F483371
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 848 | 432 | 1696 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0096810|Ga0373937_0096810_1747_2556 |
| Length | 269 |
| Sequence | MSAPGGTWRRTARHPLAFPCDRFDWLSAAFVALRDATAGERGQNVRMITVHHLNDSRSQRVLWLLEELGLPYEIKHYQRDKATMLAPPELRAVHPLGKSPVITDGQTTVAESGAIIEYLIDREGGKLRPEAGTPEFLRYRYWLHFAEGSAMSPLLMKLVFDKVASAPMPFFVKPVARGISAQVLKSFVTPNLERQLDFMEAEMATRPWFAGSEFSAADIQMSFALEASAQRAGLNASRPKLMDWLQRIHARPAYRTALERGGPYSFAGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 117 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 202 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 203 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 232 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 244 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 245 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 246 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 247 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 248 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 249 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 250 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 251 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 252 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 255 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 261 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 262 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 359 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 361 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 362 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 382 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 383 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 384 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 386 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 390 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 391 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 395 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 396 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 397 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 398 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 399 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 400 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 401 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 402 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 403 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 404 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 405 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 406 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 407 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 408 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 409 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 410 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 411 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 412 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 413 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 414 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 415 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 416 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 417 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 418 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 419 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 420 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 421 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 422 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 423 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 424 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 425 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 426 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 427 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 428 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 429 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 430 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 431 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 432 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.05 |
| Metatranscriptomes | 0.24 |
| Isolates | 4.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.09 |
| Nodule | 0.94 |
| Rhizoplane | 1.3 |
| Rhizosphere | 73.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0096810 | 3300036401 | Bacteria | 2737 |
| 2 | JGI24735J21928_10004421 | 3300002067 | Bacteria | 4727 |
| 3 | JGI25162J39368_1001721 | 3300002737 | Bacteria | 10564 |
| 4 | JGI25162J39368_1001834 | 3300002737 | Bacteria | 9911 |
| 5 | JGI25154J39366_1000670 | 3300002738 | Bacteria | 15956 |
| 6 | JGI25157J39369_1007623 | 3300002741 | Bacteria | 1553 |
| 7 | JGI25164J39214_1000843 | 3300002772 | Bacteria | 10568 |
| 8 | JGI25164J39214_1000904 | 3300002772 | Bacteria | 9909 |
| 9 | JGI25152J39213_1000333 | 3300002773 | Bacteria | 29892 |
| 10 | JGI25150J39212_1006368 | 3300002774 | Bacteria | 2441 |
| 11 | JGI25159J45721_1003741 | 3300002987 | Bacteria | 5264 |
| 12 | JGI25165J46597_1001628 | 3300003214 | Bacteria | 10568 |
| 13 | JGI25165J46597_1002627 | 3300003214 | Bacteria | 5425 |
| 14 | JGI25153J46596_10030568 | 3300003215 | Bacteria | 1830 |
| 15 | rootH1_10036074 | 3300003316 | Bacteria | 1415 |
| 16 | rootH2_10035007 | 3300003320 | Bacteria | 3030 |
| 17 | rootL2_10002558 | 3300003322 | Bacteria | 49030 |
| 18 | rootL2_10003205 | 3300003322 | Bacteria | 26879 |
| 19 | rootL2_10028022 | 3300003322 | Bacteria | 2566 |
| 20 | rootL2_10033379 | 3300003322 | Bacteria | 2245 |
| 21 | rootH1_10004792 | 3300003323 | Bacteria | 22124 |
| 22 | rootH1_10012636 | 3300003323 | Bacteria | 23130 |
| 23 | rootH1_10078746 | 3300003323 | Bacteria | 3340 |
| 24 | Ga0055525_1000081 | 3300003759 | Bacteria | 161329 |
| 25 | Ga0055529_1000565 | 3300003763 | Bacteria | 30558 |
| 26 | Ga0055526_1000230 | 3300003771 | Bacteria | 46917 |
| 27 | Ga0055526_1000258 | 3300003771 | Bacteria | 44725 |
| 28 | Ga0055526_1000442 | 3300003771 | Bacteria | 32968 |
| 29 | Ga0055526_1002405 | 3300003771 | Bacteria | 12674 |
| 30 | Ga0055526_1006039 | 3300003771 | Bacteria | 6714 |
| 31 | Ga0055526_1010482 | 3300003771 | Bacteria | 4304 |
| 32 | Ga0055537_1000128 | 3300003773 | Bacteria | 58218 |
| 33 | Ga0055537_1002789 | 3300003773 | Bacteria | 5623 |
| 34 | Ga0055524_1000026 | 3300003775 | Bacteria | 214653 |
| 35 | Ga0055524_1000528 | 3300003775 | Bacteria | 29199 |
| 36 | Ga0055524_1002759 | 3300003775 | Bacteria | 8831 |
| 37 | Ga0055524_1020729 | 3300003775 | Bacteria | 2204 |
| 38 | Ga0055534_1000120 | 3300003784 | Bacteria | 57897 |
| 39 | Ga0055528_1000069 | 3300003790 | Bacteria | 83002 |
| 40 | Ga0055530_10034349 | 3300003791 | Bacteria | 1296 |
| 41 | Ga0055531_10000154 | 3300003794 | Bacteria | 79686 |
| 42 | Ga0055531_10003023 | 3300003794 | Bacteria | 10915 |
| 43 | Ga0055531_10022807 | 3300003794 | Bacteria | 2371 |
| 44 | Ga0055543_1001084 | 3300004625 | Bacteria | 11891 |
| 45 | Ga0055543_1003994 | 3300004625 | Bacteria | 4146 |
| 46 | Ga0065165_1000067 | 3300005262 | Bacteria | 170811 |
| 47 | Ga0065165_1000276 | 3300005262 | Bacteria | 87670 |
| 48 | Ga0065165_1068932 | 3300005262 | Bacteria | 945 |
| 49 | Ga0070658_10634896 | 3300005327 | Bacteria | 926 |
| 50 | Ga0070676_10005140 | 3300005328 | Bacteria | 6944 |
| 51 | Ga0070670_100001478 | 3300005331 | Bacteria | 18935 |
| 52 | Ga0070670_100016429 | 3300005331 | Bacteria | 6355 |
| 53 | Ga0070677_10007765 | 3300005333 | Bacteria | 3592 |
| 54 | Ga0068869_100051042 | 3300005334 | Bacteria | 3000 |
| 55 | Ga0068869_100479008 | 3300005334 | Bacteria | 1036 |
| 56 | Ga0070666_10209107 | 3300005335 | Bacteria | 1374 |
| 57 | Ga0070682_100001469 | 3300005337 | Bacteria | 13211 |
| 58 | Ga0070682_100003106 | 3300005337 | Bacteria | 9203 |
| 59 | Ga0070682_100027600 | 3300005337 | Bacteria | 3408 |
| 60 | Ga0068868_100114348 | 3300005338 | Bacteria | 2196 |
| 61 | Ga0068868_100124649 | 3300005338 | Bacteria | 2103 |
| 62 | Ga0070660_100100606 | 3300005339 | Bacteria | 2290 |
| 63 | Ga0070660_100122047 | 3300005339 | Bacteria | 2080 |
| 64 | Ga0070661_100016629 | 3300005344 | Bacteria | 5203 |
| 65 | Ga0070692_10035255 | 3300005345 | Bacteria | 2532 |
| 66 | Ga0070692_10068906 | 3300005345 | Bacteria | 1881 |
| 67 | Ga0070669_100025994 | 3300005353 | Bacteria | 4210 |
| 68 | Ga0070675_100000072 | 3300005354 | Bacteria | 58324 |
| 69 | Ga0070671_100093203 | 3300005355 | Bacteria | 2524 |
| 70 | Ga0070671_100184736 | 3300005355 | Bacteria | 1766 |
| 71 | Ga0070671_100340791 | 3300005355 | Bacteria | 1279 |
| 72 | Ga0070674_100049783 | 3300005356 | Bacteria | 2882 |
| 73 | Ga0070674_100182901 | 3300005356 | Bacteria | 1607 |
| 74 | Ga0070673_100019834 | 3300005364 | Bacteria | 4835 |
| 75 | Ga0070673_100180283 | 3300005364 | Bacteria | 1808 |
| 76 | Ga0070673_100293374 | 3300005364 | Bacteria | 1430 |
| 77 | Ga0070688_100151446 | 3300005365 | Bacteria | 1586 |
| 78 | Ga0070659_100002090 | 3300005366 | Bacteria | 14229 |
| 79 | Ga0070659_100008903 | 3300005366 | Bacteria | 7358 |
| 80 | Ga0070667_100035426 | 3300005367 | Bacteria | 4181 |
| 81 | Ga0070667_100082453 | 3300005367 | Bacteria | 2753 |
| 82 | Ga0070714_100007085 | 3300005435 | Bacteria | 8695 |
| 83 | Ga0070714_100047437 | 3300005435 | Bacteria | 3649 |
| 84 | Ga0070710_10058042 | 3300005437 | Bacteria | 2195 |
| 85 | Ga0070711_101038961 | 3300005439 | Bacteria | 704 |
| 86 | Ga0070700_100236610 | 3300005441 | Bacteria | 1303 |
| 87 | Ga0070694_100183425 | 3300005444 | Bacteria | 1549 |
| 88 | Ga0070694_100251056 | 3300005444 | Bacteria | 1338 |
| 89 | Ga0070663_100048646 | 3300005455 | Bacteria | 3007 |
| 90 | Ga0070678_100098412 | 3300005456 | Bacteria | 2261 |
| 91 | Ga0070678_100265257 | 3300005456 | Bacteria | 1446 |
| 92 | Ga0070662_100067706 | 3300005457 | Bacteria | 2623 |
| 93 | Ga0070681_10002635 | 3300005458 | Bacteria | 16468 |
| 94 | Ga0068867_100323978 | 3300005459 | Bacteria | 1277 |
| 95 | Ga0068867_100341982 | 3300005459 | Bacteria | 1246 |
| 96 | Ga0070684_100163045 | 3300005535 | Bacteria | 2023 |
| 97 | Ga0068853_100001001 | 3300005539 | Bacteria | 19927 |
| 98 | Ga0068853_100046622 | 3300005539 | Bacteria | 3717 |
| 99 | Ga0070672_100009439 | 3300005543 | Bacteria | 6724 |
| 100 | Ga0070672_100010736 | 3300005543 | Bacteria | 6363 |
| 101 | Ga0070672_100040865 | 3300005543 | Bacteria | 3561 |
| 102 | Ga0070696_100116171 | 3300005546 | Bacteria | 1932 |
| 103 | Ga0070693_100050195 | 3300005547 | Bacteria | 2383 |
| 104 | Ga0070665_100013753 | 3300005548 | Bacteria | 8144 |
| 105 | Ga0070665_100071893 | 3300005548 | Bacteria | 3466 |
| 106 | Ga0070704_100002816 | 3300005549 | Bacteria | 9852 |
| 107 | Ga0070704_100963861 | 3300005549 | Bacteria | 770 |
| 108 | Ga0068855_100017967 | 3300005563 | Bacteria | 8498 |
| 109 | Ga0068855_100046260 | 3300005563 | Bacteria | 5145 |
| 110 | Ga0068855_100148866 | 3300005563 | Bacteria | 2662 |
| 111 | Ga0068855_100249067 | 3300005563 | Bacteria | 1982 |
| 112 | Ga0068855_100626652 | 3300005563 | Bacteria | 1157 |
| 113 | Ga0070664_100209471 | 3300005564 | Bacteria | 1742 |
| 114 | Ga0070664_100318999 | 3300005564 | Bacteria | 1407 |
| 115 | Ga0068857_100093646 | 3300005577 | Bacteria | 2690 |
| 116 | Ga0068854_100141076 | 3300005578 | Bacteria | 1849 |
| 117 | Ga0068856_100000088 | 3300005614 | Bacteria | 85931 |
| 118 | Ga0068856_100005127 | 3300005614 | Bacteria | 12935 |
| 119 | Ga0068856_100056334 | 3300005614 | Bacteria | 3879 |
| 120 | Ga0068856_100142457 | 3300005614 | Bacteria | 2404 |
| 121 | Ga0068852_100076538 | 3300005616 | Bacteria | 2955 |
| 122 | Ga0068859_100005367 | 3300005617 | Bacteria | 13042 |
| 123 | Ga0068859_100017147 | 3300005617 | Bacteria | 7273 |
| 124 | Ga0068859_100037413 | 3300005617 | Bacteria | 4870 |
| 125 | Ga0068859_100436241 | 3300005617 | Bacteria | 1406 |
| 126 | Ga0068864_100015249 | 3300005618 | Bacteria | 6391 |
| 127 | Ga0068864_100147585 | 3300005618 | Bacteria | 2127 |
| 128 | Ga0068864_100172136 | 3300005618 | Bacteria | 1975 |
| 129 | Ga0068866_10238336 | 3300005718 | Bacteria | 1106 |
| 130 | Ga0068866_10275532 | 3300005718 | Bacteria | 1040 |
| 131 | Ga0068870_10143865 | 3300005840 | Bacteria | 1398 |
| 132 | Ga0068863_100057083 | 3300005841 | Bacteria | 3695 |
| 133 | Ga0068863_100545074 | 3300005841 | Bacteria | 1145 |
| 134 | Ga0068858_100007339 | 3300005842 | Bacteria | 10667 |
| 135 | Ga0068860_100018631 | 3300005843 | Bacteria | 6750 |
| 136 | Ga0068860_100095772 | 3300005843 | Bacteria | 2829 |
| 137 | Ga0075366_10004937 | 3300006195 | Bacteria | 7194 |
| 138 | Ga0075366_10028699 | 3300006195 | Bacteria | 3267 |
| 139 | Ga0075366_10053845 | 3300006195 | Bacteria | 2391 |
| 140 | Ga0097621_100137407 | 3300006237 | Bacteria | 2086 |
| 141 | Ga0075370_10017358 | 3300006353 | Bacteria | 3888 |
| 142 | Ga0075370_10017940 | 3300006353 | Bacteria | 3831 |
| 143 | Ga0075370_10069391 | 3300006353 | Bacteria | 2014 |
| 144 | Ga0068871_100008131 | 3300006358 | Bacteria | 7530 |
| 145 | Ga0068871_100263298 | 3300006358 | Bacteria | 1504 |
| 146 | Ga0075431_100000781 | 3300006847 | Bacteria | 27706 |
| 147 | Ga0075433_10301891 | 3300006852 | Bacteria | 1418 |
| 148 | Ga0075434_100000002 | 3300006871 | Bacteria | 135661 |
| 149 | Ga0075429_100000009 | 3300006880 | Bacteria | 85110 |
| 150 | Ga0068865_100566626 | 3300006881 | Bacteria | 956 |
| 151 | Ga0075436_100067212 | 3300006914 | Bacteria | 2478 |
| 152 | Ga0097620_100005367 | 3300006931 | Bacteria | 13042 |
| 153 | Ga0097620_100017146 | 3300006931 | Bacteria | 7273 |
| 154 | Ga0097620_100037413 | 3300006931 | Bacteria | 4870 |
| 155 | Ga0097620_100436250 | 3300006931 | Bacteria | 1406 |
| 156 | Ga0099823_1000213 | 3300006944 | Bacteria | 32548 |
| 157 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 158 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 159 | Ga0075435_100002074 | 3300007076 | Bacteria | 13145 |
| 160 | Ga0075435_100052352 | 3300007076 | Bacteria | 3291 |
| 161 | Ga0105244_10002049 | 3300009036 | Bacteria | 15522 |
| 162 | Ga0105244_10080443 | 3300009036 | Bacteria | 1614 |
| 163 | Ga0105244_10113502 | 3300009036 | Bacteria | 1316 |
| 164 | Ga0105240_10011045 | 3300009093 | Bacteria | 12628 |
| 165 | Ga0114129_10039159 | 3300009147 | Bacteria | 6684 |
| 166 | Ga0105243_10481077 | 3300009148 | Bacteria | 1172 |
| 167 | Ga0105243_11075959 | 3300009148 | Bacteria | 811 |
| 168 | Ga0105248_10036982 | 3300009177 | Bacteria | 5459 |
| 169 | Ga0105248_10086635 | 3300009177 | Bacteria | 3524 |
| 170 | Ga0105248_10370608 | 3300009177 | Bacteria | 1612 |
| 171 | Ga0105237_10000147 | 3300009545 | Bacteria | 99597 |
| 172 | Ga0105238_10003207 | 3300009551 | Bacteria | 16332 |
| 173 | Ga0105238_10066617 | 3300009551 | Bacteria | 3602 |
| 174 | Ga0105238_10395691 | 3300009551 | Bacteria | 1374 |
| 175 | Ga0105238_10722614 | 3300009551 | Bacteria | 1009 |
| 176 | Ga0105249_10013764 | 3300009553 | Bacteria | 7145 |
| 177 | Ga0157319_1000023 | 3300012497 | Bacteria | 74829 |
| 178 | Ga0157373_10001548 | 3300013100 | Bacteria | 17559 |
| 179 | Ga0157373_10407845 | 3300013100 | Bacteria | 974 |
| 180 | Ga0157371_10010197 | 3300013102 | Bacteria | 7339 |
| 181 | Ga0157371_10086459 | 3300013102 | Bacteria | 2221 |
| 182 | Ga0157371_10370660 | 3300013102 | Bacteria | 1044 |
| 183 | Ga0157370_10000264 | 3300013104 | Bacteria | 66688 |
| 184 | Ga0157370_10005082 | 3300013104 | Bacteria | 14840 |
| 185 | Ga0157370_10026839 | 3300013104 | Bacteria | 5681 |
| 186 | Ga0157370_10047067 | 3300013104 | Bacteria | 4135 |
| 187 | Ga0157370_10112844 | 3300013104 | Bacteria | 2540 |
| 188 | Ga0157370_10249704 | 3300013104 | Bacteria | 1641 |
| 189 | Ga0157369_10143402 | 3300013105 | Bacteria | 2526 |
| 190 | Ga0157369_10230275 | 3300013105 | Bacteria | 1937 |
| 191 | Ga0157369_10561575 | 3300013105 | Bacteria | 1179 |
| 192 | Ga0157369_11275860 | 3300013105 | Bacteria | 749 |
| 193 | Ga0157374_10555533 | 3300013296 | Bacteria | 1156 |
| 194 | Ga0157378_10000033 | 3300013297 | Bacteria | 120764 |
| 195 | Ga0157378_10248252 | 3300013297 | Bacteria | 1703 |
| 196 | Ga0157372_10030731 | 3300013307 | Bacteria | 5877 |
| 197 | Ga0157372_10155933 | 3300013307 | Bacteria | 2637 |
| 198 | Ga0157372_10180132 | 3300013307 | Bacteria | 2446 |
| 199 | Ga0157372_10193061 | 3300013307 | Bacteria | 2358 |
| 200 | Ga0157372_11073813 | 3300013307 | Bacteria | 932 |
| 201 | Ga0157375_10018510 | 3300013308 | Bacteria | 6319 |
| 202 | Ga0157375_10018656 | 3300013308 | Bacteria | 6296 |
| 203 | Ga0157375_10024111 | 3300013308 | Bacteria | 5626 |
| 204 | Ga0157375_10277881 | 3300013308 | Bacteria | 1838 |
| 205 | Ga0157375_10523789 | 3300013308 | Bacteria | 1348 |
| 206 | Ga0163163_10421254 | 3300014325 | Bacteria | 1394 |
| 207 | Ga0157380_10042412 | 3300014326 | Bacteria | 3557 |
| 208 | Ga0157380_10126963 | 3300014326 | Bacteria | 2169 |
| 209 | Ga0182008_10058280 | 3300014497 | Bacteria | 1907 |
| 210 | Ga0182008_10068675 | 3300014497 | Bacteria | 1744 |
| 211 | Ga0182008_10110002 | 3300014497 | Bacteria | 1365 |
| 212 | Ga0157379_10024447 | 3300014968 | Bacteria | 5363 |
| 213 | Ga0157379_10238113 | 3300014968 | Bacteria | 1650 |
| 214 | Ga0157379_10384982 | 3300014968 | Bacteria | 1287 |
| 215 | Ga0157376_10004616 | 3300014969 | Bacteria | 9595 |
| 216 | Ga0157376_10041150 | 3300014969 | Bacteria | 3782 |
| 217 | Ga0157376_10124832 | 3300014969 | Bacteria | 2287 |
| 218 | Ga0182006_1000070 | 3300015261 | Bacteria | 137793 |
| 219 | Ga0182006_1006020 | 3300015261 | Bacteria | 5681 |
| 220 | Ga0182006_1028006 | 3300015261 | Bacteria | 2295 |
| 221 | Ga0182007_10061903 | 3300015262 | Bacteria | 1227 |
| 222 | Ga0182007_10093832 | 3300015262 | Bacteria | 990 |
| 223 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 224 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 225 | Ga0183361_13646 | 3300016635 | Bacteria | 841 |
| 226 | Ga0163161_10018024 | 3300017792 | Bacteria | 4949 |
| 227 | Ga0206356_11593915 | 3300020070 | Bacteria | 2864 |
| 228 | Ga0206353_10169809 | 3300020082 | Bacteria | 2833 |
| 229 | Ga0213872_10000252 | 3300021361 | Bacteria | 46619 |
| 230 | Ga0213872_10004097 | 3300021361 | Bacteria | 7842 |
| 231 | Ga0213872_10007564 | 3300021361 | Bacteria | 5336 |
| 232 | Ga0213872_10019215 | 3300021361 | Bacteria | 3147 |
| 233 | Ga0213872_10030430 | 3300021361 | Bacteria | 2474 |
| 234 | Ga0213874_10036041 | 3300021377 | Bacteria | 1456 |
| 235 | Ga0209436_108716 | 3300025208 | Bacteria | 1993 |
| 236 | Ga0209674_102244 | 3300025226 | Bacteria | 4277 |
| 237 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 238 | Ga0207427_100068 | 3300025231 | Bacteria | 164460 |
| 239 | Ga0207427_100143 | 3300025231 | Bacteria | 82800 |
| 240 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 241 | Ga0209437_100255 | 3300025233 | Bacteria | 82963 |
| 242 | Ga0207425_1000377 | 3300025245 | Bacteria | 30541 |
| 243 | Ga0207425_1000417 | 3300025245 | Bacteria | 28632 |
| 244 | Ga0209646_1000114 | 3300025246 | Bacteria | 152958 |
| 245 | Ga0209646_1004778 | 3300025246 | Bacteria | 2435 |
| 246 | Ga0209026_1013458 | 3300025250 | Bacteria | 1393 |
| 247 | Ga0209677_101945 | 3300025253 | Bacteria | 8248 |
| 248 | Ga0209148_1000413 | 3300025254 | Bacteria | 48939 |
| 249 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 250 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 251 | Ga0209233_1000172 | 3300025261 | Bacteria | 146504 |
| 252 | Ga0209233_1008135 | 3300025261 | Bacteria | 3274 |
| 253 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 254 | Ga0209565_1004370 | 3300025263 | Bacteria | 4311 |
| 255 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 256 | Ga0209455_1000267 | 3300025272 | Bacteria | 58711 |
| 257 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 258 | Ga0209673_1003916 | 3300025273 | Bacteria | 8353 |
| 259 | Ga0209673_1005396 | 3300025273 | Bacteria | 6443 |
| 260 | Ga0209673_1008906 | 3300025273 | Bacteria | 4414 |
| 261 | Ga0209673_1034950 | 3300025273 | Bacteria | 1511 |
| 262 | Ga0209130_1000223 | 3300025284 | Bacteria | 74374 |
| 263 | Ga0209675_1000224 | 3300025291 | Bacteria | 57961 |
| 264 | Ga0209675_1010149 | 3300025291 | Bacteria | 3245 |
| 265 | Ga0209025_1002210 | 3300025294 | Bacteria | 21466 |
| 266 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 267 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 268 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 269 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 270 | Ga0209564_1000102 | 3300025295 | Bacteria | 222597 |
| 271 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 272 | Ga0209758_1000372 | 3300025297 | Bacteria | 78825 |
| 273 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 274 | Ga0209050_1005818 | 3300025298 | Bacteria | 7564 |
| 275 | Ga0209050_1014918 | 3300025298 | Bacteria | 3305 |
| 276 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 277 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 278 | Ga0209256_1000495 | 3300025299 | Bacteria | 57952 |
| 279 | Ga0209256_1000692 | 3300025299 | Bacteria | 44918 |
| 280 | Ga0209051_1001168 | 3300025303 | Bacteria | 23858 |
| 281 | Ga0209051_1030031 | 3300025303 | Bacteria | 2116 |
| 282 | Ga0209257_1000117 | 3300025304 | Bacteria | 227328 |
| 283 | Ga0209257_1001528 | 3300025304 | Bacteria | 26973 |
| 284 | Ga0209257_1001538 | 3300025304 | Bacteria | 26872 |
| 285 | Ga0209257_1020069 | 3300025304 | Bacteria | 2487 |
| 286 | Ga0207697_10043402 | 3300025315 | Bacteria | 1849 |
| 287 | Ga0207656_10038281 | 3300025321 | Bacteria | 2023 |
| 288 | Ga0207656_10113164 | 3300025321 | Bacteria | 1256 |
| 289 | Ga0207655_1003166 | 3300025728 | Bacteria | 12424 |
| 290 | Ga0207713_1000124 | 3300025735 | Bacteria | 122014 |
| 291 | Ga0207682_10009795 | 3300025893 | Bacteria | 3773 |
| 292 | Ga0207688_10240524 | 3300025901 | Bacteria | 1095 |
| 293 | Ga0207688_10325516 | 3300025901 | Bacteria | 944 |
| 294 | Ga0207680_10291248 | 3300025903 | Bacteria | 1136 |
| 295 | Ga0207647_10022066 | 3300025904 | Bacteria | 4235 |
| 296 | Ga0207647_10041071 | 3300025904 | Bacteria | 2910 |
| 297 | Ga0207645_10040703 | 3300025907 | Bacteria | 2976 |
| 298 | Ga0207645_10218636 | 3300025907 | Bacteria | 1255 |
| 299 | Ga0207643_10012674 | 3300025908 | Bacteria | 4555 |
| 300 | Ga0207643_10022318 | 3300025908 | Bacteria | 3483 |
| 301 | Ga0207705_10492104 | 3300025909 | Bacteria | 952 |
| 302 | Ga0207707_10002503 | 3300025912 | Bacteria | 16541 |
| 303 | Ga0207695_10004771 | 3300025913 | Bacteria | 18334 |
| 304 | Ga0207695_10094068 | 3300025913 | Bacteria | 3005 |
| 305 | Ga0207695_10793370 | 3300025913 | Bacteria | 827 |
| 306 | Ga0207671_10000444 | 3300025914 | Bacteria | 57054 |
| 307 | Ga0207693_10720308 | 3300025915 | Bacteria | 772 |
| 308 | Ga0207660_10193810 | 3300025917 | Bacteria | 1584 |
| 309 | Ga0207660_10737365 | 3300025917 | Bacteria | 804 |
| 310 | Ga0207662_10064683 | 3300025918 | Bacteria | 2201 |
| 311 | Ga0207657_10017943 | 3300025919 | Bacteria | 6771 |
| 312 | Ga0207649_10241217 | 3300025920 | Bacteria | 1297 |
| 313 | Ga0207681_10023866 | 3300025923 | Bacteria | 3917 |
| 314 | Ga0207694_10121432 | 3300025924 | Bacteria | 2086 |
| 315 | Ga0207650_10000947 | 3300025925 | Bacteria | 21819 |
| 316 | Ga0207650_10028326 | 3300025925 | Bacteria | 4015 |
| 317 | Ga0207659_10030033 | 3300025926 | Bacteria | 3709 |
| 318 | Ga0207664_10000304 | 3300025929 | Bacteria | 36524 |
| 319 | Ga0207664_10014781 | 3300025929 | Bacteria | 5650 |
| 320 | Ga0207644_10008831 | 3300025931 | Bacteria | 6598 |
| 321 | Ga0207644_10019133 | 3300025931 | Bacteria | 4643 |
| 322 | Ga0207690_10000635 | 3300025932 | Bacteria | 22536 |
| 323 | Ga0207690_10332993 | 3300025932 | Bacteria | 1196 |
| 324 | Ga0207706_10003077 | 3300025933 | Bacteria | 16029 |
| 325 | Ga0207706_10115347 | 3300025933 | Bacteria | 2362 |
| 326 | Ga0207670_10465081 | 3300025936 | Bacteria | 1022 |
| 327 | Ga0207669_10018495 | 3300025937 | Bacteria | 3604 |
| 328 | Ga0207669_10037038 | 3300025937 | Bacteria | 2794 |
| 329 | Ga0207669_10275096 | 3300025937 | Bacteria | 1267 |
| 330 | Ga0207704_10059001 | 3300025938 | Bacteria | 2366 |
| 331 | Ga0207704_10482629 | 3300025938 | Bacteria | 995 |
| 332 | Ga0207691_10044273 | 3300025940 | Bacteria | 4098 |
| 333 | Ga0207691_10599609 | 3300025940 | Bacteria | 932 |
| 334 | Ga0207711_10019344 | 3300025941 | Bacteria | 5670 |
| 335 | Ga0207711_10055565 | 3300025941 | Bacteria | 3399 |
| 336 | Ga0207689_10124160 | 3300025942 | Bacteria | 2124 |
| 337 | Ga0207679_10074470 | 3300025945 | Bacteria | 2573 |
| 338 | Ga0207679_10173370 | 3300025945 | Bacteria | 1778 |
| 339 | Ga0207667_10008182 | 3300025949 | Bacteria | 12442 |
| 340 | Ga0207667_10012870 | 3300025949 | Bacteria | 9612 |
| 341 | Ga0207667_10036374 | 3300025949 | Bacteria | 5277 |
| 342 | Ga0207667_10062370 | 3300025949 | Bacteria | 3898 |
| 343 | Ga0207667_10247540 | 3300025949 | Bacteria | 1824 |
| 344 | Ga0207667_10320002 | 3300025949 | Bacteria | 1584 |
| 345 | Ga0207651_10011963 | 3300025960 | Bacteria | 4883 |
| 346 | Ga0207651_10040569 | 3300025960 | Bacteria | 3081 |
| 347 | Ga0207712_10226793 | 3300025961 | Bacteria | 1497 |
| 348 | Ga0207658_10007237 | 3300025986 | Bacteria | 7567 |
| 349 | Ga0207658_10019536 | 3300025986 | Bacteria | 4686 |
| 350 | Ga0207677_10091223 | 3300026023 | Bacteria | 2216 |
| 351 | Ga0207677_10149692 | 3300026023 | Bacteria | 1799 |
| 352 | Ga0207677_10270493 | 3300026023 | Bacteria | 1390 |
| 353 | Ga0207703_10003934 | 3300026035 | Bacteria | 12326 |
| 354 | Ga0207639_10004454 | 3300026041 | Bacteria | 9452 |
| 355 | Ga0207639_10015334 | 3300026041 | Bacteria | 5405 |
| 356 | Ga0207639_10182723 | 3300026041 | Bacteria | 1785 |
| 357 | Ga0207639_10561474 | 3300026041 | Bacteria | 1049 |
| 358 | Ga0207678_10005945 | 3300026067 | Bacteria | 10866 |
| 359 | Ga0207678_10358281 | 3300026067 | Bacteria | 1259 |
| 360 | Ga0207678_10628500 | 3300026067 | Bacteria | 942 |
| 361 | Ga0207702_10000969 | 3300026078 | Bacteria | 29407 |
| 362 | Ga0207702_10134423 | 3300026078 | Bacteria | 2229 |
| 363 | Ga0207641_10073299 | 3300026088 | Bacteria | 2950 |
| 364 | Ga0207641_10108531 | 3300026088 | Bacteria | 2457 |
| 365 | Ga0207648_10026012 | 3300026089 | Bacteria | 5204 |
| 366 | Ga0207648_10059863 | 3300026089 | Bacteria | 3321 |
| 367 | Ga0207648_10303461 | 3300026089 | Bacteria | 1432 |
| 368 | Ga0207648_10371027 | 3300026089 | Bacteria | 1293 |
| 369 | Ga0207648_10408466 | 3300026089 | Bacteria | 1231 |
| 370 | Ga0207648_10510719 | 3300026089 | Bacteria | 1100 |
| 371 | Ga0207674_10010203 | 3300026116 | Bacteria | 10668 |
| 372 | Ga0207683_10043196 | 3300026121 | Bacteria | 3939 |
| 373 | Ga0207683_10056241 | 3300026121 | Bacteria | 3450 |
| 374 | Ga0207698_10059284 | 3300026142 | Bacteria | 2971 |
| 375 | Ga0207698_10335283 | 3300026142 | Bacteria | 1422 |
| 376 | Ga0207698_10437086 | 3300026142 | Bacteria | 1260 |
| 377 | Ga0207698_10755346 | 3300026142 | Bacteria | 972 |
| 378 | Ga0209281_1000537 | 3300027111 | Bacteria | 47794 |
| 379 | Ga0209281_1002628 | 3300027111 | Bacteria | 6895 |
| 380 | Ga0209371_1000354 | 3300027312 | Bacteria | 49531 |
| 381 | Ga0209371_1019741 | 3300027312 | Bacteria | 1675 |
| 382 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 383 | Ga0268266_10055996 | 3300028379 | Bacteria | 3391 |
| 384 | Ga0268266_10572636 | 3300028379 | Bacteria | 1083 |
| 385 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 386 | Ga0307515_10038987 | 3300028794 | Bacteria | 7575 |
| 387 | Ga0307515_10091447 | 3300028794 | Bacteria | 3802 |
| 388 | Ga0307515_10099185 | 3300028794 | Bacteria | 3539 |
| 389 | Ga0307515_10265279 | 3300028794 | Bacteria | 1447 |
| 390 | Ga0268256_1000456 | 3300030500 | Bacteria | 36006 |
| 391 | Ga0268256_1022108 | 3300030500 | Bacteria | 1675 |
| 392 | Ga0307512_10168398 | 3300030522 | Bacteria | 1263 |
| 393 | Ga0316177_1018288 | 3300030731 | Bacteria | 2104 |
| 394 | Ga0316181_1288529 | 3300030744 | Bacteria | 1727 |
| 395 | Ga0265330_10000045 | 3300031235 | Bacteria | 109977 |
| 396 | Ga0265332_10000031 | 3300031238 | Bacteria | 162330 |
| 397 | Ga0265332_10127467 | 3300031238 | Bacteria | 1068 |
| 398 | Ga0265320_10160127 | 3300031240 | Bacteria | 1013 |
| 399 | Ga0265325_10007282 | 3300031241 | Bacteria | 6643 |
| 400 | Ga0265340_10011412 | 3300031247 | Bacteria | 4720 |
| 401 | Ga0307513_10000129 | 3300031456 | Bacteria | 106759 |
| 402 | Ga0307513_10004878 | 3300031456 | Bacteria | 17804 |
| 403 | Ga0307513_10265747 | 3300031456 | Bacteria | 1502 |
| 404 | Ga0307509_10007193 | 3300031507 | Bacteria | 14652 |
| 405 | Ga0307509_10305316 | 3300031507 | Bacteria | 1337 |
| 406 | Ga0307509_10342293 | 3300031507 | Bacteria | 1222 |
| 407 | Ga0307509_10353357 | 3300031507 | Bacteria | 1192 |
| 408 | Ga0307408_100107184 | 3300031548 | Bacteria | 2139 |
| 409 | Ga0307508_10001047 | 3300031616 | Bacteria | 32004 |
| 410 | Ga0265314_10000095 | 3300031711 | Bacteria | 134372 |
| 411 | Ga0265314_10014237 | 3300031711 | Bacteria | 6377 |
| 412 | Ga0265314_10204217 | 3300031711 | Bacteria | 1165 |
| 413 | Ga0307516_10000058 | 3300031730 | Bacteria | 121424 |
| 414 | Ga0307516_10005218 | 3300031730 | Bacteria | 15647 |
| 415 | Ga0307410_10319187 | 3300031852 | Bacteria | 1232 |
| 416 | Ga0307412_10387866 | 3300031911 | Bacteria | 1133 |
| 417 | Ga0307409_100598857 | 3300031995 | Bacteria | 1089 |
| 418 | Ga0307416_100037238 | 3300032002 | Bacteria | 3741 |
| 419 | Ga0307414_10017280 | 3300032004 | Bacteria | 4410 |
| 420 | Ga0307414_10044761 | 3300032004 | Bacteria | 3026 |
| 421 | Ga0307414_10922041 | 3300032004 | Bacteria | 801 |
| 422 | Ga0307411_10000118 | 3300032005 | Bacteria | 24745 |
| 423 | Ga0307411_10454819 | 3300032005 | Bacteria | 1072 |
| 424 | Ga0307510_10083804 | 3300033180 | Bacteria | 3074 |
| 425 | Ga0373949_0067717 | 3300035090 | Bacteria | 930 |
| 426 | Ga0373952_0060254 | 3300035092 | Bacteria | 926 |
| 427 | Ga0373953_0025873 | 3300035117 | Bacteria | 2245 |
| 428 | Ga0373954_0000008 | 3300035118 | Bacteria | 79963 |
| 429 | Ga0373956_0035097 | 3300035119 | Bacteria | 2211 |
| 430 | Ga0316574_0023388 | 3300035398 | Bacteria | 3689 |
| 431 | Ga0373924_0020707 | 3300035410 | Bacteria | 2559 |
| 432 | Ga0373931_0003625 | 3300035691 | Bacteria | 6975 |
| 433 | Ga0373933_0002915 | 3300035724 | Bacteria | 9553 |
| 434 | Ga0373933_0042458 | 3300035724 | Bacteria | 2688 |
| 435 | Ga0373937_0000418 | 3300036401 | Bacteria | 39714 |
| 436 | Ga0373937_0005397 | 3300036401 | Bacteria | 10937 |
| 437 | Ga0373937_0263051 | 3300036401 | Bacteria | 1627 |
| 438 | Ga0316582_0059583 | 3300036647 | Bacteria | 2445 |
| 439 | Ga0316584_0374206 | 3300036712 | Bacteria | 1019 |
| 440 | Ga0373925_0010207 | 3300037068 | Bacteria | 6817 |
| 441 | Ga0395899_0026523 | 3300037312 | Bacteria | 4372 |
| 442 | Ga0395899_0145193 | 3300037312 | Bacteria | 1685 |
| 443 | Ga0395900_0002543 | 3300037418 | Bacteria | 19971 |
| 444 | Ga0395900_0016606 | 3300037418 | Bacteria | 7507 |
| 445 | Ga0395900_0146826 | 3300037418 | Bacteria | 2411 |
| 446 | Ga0395900_0254146 | 3300037418 | Bacteria | 1757 |
| 447 | Ga0395900_0316444 | 3300037418 | Bacteria | 1542 |
| 448 | Ga0395898_0031337 | 3300037466 | Bacteria | 5314 |
| 449 | Ga0395898_0318961 | 3300037466 | Bacteria | 1482 |
| 450 | Ga0395905_0001119 | 3300037471 | Bacteria | 33615 |
| 451 | Ga0395905_0113009 | 3300037471 | Bacteria | 2551 |
| 452 | Ga0395905_0348412 | 3300037471 | Bacteria | 1373 |
| 453 | Ga0395905_0705607 | 3300037471 | Bacteria | 911 |
| 454 | Ga0395901_0003072 | 3300038443 | Bacteria | 16814 |
| 455 | Ga0400483_231697 | 3300039062 | Unclassified | 1102 |
| 456 | Ga0436361_0046720 | 3300039447 | Bacteria | 3436 |
| 457 | Ga0436361_0110138 | 3300039447 | Bacteria | 798 |
| 458 | Ga0436361_0143359 | 3300039447 | Bacteria | 4239 |
| 459 | Ga0436361_0480035 | 3300039447 | Bacteria | 16007 |
| 460 | Ga0436361_0621348 | 3300039447 | Bacteria | 2420 |
| 461 | Ga0436361_0704499 | 3300039447 | Bacteria | 2331 |
| 462 | Ga0436361_0712205 | 3300039447 | Bacteria | 2312 |
| 463 | Ga0436363_0050228 | 3300039450 | Bacteria | 2785 |
| 464 | Ga0451791_0735107 | 3300041451 | Bacteria | 794 |
| 465 | Ga0451839_0483013 | 3300041496 | Bacteria | 1037 |
| 466 | Ga0439452_111879 | 3300042010 | Bacteria | 583 |
| 467 | Ga0439455_0029293 | 3300042012 | Bacteria | 1360 |
| 468 | Ga0450890_003158 | 3300042127 | Bacteria | 2205 |
| 469 | Ga0450896_014994 | 3300042133 | Bacteria | 1108 |
| 470 | Ga0450910_010661 | 3300042147 | Bacteria | 1312 |
| 471 | Ga0439458_0015559 | 3300042157 | Bacteria | 1725 |
| 472 | Ga0439459_0000200 | 3300042438 | Bacteria | 6650 |
| 473 | Ga0439464_0012200 | 3300042439 | Bacteria | 2285 |
| 474 | Ga0450893_0010007 | 3300042532 | Bacteria | 1554 |
| 475 | Ga0451577_0005639 | 3300042876 | Bacteria | 12718 |
| 476 | Ga0451577_0023898 | 3300042876 | Bacteria | 5568 |
| 477 | Ga0451577_0249607 | 3300042876 | Bacteria | 1606 |
| 478 | Ga0451577_0352660 | 3300042876 | Bacteria | 1335 |
| 479 | Ga0466969_0017796 | 3300044656 | Bacteria | 3707 |
| 480 | Ga0466969_0035292 | 3300044656 | Bacteria | 2529 |
| 481 | Ga0466969_0091850 | 3300044656 | Bacteria | 1438 |
| 482 | Ga0466969_0134684 | 3300044656 | Bacteria | 1144 |
| 483 | Ga0466972_0005121 | 3300044658 | Bacteria | 6564 |
| 484 | Ga0466965_0154252 | 3300044683 | Bacteria | 1201 |
| 485 | Ga0466966_0004520 | 3300044684 | Bacteria | 9176 |
| 486 | Ga0466966_0039415 | 3300044684 | Bacteria | 3042 |
| 487 | Ga0466966_0080004 | 3300044684 | Bacteria | 2036 |
| 488 | Ga0466966_0175957 | 3300044684 | Bacteria | 1299 |
| 489 | Ga0466961_0179108 | 3300044693 | Bacteria | 1316 |
| 490 | Ga0466963_0159812 | 3300044694 | Bacteria | 1568 |
| 491 | Ga0466971_0086184 | 3300044719 | Bacteria | 1435 |
| 492 | Ga0466968_0003741 | 3300044735 | Bacteria | 5640 |
| 493 | Ga0466970_0059449 | 3300044765 | Bacteria | 2047 |
| 494 | Ga0466970_0114750 | 3300044765 | Bacteria | 1472 |
| 495 | Ga0466957_0008881 | 3300044842 | Bacteria | 5725 |
| 496 | Ga0466957_0021671 | 3300044842 | Bacteria | 3787 |
| 497 | Ga0466957_0267571 | 3300044842 | Bacteria | 1140 |
| 498 | Ga0466959_0005781 | 3300045049 | Bacteria | 8518 |
| 499 | Ga0466959_0021417 | 3300045049 | Bacteria | 4767 |
| 500 | Ga0466959_0209658 | 3300045049 | Bacteria | 1354 |
| 501 | Ga0451576_0166000 | 3300045051 | Bacteria | 2304 |
| 502 | Ga0451576_0426006 | 3300045051 | Bacteria | 1392 |
| 503 | Ga0451576_0604757 | 3300045051 | Bacteria | 1152 |
| 504 | Ga0466958_0025649 | 3300045836 | Bacteria | 3477 |
| 505 | Ga0466958_0036091 | 3300045836 | Bacteria | 2957 |
| 506 | Ga0466967_0017711 | 3300045976 | Bacteria | 5667 |
| 507 | Ga0495617_000048 | 3300046452 | Bacteria | 113357 |
| 508 | Ga0495627_000046 | 3300046453 | Bacteria | 176186 |
| 509 | Ga0495590_0000030 | 3300046457 | Bacteria | 146237 |
| 510 | Ga0495590_0003180 | 3300046457 | Bacteria | 6715 |
| 511 | Ga0495590_0010511 | 3300046457 | Bacteria | 3478 |
| 512 | Ga0495590_0032233 | 3300046457 | Bacteria | 1832 |
| 513 | Ga0495590_0036580 | 3300046457 | Bacteria | 1712 |
| 514 | Ga0495638_0000105 | 3300046460 | Bacteria | 134384 |
| 515 | Ga0495638_0058485 | 3300046460 | Bacteria | 2388 |
| 516 | Ga0495638_0070592 | 3300046460 | Bacteria | 2138 |
| 517 | Ga0495653_0000018 | 3300046463 | Bacteria | 185787 |
| 518 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 519 | Ga0495650_0000099 | 3300046471 | Bacteria | 215347 |
| 520 | Ga0495650_0000173 | 3300046471 | Bacteria | 142734 |
| 521 | Ga0495650_0000212 | 3300046471 | Bacteria | 124622 |
| 522 | Ga0495650_0000227 | 3300046471 | Bacteria | 114662 |
| 523 | Ga0495650_0000712 | 3300046471 | Bacteria | 42514 |
| 524 | Ga0495650_0005060 | 3300046471 | Bacteria | 8727 |
| 525 | Ga0495650_0010147 | 3300046471 | Bacteria | 5281 |
| 526 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 527 | Ga0495605_0000369 | 3300046474 | Bacteria | 42654 |
| 528 | Ga0495605_0015267 | 3300046474 | Bacteria | 4182 |
| 529 | Ga0495584_0001010 | 3300046491 | Bacteria | 17589 |
| 530 | Ga0495584_0003947 | 3300046491 | Bacteria | 8014 |
| 531 | Ga0495584_0015004 | 3300046491 | Bacteria | 3948 |
| 532 | Ga0495585_0009467 | 3300046492 | Bacteria | 5842 |
| 533 | Ga0495585_0105031 | 3300046492 | Bacteria | 1507 |
| 534 | Ga0495594_0015942 | 3300046499 | Bacteria | 3954 |
| 535 | Ga0495607_0002843 | 3300046501 | Bacteria | 13728 |
| 536 | Ga0495607_0003287 | 3300046501 | Bacteria | 12419 |
| 537 | Ga0495607_0006164 | 3300046501 | Bacteria | 8477 |
| 538 | Ga0495607_0010691 | 3300046501 | Bacteria | 6151 |
| 539 | Ga0495607_0018115 | 3300046501 | Bacteria | 4498 |
| 540 | Ga0495607_0145112 | 3300046501 | Bacteria | 1220 |
| 541 | Ga0495583_0006407 | 3300046506 | Bacteria | 7702 |
| 542 | Ga0495606_0000204 | 3300046507 | Bacteria | 103880 |
| 543 | Ga0495606_0002863 | 3300046507 | Bacteria | 19091 |
| 544 | Ga0495606_0002941 | 3300046507 | Bacteria | 18816 |
| 545 | Ga0495606_0006368 | 3300046507 | Bacteria | 10911 |
| 546 | Ga0495606_0029567 | 3300046507 | Bacteria | 3843 |
| 547 | Ga0495606_0053631 | 3300046507 | Bacteria | 2615 |
| 548 | Ga0495606_0209996 | 3300046507 | Bacteria | 1103 |
| 549 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 550 | Ga0495610_0001557 | 3300046512 | Bacteria | 20196 |
| 551 | Ga0495610_0004255 | 3300046512 | Bacteria | 10653 |
| 552 | Ga0495610_0025294 | 3300046512 | Bacteria | 3188 |
| 553 | Ga0495610_0027618 | 3300046512 | Bacteria | 3013 |
| 554 | Ga0495616_0007249 | 3300046513 | Bacteria | 6639 |
| 555 | Ga0495616_0012205 | 3300046513 | Bacteria | 4887 |
| 556 | Ga0495616_0013958 | 3300046513 | Bacteria | 4513 |
| 557 | Ga0495620_0041900 | 3300046515 | Bacteria | 2004 |
| 558 | Ga0495630_0077734 | 3300046517 | Bacteria | 2502 |
| 559 | Ga0495630_0584065 | 3300046517 | Bacteria | 857 |
| 560 | Ga0495630_0724477 | 3300046517 | Bacteria | 761 |
| 561 | Ga0495632_0003710 | 3300046519 | Bacteria | 10704 |
| 562 | Ga0495637_0200457 | 3300046520 | Bacteria | 733 |
| 563 | Ga0495643_0000181 | 3300046522 | Bacteria | 100368 |
| 564 | Ga0495643_0000460 | 3300046522 | Bacteria | 51847 |
| 565 | Ga0495643_0000770 | 3300046522 | Bacteria | 35800 |
| 566 | Ga0495643_0001670 | 3300046522 | Bacteria | 19438 |
| 567 | Ga0495643_0011341 | 3300046522 | Bacteria | 5432 |
| 568 | Ga0495643_0019107 | 3300046522 | Bacteria | 3968 |
| 569 | Ga0495643_0046669 | 3300046522 | Bacteria | 2347 |
| 570 | Ga0495644_0006659 | 3300046523 | Bacteria | 4474 |
| 571 | Ga0495644_0182287 | 3300046523 | Bacteria | 807 |
| 572 | Ga0495648_0000008 | 3300046524 | Bacteria | 336584 |
| 573 | Ga0495648_0007580 | 3300046524 | Bacteria | 8669 |
| 574 | Ga0495648_0008182 | 3300046524 | Bacteria | 8253 |
| 575 | Ga0495648_0023986 | 3300046524 | Bacteria | 4165 |
| 576 | Ga0495648_0027411 | 3300046524 | Bacteria | 3813 |
| 577 | Ga0495663_0002864 | 3300046525 | Bacteria | 5100 |
| 578 | Ga0495666_0084158 | 3300046526 | Bacteria | 1503 |
| 579 | Ga0495642_0000298 | 3300046528 | Bacteria | 27999 |
| 580 | Ga0495642_0011021 | 3300046528 | Bacteria | 3467 |
| 581 | Ga0495642_0045332 | 3300046528 | Bacteria | 1797 |
| 582 | Ga0495642_0175103 | 3300046528 | Bacteria | 933 |
| 583 | Ga0495654_0021794 | 3300046530 | Bacteria | 3332 |
| 584 | Ga0495654_0069960 | 3300046530 | Bacteria | 1665 |
| 585 | Ga0495598_0000562 | 3300046537 | Bacteria | 6973 |
| 586 | Ga0495609_0000028 | 3300046538 | Bacteria | 219908 |
| 587 | Ga0495609_0001266 | 3300046538 | Bacteria | 17276 |
| 588 | Ga0495609_0007541 | 3300046538 | Bacteria | 5412 |
| 589 | Ga0495609_0019216 | 3300046538 | Bacteria | 3163 |
| 590 | Ga0495609_0141565 | 3300046538 | Bacteria | 1026 |
| 591 | Ga0495597_0002738 | 3300046542 | Bacteria | 10872 |
| 592 | Ga0495597_0006184 | 3300046542 | Bacteria | 6218 |
| 593 | Ga0495597_0008660 | 3300046542 | Bacteria | 5086 |
| 594 | Ga0495597_0012227 | 3300046542 | Bacteria | 4147 |
| 595 | Ga0495645_0305939 | 3300046543 | Bacteria | 1037 |
| 596 | Ga0495622_0000560 | 3300046557 | Bacteria | 22348 |
| 597 | Ga0495622_0012508 | 3300046557 | Bacteria | 3930 |
| 598 | Ga0495622_0036767 | 3300046557 | Bacteria | 2282 |
| 599 | Ga0495633_0000409 | 3300046558 | Bacteria | 44723 |
| 600 | Ga0495633_0000810 | 3300046558 | Bacteria | 27687 |
| 601 | Ga0495633_0002477 | 3300046558 | Bacteria | 13017 |
| 602 | Ga0495633_0032619 | 3300046558 | Bacteria | 2515 |
| 603 | Ga0495633_0032907 | 3300046558 | Bacteria | 2502 |
| 604 | Ga0495633_0163771 | 3300046558 | Bacteria | 1026 |
| 605 | Ga0495656_0149887 | 3300046615 | Bacteria | 1126 |
| 606 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 607 | Ga0495668_0001106 | 3300046616 | Bacteria | 27873 |
| 608 | Ga0495668_0002762 | 3300046616 | Bacteria | 14038 |
| 609 | Ga0495668_0002817 | 3300046616 | Bacteria | 13834 |
| 610 | Ga0495668_0004418 | 3300046616 | Bacteria | 9992 |
| 611 | Ga0495668_0004836 | 3300046616 | Bacteria | 9371 |
| 612 | Ga0495668_0042149 | 3300046616 | Bacteria | 2542 |
| 613 | Ga0495625_0000278 | 3300046660 | Bacteria | 79607 |
| 614 | Ga0495625_0001449 | 3300046660 | Bacteria | 28796 |
| 615 | Ga0495625_0046422 | 3300046660 | Bacteria | 3135 |
| 616 | Ga0495625_0122748 | 3300046660 | Bacteria | 1766 |
| 617 | Ga0495625_0132826 | 3300046660 | Bacteria | 1685 |
| 618 | Ga0495625_0227388 | 3300046660 | Bacteria | 1220 |
| 619 | Ga0495659_0001151 | 3300046664 | Bacteria | 9180 |
| 620 | Ga0495661_0000157 | 3300046665 | Bacteria | 80637 |
| 621 | Ga0495661_0000710 | 3300046665 | Bacteria | 32881 |
| 622 | Ga0495661_0023731 | 3300046665 | Bacteria | 3976 |
| 623 | Ga0495661_0036356 | 3300046665 | Bacteria | 3085 |
| 624 | Ga0495661_0037025 | 3300046665 | Bacteria | 3048 |
| 625 | Ga0495661_0043493 | 3300046665 | Bacteria | 2760 |
| 626 | Ga0495588_0000113 | 3300046674 | Bacteria | 137279 |
| 627 | Ga0495599_0078529 | 3300046678 | Bacteria | 2061 |
| 628 | Ga0495623_0279686 | 3300046679 | Bacteria | 929 |
| 629 | Ga0495669_0030634 | 3300046684 | Bacteria | 2361 |
| 630 | Ga0495671_0000343 | 3300046692 | Bacteria | 38705 |
| 631 | Ga0495671_0000442 | 3300046692 | Bacteria | 32850 |
| 632 | Ga0495671_0050325 | 3300046692 | Bacteria | 2074 |
| 633 | Ga0495671_0360082 | 3300046692 | Bacteria | 697 |
| 634 | Ga0495649_0000725 | 3300046694 | Bacteria | 26788 |
| 635 | Ga0495649_0026199 | 3300046694 | Bacteria | 3245 |
| 636 | Ga0495649_0077498 | 3300046694 | Bacteria | 1779 |
| 637 | Ga0495649_0108955 | 3300046694 | Bacteria | 1469 |
| 638 | Ga0495649_0177676 | 3300046694 | Bacteria | 1111 |
| 639 | Ga0495649_0177690 | 3300046694 | Bacteria | 1111 |
| 640 | Ga0495589_0000098 | 3300046794 | Bacteria | 83860 |
| 641 | Ga0495589_0000117 | 3300046794 | Bacteria | 75549 |
| 642 | Ga0495589_0001522 | 3300046794 | Bacteria | 13335 |
| 643 | Ga0495660_0001411 | 3300046810 | Bacteria | 16475 |
| 644 | Ga0495660_0005422 | 3300046810 | Bacteria | 7636 |
| 645 | Ga0495660_0005755 | 3300046810 | Bacteria | 7402 |
| 646 | Ga0495660_0029510 | 3300046810 | Bacteria | 3093 |
| 647 | Ga0495660_0037420 | 3300046810 | Bacteria | 2702 |
| 648 | Ga0495660_0072660 | 3300046810 | Bacteria | 1821 |
| 649 | Ga0495636_0004214 | 3300047318 | Bacteria | 5648 |
| 650 | Ga0495672_0000410 | 3300047320 | Bacteria | 51954 |
| 651 | Ga0495672_0000423 | 3300047320 | Bacteria | 50688 |
| 652 | Ga0495672_0018201 | 3300047320 | Bacteria | 4675 |
| 653 | Ga0495672_0174514 | 3300047320 | Bacteria | 1093 |
| 654 | Ga0495676_0151576 | 3300047321 | Bacteria | 1649 |
| 655 | Ga0495680_0159771 | 3300047322 | Bacteria | 1637 |
| 656 | Ga0495683_0006508 | 3300047323 | Bacteria | 6381 |
| 657 | Ga0495683_0009385 | 3300047323 | Bacteria | 5214 |
| 658 | Ga0495683_0066318 | 3300047323 | Bacteria | 1779 |
| 659 | Ga0495687_000054 | 3300047443 | Bacteria | 194607 |
| 660 | Ga0495687_000410 | 3300047443 | Bacteria | 53080 |
| 661 | Ga0495687_001444 | 3300047443 | Bacteria | 21817 |
| 662 | Ga0495687_002747 | 3300047443 | Bacteria | 13641 |
| 663 | Ga0495687_066854 | 3300047443 | Bacteria | 1457 |
| 664 | Ga0495677_0000012 | 3300047445 | Bacteria | 146763 |
| 665 | Ga0495677_0000859 | 3300047445 | Bacteria | 12291 |
| 666 | Ga0495677_0003598 | 3300047445 | Bacteria | 6010 |
| 667 | Ga0495677_0036168 | 3300047445 | Bacteria | 1803 |
| 668 | Ga0495679_052618 | 3300047446 | Bacteria | 1217 |
| 669 | Ga0495685_005610 | 3300047447 | Bacteria | 4100 |
| 670 | Ga0495685_063798 | 3300047447 | Bacteria | 1240 |
| 671 | Ga0495673_0000150 | 3300047469 | Bacteria | 122768 |
| 672 | Ga0495681_0009383 | 3300047470 | Bacteria | 6035 |
| 673 | Ga0495681_0012911 | 3300047470 | Bacteria | 4883 |
| 674 | Ga0495681_0136157 | 3300047470 | Bacteria | 1041 |
| 675 | Ga0495686_0000219 | 3300047472 | Bacteria | 105435 |
| 676 | Ga0495686_0002068 | 3300047472 | Bacteria | 19737 |
| 677 | Ga0495686_0002299 | 3300047472 | Bacteria | 18281 |
| 678 | Ga0495686_0010880 | 3300047472 | Bacteria | 6442 |
| 679 | Ga0495686_0037529 | 3300047472 | Bacteria | 3103 |
| 680 | Ga0495686_0166351 | 3300047472 | Bacteria | 1285 |
| 681 | Ga0495593_0015123 | 3300047673 | Bacteria | 4382 |
| 682 | Ga0495626_0000036 | 3300048091 | Bacteria | 180464 |
| 683 | Ga0495626_0000940 | 3300048091 | Bacteria | 25330 |
| 684 | Ga0495626_0156728 | 3300048091 | Bacteria | 957 |
| 685 | Ga0496103_0030455 | 3300048906 | Bacteria | 3284 |
| 686 | Ga0496108_0276173 | 3300048911 | Bacteria | 1463 |
| 687 | Ga0496109_0017381 | 3300048912 | Bacteria | 6305 |
| 688 | Ga0496110_0011602 | 3300048913 | Bacteria | 7223 |
| 689 | Ga0496110_0818425 | 3300048913 | Bacteria | 836 |
| 690 | Ga0496111_0528157 | 3300048914 | Bacteria | 867 |
| 691 | Ga0496113_0012625 | 3300048916 | Bacteria | 5684 |
| 692 | Ga0496113_0066150 | 3300048916 | Bacteria | 2737 |
| 693 | Ga0496113_0434897 | 3300048916 | Bacteria | 1054 |
| 694 | Ga0496114_0027737 | 3300048917 | Bacteria | 4641 |
| 695 | Ga0496116_0027600 | 3300048919 | Bacteria | 4131 |
| 696 | Ga0496116_0031928 | 3300048919 | Bacteria | 3760 |
| 697 | Ga0496121_0074129 | 3300048924 | Bacteria | 2724 |
| 698 | Ga0496122_0000083 | 3300048925 | Bacteria | 208744 |
| 699 | Ga0496122_0016147 | 3300048925 | Bacteria | 7092 |
| 700 | Ga0496122_0020729 | 3300048925 | Bacteria | 5920 |
| 701 | Ga0496122_0091872 | 3300048925 | Bacteria | 2065 |
| 702 | Ga0496122_0099395 | 3300048925 | Bacteria | 1951 |
| 703 | Ga0496122_0205589 | 3300048925 | Bacteria | 1146 |
| 704 | Ga0496123_0000356 | 3300048926 | Bacteria | 85832 |
| 705 | Ga0496123_0008423 | 3300048926 | Bacteria | 9474 |
| 706 | Ga0496123_0045609 | 3300048926 | Bacteria | 2984 |
| 707 | Ga0496123_0267527 | 3300048926 | Bacteria | 834 |
| 708 | Ga0496124_0009703 | 3300048927 | Bacteria | 9853 |
| 709 | Ga0496124_0019323 | 3300048927 | Bacteria | 6344 |
| 710 | Ga0496124_0022774 | 3300048927 | Bacteria | 5735 |
| 711 | Ga0496124_0046979 | 3300048927 | Bacteria | 3695 |
| 712 | Ga0496124_0175363 | 3300048927 | Bacteria | 1655 |
| 713 | Ga0496124_0283189 | 3300048927 | Bacteria | 1207 |
| 714 | Ga0496125_0009768 | 3300048928 | Bacteria | 9790 |
| 715 | Ga0496125_0011420 | 3300048928 | Bacteria | 8885 |
| 716 | Ga0496125_0020289 | 3300048928 | Bacteria | 6239 |
| 717 | Ga0496125_0128747 | 3300048928 | Bacteria | 1787 |
| 718 | Ga0496126_0016636 | 3300048929 | Bacteria | 7350 |
| 719 | Ga0496126_0119777 | 3300048929 | Bacteria | 2284 |
| 720 | Ga0496126_0119976 | 3300048929 | Bacteria | 2282 |
| 721 | Ga0496126_0561053 | 3300048929 | Bacteria | 905 |
| 722 | Ga0495678_000076 | 3300049459 | Bacteria | 125077 |
| 723 | Ga0495678_000780 | 3300049459 | Bacteria | 28573 |
| 724 | Ga0495678_001241 | 3300049459 | Bacteria | 20760 |
| 725 | Ga0495678_009738 | 3300049459 | Bacteria | 4722 |
| 726 | Ga0495678_015957 | 3300049459 | Bacteria | 3447 |
| 727 | Ga0495682_0042830 | 3300049460 | Bacteria | 1659 |
| 728 | Ga0495682_0047290 | 3300049460 | Bacteria | 1570 |
| 729 | Ga0501295_003868 | 3300049518 | Bacteria | 1890 |
| 730 | Ga0501032_0030990 | 3300049569 | Bacteria | 3668 |
| 731 | Ga0501033_0026581 | 3300049570 | Bacteria | 4354 |
| 732 | Ga0501034_0036134 | 3300049571 | Bacteria | 5007 |
| 733 | Ga0501034_0170966 | 3300049571 | Bacteria | 2140 |
| 734 | Ga0501034_0204448 | 3300049571 | Bacteria | 1931 |
| 735 | Ga0501036_0067039 | 3300049572 | Bacteria | 3037 |
| 736 | Ga0501036_0220855 | 3300049572 | Bacteria | 1591 |
| 737 | Ga0501037_0019833 | 3300049573 | Bacteria | 4961 |
| 738 | Ga0501037_0040470 | 3300049573 | Bacteria | 3430 |
| 739 | Ga0501038_0259465 | 3300049574 | Bacteria | 1374 |
| 740 | Ga0501038_0487033 | 3300049574 | Bacteria | 944 |
| 741 | Ga0501043_0000112 | 3300049579 | Bacteria | 76249 |
| 742 | Ga0501043_0052256 | 3300049579 | Bacteria | 3210 |
| 743 | Ga0501043_0063364 | 3300049579 | Bacteria | 2903 |
| 744 | Ga0501043_0409350 | 3300049579 | Bacteria | 1024 |
| 745 | Ga0501043_0580821 | 3300049579 | Bacteria | 830 |
| 746 | Ga0501046_0000146 | 3300049580 | Bacteria | 74204 |
| 747 | Ga0501046_0005311 | 3300049580 | Bacteria | 11522 |
| 748 | Ga0501046_0080023 | 3300049580 | Bacteria | 2526 |
| 749 | Ga0501046_0154907 | 3300049580 | Bacteria | 1727 |
| 750 | Ga0501046_0261657 | 3300049580 | Bacteria | 1271 |
| 751 | Ga0501047_0000192 | 3300049581 | Bacteria | 74300 |
| 752 | Ga0501047_0015361 | 3300049581 | Bacteria | 7295 |
| 753 | Ga0501047_0121379 | 3300049581 | Bacteria | 2495 |
| 754 | Ga0501047_0335048 | 3300049581 | Bacteria | 1351 |
| 755 | Ga0501048_0220145 | 3300049582 | Bacteria | 1346 |
| 756 | Ga0501068_0100090 | 3300049584 | Bacteria | 1796 |
| 757 | Ga0501072_0246343 | 3300049588 | Bacteria | 1423 |
| 758 | Ga0501073_0008559 | 3300049589 | Bacteria | 7586 |
| 759 | Ga0501074_0301275 | 3300049590 | Bacteria | 1138 |
| 760 | Ga0501222_006895 | 3300049662 | Bacteria | 1521 |
| 761 | Ga0501223_039896 | 3300049663 | Bacteria | 911 |
| 762 | Ga0501227_000801 | 3300049665 | Bacteria | 6864 |
| 763 | Ga0501227_025235 | 3300049665 | Bacteria | 1393 |
| 764 | Ga0501230_000883 | 3300049667 | Bacteria | 3351 |
| 765 | Ga0501238_029578 | 3300049671 | Bacteria | 790 |
| 766 | Ga0501080_0000748 | 3300049742 | Bacteria | 26257 |
| 767 | Ga0501080_0251991 | 3300049742 | Bacteria | 1610 |
| 768 | Ga0501083_0123437 | 3300049744 | Bacteria | 1698 |
| 769 | Ga0501269_000253 | 3300049766 | Bacteria | 15243 |
| 770 | Ga0501279_011672 | 3300049775 | Bacteria | 1190 |
| 771 | Ga0501035_0077228 | 3300049822 | Bacteria | 2943 |
| 772 | Ga0501035_0176028 | 3300049822 | Bacteria | 1845 |
| 773 | Ga0501035_0194553 | 3300049822 | Bacteria | 1742 |
| 774 | Ga0501044_0006039 | 3300049823 | Bacteria | 13368 |
| 775 | Ga0501044_0276567 | 3300049823 | Bacteria | 1614 |
| 776 | Ga0501045_0027653 | 3300049824 | Bacteria | 4089 |
| 777 | nmdc:mga03683_158940_c1 | 3300050489 | Bacteria | 1023 |
| 778 | nmdc:mga03683_2428_c1 | 3300050489 | Bacteria | 5785 |
| 779 | nmdc:mga0k408_134510_c1 | 3300050493 | Bacteria | 1468 |
| 780 | nmdc:mga0k408_15821_c1 | 3300050493 | Bacteria | 4176 |
| 781 | nmdc:mga0k408_78517_c1 | 3300050493 | Bacteria | 1931 |
| 782 | nmdc:mga07m45_131019_c1 | 3300050496 | Bacteria | 1451 |
| 783 | nmdc:mga07m45_205757_c1 | 3300050496 | Bacteria | 1145 |
| 784 | nmdc:mga07m45_51108_c1 | 3300050496 | Bacteria | 2330 |
| 785 | nmdc:mga07m45_6354_c1 | 3300050496 | Bacteria | 5967 |
| 786 | nmdc:mga05p37_103_c1 | 3300050507 | Bacteria | 76610 |
| 787 | nmdc:mga09592_9_c1 | 3300050508 | Bacteria | 108110 |
| 788 | nmdc:mga06r32_2368_c2 | 3300050510 | Bacteria | 15697 |
| 789 | nmdc:mga08y16_127494_c1 | 3300050511 | Bacteria | 2647 |
| 790 | nmdc:mga08y16_798620_c1 | 3300050511 | Bacteria | 937 |
| 791 | nmdc:mga0n895_509021_c1 | 3300050512 | Bacteria | 1212 |
| 792 | nmdc:mga0rr50_331_c1 | 3300050513 | Bacteria | 25779 |
| 793 | nmdc:mga08x19_64439_c1 | 3300050514 | Bacteria | 2379 |
| 794 | nmdc:mga0a205_68568_c1 | 3300050515 | Bacteria | 3425 |
| 795 | Ga0500646_0001035 | 3300053090 | Bacteria | 7594 |
| 796 | Ga0500583_0034343 | 3300053092 | Bacteria | 2254 |
| 797 | Ga0500651_0055508 | 3300053093 | Bacteria | 2481 |
| 798 | Ga0500651_0066333 | 3300053093 | Bacteria | 2248 |
| 799 | Ga0500641_0192660 | 3300053096 | Bacteria | 872 |
| 800 | Ga0500617_070568 | 3300053124 | Bacteria | 1531 |
| 801 | Ga0500618_001000 | 3300053125 | Bacteria | 14271 |
| 802 | Ga0500658_0029991 | 3300053134 | Bacteria | 2119 |
| 803 | Ga0500561_0006787 | 3300053137 | Bacteria | 2201 |
| 804 | Ga0500577_0120146 | 3300053142 | Bacteria | 1093 |
| 805 | Ga0500622_0006099 | 3300053156 | Bacteria | 7077 |
| 806 | Ga0500627_0050687 | 3300053158 | Bacteria | 1808 |
| 807 | Ga0500584_025872 | 3300053726 | Bacteria | 2728 |
| 808 | Ga0501082_0005598 | 3300060353 | Bacteria | 10910 |
| 809 | 2538833722 | 2537561836 | Bacteria | 3910579 |
| 810 | 2587725414 | 2585428057 | Bacteria | 6737412 |
| 811 | 2588289989 | 2588253510 | Bacteria | 6901809 |
| 812 | 2643800442 | 2643221556 | Bacteria | 7251154 |
| 813 | 2643829043 | 2643221562 | Bacteria | 4048635 |
| 814 | 2643882776 | 2643221574 | Bacteria | 2789653 |
| 815 | 2643896536 | 2643221577 | Bacteria | 3710843 |
| 816 | 2644058742 | 2643221609 | Bacteria | 6756331 |
| 817 | 2644070984 | 2643221611 | Bacteria | 6820941 |
| 818 | 2644255590 | 2643221646 | Bacteria | 6433402 |
| 819 | 2644302838 | 2643221654 | Bacteria | 5273570 |
| 820 | 2644353019 | 2643221663 | Bacteria | 3425771 |
| 821 | 2644470351 | 2643221684 | Bacteria | 7145183 |
| 822 | 2644478707 | 2643221685 | Bacteria | 3673288 |
| 823 | 2644549791 | 2643221699 | Bacteria | 5731501 |
| 824 | 2644550301 | 2643221699 | Bacteria | 5731501 |
| 825 | 2738825933 | 2738541297 | Bacteria | 6549566 |
| 826 | 2739149730 | 2738541357 | Bacteria | 6549408 |
| 827 | 2739191649 | 2738543003 | Bacteria | 6549560 |
| 828 | 2739245251 | 2738543012 | Bacteria | 7115078 |
| 829 | 2739285939 | 2738543020 | Bacteria | 5718238 |
| 830 | 2739291252 | 2738543021 | Bacteria | 5718241 |
| 831 | 2739318126 | 2738543026 | Bacteria | 6549408 |
| 832 | 2739336367 | 2738543029 | Bacteria | 6549249 |
| 833 | 2765570187 | 2765235838 | Bacteria | 5445269 |
| 834 | 2816471587 | 2816332133 | Bacteria | 7249298 |
| 835 | 2821135575 | 2821131069 | Bacteria | 6108407 |
| 836 | 2831866447 | 2831864461 | Bacteria | 6502356 |
| 837 | 2839096871 | 2839094727 | Bacteria | 5534556 |
| 838 | 2842714005 | 2842711865 | Bacteria | 7155354 |
| 839 | 2842807695 | 2842805378 | Bacteria | 5385175 |
| 840 | 2857555051 | 2857553236 | Bacteria | 6166726 |
| 841 | 2885084469 | 2885080285 | Bacteria | 6355622 |
| 842 | 2886848903 | 2886848708 | Bacteria | 5632523 |
| 843 | 2895396038 | 2895395659 | Bacteria | 3983269 |
| 844 | 2939613208 | 2939611941 | Bacteria | 3892017 |
| 845 | 2939636048 | 2939631187 | Bacteria | 6118131 |
| 846 | 3007256287 | 3007252601 | Bacteria | 4559114 |
| 847 | 3007319487 | 3007315729 | Bacteria | 5076637 |
| 848 | 8047678741 | 8047673197 | Bacteria | 7395230 |
| 849 | Ga0373937_0096810 | |||
| 850 | JGI24735J21928_10004421 | |||
| 851 | JGI25162J39368_1001721 | |||
| 852 | JGI25162J39368_1001834 | |||
| 853 | JGI25154J39366_1000670 | |||
| 854 | JGI25157J39369_1007623 | |||
| 855 | JGI25164J39214_1000843 | |||
| 856 | JGI25164J39214_1000904 | |||
| 857 | JGI25152J39213_1000333 | |||
| 858 | JGI25150J39212_1006368 | |||
| 859 | JGI25159J45721_1003741 | |||
| 860 | JGI25165J46597_1001628 | |||
| 861 | JGI25165J46597_1002627 | |||
| 862 | JGI25153J46596_10030568 | |||
| 863 | rootH1_10036074 | |||
| 864 | rootH2_10035007 | |||
| 865 | rootL2_10002558 | |||
| 866 | rootL2_10003205 | |||
| 867 | rootL2_10028022 | |||
| 868 | rootL2_10033379 | |||
| 869 | rootH1_10004792 | |||
| 870 | rootH1_10012636 | |||
| 871 | rootH1_10078746 | |||
| 872 | Ga0055525_1000081 | |||
| 873 | Ga0055529_1000565 | |||
| 874 | Ga0055526_1000230 | |||
| 875 | Ga0055526_1000258 | |||
| 876 | Ga0055526_1000442 | |||
| 877 | Ga0055526_1002405 | |||
| 878 | Ga0055526_1006039 | |||
| 879 | Ga0055526_1010482 | |||
| 880 | Ga0055537_1000128 | |||
| 881 | Ga0055537_1002789 | |||
| 882 | Ga0055524_1000026 | |||
| 883 | Ga0055524_1000528 | |||
| 884 | Ga0055524_1002759 | |||
| 885 | Ga0055524_1020729 | |||
| 886 | Ga0055534_1000120 | |||
| 887 | Ga0055528_1000069 | |||
| 888 | Ga0055530_10034349 | |||
| 889 | Ga0055531_10000154 | |||
| 890 | Ga0055531_10003023 | |||
| 891 | Ga0055531_10022807 | |||
| 892 | Ga0055543_1001084 | |||
| 893 | Ga0055543_1003994 | |||
| 894 | Ga0065165_1000067 | |||
| 895 | Ga0065165_1000276 | |||
| 896 | Ga0065165_1068932 | |||
| 897 | Ga0070658_10634896 | |||
| 898 | Ga0070676_10005140 | |||
| 899 | Ga0070670_100001478 | |||
| 900 | Ga0070670_100016429 | |||
| 901 | Ga0070677_10007765 | |||
| 902 | Ga0068869_100051042 | |||
| 903 | Ga0068869_100479008 | |||
| 904 | Ga0070666_10209107 | |||
| 905 | Ga0070682_100001469 | |||
| 906 | Ga0070682_100003106 | |||
| 907 | Ga0070682_100027600 | |||
| 908 | Ga0068868_100114348 | |||
| 909 | Ga0068868_100124649 | |||
| 910 | Ga0070660_100100606 | |||
| 911 | Ga0070660_100122047 | |||
| 912 | Ga0070661_100016629 | |||
| 913 | Ga0070692_10035255 | |||
| 914 | Ga0070692_10068906 | |||
| 915 | Ga0070669_100025994 | |||
| 916 | Ga0070675_100000072 | |||
| 917 | Ga0070671_100093203 | |||
| 918 | Ga0070671_100184736 | |||
| 919 | Ga0070671_100340791 | |||
| 920 | Ga0070674_100049783 | |||
| 921 | Ga0070674_100182901 | |||
| 922 | Ga0070673_100019834 | |||
| 923 | Ga0070673_100180283 | |||
| 924 | Ga0070673_100293374 | |||
| 925 | Ga0070688_100151446 | |||
| 926 | Ga0070659_100002090 | |||
| 927 | Ga0070659_100008903 | |||
| 928 | Ga0070667_100035426 | |||
| 929 | Ga0070667_100082453 | |||
| 930 | Ga0070714_100007085 | |||
| 931 | Ga0070714_100047437 | |||
| 932 | Ga0070710_10058042 | |||
| 933 | Ga0070711_101038961 | |||
| 934 | Ga0070700_100236610 | |||
| 935 | Ga0070694_100183425 | |||
| 936 | Ga0070694_100251056 | |||
| 937 | Ga0070663_100048646 | |||
| 938 | Ga0070678_100098412 | |||
| 939 | Ga0070678_100265257 | |||
| 940 | Ga0070662_100067706 | |||
| 941 | Ga0070681_10002635 | |||
| 942 | Ga0068867_100323978 | |||
| 943 | Ga0068867_100341982 | |||
| 944 | Ga0070684_100163045 | |||
| 945 | Ga0068853_100001001 | |||
| 946 | Ga0068853_100046622 | |||
| 947 | Ga0070672_100009439 | |||
| 948 | Ga0070672_100010736 | |||
| 949 | Ga0070672_100040865 | |||
| 950 | Ga0070696_100116171 | |||
| 951 | Ga0070693_100050195 | |||
| 952 | Ga0070665_100013753 | |||
| 953 | Ga0070665_100071893 | |||
| 954 | Ga0070704_100002816 | |||
| 955 | Ga0070704_100963861 | |||
| 956 | Ga0068855_100017967 | |||
| 957 | Ga0068855_100046260 | |||
| 958 | Ga0068855_100148866 | |||
| 959 | Ga0068855_100249067 | |||
| 960 | Ga0068855_100626652 | |||
| 961 | Ga0070664_100209471 | |||
| 962 | Ga0070664_100318999 | |||
| 963 | Ga0068857_100093646 | |||
| 964 | Ga0068854_100141076 | |||
| 965 | Ga0068856_100000088 | |||
| 966 | Ga0068856_100005127 | |||
| 967 | Ga0068856_100056334 | |||
| 968 | Ga0068856_100142457 | |||
| 969 | Ga0068852_100076538 | |||
| 970 | Ga0068859_100005367 | |||
| 971 | Ga0068859_100017147 | |||
| 972 | Ga0068859_100037413 | |||
| 973 | Ga0068859_100436241 | |||
| 974 | Ga0068864_100015249 | |||
| 975 | Ga0068864_100147585 | |||
| 976 | Ga0068864_100172136 | |||
| 977 | Ga0068866_10238336 | |||
| 978 | Ga0068866_10275532 | |||
| 979 | Ga0068870_10143865 | |||
| 980 | Ga0068863_100057083 | |||
| 981 | Ga0068863_100545074 | |||
| 982 | Ga0068858_100007339 | |||
| 983 | Ga0068860_100018631 | |||
| 984 | Ga0068860_100095772 | |||
| 985 | Ga0075366_10004937 | |||
| 986 | Ga0075366_10028699 | |||
| 987 | Ga0075366_10053845 | |||
| 988 | Ga0097621_100137407 | |||
| 989 | Ga0075370_10017358 | |||
| 990 | Ga0075370_10017940 | |||
| 991 | Ga0075370_10069391 | |||
| 992 | Ga0068871_100008131 | |||
| 993 | Ga0068871_100263298 | |||
| 994 | Ga0075431_100000781 | |||
| 995 | Ga0075433_10301891 | |||
| 996 | Ga0075434_100000002 | |||
| 997 | Ga0075429_100000009 | |||
| 998 | Ga0068865_100566626 | |||
| 999 | Ga0075436_100067212 | |||
| 1000 | Ga0097620_100005367 | |||
| 1001 | Ga0097620_100017146 | |||
| 1002 | Ga0097620_100037413 | |||
| 1003 | Ga0097620_100436250 | |||
| 1004 | Ga0099823_1000213 | |||
| 1005 | Ga0079104_1000001 | |||
| 1006 | Ga0099826_10000003 | |||
| 1007 | Ga0075435_100002074 | |||
| 1008 | Ga0075435_100052352 | |||
| 1009 | Ga0105244_10002049 | |||
| 1010 | Ga0105244_10080443 | |||
| 1011 | Ga0105244_10113502 | |||
| 1012 | Ga0105240_10011045 | |||
| 1013 | Ga0114129_10039159 | |||
| 1014 | Ga0105243_10481077 | |||
| 1015 | Ga0105243_11075959 | |||
| 1016 | Ga0105248_10036982 | |||
| 1017 | Ga0105248_10086635 | |||
| 1018 | Ga0105248_10370608 | |||
| 1019 | Ga0105237_10000147 | |||
| 1020 | Ga0105238_10003207 | |||
| 1021 | Ga0105238_10066617 | |||
| 1022 | Ga0105238_10395691 | |||
| 1023 | Ga0105238_10722614 | |||
| 1024 | Ga0105249_10013764 | |||
| 1025 | Ga0157319_1000023 | |||
| 1026 | Ga0157373_10001548 | |||
| 1027 | Ga0157373_10407845 | |||
| 1028 | Ga0157371_10010197 | |||
| 1029 | Ga0157371_10086459 | |||
| 1030 | Ga0157371_10370660 | |||
| 1031 | Ga0157370_10000264 | |||
| 1032 | Ga0157370_10005082 | |||
| 1033 | Ga0157370_10026839 | |||
| 1034 | Ga0157370_10047067 | |||
| 1035 | Ga0157370_10112844 | |||
| 1036 | Ga0157370_10249704 | |||
| 1037 | Ga0157369_10143402 | |||
| 1038 | Ga0157369_10230275 | |||
| 1039 | Ga0157369_10561575 | |||
| 1040 | Ga0157369_11275860 | |||
| 1041 | Ga0157374_10555533 | |||
| 1042 | Ga0157378_10000033 | |||
| 1043 | Ga0157378_10248252 | |||
| 1044 | Ga0157372_10030731 | |||
| 1045 | Ga0157372_10155933 | |||
| 1046 | Ga0157372_10180132 | |||
| 1047 | Ga0157372_10193061 | |||
| 1048 | Ga0157372_11073813 | |||
| 1049 | Ga0157375_10018510 | |||
| 1050 | Ga0157375_10018656 | |||
| 1051 | Ga0157375_10024111 | |||
| 1052 | Ga0157375_10277881 | |||
| 1053 | Ga0157375_10523789 | |||
| 1054 | Ga0163163_10421254 | |||
| 1055 | Ga0157380_10042412 | |||
| 1056 | Ga0157380_10126963 | |||
| 1057 | Ga0182008_10058280 | |||
| 1058 | Ga0182008_10068675 | |||
| 1059 | Ga0182008_10110002 | |||
| 1060 | Ga0157379_10024447 | |||
| 1061 | Ga0157379_10238113 | |||
| 1062 | Ga0157379_10384982 | |||
| 1063 | Ga0157376_10004616 | |||
| 1064 | Ga0157376_10041150 | |||
| 1065 | Ga0157376_10124832 | |||
| 1066 | Ga0182006_1000070 | |||
| 1067 | Ga0182006_1006020 | |||
| 1068 | Ga0182006_1028006 | |||
| 1069 | Ga0182007_10061903 | |||
| 1070 | Ga0182007_10093832 | |||
| 1071 | Ga0182005_1000003 | |||
| 1072 | Ga0183369_1004 | |||
| 1073 | Ga0183361_13646 | |||
| 1074 | Ga0163161_10018024 | |||
| 1075 | Ga0206356_11593915 | |||
| 1076 | Ga0206353_10169809 | |||
| 1077 | Ga0213872_10000252 | |||
| 1078 | Ga0213872_10004097 | |||
| 1079 | Ga0213872_10007564 | |||
| 1080 | Ga0213872_10019215 | |||
| 1081 | Ga0213872_10030430 | |||
| 1082 | Ga0213874_10036041 | |||
| 1083 | Ga0209436_108716 | |||
| 1084 | Ga0209674_102244 | |||
| 1085 | Ga0209563_100015 | |||
| 1086 | Ga0207427_100068 | |||
| 1087 | Ga0207427_100143 | |||
| 1088 | Ga0209437_100005 | |||
| 1089 | Ga0209437_100255 | |||
| 1090 | Ga0207425_1000377 | |||
| 1091 | Ga0207425_1000417 | |||
| 1092 | Ga0209646_1000114 | |||
| 1093 | Ga0209646_1004778 | |||
| 1094 | Ga0209026_1013458 | |||
| 1095 | Ga0209677_101945 | |||
| 1096 | Ga0209148_1000413 | |||
| 1097 | Ga0209129_1000062 | |||
| 1098 | Ga0209233_1000011 | |||
| 1099 | Ga0209233_1000172 | |||
| 1100 | Ga0209233_1008135 | |||
| 1101 | Ga0209565_1000006 | |||
| 1102 | Ga0209565_1004370 | |||
| 1103 | Ga0209455_1000063 | |||
| 1104 | Ga0209455_1000267 | |||
| 1105 | Ga0209673_1000004 | |||
| 1106 | Ga0209673_1003916 | |||
| 1107 | Ga0209673_1005396 | |||
| 1108 | Ga0209673_1008906 | |||
| 1109 | Ga0209673_1034950 | |||
| 1110 | Ga0209130_1000223 | |||
| 1111 | Ga0209675_1000224 | |||
| 1112 | Ga0209675_1010149 | |||
| 1113 | Ga0209025_1002210 | |||
| 1114 | Ga0209564_1000003 | |||
| 1115 | Ga0209564_1000006 | |||
| 1116 | Ga0209564_1000014 | |||
| 1117 | Ga0209564_1000026 | |||
| 1118 | Ga0209564_1000102 | |||
| 1119 | Ga0209758_1000129 | |||
| 1120 | Ga0209758_1000372 | |||
| 1121 | Ga0209050_1000118 | |||
| 1122 | Ga0209050_1005818 | |||
| 1123 | Ga0209050_1014918 | |||
| 1124 | Ga0209256_1000013 | |||
| 1125 | Ga0209256_1000015 | |||
| 1126 | Ga0209256_1000495 | |||
| 1127 | Ga0209256_1000692 | |||
| 1128 | Ga0209051_1001168 | |||
| 1129 | Ga0209051_1030031 | |||
| 1130 | Ga0209257_1000117 | |||
| 1131 | Ga0209257_1001528 | |||
| 1132 | Ga0209257_1001538 | |||
| 1133 | Ga0209257_1020069 | |||
| 1134 | Ga0207697_10043402 | |||
| 1135 | Ga0207656_10038281 | |||
| 1136 | Ga0207656_10113164 | |||
| 1137 | Ga0207655_1003166 | |||
| 1138 | Ga0207713_1000124 | |||
| 1139 | Ga0207682_10009795 | |||
| 1140 | Ga0207688_10240524 | |||
| 1141 | Ga0207688_10325516 | |||
| 1142 | Ga0207680_10291248 | |||
| 1143 | Ga0207647_10022066 | |||
| 1144 | Ga0207647_10041071 | |||
| 1145 | Ga0207645_10040703 | |||
| 1146 | Ga0207645_10218636 | |||
| 1147 | Ga0207643_10012674 | |||
| 1148 | Ga0207643_10022318 | |||
| 1149 | Ga0207705_10492104 | |||
| 1150 | Ga0207707_10002503 | |||
| 1151 | Ga0207695_10004771 | |||
| 1152 | Ga0207695_10094068 | |||
| 1153 | Ga0207695_10793370 | |||
| 1154 | Ga0207671_10000444 | |||
| 1155 | Ga0207693_10720308 | |||
| 1156 | Ga0207660_10193810 | |||
| 1157 | Ga0207660_10737365 | |||
| 1158 | Ga0207662_10064683 | |||
| 1159 | Ga0207657_10017943 | |||
| 1160 | Ga0207649_10241217 | |||
| 1161 | Ga0207681_10023866 | |||
| 1162 | Ga0207694_10121432 | |||
| 1163 | Ga0207650_10000947 | |||
| 1164 | Ga0207650_10028326 | |||
| 1165 | Ga0207659_10030033 | |||
| 1166 | Ga0207664_10000304 | |||
| 1167 | Ga0207664_10014781 | |||
| 1168 | Ga0207644_10008831 | |||
| 1169 | Ga0207644_10019133 | |||
| 1170 | Ga0207690_10000635 | |||
| 1171 | Ga0207690_10332993 | |||
| 1172 | Ga0207706_10003077 | |||
| 1173 | Ga0207706_10115347 | |||
| 1174 | Ga0207670_10465081 | |||
| 1175 | Ga0207669_10018495 | |||
| 1176 | Ga0207669_10037038 | |||
| 1177 | Ga0207669_10275096 | |||
| 1178 | Ga0207704_10059001 | |||
| 1179 | Ga0207704_10482629 | |||
| 1180 | Ga0207691_10044273 | |||
| 1181 | Ga0207691_10599609 | |||
| 1182 | Ga0207711_10019344 | |||
| 1183 | Ga0207711_10055565 | |||
| 1184 | Ga0207689_10124160 | |||
| 1185 | Ga0207679_10074470 | |||
| 1186 | Ga0207679_10173370 | |||
| 1187 | Ga0207667_10008182 | |||
| 1188 | Ga0207667_10012870 | |||
| 1189 | Ga0207667_10036374 | |||
| 1190 | Ga0207667_10062370 | |||
| 1191 | Ga0207667_10247540 | |||
| 1192 | Ga0207667_10320002 | |||
| 1193 | Ga0207651_10011963 | |||
| 1194 | Ga0207651_10040569 | |||
| 1195 | Ga0207712_10226793 | |||
| 1196 | Ga0207658_10007237 | |||
| 1197 | Ga0207658_10019536 | |||
| 1198 | Ga0207677_10091223 | |||
| 1199 | Ga0207677_10149692 | |||
| 1200 | Ga0207677_10270493 | |||
| 1201 | Ga0207703_10003934 | |||
| 1202 | Ga0207639_10004454 | |||
| 1203 | Ga0207639_10015334 | |||
| 1204 | Ga0207639_10182723 | |||
| 1205 | Ga0207639_10561474 | |||
| 1206 | Ga0207678_10005945 | |||
| 1207 | Ga0207678_10358281 | |||
| 1208 | Ga0207678_10628500 | |||
| 1209 | Ga0207702_10000969 | |||
| 1210 | Ga0207702_10134423 | |||
| 1211 | Ga0207641_10073299 | |||
| 1212 | Ga0207641_10108531 | |||
| 1213 | Ga0207648_10026012 | |||
| 1214 | Ga0207648_10059863 | |||
| 1215 | Ga0207648_10303461 | |||
| 1216 | Ga0207648_10371027 | |||
| 1217 | Ga0207648_10408466 | |||
| 1218 | Ga0207648_10510719 | |||
| 1219 | Ga0207674_10010203 | |||
| 1220 | Ga0207683_10043196 | |||
| 1221 | Ga0207683_10056241 | |||
| 1222 | Ga0207698_10059284 | |||
| 1223 | Ga0207698_10335283 | |||
| 1224 | Ga0207698_10437086 | |||
| 1225 | Ga0207698_10755346 | |||
| 1226 | Ga0209281_1000537 | |||
| 1227 | Ga0209281_1002628 | |||
| 1228 | Ga0209371_1000354 | |||
| 1229 | Ga0209371_1019741 | |||
| 1230 | Ga0209282_1000002 | |||
| 1231 | Ga0268266_10055996 | |||
| 1232 | Ga0268266_10572636 | |||
| 1233 | Ga0307515_10000006 | |||
| 1234 | Ga0307515_10038987 | |||
| 1235 | Ga0307515_10091447 | |||
| 1236 | Ga0307515_10099185 | |||
| 1237 | Ga0307515_10265279 | |||
| 1238 | Ga0268256_1000456 | |||
| 1239 | Ga0268256_1022108 | |||
| 1240 | Ga0307512_10168398 | |||
| 1241 | Ga0316177_1018288 | |||
| 1242 | Ga0316181_1288529 | |||
| 1243 | Ga0265330_10000045 | |||
| 1244 | Ga0265332_10000031 | |||
| 1245 | Ga0265332_10127467 | |||
| 1246 | Ga0265320_10160127 | |||
| 1247 | Ga0265325_10007282 | |||
| 1248 | Ga0265340_10011412 | |||
| 1249 | Ga0307513_10000129 | |||
| 1250 | Ga0307513_10004878 | |||
| 1251 | Ga0307513_10265747 | |||
| 1252 | Ga0307509_10007193 | |||
| 1253 | Ga0307509_10305316 | |||
| 1254 | Ga0307509_10342293 | |||
| 1255 | Ga0307509_10353357 | |||
| 1256 | Ga0307408_100107184 | |||
| 1257 | Ga0307508_10001047 | |||
| 1258 | Ga0265314_10000095 | |||
| 1259 | Ga0265314_10014237 | |||
| 1260 | Ga0265314_10204217 | |||
| 1261 | Ga0307516_10000058 | |||
| 1262 | Ga0307516_10005218 | |||
| 1263 | Ga0307410_10319187 | |||
| 1264 | Ga0307412_10387866 | |||
| 1265 | Ga0307409_100598857 | |||
| 1266 | Ga0307416_100037238 | |||
| 1267 | Ga0307414_10017280 | |||
| 1268 | Ga0307414_10044761 | |||
| 1269 | Ga0307414_10922041 | |||
| 1270 | Ga0307411_10000118 | |||
| 1271 | Ga0307411_10454819 | |||
| 1272 | Ga0307510_10083804 | |||
| 1273 | Ga0373949_0067717 | |||
| 1274 | Ga0373952_0060254 | |||
| 1275 | Ga0373953_0025873 | |||
| 1276 | Ga0373954_0000008 | |||
| 1277 | Ga0373956_0035097 | |||
| 1278 | Ga0316574_0023388 | |||
| 1279 | Ga0373924_0020707 | |||
| 1280 | Ga0373931_0003625 | |||
| 1281 | Ga0373933_0002915 | |||
| 1282 | Ga0373933_0042458 | |||
| 1283 | Ga0373937_0000418 | |||
| 1284 | Ga0373937_0005397 | |||
| 1285 | Ga0373937_0263051 | |||
| 1286 | Ga0316582_0059583 | |||
| 1287 | Ga0316584_0374206 | |||
| 1288 | Ga0373925_0010207 | |||
| 1289 | Ga0395899_0026523 | |||
| 1290 | Ga0395899_0145193 | |||
| 1291 | Ga0395900_0002543 | |||
| 1292 | Ga0395900_0016606 | |||
| 1293 | Ga0395900_0146826 | |||
| 1294 | Ga0395900_0254146 | |||
| 1295 | Ga0395900_0316444 | |||
| 1296 | Ga0395898_0031337 | |||
| 1297 | Ga0395898_0318961 | |||
| 1298 | Ga0395905_0001119 | |||
| 1299 | Ga0395905_0113009 | |||
| 1300 | Ga0395905_0348412 | |||
| 1301 | Ga0395905_0705607 | |||
| 1302 | Ga0395901_0003072 | |||
| 1303 | Ga0400483_231697 | |||
| 1304 | Ga0436361_0046720 | |||
| 1305 | Ga0436361_0110138 | |||
| 1306 | Ga0436361_0143359 | |||
| 1307 | Ga0436361_0480035 | |||
| 1308 | Ga0436361_0621348 | |||
| 1309 | Ga0436361_0704499 | |||
| 1310 | Ga0436361_0712205 | |||
| 1311 | Ga0436363_0050228 | |||
| 1312 | Ga0451791_0735107 | |||
| 1313 | Ga0451839_0483013 | |||
| 1314 | Ga0439452_111879 | |||
| 1315 | Ga0439455_0029293 | |||
| 1316 | Ga0450890_003158 | |||
| 1317 | Ga0450896_014994 | |||
| 1318 | Ga0450910_010661 | |||
| 1319 | Ga0439458_0015559 | |||
| 1320 | Ga0439459_0000200 | |||
| 1321 | Ga0439464_0012200 | |||
| 1322 | Ga0450893_0010007 | |||
| 1323 | Ga0451577_0005639 | |||
| 1324 | Ga0451577_0023898 | |||
| 1325 | Ga0451577_0249607 | |||
| 1326 | Ga0451577_0352660 | |||
| 1327 | Ga0466969_0017796 | |||
| 1328 | Ga0466969_0035292 | |||
| 1329 | Ga0466969_0091850 | |||
| 1330 | Ga0466969_0134684 | |||
| 1331 | Ga0466972_0005121 | |||
| 1332 | Ga0466965_0154252 | |||
| 1333 | Ga0466966_0004520 | |||
| 1334 | Ga0466966_0039415 | |||
| 1335 | Ga0466966_0080004 | |||
| 1336 | Ga0466966_0175957 | |||
| 1337 | Ga0466961_0179108 | |||
| 1338 | Ga0466963_0159812 | |||
| 1339 | Ga0466971_0086184 | |||
| 1340 | Ga0466968_0003741 | |||
| 1341 | Ga0466970_0059449 | |||
| 1342 | Ga0466970_0114750 | |||
| 1343 | Ga0466957_0008881 | |||
| 1344 | Ga0466957_0021671 | |||
| 1345 | Ga0466957_0267571 | |||
| 1346 | Ga0466959_0005781 | |||
| 1347 | Ga0466959_0021417 | |||
| 1348 | Ga0466959_0209658 | |||
| 1349 | Ga0451576_0166000 | |||
| 1350 | Ga0451576_0426006 | |||
| 1351 | Ga0451576_0604757 | |||
| 1352 | Ga0466958_0025649 | |||
| 1353 | Ga0466958_0036091 | |||
| 1354 | Ga0466967_0017711 | |||
| 1355 | Ga0495617_000048 | |||
| 1356 | Ga0495627_000046 | |||
| 1357 | Ga0495590_0000030 | |||
| 1358 | Ga0495590_0003180 | |||
| 1359 | Ga0495590_0010511 | |||
| 1360 | Ga0495590_0032233 | |||
| 1361 | Ga0495590_0036580 | |||
| 1362 | Ga0495638_0000105 | |||
| 1363 | Ga0495638_0058485 | |||
| 1364 | Ga0495638_0070592 | |||
| 1365 | Ga0495653_0000018 | |||
| 1366 | Ga0495650_0000024 | |||
| 1367 | Ga0495650_0000099 | |||
| 1368 | Ga0495650_0000173 | |||
| 1369 | Ga0495650_0000212 | |||
| 1370 | Ga0495650_0000227 | |||
| 1371 | Ga0495650_0000712 | |||
| 1372 | Ga0495650_0005060 | |||
| 1373 | Ga0495650_0010147 | |||
| 1374 | Ga0495605_0000005 | |||
| 1375 | Ga0495605_0000369 | |||
| 1376 | Ga0495605_0015267 | |||
| 1377 | Ga0495584_0001010 | |||
| 1378 | Ga0495584_0003947 | |||
| 1379 | Ga0495584_0015004 | |||
| 1380 | Ga0495585_0009467 | |||
| 1381 | Ga0495585_0105031 | |||
| 1382 | Ga0495594_0015942 | |||
| 1383 | Ga0495607_0002843 | |||
| 1384 | Ga0495607_0003287 | |||
| 1385 | Ga0495607_0006164 | |||
| 1386 | Ga0495607_0010691 | |||
| 1387 | Ga0495607_0018115 | |||
| 1388 | Ga0495607_0145112 | |||
| 1389 | Ga0495583_0006407 | |||
| 1390 | Ga0495606_0000204 | |||
| 1391 | Ga0495606_0002863 | |||
| 1392 | Ga0495606_0002941 | |||
| 1393 | Ga0495606_0006368 | |||
| 1394 | Ga0495606_0029567 | |||
| 1395 | Ga0495606_0053631 | |||
| 1396 | Ga0495606_0209996 | |||
| 1397 | Ga0495610_0000021 | |||
| 1398 | Ga0495610_0001557 | |||
| 1399 | Ga0495610_0004255 | |||
| 1400 | Ga0495610_0025294 | |||
| 1401 | Ga0495610_0027618 | |||
| 1402 | Ga0495616_0007249 | |||
| 1403 | Ga0495616_0012205 | |||
| 1404 | Ga0495616_0013958 | |||
| 1405 | Ga0495620_0041900 | |||
| 1406 | Ga0495630_0077734 | |||
| 1407 | Ga0495630_0584065 | |||
| 1408 | Ga0495630_0724477 | |||
| 1409 | Ga0495632_0003710 | |||
| 1410 | Ga0495637_0200457 | |||
| 1411 | Ga0495643_0000181 | |||
| 1412 | Ga0495643_0000460 | |||
| 1413 | Ga0495643_0000770 | |||
| 1414 | Ga0495643_0001670 | |||
| 1415 | Ga0495643_0011341 | |||
| 1416 | Ga0495643_0019107 | |||
| 1417 | Ga0495643_0046669 | |||
| 1418 | Ga0495644_0006659 | |||
| 1419 | Ga0495644_0182287 | |||
| 1420 | Ga0495648_0000008 | |||
| 1421 | Ga0495648_0007580 | |||
| 1422 | Ga0495648_0008182 | |||
| 1423 | Ga0495648_0023986 | |||
| 1424 | Ga0495648_0027411 | |||
| 1425 | Ga0495663_0002864 | |||
| 1426 | Ga0495666_0084158 | |||
| 1427 | Ga0495642_0000298 | |||
| 1428 | Ga0495642_0011021 | |||
| 1429 | Ga0495642_0045332 | |||
| 1430 | Ga0495642_0175103 | |||
| 1431 | Ga0495654_0021794 | |||
| 1432 | Ga0495654_0069960 | |||
| 1433 | Ga0495598_0000562 | |||
| 1434 | Ga0495609_0000028 | |||
| 1435 | Ga0495609_0001266 | |||
| 1436 | Ga0495609_0007541 | |||
| 1437 | Ga0495609_0019216 | |||
| 1438 | Ga0495609_0141565 | |||
| 1439 | Ga0495597_0002738 | |||
| 1440 | Ga0495597_0006184 | |||
| 1441 | Ga0495597_0008660 | |||
| 1442 | Ga0495597_0012227 | |||
| 1443 | Ga0495645_0305939 | |||
| 1444 | Ga0495622_0000560 | |||
| 1445 | Ga0495622_0012508 | |||
| 1446 | Ga0495622_0036767 | |||
| 1447 | Ga0495633_0000409 | |||
| 1448 | Ga0495633_0000810 | |||
| 1449 | Ga0495633_0002477 | |||
| 1450 | Ga0495633_0032619 | |||
| 1451 | Ga0495633_0032907 | |||
| 1452 | Ga0495633_0163771 | |||
| 1453 | Ga0495656_0149887 | |||
| 1454 | Ga0495668_0000008 | |||
| 1455 | Ga0495668_0001106 | |||
| 1456 | Ga0495668_0002762 | |||
| 1457 | Ga0495668_0002817 | |||
| 1458 | Ga0495668_0004418 | |||
| 1459 | Ga0495668_0004836 | |||
| 1460 | Ga0495668_0042149 | |||
| 1461 | Ga0495625_0000278 | |||
| 1462 | Ga0495625_0001449 | |||
| 1463 | Ga0495625_0046422 | |||
| 1464 | Ga0495625_0122748 | |||
| 1465 | Ga0495625_0132826 | |||
| 1466 | Ga0495625_0227388 | |||
| 1467 | Ga0495659_0001151 | |||
| 1468 | Ga0495661_0000157 | |||
| 1469 | Ga0495661_0000710 | |||
| 1470 | Ga0495661_0023731 | |||
| 1471 | Ga0495661_0036356 | |||
| 1472 | Ga0495661_0037025 | |||
| 1473 | Ga0495661_0043493 | |||
| 1474 | Ga0495588_0000113 | |||
| 1475 | Ga0495599_0078529 | |||
| 1476 | Ga0495623_0279686 | |||
| 1477 | Ga0495669_0030634 | |||
| 1478 | Ga0495671_0000343 | |||
| 1479 | Ga0495671_0000442 | |||
| 1480 | Ga0495671_0050325 | |||
| 1481 | Ga0495671_0360082 | |||
| 1482 | Ga0495649_0000725 | |||
| 1483 | Ga0495649_0026199 | |||
| 1484 | Ga0495649_0077498 | |||
| 1485 | Ga0495649_0108955 | |||
| 1486 | Ga0495649_0177676 | |||
| 1487 | Ga0495649_0177690 | |||
| 1488 | Ga0495589_0000098 | |||
| 1489 | Ga0495589_0000117 | |||
| 1490 | Ga0495589_0001522 | |||
| 1491 | Ga0495660_0001411 | |||
| 1492 | Ga0495660_0005422 | |||
| 1493 | Ga0495660_0005755 | |||
| 1494 | Ga0495660_0029510 | |||
| 1495 | Ga0495660_0037420 | |||
| 1496 | Ga0495660_0072660 | |||
| 1497 | Ga0495636_0004214 | |||
| 1498 | Ga0495672_0000410 | |||
| 1499 | Ga0495672_0000423 | |||
| 1500 | Ga0495672_0018201 | |||
| 1501 | Ga0495672_0174514 | |||
| 1502 | Ga0495676_0151576 | |||
| 1503 | Ga0495680_0159771 | |||
| 1504 | Ga0495683_0006508 | |||
| 1505 | Ga0495683_0009385 | |||
| 1506 | Ga0495683_0066318 | |||
| 1507 | Ga0495687_000054 | |||
| 1508 | Ga0495687_000410 | |||
| 1509 | Ga0495687_001444 | |||
| 1510 | Ga0495687_002747 | |||
| 1511 | Ga0495687_066854 | |||
| 1512 | Ga0495677_0000012 | |||
| 1513 | Ga0495677_0000859 | |||
| 1514 | Ga0495677_0003598 | |||
| 1515 | Ga0495677_0036168 | |||
| 1516 | Ga0495679_052618 | |||
| 1517 | Ga0495685_005610 | |||
| 1518 | Ga0495685_063798 | |||
| 1519 | Ga0495673_0000150 | |||
| 1520 | Ga0495681_0009383 | |||
| 1521 | Ga0495681_0012911 | |||
| 1522 | Ga0495681_0136157 | |||
| 1523 | Ga0495686_0000219 | |||
| 1524 | Ga0495686_0002068 | |||
| 1525 | Ga0495686_0002299 | |||
| 1526 | Ga0495686_0010880 | |||
| 1527 | Ga0495686_0037529 | |||
| 1528 | Ga0495686_0166351 | |||
| 1529 | Ga0495593_0015123 | |||
| 1530 | Ga0495626_0000036 | |||
| 1531 | Ga0495626_0000940 | |||
| 1532 | Ga0495626_0156728 | |||
| 1533 | Ga0496103_0030455 | |||
| 1534 | Ga0496108_0276173 | |||
| 1535 | Ga0496109_0017381 | |||
| 1536 | Ga0496110_0011602 | |||
| 1537 | Ga0496110_0818425 | |||
| 1538 | Ga0496111_0528157 | |||
| 1539 | Ga0496113_0012625 | |||
| 1540 | Ga0496113_0066150 | |||
| 1541 | Ga0496113_0434897 | |||
| 1542 | Ga0496114_0027737 | |||
| 1543 | Ga0496116_0027600 | |||
| 1544 | Ga0496116_0031928 | |||
| 1545 | Ga0496121_0074129 | |||
| 1546 | Ga0496122_0000083 | |||
| 1547 | Ga0496122_0016147 | |||
| 1548 | Ga0496122_0020729 | |||
| 1549 | Ga0496122_0091872 | |||
| 1550 | Ga0496122_0099395 | |||
| 1551 | Ga0496122_0205589 | |||
| 1552 | Ga0496123_0000356 | |||
| 1553 | Ga0496123_0008423 | |||
| 1554 | Ga0496123_0045609 | |||
| 1555 | Ga0496123_0267527 | |||
| 1556 | Ga0496124_0009703 | |||
| 1557 | Ga0496124_0019323 | |||
| 1558 | Ga0496124_0022774 | |||
| 1559 | Ga0496124_0046979 | |||
| 1560 | Ga0496124_0175363 | |||
| 1561 | Ga0496124_0283189 | |||
| 1562 | Ga0496125_0009768 | |||
| 1563 | Ga0496125_0011420 | |||
| 1564 | Ga0496125_0020289 | |||
| 1565 | Ga0496125_0128747 | |||
| 1566 | Ga0496126_0016636 | |||
| 1567 | Ga0496126_0119777 | |||
| 1568 | Ga0496126_0119976 | |||
| 1569 | Ga0496126_0561053 | |||
| 1570 | Ga0495678_000076 | |||
| 1571 | Ga0495678_000780 | |||
| 1572 | Ga0495678_001241 | |||
| 1573 | Ga0495678_009738 | |||
| 1574 | Ga0495678_015957 | |||
| 1575 | Ga0495682_0042830 | |||
| 1576 | Ga0495682_0047290 | |||
| 1577 | Ga0501295_003868 | |||
| 1578 | Ga0501032_0030990 | |||
| 1579 | Ga0501033_0026581 | |||
| 1580 | Ga0501034_0036134 | |||
| 1581 | Ga0501034_0170966 | |||
| 1582 | Ga0501034_0204448 | |||
| 1583 | Ga0501036_0067039 | |||
| 1584 | Ga0501036_0220855 | |||
| 1585 | Ga0501037_0019833 | |||
| 1586 | Ga0501037_0040470 | |||
| 1587 | Ga0501038_0259465 | |||
| 1588 | Ga0501038_0487033 | |||
| 1589 | Ga0501043_0000112 | |||
| 1590 | Ga0501043_0052256 | |||
| 1591 | Ga0501043_0063364 | |||
| 1592 | Ga0501043_0409350 | |||
| 1593 | Ga0501043_0580821 | |||
| 1594 | Ga0501046_0000146 | |||
| 1595 | Ga0501046_0005311 | |||
| 1596 | Ga0501046_0080023 | |||
| 1597 | Ga0501046_0154907 | |||
| 1598 | Ga0501046_0261657 | |||
| 1599 | Ga0501047_0000192 | |||
| 1600 | Ga0501047_0015361 | |||
| 1601 | Ga0501047_0121379 | |||
| 1602 | Ga0501047_0335048 | |||
| 1603 | Ga0501048_0220145 | |||
| 1604 | Ga0501068_0100090 | |||
| 1605 | Ga0501072_0246343 | |||
| 1606 | Ga0501073_0008559 | |||
| 1607 | Ga0501074_0301275 | |||
| 1608 | Ga0501222_006895 | |||
| 1609 | Ga0501223_039896 | |||
| 1610 | Ga0501227_000801 | |||
| 1611 | Ga0501227_025235 | |||
| 1612 | Ga0501230_000883 | |||
| 1613 | Ga0501238_029578 | |||
| 1614 | Ga0501080_0000748 | |||
| 1615 | Ga0501080_0251991 | |||
| 1616 | Ga0501083_0123437 | |||
| 1617 | Ga0501269_000253 | |||
| 1618 | Ga0501279_011672 | |||
| 1619 | Ga0501035_0077228 | |||
| 1620 | Ga0501035_0176028 | |||
| 1621 | Ga0501035_0194553 | |||
| 1622 | Ga0501044_0006039 | |||
| 1623 | Ga0501044_0276567 | |||
| 1624 | Ga0501045_0027653 | |||
| 1625 | nmdc:mga03683_158940_c1 | |||
| 1626 | nmdc:mga03683_2428_c1 | |||
| 1627 | nmdc:mga0k408_134510_c1 | |||
| 1628 | nmdc:mga0k408_15821_c1 | |||
| 1629 | nmdc:mga0k408_78517_c1 | |||
| 1630 | nmdc:mga07m45_131019_c1 | |||
| 1631 | nmdc:mga07m45_205757_c1 | |||
| 1632 | nmdc:mga07m45_51108_c1 | |||
| 1633 | nmdc:mga07m45_6354_c1 | |||
| 1634 | nmdc:mga05p37_103_c1 | |||
| 1635 | nmdc:mga09592_9_c1 | |||
| 1636 | nmdc:mga06r32_2368_c2 | |||
| 1637 | nmdc:mga08y16_127494_c1 | |||
| 1638 | nmdc:mga08y16_798620_c1 | |||
| 1639 | nmdc:mga0n895_509021_c1 | |||
| 1640 | nmdc:mga0rr50_331_c1 | |||
| 1641 | nmdc:mga08x19_64439_c1 | |||
| 1642 | nmdc:mga0a205_68568_c1 | |||
| 1643 | Ga0500646_0001035 | |||
| 1644 | Ga0500583_0034343 | |||
| 1645 | Ga0500651_0055508 | |||
| 1646 | Ga0500651_0066333 | |||
| 1647 | Ga0500641_0192660 | |||
| 1648 | Ga0500617_070568 | |||
| 1649 | Ga0500618_001000 | |||
| 1650 | Ga0500658_0029991 | |||
| 1651 | Ga0500561_0006787 | |||
| 1652 | Ga0500577_0120146 | |||
| 1653 | Ga0500622_0006099 | |||
| 1654 | Ga0500627_0050687 | |||
| 1655 | Ga0500584_025872 | |||
| 1656 | Ga0501082_0005598 | |||
| 1657 | 2538833722 | |||
| 1658 | 2587725414 | |||
| 1659 | 2588289989 | |||
| 1660 | 2643800442 | |||
| 1661 | 2643829043 | |||
| 1662 | 2643882776 | |||
| 1663 | 2643896536 | |||
| 1664 | 2644058742 | |||
| 1665 | 2644070984 | |||
| 1666 | 2644255590 | |||
| 1667 | 2644302838 | |||
| 1668 | 2644353019 | |||
| 1669 | 2644470351 | |||
| 1670 | 2644478707 | |||
| 1671 | 2644549791 | |||
| 1672 | 2644550301 | |||
| 1673 | 2738825933 | |||
| 1674 | 2739149730 | |||
| 1675 | 2739191649 | |||
| 1676 | 2739245251 | |||
| 1677 | 2739285939 | |||
| 1678 | 2739291252 | |||
| 1679 | 2739318126 | |||
| 1680 | 2739336367 | |||
| 1681 | 2765570187 | |||
| 1682 | 2816471587 | |||
| 1683 | 2821135575 | |||
| 1684 | 2831866447 | |||
| 1685 | 2839096871 | |||
| 1686 | 2842714005 | |||
| 1687 | 2842807695 | |||
| 1688 | 2857555051 | |||
| 1689 | 2885084469 | |||
| 1690 | 2886848903 | |||
| 1691 | 2895396038 | |||
| 1692 | 2939613208 | |||
| 1693 | 2939636048 | |||
| 1694 | 3007256287 | |||
| 1695 | 3007319487 | |||
| 1696 | 8047678741 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hz4-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase b4xh91 (target efi-501787) from actinobacillus pleuropneumoniae | 0.8876 | 1 | 204 |
| 1v2a-assembly1.cif.gz_B | glutathione s-transferase 1-6 from anopheles dirus species b | 0.8552 | 3 | 199 |
| 8aib-assembly1.cif.gz_B | r11a variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione | 0.8471 | 1 | 197 |
| 3qav-assembly1.cif.gz_A | crystal structure of a glutathione s-transferase from antarctic clam laternula elliptica | 0.8452 | 2 | 196 |
| 8ai8-assembly1.cif.gz_B | crystal structure of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione | 0.8444 | 1 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9P6M1_1_80_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9016 | 1 | 80 | 3.40.30.10 |
| af_B6U5S1_5_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8919 | 1 | 84 | 3.40.30.10 |
| af_B6U5S1_5_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8815 | 1 | 84 | 3.40.30.10 |
| af_P77526_93_209_1.20.1050.130 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.8813 | 91 | 198 | 1.20.1050.130 |
| 4hz4A02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.8798 | 84 | 195 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519KNR3-F1-model_v4 | Glutathione S-transferase | 0.9549 | 1 | 166 |
GO:0016740
|
| AF-A0A519EWL6-F1-model_v4 | Glutathione S-transferase | 0.9521 | 29 | 206 |
GO:0016740
|
| AF-A0A1G4PCU8-F1-model_v4 | Glutathione S-transferase | 0.952 | 1 | 205 |
GO:0016740
|
| AF-A0A2M8ZT25-F1-model_v4 | deleted | 0.9519 | 1 | 204 |
|
| AF-A0A5S9INC3-F1-model_v4 | Glutathione S-transferase | 0.9504 | 1 | 202 |
GO:0016740
|