 Ensifer sp. BR816 Isolate Nodule
204 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
205 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
206 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
207 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
208 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
209 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
210 2519899620 Rhizobium sp. Pop5 Isolate Nodule
211 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
212 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
213 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
214 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
215 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
216 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
217 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
218 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
219 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
220 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
221 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
222 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
223 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
224 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
225 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
226 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
227 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
228 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
229 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
230 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
231 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
232 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
233 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
234 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
235 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
236 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
237 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
238 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
239 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
240 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
241 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
242 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
243 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
244 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
245 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
246 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
247 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
248 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
249 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
250 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
251 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
252 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
253 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
254 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
255 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
256 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
257 2643221557 Ensifer sp. Root558 Isolate Unclassified
258 2643221607 Rhizobium sp. Root73 Isolate Unclassified
259 2643221610 Ensifer sp. Root74 Isolate Unclassified
260 2643221618 Ensifer sp. Root231 Isolate Unclassified
261 2643221626 Ensifer sp. Root31 Isolate Unclassified
262 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
263 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
264 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
265 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
266 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
267 2643221655 Ensifer sp. Root1252 Isolate Unclassified
268 2643221659 Ensifer sp. Root127 Isolate Unclassified
269 2643221668 Ensifer sp. Root423 Isolate Unclassified
270 2643221675 Ensifer sp. Root1298 Isolate Unclassified
271 2643221680 Ensifer sp. Root1312 Isolate Unclassified
272 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
273 2643221688 Rhizobium sp. Root482 Isolate Unclassified
274 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
275 2643221693 Rhizobium sp. Root491 Isolate Unclassified
276 2643221698 Ensifer sp. Root142 Isolate Unclassified
277 2643221712 Ensifer sp. Root258 Isolate Unclassified
278 2643221718 Rhizobium sp. Root268 Isolate Unclassified
279 2643221719 Rhizobium sp. Root274 Isolate Unclassified
280 2643221723 Ensifer sp. Root278 Isolate Unclassified
281 2643221726 Ensifer sp. Root954 Isolate Unclassified
282 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
283 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
284 2718217882 Rhizobium sp. N741 Isolate Nodule
285 2718217927 Rhizobium sp. N324 Isolate Nodule
286 2718218009 Rhizobium sp. N561 Isolate Nodule
287 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
288 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
289 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
290 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
291 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
292 2718218363 Rhizobium sp. N113 Isolate Nodule
293 2718218365 Rhizobium sp. N731 Isolate Nodule
294 2718218366 Rhizobium sp. N621 Isolate Nodule
295 2718218423 Rhizobium sp. N941 Isolate Nodule
296 2721755514 Rhizobium sp. N6212 Isolate Nodule
297 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
298 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
299 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
300 2721755809 Rhizobium sp. N541 Isolate Nodule
301 2721755810 Rhizobium sp. N871 Isolate Nodule
302 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
303 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
304 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
305 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
306 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
307 2728369365 Rhizobium sp. N1341 Isolate Nodule
308 2728369397 Rhizobium sp. N1314 Isolate Nodule
309 2738541293 Rhizobium sp. GV031 Isolate Unclassified
310 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
311 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
312 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
313 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
314 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
315 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
316 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
317 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
318 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
319 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
320 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
321 2791355256 Rhizobium sp. M10 Isolate Nodule
322 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
323 2791355260 Rhizobium sp. L9 Isolate Nodule
324 2791355261 Rhizobium sp. J15 Isolate Nodule
325 2791355262 Rhizobium sp. M1 Isolate Nodule
326 2791355263 Rhizobium chutanense C5 Isolate Nodule
327 2791355264 Rhizobium sp. S9 Isolate Nodule
328 2791355265 Rhizobium sp. H4 Isolate Nodule
329 2791355266 Rhizobium sp. L43 Isolate Nodule
330 2791355267 Rhizobium sp. L18 Isolate Nodule
331 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
332 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
333 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
334 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
335 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
336 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
337 2802429633 Rhizobium anhuiense J3 Isolate Nodule
338 2802429634 Rhizobium anhuiense S10 Isolate Nodule
339 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
340 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
341 2802429637 Rhizobium anhuiense C15 Isolate Nodule
342 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
343 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
344 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
345 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
346 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
347 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
348 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
349 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
350 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
351 2838048938 Rhizobium pisi 27/80 Isolate Nodule
352 2838061910 Rhizobium phaseoli L15 Isolate Nodule
353 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
354 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
355 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
356 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
357 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
358 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
359 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
360 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
361 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
362 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
363 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
364 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
365 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
366 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
367 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
368 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
369 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
370 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
371 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
372 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
373 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
374 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
375 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
376 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
377 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
378 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
379 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
380 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
381 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
382 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
383 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
384 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
385 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
386 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
387 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
388 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
389 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
390 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
391 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
392 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
393 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
394 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
395 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
396 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
397 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
398 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
399 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
400 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
401 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
402 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
403 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
404 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
405 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
406 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
407 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
408 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
409 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
410 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
411 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
412 2844163670 Ensifer sp. 1H6 Isolate Unclassified
413 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
414 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
415 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
416 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
417 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
418 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
419 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
420 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
421 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
422 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
423 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
424 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
425 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
426 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
427 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
428 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
429 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
430 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
431 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
432 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
433 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
434 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
435 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
436 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
437 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
438 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
439 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
440 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
441 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
442 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
443 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
444 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
445 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
446 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
447 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
448 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
449 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
450 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
451 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
452 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
453 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
454 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
455 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
456 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
457 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
458 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
459 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
460 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
461 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
462 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
463 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
464 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
465 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
466 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
467 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
468 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
469 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
470 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
471 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
472 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
473 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
474 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
475 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
476 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
477 2933599457 Rhizobium phaseoli M3 Isolate Nodule
478 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
479 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
480 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
481 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
482 2936381700 Rhizobium chutanense C16 Isolate Unclassified
483 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
484 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
485 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
486 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
487 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
488 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
489 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
490 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
491 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
492 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
493 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
494 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
495 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
496 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
497 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
498 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
499 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
500 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
501 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
502 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
503 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
504 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
505 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
506 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
507 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
508 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
509 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
510 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
511 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
512 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
513 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
514 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
515 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
516 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
517 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
518 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
519 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
520 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
521 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
522 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
523 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
524 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
525 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
526 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
527 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
528 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
529 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
530 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
531 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
532 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
533 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
534 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
535 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
536 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
537 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
538 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
539 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
540 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
541 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
542 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
543 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
544 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
545 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
546 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
547 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
548 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
549 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
550 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
551 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
552 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
553 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
554 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
555 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
556 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
557 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
558 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
559 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
560 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
561 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
562 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
563 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
564 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
565 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
566 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
567 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
568 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
569 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
570 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
571 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
572 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
573 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
574 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
575 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
576 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
577 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
578 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
579 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
580 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
581 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
582 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
583 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
584 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
585 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
586 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
587 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
588 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
589 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
590 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
591 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
592 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
593 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
594 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
595 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
596 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
597 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
598 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
599 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
600 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
601 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
602 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
603 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
604 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
605 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
606 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
607 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
608 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
609 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
610 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
611 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
612 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
613 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
614 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
615 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
616 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
617 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
618 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
619 2996887358 Rhizobium sp. R711 Isolate Nodule
620 2996893221 Rhizobium sp. R635 Isolate Nodule
621 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
622 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
623 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
624 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
625 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
626 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
627 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
628 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
629 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
630 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
631 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
632 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
633 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
634 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
635 8005258706 Rhizobium sp. R693 Isolate Nodule
636 8005275841 Rhizobium sp. N4311 Isolate Nodule
637 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
638 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
639 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
640 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
641 8005321885 Rhizobium sp. R72 Isolate Nodule
642 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
643 8005382845 Rhizobium sp. R634 Isolate Nodule
644 8005395548 Rhizobium sp. R339 Isolate Nodule
645 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
646 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
647 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
648 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
649 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
650 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
651 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
652 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
653 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
654 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
655 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
656 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
657 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
658 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
659 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
660 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
661 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
662 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
663 8018176218 Rhizobium sp. N122 Isolate Nodule
664 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
665 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
666 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
667 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
668 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
669 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
670 8056382006 Rhizobium croatiense 13T Isolate Nodule
671 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
672 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
673 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.5
Metatranscriptomes 0.24
Isolates 60.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 19.1
Nodule 45.17
Rhizoplane 1.42
Rhizosphere 16.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0123341_1000032 3300009765 Bacteria 62527
2 JGI25158J39367_1000336 3300002739 Bacteria 10357
3 JGI25152J39213_1000826 3300002773 Bacteria 15432
4 JGI25152J39213_1006182 3300002773 Bacteria 3323
5 JGI25152J39213_1006351 3300002773 Bacteria 3243
6 JGI25152J39213_1017437 3300002773 Bacteria 1356
7 JGI25150J39212_1000165 3300002774 Bacteria 37364
8 JGI25150J39212_1000307 3300002774 Bacteria 24463
9 JGI25150J39212_1006463 3300002774 Bacteria 2416
10 JGI25159J45721_1000040 3300002987 Bacteria 68143
11 JGI25159J45721_1000966 3300002987 Bacteria 12481
12 JGI25151J46595_10000329 3300003187 Bacteria 51364
13 JGI25151J46595_10005981 3300003187 Bacteria 6194
14 JGI25151J46595_10024415 3300003187 Bacteria 2474
15 JGI25151J46595_10034270 3300003187 Bacteria 1944
16 JGI25153J46596_10003631 3300003215 Bacteria 8560
17 JGI25153J46596_10009561 3300003215 Bacteria 4484
18 JGI25153J46596_10012453 3300003215 Bacteria 3669
19 JGI25153J46596_10014210 3300003215 Bacteria 3323
20 JGI25153J46596_10026848 3300003215 Bacteria 2029
21 JGI25153J46596_10043631 3300003215 Bacteria 1356
22 rootH2_10199801 3300003320 Bacteria 1227
23 rootL2_10127000 3300003322 Bacteria 2632
24 JGI25160J50197_1000001 3300003354 Bacteria 782301
25 JGI25160J50197_1000128 3300003354 Bacteria 68143
26 JGI25161J50226_1000001 3300003374 Bacteria 655036
27 JGI25161J50226_1000996 3300003374 Bacteria 9921
28 Ga0006562J51391_1036025 3300003578 Bacteria 1556
29 Ga0055526_1001311 3300003771 Bacteria 17836
30 Ga0055526_1001851 3300003771 Bacteria 14653
31 Ga0055526_1005523 3300003771 Bacteria 7236
32 Ga0055526_1007857 3300003771 Bacteria 5451
33 Ga0055524_1002368 3300003775 Bacteria 9799
34 Ga0055524_1004414 3300003775 Bacteria 6490
35 Ga0055524_1015223 3300003775 Bacteria 2814
36 Ga0055524_1053175 3300003775 Bacteria 899
37 Ga0055536_1002507 3300003781 Bacteria 10298
38 Ga0055536_1009417 3300003781 Bacteria 4039
39 Ga0055528_1001122 3300003790 Bacteria 17570
40 Ga0055528_1003598 3300003790 Bacteria 7716
41 Ga0055528_1004902 3300003790 Bacteria 6318
42 Ga0055528_1011411 3300003790 Bacteria 3531
43 Ga0055528_1013658 3300003790 Bacteria 3061
44 Ga0055528_1014492 3300003790 Bacteria 2914
45 Ga0055528_1026156 3300003790 Bacteria 1689
46 Ga0055530_10016163 3300003791 Bacteria 2396
47 Ga0055530_10018535 3300003791 Bacteria 2142
48 Ga0055540_1000283 3300003792 Bacteria 45546
49 Ga0055540_1006077 3300003792 Bacteria 4876
50 Ga0055540_1008899 3300003792 Bacteria 3547
51 Ga0055540_1021104 3300003792 Bacteria 1701
52 Ga0055531_10014920 3300003794 Bacteria 3465
53 Ga0055531_10019396 3300003794 Bacteria 2751
54 Ga0055543_1000003 3300004625 Bacteria 358656
55 Ga0055543_1000130 3300004625 Bacteria 62045
56 Ga0065165_1000013 3300005262 Bacteria 301887
57 Ga0065165_1000068 3300005262 Bacteria 170609
58 Ga0065165_1018622 3300005262 Bacteria 2506
59 Ga0070668_100484784 3300005347 Bacteria 1068
60 Ga0070669_100366031 3300005353 Bacteria 1173
61 Ga0070671_100043123 3300005355 Bacteria 3750
62 Ga0075365_10002254 3300006038 Bacteria 9345
63 Ga0075365_10146606 3300006038 Bacteria 1640
64 Ga0075363_100171077 3300006048 Bacteria 1233
65 Ga0075362_10199156 3300006177 Bacteria 974
66 Ga0075367_10111600 3300006178 Bacteria 1679
67 Ga0075369_10000132 3300006186 Bacteria 20799
68 Ga0075369_10055198 3300006186 Bacteria 1726
69 Ga0075370_10103814 3300006353 Bacteria 1647
70 Ga0105248_10041256 3300009177 Bacteria 5173
71 Ga0105248_10055062 3300009177 Bacteria 4461
72 Ga0123342_1005565 3300009766 Bacteria 18132
73 Ga0123342_1021015 3300009766 Bacteria 4659
74 Ga0171463_1003 3300013249 Bacteria 695693
75 Ga0157375_10860375 3300013308 Bacteria 1053
76 Ga0183363_1104 3300015690 Bacteria 24110
77 Ga0214543_1000038 3300021327 Bacteria 182106
78 Ga0228710_1000009 3300022740 Bacteria 169770
79 Ga0209436_100478 3300025208 Bacteria 17685
80 Ga0207425_1000024 3300025245 Bacteria 328978
81 Ga0207425_1006299 3300025245 Bacteria 3259
82 Ga0207425_1006673 3300025245 Bacteria 3131
83 Ga0207425_1022530 3300025245 Bacteria 1326
84 Ga0207425_1029056 3300025245 Bacteria 1117
85 Ga0209129_1000146 3300025258 Bacteria 115180
86 Ga0209129_1000161 3300025258 Bacteria 102017
87 Ga0209129_1001999 3300025258 Bacteria 10596
88 Ga0209129_1002877 3300025258 Bacteria 7934
89 Ga0209129_1005114 3300025258 Bacteria 4803
90 Ga0209129_1022237 3300025258 Bacteria 1148
91 Ga0209129_1025995 3300025258 Bacteria 1015
92 Ga0209673_1000010 3300025273 Bacteria 596656
93 Ga0209673_1000384 3300025273 Bacteria 79540
94 Ga0209673_1000977 3300025273 Bacteria 35281
95 Ga0209673_1004894 3300025273 Bacteria 6978
96 Ga0209673_1005688 3300025273 Bacteria 6218
97 Ga0209673_1013499 3300025273 Bacteria 3218
98 Ga0209673_1091836 3300025273 Bacteria 670
99 Ga0209130_1000003 3300025284 Bacteria 677988
100 Ga0209130_1000034 3300025284 Bacteria 302439
101 Ga0209130_1027074 3300025284 Bacteria 1222
102 Ga0209676_1001813 3300025292 Bacteria 17850
103 Ga0209676_1002914 3300025292 Bacteria 11195
104 Ga0209676_1034652 3300025292 Bacteria 1490
105 Ga0209025_1000050 3300025294 Bacteria 331531
106 Ga0209025_1002141 3300025294 Bacteria 22141
107 Ga0209025_1005836 3300025294 Bacteria 9857
108 Ga0209025_1006154 3300025294 Bacteria 9440
109 Ga0209025_1071243 3300025294 Bacteria 1233
110 Ga0209025_1113848 3300025294 Bacteria 824
111 Ga0209564_1000013 3300025295 Bacteria 775755
112 Ga0209564_1000388 3300025295 Bacteria 79331
113 Ga0209564_1000512 3300025295 Bacteria 63708
114 Ga0209564_1005163 3300025295 Bacteria 7580
115 Ga0209758_1000083 3300025297 Bacteria 257283
116 Ga0209758_1000642 3300025297 Bacteria 53219
117 Ga0209758_1002951 3300025297 Bacteria 16327
118 Ga0209758_1003069 3300025297 Bacteria 15878
119 Ga0209758_1003364 3300025297 Bacteria 14653
120 Ga0209758_1009029 3300025297 Bacteria 6300
121 Ga0209758_1012299 3300025297 Bacteria 4804
122 Ga0209758_1046605 3300025297 Bacteria 1561
123 Ga0209758_1060767 3300025297 Bacteria 1249
124 Ga0209758_1099502 3300025297 Bacteria 830
125 Ga0209050_1002022 3300025298 Bacteria 18857
126 Ga0209256_1000442 3300025299 Bacteria 63395
127 Ga0209256_1001584 3300025299 Bacteria 22294
128 Ga0209256_1002304 3300025299 Bacteria 15989
129 Ga0209256_1003052 3300025299 Bacteria 12342
130 Ga0209256_1020294 3300025299 Bacteria 2079
131 Ga0209256_1021361 3300025299 Bacteria 1990
132 Ga0207426_1000006 3300025302 Bacteria 1025969
133 Ga0207426_1000011 3300025302 Bacteria 791203
134 Ga0207426_1002076 3300025302 Bacteria 13895
135 Ga0209051_1000308 3300025303 Bacteria 76477
136 Ga0209051_1002410 3300025303 Bacteria 13449
137 Ga0209051_1003936 3300025303 Bacteria 9464
138 Ga0209051_1007466 3300025303 Bacteria 5969
139 Ga0209051_1042307 3300025303 Bacteria 1611
140 Ga0209257_1000853 3300025304 Bacteria 43617
141 Ga0209257_1002648 3300025304 Bacteria 17217
142 Ga0209257_1003491 3300025304 Bacteria 13392
143 Ga0209257_1021628 3300025304 Bacteria 2328
144 Ga0207681_10147234 3300025923 Bacteria 1761
145 Ga0207711_10014356 3300025941 Bacteria 6578
146 Ga0207711_10015952 3300025941 Bacteria 6232
147 Ga0209974_10026978 3300027876 Bacteria 1900
148 Ga0268266_10381118 3300028379 Bacteria 1330
149 Ga0307515_10017597 3300028794 Bacteria 13001
150 Ga0307515_10025749 3300028794 Bacteria 10161
151 Ga0307515_10188841 3300028794 Bacteria 1979
152 Ga0307513_10093771 3300031456 Bacteria 3050
153 Ga0307408_100346790 3300031548 Bacteria 1259
154 Ga0307412_11023142 3300031911 Bacteria 731
155 Ga0307416_101434602 3300032002 Bacteria 796
156 Ga0307414_10082671 3300032004 Bacteria 2355
157 Ga0315913_1000006 3300033430 Bacteria 169893
158 Ga0395905_0000736 3300037471 Bacteria 43138
159 Ga0439436_0001576 3300041404 Bacteria 6644
160 Ga0439436_0012157 3300041404 Bacteria 2613
161 Ga0439439_0027963 3300041406 Bacteria 1426
162 Ga0439465_0001082 3300041413 Bacteria 8718
163 Ga0439465_0004189 3300041413 Bacteria 4692
164 Ga0439465_0218761 3300041413 Bacteria 698
165 Ga0451787_436462 3300041441 Bacteria 1242
166 Ga0451791_0821308 3300041451 Bacteria 2156
167 Ga0451833_0225210 3300041491 Bacteria 836
168 Ga0451837_0392092 3300041494 Bacteria 3031
169 Ga0451837_0569472 3300041494 Bacteria 1243
170 Ga0451839_0313923 3300041496 Bacteria 4452
171 Ga0451841_0936760 3300041498 Bacteria 1090
172 Ga0451846_55098 3300041502 Bacteria 766
173 Ga0451847_0237521 3300041503 Bacteria 1694
174 Ga0451847_0735982 3300041503 Bacteria 1749
175 Ga0451849_1213583 3300041505 Bacteria 856
176 Ga0451851_0161803 3300041507 Bacteria 5715
177 Ga0451843_0233737 3300041509 Bacteria 1014
178 Ga0451843_0998701 3300041509 Bacteria 2137
179 Ga0451855_0713139 3300041511 Bacteria 956
180 Ga0451853_0211463 3300041512 Bacteria 1657
181 Ga0451853_1152098 3300041512 Bacteria 5309
182 Ga0451853_1888721 3300041512 Bacteria 749
183 Ga0439431_0028971 3300041997 Bacteria 1366
184 Ga0450906_004190 3300042145 Bacteria 3040
185 Ga0450906_061604 3300042145 Bacteria 668
186 Ga0439434_0009578 3300042435 Bacteria 2850
187 Ga0466970_0069085 3300044765 Bacteria 1899
188 Ga0495617_013469 3300046452 Bacteria 2784
189 Ga0495638_0000195 3300046460 Bacteria 88030
190 Ga0495650_0047306 3300046471 Bacteria 1800
191 Ga0495605_0007566 3300046474 Bacteria 6160
192 Ga0495605_0018481 3300046474 Bacteria 3737
193 Ga0495585_0006794 3300046492 Bacteria 7061
194 Ga0495596_0021263 3300046500 Bacteria 2650
195 Ga0495607_0153511 3300046501 Bacteria 1176
196 Ga0495583_0101246 3300046506 Bacteria 1229
197 Ga0495606_0010451 3300046507 Bacteria 7701
198 Ga0495606_0236521 3300046507 Bacteria 1021
199 Ga0495610_0001253 3300046512 Bacteria 22804
200 Ga0495610_0011895 3300046512 Bacteria 5282
201 Ga0495620_0048655 3300046515 Bacteria 1818
202 Ga0495631_0001628 3300046518 Bacteria 13398
203 Ga0495631_0056441 3300046518 Bacteria 1710
204 Ga0495632_0080978 3300046519 Bacteria 1548
205 Ga0495643_0007771 3300046522 Bacteria 6862
206 Ga0495643_0015966 3300046522 Bacteria 4421
207 Ga0495643_0078291 3300046522 Bacteria 1726
208 Ga0495643_0099412 3300046522 Bacteria 1492
209 Ga0495648_0091124 3300046524 Bacteria 1706
210 Ga0495648_0196670 3300046524 Bacteria 1013
211 Ga0495663_0008753 3300046525 Bacteria 2807
212 Ga0495597_0011360 3300046542 Bacteria 4320
213 Ga0495633_0012064 3300046558 Bacteria 4615
214 Ga0495656_0219239 3300046615 Bacteria 951
215 Ga0495668_0013421 3300046616 Bacteria 4832
216 Ga0495611_0009701 3300046648 Bacteria 4069
217 Ga0495611_0058439 3300046648 Bacteria 1749
218 Ga0495625_0000621 3300046660 Bacteria 51568
219 Ga0495625_0003972 3300046660 Bacteria 14184
220 Ga0495625_0151117 3300046660 Bacteria 1561
221 Ga0495625_0251681 3300046660 Bacteria 1146
222 Ga0495670_0016423 3300046691 Bacteria 3638
223 Ga0495670_0095238 3300046691 Bacteria 1527
224 Ga0495671_0077923 3300046692 Bacteria 1625
225 Ga0495660_0021318 3300046810 Bacteria 3711
226 Ga0495660_0046709 3300046810 Bacteria 2373
227 Ga0495636_0077919 3300047318 Bacteria 1423
228 Ga0495672_0005251 3300047320 Bacteria 10318
229 Ga0495687_071448 3300047443 Bacteria 1390
230 Ga0495686_0003045 3300047472 Bacteria 14859
231 Ga0495686_0033251 3300047472 Bacteria 3331
232 Ga0495686_0046675 3300047472 Bacteria 2737
233 Ga0495626_0069954 3300048091 Bacteria 1580
234 Ga0495626_0242227 3300048091 Bacteria 726
235 Ga0496102_0033698 3300048905 Bacteria 4604
236 Ga0496106_0000578 3300048909 Bacteria 26182
237 Ga0496110_0011425 3300048913 Bacteria 7268
238 Ga0496113_0178332 3300048916 Bacteria 1684
239 Ga0496114_0986492 3300048917 Bacteria 725
240 Ga0496116_0007652 3300048919 Bacteria 9529
241 Ga0496116_0021014 3300048919 Bacteria 4936
242 Ga0496116_0098082 3300048919 Bacteria 1759
243 Ga0496116_0301076 3300048919 Bacteria 763
244 Ga0496117_0011077 3300048920 Bacteria 8114
245 Ga0496117_0076711 3300048920 Bacteria 2214
246 Ga0496117_0130386 3300048920 Bacteria 1525
247 Ga0496118_0007840 3300048921 Bacteria 11196
248 Ga0496118_0013080 3300048921 Bacteria 7889
249 Ga0496118_0027940 3300048921 Bacteria 4764
250 Ga0496119_0187637 3300048922 Bacteria 1080
251 Ga0496119_0293636 3300048922 Bacteria 804
252 Ga0496121_0009569 3300048924 Bacteria 11104
253 Ga0496121_0011992 3300048924 Bacteria 9529
254 Ga0496121_0029632 3300048924 Bacteria 5052
255 Ga0496121_0042223 3300048924 Bacteria 3971
256 Ga0496121_0061579 3300048924 Bacteria 3078
257 Ga0496121_0085895 3300048924 Bacteria 2474
258 Ga0496121_0086354 3300048924 Bacteria 2466
259 Ga0496121_0344383 3300048924 Bacteria 995
260 Ga0496122_0002690 3300048925 Bacteria 24724
261 Ga0496122_0013904 3300048925 Bacteria 7829
262 Ga0496122_0016080 3300048925 Bacteria 7110
263 Ga0496122_0035177 3300048925 Bacteria 4083
264 Ga0496122_0045332 3300048925 Bacteria 3419
265 Ga0496122_0459654 3300048925 Bacteria 629
266 Ga0496123_0000054 3300048926 Bacteria 234046
267 Ga0496123_0009709 3300048926 Bacteria 8623
268 Ga0496123_0019000 3300048926 Bacteria 5432
269 Ga0496123_0045692 3300048926 Bacteria 2980
270 Ga0496123_0062910 3300048926 Bacteria 2374
271 Ga0496124_0001702 3300048927 Bacteria 31109
272 Ga0496124_0006525 3300048927 Bacteria 12691
273 Ga0496124_0034478 3300048927 Bacteria 4441
274 Ga0496124_0038771 3300048927 Bacteria 4134
275 Ga0496124_0100509 3300048927 Bacteria 2344
276 Ga0496124_0131331 3300048927 Bacteria 1989
277 Ga0496125_0000273 3300048928 Bacteria 104663
278 Ga0496125_0012546 3300048928 Bacteria 8403
279 Ga0496125_0064881 3300048928 Bacteria 2898
280 Ga0496125_0085645 3300048928 Bacteria 2387
281 Ga0496125_0217125 3300048928 Bacteria 1236
282 Ga0496125_0396043 3300048928 Bacteria 809
283 Ga0496126_0000589 3300048929 Bacteria 68753
284 Ga0496126_0022038 3300048929 Bacteria 6208
285 Ga0496126_0044422 3300048929 Bacteria 4092
286 Ga0496126_0373740 3300048929 Bacteria 1162
287 Ga0496126_0518452 3300048929 Bacteria 950
288 Ga0495678_091705 3300049459 Bacteria 1069
289 Ga0495678_103658 3300049459 Bacteria 982
290 Ga0501032_0057958 3300049569 Bacteria 2601
291 Ga0501033_0150145 3300049570 Bacteria 1681
292 Ga0501034_0780151 3300049571 Bacteria 849
293 Ga0501036_0164362 3300049572 Bacteria 1871
294 Ga0501037_0123580 3300049573 Bacteria 1859
295 Ga0501039_0109357 3300049575 Bacteria 2161
296 Ga0501043_0191596 3300049579 Bacteria 1590
297 Ga0501073_0213904 3300049589 Bacteria 1332
298 Ga0501276_008926 3300049773 Bacteria 823
299 Ga0501035_0097802 3300049822 Bacteria 2577
300 Ga0501044_0056630 3300049823 Bacteria 4025
301 Ga0501044_0618799 3300049823 Bacteria 974
302 nmdc:mga00v17_99741_c1 3300050491 Bacteria 1832
303 nmdc:mga0yw44_10832_c1 3300050492 Bacteria 4674
304 nmdc:mga0yw44_213667_c1 3300050492 Bacteria 1276
305 nmdc:mga07m45_129080_c1 3300050496 Bacteria 1462
306 nmdc:mga07m45_170867_c1 3300050496 Bacteria 1263
307 nmdc:mga0sz30_10737_c2 3300050516 Bacteria 1325
308 nmdc:mga0sz30_286662_c1 3300050516 Bacteria 734
309 Ga0500610_0034789 3300053079 Bacteria 2580
310 Ga0495655_0021806 3300053083 Bacteria 1455
311 Ga0500578_0117842 3300053086 Bacteria 1670
312 Ga0500643_023448 3300053087 Bacteria 1971
313 Ga0500557_003926 3300053105 Bacteria 3039
314 Ga0500562_019999 3300053108 Bacteria 1737
315 Ga0500569_009973 3300053109 Bacteria 2222
316 Ga0500569_012112 3300053109 Bacteria 2078
317 Ga0500594_0002292 3300053118 Bacteria 4149
318 Ga0500608_029678 3300053122 Bacteria 2588
319 Ga0500658_0002369 3300053134 Bacteria 7302
320 Ga0500658_0132682 3300053134 Bacteria 1112
321 Ga0500659_0108663 3300053135 Bacteria 1429
322 Ga0500559_0005229 3300053136 Bacteria 5983
323 Ga0500568_0005767 3300053139 Bacteria 6338
324 Ga0500568_0008709 3300053139 Bacteria 4869
325 Ga0500568_0060281 3300053139 Bacteria 1470
326 Ga0500568_0068957 3300053139 Bacteria 1357
327 Ga0500604_0007759 3300053151 Bacteria 2844
328 Ga0500616_0000884 3300053153 Bacteria 33039
329 Ga0500616_0019444 3300053153 Bacteria 3828
330 Ga0500616_0091969 3300053153 Bacteria 1500
331 Ga0500616_0189017 3300053153 Bacteria 921
332 Ga0500622_0000697 3300053156 Bacteria 29561
333 Ga0500622_0000899 3300053156 Bacteria 25323
334 Ga0500622_0191860 3300053156 Bacteria 936
335 Ga0500627_0015706 3300053158 Bacteria 2935
336 Ga0500633_0031808 3300053160 Bacteria 1708
337 Ga0500599_004643 3300053736 Bacteria 1703
338 2509111329 2508501122 Bacteria 6292184
339 2509376393 2509276019 Bacteria 6802256
340 2509392132 2509276021 Bacteria 7634384
341 2509445778 2509276033 Bacteria 7180565
342 2509446920 2509276033 Bacteria 7180565
343 2510133878 2510065019 Bacteria 6903379
344 2510304391 2510065057 Bacteria 6649661
345 2510840077 2510461069 Bacteria 5505000
346 2510895299 2510461076 Bacteria 8618824
347 2511135317 2510917022 Bacteria 6504556
348 2511173698 2510917026 Bacteria 7046020
349 2511186984 2510917028 Bacteria 6185411
350 2511196079 2510917030 Bacteria 7460662
351 2511389781 2511231027 Bacteria 5013807
352 2511502165 2511231052 Bacteria 6974333
353 2512533544 2512047086 Bacteria 6850303
354 2512970781 2512875026 Bacteria 6861065
355 2513573647 2513237084 Bacteria 7231967
356 2513576868 2513237085 Bacteria 7695351
357 2513582441 2513237086 Bacteria 7265287
358 2513596402 2513237088 Bacteria 6927906
359 2513604176 2513237089 Bacteria 6553624
360 2513617982 2513237091 Bacteria 6900273
361 2513629475 2513237093 Bacteria 7545552
362 2513708125 2513237103 Bacteria 7647401
363 2513865526 2513237138 Bacteria 7368160
364 2513885506 2513237140 Bacteria 7076289
365 2513903282 2513237143 Bacteria 6664116
366 2513909185 2513237144 Bacteria 7530820
367 2513925452 2513237146 Bacteria 7166346
368 2513985317 2513237156 Bacteria 6402557
369 2513996873 2513237159 Bacteria 6810126
370 2514006475 2513237160 Bacteria 6650282
371 2514020082 2513237162 Bacteria 7468464
372 2515112923 2515075009 Bacteria 7288508
373 2515608945 2515154107 Bacteria 6795637
374 2515636398 2515154113 Bacteria 7807172
375 2515640886 2515154114 Bacteria 7848616
376 2515655430 2515154116 Bacteria 7552979
377 2515739407 2515154134 Bacteria 7220242
378 2516204079 2516143018 Bacteria 6951533
379 2516893545 2516653046 Bacteria 6989037
380 2517036625 2516653077 Bacteria 7555578
381 2517076987 2516653085 Bacteria 7346596
382 2517095757 2517093000 Bacteria 7412387
383 2517407322 2517287029 Bacteria 6905599
384 2517570248 2517487022 Bacteria 7227575
385 2520381427 2519899620 Bacteria 6499161
386 2524448631 2524023207 Bacteria 6813453
387 2524459517 2524023209 Bacteria 6679728
388 2530646030 2529292951 Bacteria 6916614
389 2535516796 2534681796 Bacteria 7146037
390 2551674484 2551306084 Bacteria 8942552
391 2551685847 2551306085 Bacteria 7347181
392 2551695969 2551306086 Bacteria 6843938
393 2551697269 2551306087 Bacteria 7351905
394 2551715303 2551306089 Bacteria 7162724
395 2551725120 2551306091 Bacteria 7086830
396 2551733150 2551306092 Bacteria 6992595
397 2551743322 2551306093 Bacteria 7064773
398 2558867781 2558860100 Bacteria 8458965
399 2559295277 2558860242 Bacteria 5568029
400 2585166277 2582581283 Bacteria 6030556
401 2585200535 2582581294 Bacteria 6626667
402 2585222749 2582581298 Bacteria 7315509
403 2585232766 2582581299 Bacteria 6518058
404 2585255010 2582581304 Bacteria 5831370
405 2585267512 2582581306 Bacteria 6450535
406 2585271054 2582581307 Bacteria 6597605
407 2585331551 2582581316 Bacteria 7774528
408 2585386574 2582581865 Bacteria 6644329
409 2585393187 2582581866 Bacteria 6859583
410 2585402471 2582581867 Bacteria 7184437
411 2585527367 2585427526 Bacteria 7258840
412 2585535036 2585427527 Bacteria 7273426
413 2585538109 2585427528 Bacteria 6842387
414 2585545332 2585427529 Bacteria 7395659
415 2585555884 2585427530 Bacteria 7383882
416 2585558778 2585427531 Bacteria 6992870
417 2585822841 2585427590 Bacteria 6824633
418 2585836057 2585427593 Bacteria 7141551
419 2585843097 2585427594 Bacteria 6180594
420 2585898173 2585427608 Bacteria 6544331
421 2585904252 2585427609 Bacteria 6667127
422 2585996124 2585427633 Bacteria 6413184
423 2586000741 2585427634 Bacteria 6455027
424 2587980631 2585428125 Bacteria 6662905
425 2599417369 2599185170 Bacteria 7295545
426 2599601591 2599185210 Bacteria 5624189
427 2600194301 2599185352 Bacteria 7228948
428 2616293434 2615840624 Bacteria 6557588
429 2616308884 2615840626 Bacteria 7921970
430 2616556907 2615840698 Bacteria 7319877
431 2617385956 2617270742 Bacteria 6808054
432 2643803189 2643221557 Bacteria 7184309
433 2644050590 2643221607 Bacteria 6314006
434 2644063553 2643221610 Bacteria 7480339
435 2644107372 2643221618 Bacteria 7717186
436 2644150939 2643221626 Bacteria 8069654
437 2644193431 2643221634 Bacteria 6705461
438 2644205064 2643221636 Bacteria 6583769
439 2644210093 2643221637 Bacteria 5345260
440 2644238876 2643221643 Bacteria 5749658
441 2644298598 2643221653 Bacteria 4569637
442 2644308767 2643221655 Bacteria 7722067
443 2644335584 2643221659 Bacteria 7890716
444 2644374834 2643221668 Bacteria 7306521
445 2644414316 2643221675 Bacteria 7473456
446 2644447844 2643221680 Bacteria 7473610
447 2644483508 2643221686 Bacteria 6310811
448 2644491968 2643221688 Bacteria 5260751
449 2644499715 2643221689 Bacteria 6042950
450 2644522029 2643221693 Bacteria 5513853
451 2644539990 2643221698 Bacteria 7756764
452 2644614708 2643221712 Bacteria 7729434
453 2644653645 2643221718 Bacteria 5345506
454 2644656827 2643221719 Bacteria 4568197
455 2644676173 2643221723 Bacteria 7095460
456 2644690317 2643221726 Bacteria 7455827
457 2657681493 2657244999 Bacteria 5946535
458 2671111509 2667528174 Bacteria 6435400
459 2719181736 2718217882 Bacteria 6556348
460 2719386260 2718217927 Bacteria 6972593
461 2719732400 2718218009 Bacteria 6478651
462 2720492501 2718218199 Bacteria 6740745
463 2720613937 2718218232 Bacteria 6720332
464 2720620741 2718218233 Bacteria 6662049
465 2720632064 2718218235 Bacteria 6630699
466 2720775792 2718218269 Bacteria 6906114
467 2721147827 2718218363 Bacteria 6524337
468 2721159277 2718218365 Bacteria 6274507
469 2721164663 2718218366 Bacteria 6425255
470 2721400042 2718218423 Bacteria 6438183
471 2722840833 2721755514 Bacteria 6424414
472 2723027399 2721755556 Bacteria 6745503
473 2723561018 2721755684 Bacteria 6859907
474 2723567611 2721755685 Bacteria 6704835
475 2724038855 2721755809 Bacteria 6438790
476 2724045156 2721755810 Bacteria 6479005
477 2724090399 2721755819 Bacteria 6906405
478 2724104876 2721755822 Bacteria 6726041
479 2724110681 2721755823 Bacteria 6752556
480 2725952637 2724679232 Bacteria 7646494
481 2730108335 2728369352 Bacteria 6745171
482 2730164971 2728369365 Bacteria 6555560
483 2730298909 2728369397 Bacteria 6274511
484 2738800008 2738541293 Bacteria 7065685
485 2739032767 2738541333 Bacteria 7106503
486 2753461957 2751185821 Bacteria 6189929
487 2765464697 2765235802 Bacteria 5618596
488 2766065791 2765235942 Bacteria 7445910
489 2770195370 2767802442 Bacteria 5747986
490 2776270688 2775506902 Bacteria 6208009
491 2776280489 2775506904 Bacteria 5954060
492 2778175343 2775507266 Bacteria 7392367
493 2792620847 2791355091 Bacteria 6135441
494 2792626207 2791355092 Bacteria 6248105
495 2792639145 2791355094 Bacteria 7011481
496 2793294512 2791355256 Bacteria 6798008
497 2793314613 2791355259 Bacteria 7254731
498 2793320440 2791355260 Bacteria 6598818
499 2793331712 2791355261 Bacteria 6661293
500 2793336836 2791355262 Bacteria 6774204
501 2793339127 2791355263 Bacteria 6872478
502 2793348810 2791355264 Bacteria 6429314
503 2793351907 2791355265 Bacteria 6539969
504 2793363622 2791355266 Bacteria 7116587
505 2793370252 2791355267 Bacteria 7222458
506 2802719943 2802428858 Bacteria 6636079
507 2802731874 2802428860 Bacteria 6525526
508 2802739205 2802428861 Bacteria 6534206
509 2802745815 2802428862 Bacteria 6633353
510 2802752417 2802428863 Bacteria 6410669
511 2804752685 2802429268 Bacteria 6094027
512 2806043746 2802429633 Bacteria 7341974
513 2806050322 2802429634 Bacteria 7083200
514 2806057139 2802429635 Bacteria 7650140
515 2806064521 2802429636 Bacteria 7597525
516 2806071788 2802429637 Bacteria 7067217
517 2808987989 2808606387 Bacteria 5697198
518 2819241478 2818991272 Bacteria 4622173
519 2819558994 2818991439 Bacteria 6907412
520 2819609067 2818991448 Bacteria 6772224
521 2819637700 2818991453 Bacteria 7181617
522 2838028398 2838022645 Bacteria 6494267
523 2838029888 2838029111 Bacteria 6603031
524 2838038430 2838035591 Bacteria 7166484
525 2838043891 2838042994 Bacteria 6046894
526 2838051977 2838048938 Bacteria 6044578
527 2838067405 2838061910 Bacteria 6794874
528 2838070223 2838068647 Bacteria 6208656
529 2838661661 2838661181 Bacteria 7385261
530 2838670285 2838668709 Bacteria 6671819
531 2838681688 2838680041 Bacteria 6545511
532 2838687131 2838686498 Bacteria 7807632
533 2838696260 2838694306 Bacteria 6853137
534 2838702656 2838701080 Bacteria 6669771
535 2838710501 2838707686 Bacteria 6619912
536 2838729896 2838729681 Bacteria 7400765
537 2838743089 2838742623 Bacteria 7396178
538 2839996961 2839993093 Bacteria 5512535
539 2840767485 2840764183 Bacteria 6358399
540 2841852575 2841851746 Bacteria 7532261
541 2841862054 2841859092 Bacteria 5436171
542 2841869874 2841864319 Bacteria 6742987
543 2842078675 2842077413 Bacteria 6508645
544 2842114905 2842110456 Bacteria 7656360
545 2842118816 2842118031 Bacteria 7033875
546 2842148086 2842146304 Bacteria 5957337
547 2842157965 2842156927 Bacteria 6894975
548 2842167485 2842163707 Bacteria 6916235
549 2842181584 2842180545 Bacteria 6888678
550 2842204471 2842198810 Bacteria 6608673
551 2842205555 2842205361 Bacteria 6340321
552 2842217856 2842217011 Bacteria 7497767
553 2842230365 2842229732 Bacteria 7475766
554 2842239913 2842237096 Bacteria 6620661
555 2842244267 2842243621 Bacteria 7421798
556 2842253152 2842250916 Bacteria 6579627
557 2842257647 2842257432 Bacteria 7401195
558 2842266187 2842264693 Bacteria 6472963
559 2842271331 2842271015 Bacteria 7807131
560 2842279012 2842278818 Bacteria 6340002
561 2842292337 2842291075 Bacteria 7076806
562 2842301297 2842298080 Bacteria 6123127
563 2842304960 2842304105 Bacteria 7023636
564 2842314991 2842311132 Bacteria 6616990
565 2842346380 2842341865 Bacteria 7003929
566 2842357834 2842357229 Bacteria 6485165
567 2842369041 2842363717 Bacteria 6844742
568 2842372255 2842370503 Bacteria 7038661
569 2842378734 2842377471 Bacteria 7140707
570 2842385326 2842384541 Bacteria 7057858
571 2842399958 2842395702 Bacteria 6780583
572 2842423837 2842422224 Bacteria 6239196
573 2842430650 2842428310 Bacteria 6767288
574 2842437363 2842434925 Bacteria 6502746
575 2842443733 2842441272 Bacteria 6769273
576 2842453141 2842447887 Bacteria 6754142
577 2842464793 2842462802 Bacteria 6588055
578 2842471981 2842469257 Bacteria 6752936
579 2842476827 2842475841 Bacteria 6603183
580 2842484638 2842482326 Bacteria 7212537
581 2842491902 2842489311 Bacteria 6620893
582 2842503416 2842502639 Bacteria 6604161
583 2842511207 2842509118 Bacteria 6850950
584 2842518838 2842515876 Bacteria 5436280
585 2842522888 2842521101 Bacteria 6569494
586 2842871878 2842871566 Bacteria 4827117
587 2844166654 2844163670 Bacteria 7266046
588 2844458498 2844454524 Bacteria 7952546
589 2850081362 2850079185 Bacteria 6848280
590 2852390135 2852387548 Bacteria 8025568
591 2854899207 2854896431 Bacteria 5869725
592 2854918762 2854916844 Bacteria 5725939
593 2855826265 2855825444 Bacteria 6785811
594 2855841610 2855839649 Bacteria 7135830
595 2857517514 2857516855 Bacteria 7787325
596 2858801726 2858800743 Bacteria 6603254
597 2894656061 2894652903 Bacteria 4587256
598 2899796122 2899792073 Bacteria 4926588
599 2899807347 2899803654 Bacteria 5577784
600 2899850706 2899845264 Bacteria 5672268
601 2904580690 2904578770 Bacteria 5302906
602 2915981353 2915980308 Bacteria 6624279
603 2915990418 2915986958 Bacteria 6739310
604 2915998080 2915993759 Bacteria 7016183
605 2916006855 2916000859 Bacteria 6865702
606 2916013853 2916007675 Bacteria 6898660
607 2916017585 2916014648 Bacteria 6946486
608 2916025044 2916021584 Bacteria 6854472
609 2916033207 2916028427 Bacteria 6748433
610 2916040209 2916035215 Bacteria 6755766
611 2916044048 2916041962 Bacteria 6820487
612 2916054229 2916048683 Bacteria 6543552
613 2916059656 2916055098 Bacteria 6758838
614 2916064253 2916061851 Bacteria 6737736
615 2916070328 2916068649 Bacteria 6943657
616 2916079887 2916076590 Bacteria 6596108
617 2919106635 2919100787 Bacteria 7710546
618 2919121596 2919119836 Bacteria 5208557
619 2919174776 2919171160 Bacteria 6499771
620 2919409899 2919408235 Bacteria 6149349
621 2920761619 2920760137 Bacteria 7427611
622 2920825128 2920822456 Bacteria 6897201
623 2921208469 2921201388 Bacteria 6926299
624 2921214511 2921208531 Bacteria 6745326
625 2921244123 2921237296 Bacteria 6876710
626 2921248566 2921244191 Bacteria 6568419
627 2921252000 2921250672 Bacteria 6677771
628 2921261222 2921257292 Bacteria 6808382
629 2921268639 2921263974 Bacteria 6864552
630 2921285860 2921282425 Bacteria 6826397
631 2921289453 2921289301 Bacteria 7316391
632 2923558497 2923556063 Bacteria 6793593
633 2924148438 2924144063 Bacteria 6883928
634 2924158066 2924150972 Bacteria 7169444
635 2924159200 2924158325 Bacteria 7188855
636 2924171430 2924165586 Bacteria 7260590
637 2924177921 2924172951 Bacteria 6749356
638 2924183713 2924179722 Bacteria 6843264
639 2924191965 2924186466 Bacteria 6876637
640 2924197991 2924193448 Bacteria 6955718
641 2924204753 2924200457 Bacteria 6757188
642 2924211499 2924207177 Bacteria 6917007
643 2924218738 2924214083 Bacteria 7080103
644 2924225741 2924221636 Bacteria 7113495
645 2924233062 2924228884 Bacteria 6633132
646 2926762901 2926760298 Bacteria 5505990
647 2928523809 2928521798 Bacteria 4960112
648 2929140793 2929138655 Bacteria 5810547
649 2933014988 2933011516 Bacteria 5439334
650 2933570768 2933570622 Bacteria 7023390
651 2933591277 2933586486 Bacteria 7667493
652 2933601029 2933599457 Bacteria 5858799
653 2935900734 2935894831 Bacteria 6620579
654 2935902035 2935901341 Bacteria 7341747
655 2936372120 2936367885 Bacteria 7324495
656 2936381075 2936375103 Bacteria 6652732
657 2936382970 2936381700 Bacteria 7006523
658 2936999688 2936996657 Bacteria 6298727
659 2937007351 2937002841 Bacteria 6934057
660 2937012919 2937009748 Bacteria 6746052
661 2937021655 2937016420 Bacteria 6782579
662 2937026885 2937023124 Bacteria 6815156
663 2937030199 2937029754 Bacteria 6424026
664 2937042579 2937036028 Bacteria 6846469
665 2937047717 2937042894 Bacteria 6741576
666 2937053678 2937049772 Bacteria 6757901
667 2937063402 2937056579 Bacteria 7107896
668 2937070728 2937063883 Bacteria 7199456
669 2937077149 2937071275 Bacteria 6984483
670 2937085542 2937084907 Bacteria 6618516
671 2937098198 2937091812 Bacteria 6979387
672 2937102525 2937098957 Bacteria 7249374
673 2937111235 2937106411 Bacteria 6947143
674 2937117906 2937113482 Bacteria 6505872
675 2937124044 2937119839 Bacteria 6597547
676 2937130587 2937126314 Bacteria 6771275
677 2941502223 2941499720 Bacteria 7599444
678 2954016094 2954011201 Bacteria 4762601
679 2957376472 2957375807 Bacteria 6425588
680 2957386608 2957382221 Bacteria 6737050
681 2957392910 2957388812 Bacteria 6778072
682 2957395973 2957395598 Bacteria 6822399
683 2957406707 2957402308 Bacteria 6741770
684 2957410768 2957408893 Bacteria 6558585
685 2957417597 2957415311 Bacteria 6991633
686 2957423717 2957422303 Bacteria 7172205
687 2957434303 2957430029 Bacteria 7022557
688 2957437635 2957437181 Bacteria 6568994
689 2957446340 2957443900 Bacteria 6869977
690 2957454726 2957450854 Bacteria 6765715
691 2957461980 2957457609 Bacteria 6967680
692 2957468644 2957464669 Bacteria 6568877
693 2957476466 2957471148 Bacteria 6797643
694 2957482806 2957478035 Bacteria 6756658
695 2957488700 2957484790 Bacteria 6703082
696 2957496969 2957491536 Bacteria 6695180
697 2957503232 2957498199 Bacteria 7126688
698 2957507288 2957505466 Bacteria 7253085
699 2960584526 2960584000 Bacteria 6864594
700 2960591998 2960591022 Bacteria 6622873
701 2960602492 2960597568 Bacteria 6550735
702 2960606449 2960603979 Bacteria 6898737
703 2960612395 2960610863 Bacteria 6691244
704 2960621486 2960617483 Bacteria 6727748
705 2960630831 2960624210 Bacteria 6875384
706 2960631959 2960631154 Bacteria 6732508
707 2960650009 2960645483 Bacteria 7211087
708 2960654750 2960652885 Bacteria 7083688
709 2960665247 2960660292 Bacteria 7041660
710 2960671732 2960667422 Bacteria 6763020
711 2960678347 2960674078 Bacteria 6609048
712 2960681534 2960680706 Bacteria 6624464
713 2960692527 2960687367 Bacteria 6535474
714 2960698117 2960693952 Bacteria 6749742
715 2964614505 2964607997 Bacteria 7101408
716 2964621064 2964615318 Bacteria 6809089
717 2964625726 2964621998 Bacteria 6834995
718 2964632987 2964628898 Bacteria 7083044
719 2964640147 2964636051 Bacteria 7091832
720 2964646837 2964643177 Bacteria 6820887
721 2964655341 2964649959 Bacteria 6675118
722 2964663220 2964656573 Bacteria 7100150
723 2964668297 2964663802 Bacteria 7019362
724 2964671771 2964670856 Bacteria 6851364
725 2964681593 2964678106 Bacteria 6792020
726 2964691343 2964685014 Bacteria 6839111
727 2964698277 2964691889 Bacteria 6802758
728 2964705097 2964698721 Bacteria 6765331
729 2964709829 2964705432 Bacteria 7114648
730 2964716525 2964712639 Bacteria 6695970
731 2964724635 2964719344 Bacteria 7286602
732 2967665487 2967664464 Bacteria 6948836
733 2967675909 2967671571 Bacteria 7021409
734 2967684503 2967678726 Bacteria 7264382
735 2967688881 2967686174 Bacteria 6678622
736 2967697355 2967693043 Bacteria 6804451
737 2967706623 2967699805 Bacteria 6854538
738 2967711545 2967706974 Bacteria 7186053
739 2967714795 2967714385 Bacteria 7000047
740 2967725810 2967721400 Bacteria 7073753
741 2967729084 2967728569 Bacteria 6641507
742 2967738858 2967735183 Bacteria 6827012
743 2967743527 2967742019 Bacteria 6794534
744 2967753566 2967748971 Bacteria 6733771
745 2967758957 2967755722 Bacteria 6814706
746 2967768481 2967762386 Bacteria 6923502
747 2967773849 2967769361 Bacteria 6587838
748 2967778027 2967775926 Bacteria 6738189
749 2970023492 2970019648 Bacteria 7072033
750 2970030354 2970026789 Bacteria 6785236
751 2970040212 2970033650 Bacteria 7118744
752 2970045859 2970040964 Bacteria 6731123
753 2970053967 2970047711 Bacteria 7088379
754 2970059286 2970054988 Bacteria 6611507
755 2970065657 2970061556 Bacteria 7099761
756 2970075490 2970068827 Bacteria 7123112
757 2970080194 2970076120 Bacteria 6697332
758 2970087780 2970082768 Bacteria 6183754
759 2970093221 2970088815 Bacteria 6933825
760 2970100072 2970095765 Bacteria 6936963
761 2970108076 2970102677 Bacteria 6812532
762 2970113886 2970109326 Bacteria 6863976
763 2970120490 2970116247 Bacteria 6501857
764 2970127027 2970122695 Bacteria 6625855
765 2970133203 2970129317 Bacteria 6806560
766 2970140460 2970136068 Bacteria 7207982
767 2970146190 2970143518 Bacteria 6446480
768 2970161091 2970156795 Bacteria 7168044
769 2970168476 2970164137 Bacteria 6861252
770 2970171562 2970170962 Bacteria 6876229
771 2970182894 2970177841 Bacteria 6768001
772 2970188698 2970184632 Bacteria 7054431
773 2970196364 2970191845 Bacteria 7032787
774 2977522530 2977516862 Bacteria 6940108
775 2977526250 2977523885 Bacteria 6960446
776 2977534346 2977530762 Bacteria 6951399
777 2977542019 2977537788 Bacteria 6929320
778 2977547713 2977544691 Bacteria 6875412
779 2977558354 2977551784 Bacteria 7125765
780 2977562681 2977558990 Bacteria 6863948
781 2977570270 2977565890 Bacteria 6901543
782 2977577071 2977572785 Bacteria 6763888
783 2977583578 2977579622 Bacteria 6772100
784 2978974546 2978969890 Bacteria 5400756
785 2979094607 2979089926 Bacteria 5670289
786 2979100828 2979095461 Bacteria 5669583
787 2984511589 2984509177 Bacteria 5274802
788 2984522050 2984518228 Bacteria 5277463
789 2984541348 2984537506 Bacteria 5277481
790 2984589866 2984587000 Bacteria 5263363
791 2984603625 2984601300 Bacteria 5455244
792 2989349566 2989349275 Bacteria 6349068
793 2989779131 2989776772 Bacteria 4843317
794 2996889111 2996887358 Bacteria 5795980
795 2996896433 2996893221 Bacteria 5823108
796 3002144691 3002141150 Bacteria 5254435
797 3003933940 3003930520 Bacteria 5667563
798 3005414701 3005409236 Bacteria 7188837
799 3005419554 3005416602 Bacteria 7064308
800 3005448364 3005445848 Bacteria 6906074
801 3005454561 3005452660 Bacteria 5889319
802 639649116 639633055 Bacteria 7751309
803 643826212 643692032 Bacteria 6891900
804 648740495 648276728 Bacteria 6968865
805 650740486 650716007 Bacteria 5573770
806 8003571553 8003570095 Bacteria 5747666
807 8003994085 8003992118 Bacteria 7266902
808 8004001709 8003999396 Bacteria 7063185
809 8005248695 8005246636 Bacteria 4933972
810 8005260232 8005258706 Bacteria 6184835
811 8005281051 8005275841 Bacteria 6929066
812 8005283339 8005282627 Bacteria 6675747
813 8005303045 8005301065 Bacteria 6614431
814 8005312754 8005307578 Bacteria 7395396
815 8005316845 8005314921 Bacteria 7072929
816 8005323638 8005321885 Bacteria 5795980
817 8005380849 8005376324 Bacteria 6590079
818 8005385283 8005382845 Bacteria 6732062
819 8005396200 8005395548 Bacteria 6806915
820 8005435076 8005430974 Bacteria 6689030
821 8005463600 8005460587 Bacteria 7157962
822 8005485349 8005484373 Bacteria 6297373
823 8005500814 8005497431 Bacteria 6477605
824 8005545544 8005542996 Bacteria 7077758
825 8005557093 8005556819 Bacteria 6908598
826 8005567912 8005563573 Bacteria 7153261
827 8005573542 8005570704 Bacteria 6957481
828 8005622191 8005619151 Bacteria 7030230
829 8005632333 8005626139 Bacteria 6534237
830 8005649661 8005645114 Bacteria 6950293
831 8005659112 8005658619 Bacteria 4500593
832 8005672232 8005668836 Bacteria 6953162
833 8005682974 8005682033 Bacteria 6726518
834 8005692185 8005688590 Bacteria 6610080
835 8005697321 8005695170 Bacteria 6912330
836 8018134016 8018127388 Bacteria 7351159
837 8018163869 8018163183 Bacteria 7277977
838 8018181401 8018176218 Bacteria 6896178
839 8023683247 8023680758 Bacteria 7729763
840 8024482945 8024479707 Bacteria 6954785
841 8024487949 8024486573 Bacteria 6540512
842 8046771623 8046767195 Bacteria 7547379
843 8054560763 8054558443 Bacteria 5204801
844 8056378450 8056375014 Bacteria 7006639
845 8056386647 8056382006 Bacteria 6408074
846 8056877365 8056875544 Bacteria 4355797
847 8057575817 8057575449 Bacteria 7367519
848 8057877318 8057874678 Bacteria 7494653
849 Ga0123341_1000032
850 JGI25158J39367_1000336
851 JGI25152J39213_1000826
852 JGI25152J39213_1006182
853 JGI25152J39213_1006351
854 JGI25152J39213_1017437
855 JGI25150J39212_1000165
856 JGI25150J39212_1000307
857 JGI25150J39212_1006463
858 JGI25159J45721_1000040
859 JGI25159J45721_1000966
860 JGI25151J46595_10000329
861 JGI25151J46595_10005981
862 JGI25151J46595_10024415
863 JGI25151J46595_10034270
864 JGI25153J46596_10003631
865 JGI25153J46596_10009561
866 JGI25153J46596_10012453
867 JGI25153J46596_10014210
868 JGI25153J46596_10026848
869 JGI25153J46596_10043631
870 rootH2_10199801
871 rootL2_10127000
872 JGI25160J50197_1000001
873 JGI25160J50197_1000128
874 JGI25161J50226_1000001
875 JGI25161J50226_1000996
876 Ga0006562J51391_1036025
877 Ga0055526_1001311
878 Ga0055526_1001851
879 Ga0055526_1005523
880 Ga0055526_1007857
881 Ga0055524_1002368
882 Ga0055524_1004414
883 Ga0055524_1015223
884 Ga0055524_1053175
885 Ga0055536_1002507
886 Ga0055536_1009417
887 Ga0055528_1001122
888 Ga0055528_1003598
889 Ga0055528_1004902
890 Ga0055528_1011411
891 Ga0055528_1013658
892 Ga0055528_1014492
893 Ga0055528_1026156
894 Ga0055530_10016163
895 Ga0055530_10018535
896 Ga0055540_1000283
897 Ga0055540_1006077
898 Ga0055540_1008899
899 Ga0055540_1021104
900 Ga0055531_10014920
901 Ga0055531_10019396
902 Ga0055543_1000003
903 Ga0055543_1000130
904 Ga0065165_1000013
905 Ga0065165_1000068
906 Ga0065165_1018622
907 Ga0070668_100484784
908 Ga0070669_100366031
909 Ga0070671_100043123
910 Ga0075365_10002254
911 Ga0075365_10146606
912 Ga0075363_100171077
913 Ga0075362_10199156
914 Ga0075367_10111600
915 Ga0075369_10000132
916 Ga0075369_10055198
917 Ga0075370_10103814
918 Ga0105248_10041256
919 Ga0105248_10055062
920 Ga0123342_1005565
921 Ga0123342_1021015
922 Ga0171463_1003
923 Ga0157375_10860375
924 Ga0183363_1104
925 Ga0214543_1000038
926 Ga0228710_1000009
927 Ga0209436_100478
928 Ga0207425_1000024
929 Ga0207425_1006299
930 Ga0207425_1006673
931 Ga0207425_1022530
932 Ga0207425_1029056
933 Ga0209129_1000146
934 Ga0209129_1000161
935 Ga0209129_1001999
936 Ga0209129_1002877
937 Ga0209129_1005114
938 Ga0209129_1022237
939 Ga0209129_1025995
940 Ga0209673_1000010
941 Ga0209673_1000384
942 Ga0209673_1000977
943 Ga0209673_1004894
944 Ga0209673_1005688
945 Ga0209673_1013499
946 Ga0209673_1091836
947 Ga0209130_1000003
948 Ga0209130_1000034
949 Ga0209130_1027074
950 Ga0209676_1001813
951 Ga0209676_1002914
952 Ga0209676_1034652
953 Ga0209025_1000050
954 Ga0209025_1002141
955 Ga0209025_1005836
956 Ga0209025_1006154
957 Ga0209025_1071243
958 Ga0209025_1113848
959 Ga0209564_1000013
960 Ga0209564_1000388
961 Ga0209564_1000512
962 Ga0209564_1005163
963 Ga0209758_1000083
964 Ga0209758_1000642
965 Ga0209758_1002951
966 Ga0209758_1003069
967 Ga0209758_1003364
968 Ga0209758_1009029
969 Ga0209758_1012299
970 Ga0209758_1046605
971 Ga0209758_1060767
972 Ga0209758_1099502
973 Ga0209050_1002022
974 Ga0209256_1000442
975 Ga0209256_1001584
976 Ga0209256_1002304
977 Ga0209256_1003052
978 Ga0209256_1020294
979 Ga0209256_1021361
980 Ga0207426_1000006
981 Ga0207426_1000011
982 Ga0207426_1002076
983 Ga0209051_1000308
984 Ga0209051_1002410
985 Ga0209051_1003936
986 Ga0209051_1007466
987 Ga0209051_1042307
988 Ga0209257_1000853
989 Ga0209257_1002648
990 Ga0209257_1003491
991 Ga0209257_1021628
992 Ga0207681_10147234
993 Ga0207711_10014356
994 Ga0207711_10015952
995 Ga0209974_10026978
996 Ga0268266_10381118
997 Ga0307515_10017597
998 Ga0307515_10025749
999 Ga0307515_10188841
1000 Ga0307513_10093771
1001 Ga0307408_100346790
1002 Ga0307412_11023142
1003 Ga0307416_101434602
1004 Ga0307414_10082671
1005 Ga0315913_1000006
1006 Ga0395905_0000736
1007 Ga0439436_0001576
1008 Ga0439436_0012157
1009 Ga0439439_0027963
1010 Ga0439465_0001082
1011 Ga0439465_0004189
1012 Ga0439465_0218761
1013 Ga0451787_436462
1014 Ga0451791_0821308
1015 Ga0451833_0225210
1016 Ga0451837_0392092
1017 Ga0451837_0569472
1018 Ga0451839_0313923
1019 Ga0451841_0936760
1020 Ga0451846_55098
1021 Ga0451847_0237521
1022 Ga0451847_0735982
1023 Ga0451849_1213583
1024 Ga0451851_0161803
1025 Ga0451843_0233737
1026 Ga0451843_0998701
1027 Ga0451855_0713139
1028 Ga0451853_0211463
1029 Ga0451853_1152098
1030 Ga0451853_1888721
1031 Ga0439431_0028971
1032 Ga0450906_004190
1033 Ga0450906_061604
1034 Ga0439434_0009578
1035 Ga0466970_0069085
1036 Ga0495617_013469
1037 Ga0495638_0000195
1038 Ga0495650_0047306
1039 Ga0495605_0007566
1040 Ga0495605_0018481
1041 Ga0495585_0006794
1042 Ga0495596_0021263
1043 Ga0495607_0153511
1044 Ga0495583_0101246
1045 Ga0495606_0010451
1046 Ga0495606_0236521
1047 Ga0495610_0001253
1048 Ga0495610_0011895
1049 Ga0495620_0048655
1050 Ga0495631_0001628
1051 Ga0495631_0056441
1052 Ga0495632_0080978
1053 Ga0495643_0007771
1054 Ga0495643_0015966
1055 Ga0495643_0078291
1056 Ga0495643_0099412
1057 Ga0495648_0091124
1058 Ga0495648_0196670
1059 Ga0495663_0008753
1060 Ga0495597_0011360
1061 Ga0495633_0012064
1062 Ga0495656_0219239
1063 Ga0495668_0013421
1064 Ga0495611_0009701
1065 Ga0495611_0058439
1066 Ga0495625_0000621
1067 Ga0495625_0003972
1068 Ga0495625_0151117
1069 Ga0495625_0251681
1070 Ga0495670_0016423
1071 Ga0495670_0095238
1072 Ga0495671_0077923
1073 Ga0495660_0021318
1074 Ga0495660_0046709
1075 Ga0495636_0077919
1076 Ga0495672_0005251
1077 Ga0495687_071448
1078 Ga0495686_0003045
1079 Ga0495686_0033251
1080 Ga0495686_0046675
1081 Ga0495626_0069954
1082 Ga0495626_0242227
1083 Ga0496102_0033698
1084 Ga0496106_0000578
1085 Ga0496110_0011425
1086 Ga0496113_0178332
1087 Ga0496114_0986492
1088 Ga0496116_0007652
1089 Ga0496116_0021014
1090 Ga0496116_0098082
1091 Ga0496116_0301076
1092 Ga0496117_0011077
1093 Ga0496117_0076711
1094 Ga0496117_0130386
1095 Ga0496118_0007840
1096 Ga0496118_0013080
1097 Ga0496118_0027940
1098 Ga0496119_0187637
1099 Ga0496119_0293636
1100 Ga0496121_0009569
1101 Ga0496121_0011992
1102 Ga0496121_0029632
1103 Ga0496121_0042223
1104 Ga0496121_0061579
1105 Ga0496121_0085895
1106 Ga0496121_0086354
1107 Ga0496121_0344383
1108 Ga0496122_0002690
1109 Ga0496122_0013904
1110 Ga0496122_0016080
1111 Ga0496122_0035177
1112 Ga0496122_0045332
1113 Ga0496122_0459654
1114 Ga0496123_0000054
1115 Ga0496123_0009709
1116 Ga0496123_0019000
1117 Ga0496123_0045692
1118 Ga0496123_0062910
1119 Ga0496124_0001702
1120 Ga0496124_0006525
1121 Ga0496124_0034478
1122 Ga0496124_0038771
1123 Ga0496124_0100509
1124 Ga0496124_0131331
1125 Ga0496125_0000273
1126 Ga0496125_0012546
1127 Ga0496125_0064881
1128 Ga0496125_0085645
1129 Ga0496125_0217125
1130 Ga0496125_0396043
1131 Ga0496126_0000589
1132 Ga0496126_0022038
1133 Ga0496126_0044422
1134 Ga0496126_0373740
1135 Ga0496126_0518452
1136 Ga0495678_091705
1137 Ga0495678_103658
1138 Ga0501032_0057958
1139 Ga0501033_0150145
1140 Ga0501034_0780151
1141 Ga0501036_0164362
1142 Ga0501037_0123580
1143 Ga0501039_0109357
1144 Ga0501043_0191596
1145 Ga0501073_0213904
1146 Ga0501276_008926
1147 Ga0501035_0097802
1148 Ga0501044_0056630
1149 Ga0501044_0618799
1150 nmdc:mga00v17_99741_c1
1151 nmdc:mga0yw44_10832_c1
1152 nmdc:mga0yw44_213667_c1
1153 nmdc:mga07m45_129080_c1
1154 nmdc:mga07m45_170867_c1
1155 nmdc:mga0sz30_10737_c2
1156 nmdc:mga0sz30_286662_c1
1157 Ga0500610_0034789
1158 Ga0495655_0021806
1159 Ga0500578_0117842
1160 Ga0500643_023448
1161 Ga0500557_003926
1162 Ga0500562_019999
1163 Ga0500569_009973
1164 Ga0500569_012112
1165 Ga0500594_0002292
1166 Ga0500608_029678
1167 Ga0500658_0002369
1168 Ga0500658_0132682
1169 Ga0500659_0108663
1170 Ga0500559_0005229
1171 Ga0500568_0005767
1172 Ga0500568_0008709
1173 Ga0500568_0060281
1174 Ga0500568_0068957
1175 Ga0500604_0007759
1176 Ga0500616_0000884
1177 Ga0500616_0019444
1178 Ga0500616_0091969
1179 Ga0500616_0189017
1180 Ga0500622_0000697
1181 Ga0500622_0000899
1182 Ga0500622_0191860
1183 Ga0500627_0015706
1184 Ga0500633_0031808
1185 Ga0500599_004643
1186 2509111329
1187 2509376393
1188 2509392132
1189 2509445778
1190 2509446920
1191 2510133878
1192 2510304391
1193 2510840077
1194 2510895299
1195 2511135317
1196 2511173698
1197 2511186984
1198 2511196079
1199 2511389781
1200 2511502165
1201 2512533544
1202 2512970781
1203 2513573647
1204 2513576868
1205 2513582441
1206 2513596402
1207 2513604176
1208 2513617982
1209 2513629475
1210 2513708125
1211 2513865526
1212 2513885506
1213 2513903282
1214 2513909185
1215 2513925452
1216 2513985317
1217 2513996873
1218 2514006475
1219 2514020082
1220 2515112923
1221 2515608945
1222 2515636398
1223 2515640886
1224 2515655430
1225 2515739407
1226 2516204079
1227 2516893545
1228 2517036625
1229 2517076987
1230 2517095757
1231 2517407322
1232 2517570248
1233 2520381427
1234 2524448631
1235 2524459517
1236 2530646030
1237 2535516796
1238 2551674484
1239 2551685847
1240 2551695969
1241 2551697269
1242 2551715303
1243 2551725120
1244 2551733150
1245 2551743322
1246 2558867781
1247 2559295277
1248 2585166277
1249 2585200535
1250 2585222749
1251 2585232766
1252 2585255010
1253 2585267512
1254 2585271054
1255 2585331551
1256 2585386574
1257 2585393187
1258 2585402471
1259 2585527367
1260 2585535036
1261 2585538109
1262 2585545332
1263 2585555884
1264 2585558778
1265 2585822841
1266 2585836057
1267 2585843097
1268 2585898173
1269 2585904252
1270 2585996124
1271 2586000741
1272 2587980631
1273 2599417369
1274 2599601591
1275 2600194301
1276 2616293434
1277 2616308884
1278 2616556907
1279 2617385956
1280 2643803189
1281 2644050590
1282 2644063553
1283 2644107372
1284 2644150939
1285 2644193431
1286 2644205064
1287 2644210093
1288 2644238876
1289 2644298598
1290 2644308767
1291 2644335584
1292 2644374834
1293 2644414316
1294 2644447844
1295 2644483508
1296 2644491968
1297 2644499715
1298 2644522029
1299 2644539990
1300 2644614708
1301 2644653645
1302 2644656827
1303 2644676173
1304 2644690317
1305 2657681493
1306 2671111509
1307 2719181736
1308 2719386260
1309 2719732400
1310 2720492501
1311 2720613937
1312 2720620741
1313 2720632064
1314 2720775792
1315 2721147827
1316 2721159277
1317 2721164663
1318 2721400042
1319 2722840833
1320 2723027399
1321 2723561018
1322 2723567611
1323 2724038855
1324 2724045156
1325 2724090399
1326 2724104876
1327 2724110681
1328 2725952637
1329 2730108335
1330 2730164971
1331 2730298909
1332 2738800008
1333 2739032767
1334 2753461957
1335 2765464697
1336 2766065791
1337 2770195370
1338 2776270688
1339 2776280489
1340 2778175343
1341 2792620847
1342 2792626207
1343 2792639145
1344 2793294512
1345 2793314613
1346 2793320440
1347 2793331712
1348 2793336836
1349 2793339127
1350 2793348810
1351 2793351907
1352 2793363622
1353 2793370252
1354 2802719943
1355 2802731874
1356 2802739205
1357 2802745815
1358 2802752417
1359 2804752685
1360 2806043746
1361 2806050322
1362 2806057139
1363 2806064521
1364 2806071788
1365 2808987989
1366 2819241478
1367 2819558994
1368 2819609067
1369 2819637700
1370 2838028398
1371 2838029888
1372 2838038430
1373 2838043891
1374 2838051977
1375 2838067405
1376 2838070223
1377 2838661661
1378 2838670285
1379 2838681688
1380 2838687131
1381 2838696260
1382 2838702656
1383 2838710501
1384 2838729896
1385 2838743089
1386 2839996961
1387 2840767485
1388 2841852575
1389 2841862054
1390 2841869874
1391 2842078675
1392 2842114905
1393 2842118816
1394 2842148086
1395 2842157965
1396 2842167485
1397 2842181584
1398 2842204471
1399 2842205555
1400 2842217856
1401 2842230365
1402 2842239913
1403 2842244267
1404 2842253152
1405 2842257647
1406 2842266187
1407 2842271331
1408 2842279012
1409 2842292337
1410 2842301297
1411 2842304960
1412 2842314991
1413 2842346380
1414 2842357834
1415 2842369041
1416 2842372255
1417 2842378734
1418 2842385326
1419 2842399958
1420 2842423837
1421 2842430650
1422 2842437363
1423 2842443733
1424 2842453141
1425 2842464793
1426 2842471981
1427 2842476827
1428 2842484638
1429 2842491902
1430 2842503416
1431 2842511207
1432 2842518838
1433 2842522888
1434 2842871878
1435 2844166654
1436 2844458498
1437 2850081362
1438 2852390135
1439 2854899207
1440 2854918762
1441 2855826265
1442 2855841610
1443 2857517514
1444 2858801726
1445 2894656061
1446 2899796122
1447 2899807347
1448 2899850706
1449 2904580690
1450 2915981353
1451 2915990418
1452 2915998080
1453 2916006855
1454 2916013853
1455 2916017585
1456 2916025044
1457 2916033207
1458 2916040209
1459 2916044048
1460 2916054229
1461 2916059656
1462 2916064253
1463 2916070328
1464 2916079887
1465 2919106635
1466 2919121596
1467 2919174776
1468 2919409899
1469 2920761619
1470 2920825128
1471 2921208469
1472 2921214511
1473 2921244123
1474 2921248566
1475 2921252000
1476 2921261222
1477 2921268639
1478 2921285860
1479 2921289453
1480 2923558497
1481 2924148438
1482 2924158066
1483 2924159200
1484 2924171430
1485 2924177921
1486 2924183713
1487 2924191965
1488 2924197991
1489 2924204753
1490 2924211499
1491 2924218738
1492 2924225741
1493 2924233062
1494 2926762901
1495 2928523809
1496 2929140793
1497 2933014988
1498 2933570768
1499 2933591277
1500 2933601029
1501 2935900734
1502 2935902035
1503 2936372120
1504 2936381075
1505 2936382970
1506 2936999688
1507 2937007351
1508 2937012919
1509 2937021655
1510 2937026885
1511 2937030199
1512 2937042579
1513 2937047717
1514 2937053678
1515 2937063402
1516 2937070728
1517 2937077149
1518 2937085542
1519 2937098198
1520 2937102525
1521 2937111235
1522 2937117906
1523 2937124044
1524 2937130587
1525 2941502223
1526 2954016094
1527 2957376472
1528 2957386608
1529 2957392910
1530 2957395973
1531 2957406707
1532 2957410768
1533 2957417597
1534 2957423717
1535 2957434303
1536 2957437635
1537 2957446340
1538 2957454726
1539 2957461980
1540 2957468644
1541 2957476466
1542 2957482806
1543 2957488700
1544 2957496969
1545 2957503232
1546 2957507288
1547 2960584526
1548 2960591998
1549 2960602492
1550 2960606449
1551 2960612395
1552 2960621486
1553 2960630831
1554 2960631959
1555 2960650009
1556 2960654750
1557 2960665247
1558 2960671732
1559 2960678347
1560 2960681534
1561 2960692527
1562 2960698117
1563 2964614505
1564 2964621064
1565 2964625726
1566 2964632987
1567 2964640147
1568 2964646837
1569 2964655341
1570 2964663220
1571 2964668297
1572 2964671771
1573 2964681593
1574 2964691343
1575 2964698277
1576 2964705097
1577 2964709829
1578 2964716525
1579 2964724635
1580 2967665487
1581 2967675909
1582 2967684503
1583 2967688881
1584 2967697355
1585 2967706623
1586 2967711545
1587 2967714795
1588 2967725810
1589 2967729084
1590 2967738858
1591 2967743527
1592 2967753566
1593 2967758957
1594 2967768481
1595 2967773849
1596 2967778027
1597 2970023492
1598 2970030354
1599 2970040212
1600 2970045859
1601 2970053967
1602 2970059286
1603 2970065657
1604 2970075490
1605 2970080194
1606 2970087780
1607 2970093221
1608 2970100072
1609 2970108076
1610 2970113886
1611 2970120490
1612 2970127027
1613 2970133203
1614 2970140460
1615 2970146190
1616 2970161091
1617 2970168476
1618 2970171562
1619 2970182894
1620 2970188698
1621 2970196364
1622 2977522530
1623 2977526250
1624 2977534346
1625 2977542019
1626 2977547713
1627 2977558354
1628 2977562681
1629 2977570270
1630 2977577071
1631 2977583578
1632 2978974546
1633 2979094607
1634 2979100828
1635 2984511589
1636 2984522050
1637 2984541348
1638 2984589866
1639 2984603625
1640 2989349566
1641 2989779131
1642 2996889111
1643 2996896433
1644 3002144691
1645 3003933940
1646 3005414701
1647 3005419554
1648 3005448364
1649 3005454561
1650 639649116
1651 643826212
1652 648740495
1653 650740486
1654 8003571553
1655 8003994085
1656 8004001709
1657 8005248695
1658 8005260232
1659 8005281051
1660 8005283339
1661 8005303045
1662 8005312754
1663 8005316845
1664 8005323638
1665 8005380849
1666 8005385283
1667 8005396200
1668 8005435076
1669 8005463600
1670 8005485349
1671 8005500814
1672 8005545544
1673 8005557093
1674 8005567912
1675 8005573542
1676 8005622191
1677 8005632333
1678 8005649661
1679 8005659112
1680 8005672232
1681 8005682974
1682 8005692185
1683 8005697321
1684 8018134016
1685 8018163869
1686 8018181401
1687 8023683247
1688 8024482945
1689 8024487949
1690 8046771623
1691 8054560763
1692 8056378450
1693 8056386647
1694 8056877365
1695 8057575817
1696 8057877318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

8

180

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t3o-assembly1.cif.gz_A rat vesicular glutamate transporter 2 (vglut2) in low cl condition 0.4651 1 184
7t3o-assembly1.cif.gz_A rat vesicular glutamate transporter 2 (vglut2) in low cl condition 0.456 1 184
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.4362 9 188
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.4116 9 188
7t3n-assembly1.cif.gz_A r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) 0.4066 6 184
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5109 4 184 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4965 4 184 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.462 14 184 1.20.1250.20
af_A0A1D8PSL9_199_630_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.457 3 182 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4494 14 184 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A658A6K1-F1-model_v4 deleted 0.8461 38 188
AF-A0A653L4V5-F1-model_v4 deleted 0.8351 1 187
AF-A0A653L4V5-F1-model_v4 deleted 0.8273 1 187
AF-A0A1H5JP08-F1-model_v4 deleted 0.8162 1 187
AF-Q2T994-F1-model_v4 LysE family protein 0.8148 3 187 GO:0005886
GO:0015171
GO:0033228

Map