F483371

General Info

Members Datasets Scaffolds Average Seq Length
848 432 1696 223

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0096810|Ga0373937_0096810_1747_2556
Length 269
Sequence MSAPGGTWRRTARHPLAFPCDRFDWLSAAFVALRDATAGERGQNVRMITVHHLNDSRSQRVLWLLEELGLPYEIKHYQRDKATMLAPPELRAVHPLGKSPVITDGQTTVAESGAIIEYLIDREGGKLRPEAGTPEFLRYRYWLHFAEGSAMSPLLMKLVFDKVASAPMPFFVKPVARGISAQVLKSFVTPNLERQLDFMEAEMATRPWFAGSEFSAADIQMSFALEASAQRAGLNASRPKLMDWLQRIHARPAYRTALERGGPYSFAGD

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
117 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
196 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
202 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
203 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
243 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
244 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
245 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
246 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
247 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
248 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
249 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
250 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
261 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
262 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
279 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
295 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
318 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
321 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
359 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
360 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
361 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
362 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
366 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
382 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
385 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
386 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
388 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
389 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
392 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
395 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
396 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
397 2643221556 Massilia sp. Root1485 Isolate Unclassified
398 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
399 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
400 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
401 2643221609 Acidovorax sp. Root217 Isolate Unclassified
402 2643221611 Acidovorax sp. Root219 Isolate Unclassified
403 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
404 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
405 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
406 2643221684 Massilia sp. Root133 Isolate Unclassified
407 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
408 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
409 2738541297 Duganella sp. GV083 Isolate Unclassified
410 2738541357 Duganella sp. GV053 Isolate Unclassified
411 2738543003 Duganella sp. GV066 Isolate Unclassified
412 2738543012 Acidovorax sp. CF301 Isolate Unclassified
413 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
414 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
415 2738543026 Duganella sp. GV089 Isolate Unclassified
416 2738543029 Duganella sp. GV039 Isolate Unclassified
417 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
418 2816332133 Acidovorax radicis 2721A Isolate Unclassified
419 2821131069 Duganella sp. 1224 Isolate Unclassified
420 2831864461 Roseateles noduli HZ7 Isolate Nodule
421 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
422 2842711865 Duganella sp. R-73148 Isolate Unclassified
423 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
424 2857553236 Duganella sp. R-74557 Isolate Unclassified
425 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
426 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
427 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
428 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
429 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
430 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
431 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
432 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0.24
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.09
Nodule 0.94
Rhizoplane 1.3
Rhizosphere 73.58
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0096810 3300036401 Bacteria 2737
2 JGI24735J21928_10004421 3300002067 Bacteria 4727
3 JGI25162J39368_1001721 3300002737 Bacteria 10564
4 JGI25162J39368_1001834 3300002737 Bacteria 9911
5 JGI25154J39366_1000670 3300002738 Bacteria 15956
6 JGI25157J39369_1007623 3300002741 Bacteria 1553
7 JGI25164J39214_1000843 3300002772 Bacteria 10568
8 JGI25164J39214_1000904 3300002772 Bacteria 9909
9 JGI25152J39213_1000333 3300002773 Bacteria 29892
10 JGI25150J39212_1006368 3300002774 Bacteria 2441
11 JGI25159J45721_1003741 3300002987 Bacteria 5264
12 JGI25165J46597_1001628 3300003214 Bacteria 10568
13 JGI25165J46597_1002627 3300003214 Bacteria 5425
14 JGI25153J46596_10030568 3300003215 Bacteria 1830
15 rootH1_10036074 3300003316 Bacteria 1415
16 rootH2_10035007 3300003320 Bacteria 3030
17 rootL2_10002558 3300003322 Bacteria 49030
18 rootL2_10003205 3300003322 Bacteria 26879
19 rootL2_10028022 3300003322 Bacteria 2566
20 rootL2_10033379 3300003322 Bacteria 2245
21 rootH1_10004792 3300003323 Bacteria 22124
22 rootH1_10012636 3300003323 Bacteria 23130
23 rootH1_10078746 3300003323 Bacteria 3340
24 Ga0055525_1000081 3300003759 Bacteria 161329
25 Ga0055529_1000565 3300003763 Bacteria 30558
26 Ga0055526_1000230 3300003771 Bacteria 46917
27 Ga0055526_1000258 3300003771 Bacteria 44725
28 Ga0055526_1000442 3300003771 Bacteria 32968
29 Ga0055526_1002405 3300003771 Bacteria 12674
30 Ga0055526_1006039 3300003771 Bacteria 6714
31 Ga0055526_1010482 3300003771 Bacteria 4304
32 Ga0055537_1000128 3300003773 Bacteria 58218
33 Ga0055537_1002789 3300003773 Bacteria 5623
34 Ga0055524_1000026 3300003775 Bacteria 214653
35 Ga0055524_1000528 3300003775 Bacteria 29199
36 Ga0055524_1002759 3300003775 Bacteria 8831
37 Ga0055524_1020729 3300003775 Bacteria 2204
38 Ga0055534_1000120 3300003784 Bacteria 57897
39 Ga0055528_1000069 3300003790 Bacteria 83002
40 Ga0055530_10034349 3300003791 Bacteria 1296
41 Ga0055531_10000154 3300003794 Bacteria 79686
42 Ga0055531_10003023 3300003794 Bacteria 10915
43 Ga0055531_10022807 3300003794 Bacteria 2371
44 Ga0055543_1001084 3300004625 Bacteria 11891
45 Ga0055543_1003994 3300004625 Bacteria 4146
46 Ga0065165_1000067 3300005262 Bacteria 170811
47 Ga0065165_1000276 3300005262 Bacteria 87670
48 Ga0065165_1068932 3300005262 Bacteria 945
49 Ga0070658_10634896 3300005327 Bacteria 926
50 Ga0070676_10005140 3300005328 Bacteria 6944
51 Ga0070670_100001478 3300005331 Bacteria 18935
52 Ga0070670_100016429 3300005331 Bacteria 6355
53 Ga0070677_10007765 3300005333 Bacteria 3592
54 Ga0068869_100051042 3300005334 Bacteria 3000
55 Ga0068869_100479008 3300005334 Bacteria 1036
56 Ga0070666_10209107 3300005335 Bacteria 1374
57 Ga0070682_100001469 3300005337 Bacteria 13211
58 Ga0070682_100003106 3300005337 Bacteria 9203
59 Ga0070682_100027600 3300005337 Bacteria 3408
60 Ga0068868_100114348 3300005338 Bacteria 2196
61 Ga0068868_100124649 3300005338 Bacteria 2103
62 Ga0070660_100100606 3300005339 Bacteria 2290
63 Ga0070660_100122047 3300005339 Bacteria 2080
64 Ga0070661_100016629 3300005344 Bacteria 5203
65 Ga0070692_10035255 3300005345 Bacteria 2532
66 Ga0070692_10068906 3300005345 Bacteria 1881
67 Ga0070669_100025994 3300005353 Bacteria 4210
68 Ga0070675_100000072 3300005354 Bacteria 58324
69 Ga0070671_100093203 3300005355 Bacteria 2524
70 Ga0070671_100184736 3300005355 Bacteria 1766
71 Ga0070671_100340791 3300005355 Bacteria 1279
72 Ga0070674_100049783 3300005356 Bacteria 2882
73 Ga0070674_100182901 3300005356 Bacteria 1607
74 Ga0070673_100019834 3300005364 Bacteria 4835
75 Ga0070673_100180283 3300005364 Bacteria 1808
76 Ga0070673_100293374 3300005364 Bacteria 1430
77 Ga0070688_100151446 3300005365 Bacteria 1586
78 Ga0070659_100002090 3300005366 Bacteria 14229
79 Ga0070659_100008903 3300005366 Bacteria 7358
80 Ga0070667_100035426 3300005367 Bacteria 4181
81 Ga0070667_100082453 3300005367 Bacteria 2753
82 Ga0070714_100007085 3300005435 Bacteria 8695
83 Ga0070714_100047437 3300005435 Bacteria 3649
84 Ga0070710_10058042 3300005437 Bacteria 2195
85 Ga0070711_101038961 3300005439 Bacteria 704
86 Ga0070700_100236610 3300005441 Bacteria 1303
87 Ga0070694_100183425 3300005444 Bacteria 1549
88 Ga0070694_100251056 3300005444 Bacteria 1338
89 Ga0070663_100048646 3300005455 Bacteria 3007
90 Ga0070678_100098412 3300005456 Bacteria 2261
91 Ga0070678_100265257 3300005456 Bacteria 1446
92 Ga0070662_100067706 3300005457 Bacteria 2623
93 Ga0070681_10002635 3300005458 Bacteria 16468
94 Ga0068867_100323978 3300005459 Bacteria 1277
95 Ga0068867_100341982 3300005459 Bacteria 1246
96 Ga0070684_100163045 3300005535 Bacteria 2023
97 Ga0068853_100001001 3300005539 Bacteria 19927
98 Ga0068853_100046622 3300005539 Bacteria 3717
99 Ga0070672_100009439 3300005543 Bacteria 6724
100 Ga0070672_100010736 3300005543 Bacteria 6363
101 Ga0070672_100040865 3300005543 Bacteria 3561
102 Ga0070696_100116171 3300005546 Bacteria 1932
103 Ga0070693_100050195 3300005547 Bacteria 2383
104 Ga0070665_100013753 3300005548 Bacteria 8144
105 Ga0070665_100071893 3300005548 Bacteria 3466
106 Ga0070704_100002816 3300005549 Bacteria 9852
107 Ga0070704_100963861 3300005549 Bacteria 770
108 Ga0068855_100017967 3300005563 Bacteria 8498
109 Ga0068855_100046260 3300005563 Bacteria 5145
110 Ga0068855_100148866 3300005563 Bacteria 2662
111 Ga0068855_100249067 3300005563 Bacteria 1982
112 Ga0068855_100626652 3300005563 Bacteria 1157
113 Ga0070664_100209471 3300005564 Bacteria 1742
114 Ga0070664_100318999 3300005564 Bacteria 1407
115 Ga0068857_100093646 3300005577 Bacteria 2690
116 Ga0068854_100141076 3300005578 Bacteria 1849
117 Ga0068856_100000088 3300005614 Bacteria 85931
118 Ga0068856_100005127 3300005614 Bacteria 12935
119 Ga0068856_100056334 3300005614 Bacteria 3879
120 Ga0068856_100142457 3300005614 Bacteria 2404
121 Ga0068852_100076538 3300005616 Bacteria 2955
122 Ga0068859_100005367 3300005617 Bacteria 13042
123 Ga0068859_100017147 3300005617 Bacteria 7273
124 Ga0068859_100037413 3300005617 Bacteria 4870
125 Ga0068859_100436241 3300005617 Bacteria 1406
126 Ga0068864_100015249 3300005618 Bacteria 6391
127 Ga0068864_100147585 3300005618 Bacteria 2127
128 Ga0068864_100172136 3300005618 Bacteria 1975
129 Ga0068866_10238336 3300005718 Bacteria 1106
130 Ga0068866_10275532 3300005718 Bacteria 1040
131 Ga0068870_10143865 3300005840 Bacteria 1398
132 Ga0068863_100057083 3300005841 Bacteria 3695
133 Ga0068863_100545074 3300005841 Bacteria 1145
134 Ga0068858_100007339 3300005842 Bacteria 10667
135 Ga0068860_100018631 3300005843 Bacteria 6750
136 Ga0068860_100095772 3300005843 Bacteria 2829
137 Ga0075366_10004937 3300006195 Bacteria 7194
138 Ga0075366_10028699 3300006195 Bacteria 3267
139 Ga0075366_10053845 3300006195 Bacteria 2391
140 Ga0097621_100137407 3300006237 Bacteria 2086
141 Ga0075370_10017358 3300006353 Bacteria 3888
142 Ga0075370_10017940 3300006353 Bacteria 3831
143 Ga0075370_10069391 3300006353 Bacteria 2014
144 Ga0068871_100008131 3300006358 Bacteria 7530
145 Ga0068871_100263298 3300006358 Bacteria 1504
146 Ga0075431_100000781 3300006847 Bacteria 27706
147 Ga0075433_10301891 3300006852 Bacteria 1418
148 Ga0075434_100000002 3300006871 Bacteria 135661
149 Ga0075429_100000009 3300006880 Bacteria 85110
150 Ga0068865_100566626 3300006881 Bacteria 956
151 Ga0075436_100067212 3300006914 Bacteria 2478
152 Ga0097620_100005367 3300006931 Bacteria 13042
153 Ga0097620_100017146 3300006931 Bacteria 7273
154 Ga0097620_100037413 3300006931 Bacteria 4870
155 Ga0097620_100436250 3300006931 Bacteria 1406
156 Ga0099823_1000213 3300006944 Bacteria 32548
157 Ga0079104_1000001 3300006946 Bacteria 521847
158 Ga0099826_10000003 3300006948 Bacteria 1067817
159 Ga0075435_100002074 3300007076 Bacteria 13145
160 Ga0075435_100052352 3300007076 Bacteria 3291
161 Ga0105244_10002049 3300009036 Bacteria 15522
162 Ga0105244_10080443 3300009036 Bacteria 1614
163 Ga0105244_10113502 3300009036 Bacteria 1316
164 Ga0105240_10011045 3300009093 Bacteria 12628
165 Ga0114129_10039159 3300009147 Bacteria 6684
166 Ga0105243_10481077 3300009148 Bacteria 1172
167 Ga0105243_11075959 3300009148 Bacteria 811
168 Ga0105248_10036982 3300009177 Bacteria 5459
169 Ga0105248_10086635 3300009177 Bacteria 3524
170 Ga0105248_10370608 3300009177 Bacteria 1612
171 Ga0105237_10000147 3300009545 Bacteria 99597
172 Ga0105238_10003207 3300009551 Bacteria 16332
173 Ga0105238_10066617 3300009551 Bacteria 3602
174 Ga0105238_10395691 3300009551 Bacteria 1374
175 Ga0105238_10722614 3300009551 Bacteria 1009
176 Ga0105249_10013764 3300009553 Bacteria 7145
177 Ga0157319_1000023 3300012497 Bacteria 74829
178 Ga0157373_10001548 3300013100 Bacteria 17559
179 Ga0157373_10407845 3300013100 Bacteria 974
180 Ga0157371_10010197 3300013102 Bacteria 7339
181 Ga0157371_10086459 3300013102 Bacteria 2221
182 Ga0157371_10370660 3300013102 Bacteria 1044
183 Ga0157370_10000264 3300013104 Bacteria 66688
184 Ga0157370_10005082 3300013104 Bacteria 14840
185 Ga0157370_10026839 3300013104 Bacteria 5681
186 Ga0157370_10047067 3300013104 Bacteria 4135
187 Ga0157370_10112844 3300013104 Bacteria 2540
188 Ga0157370_10249704 3300013104 Bacteria 1641
189 Ga0157369_10143402 3300013105 Bacteria 2526
190 Ga0157369_10230275 3300013105 Bacteria 1937
191 Ga0157369_10561575 3300013105 Bacteria 1179
192 Ga0157369_11275860 3300013105 Bacteria 749
193 Ga0157374_10555533 3300013296 Bacteria 1156
194 Ga0157378_10000033 3300013297 Bacteria 120764
195 Ga0157378_10248252 3300013297 Bacteria 1703
196 Ga0157372_10030731 3300013307 Bacteria 5877
197 Ga0157372_10155933 3300013307 Bacteria 2637
198 Ga0157372_10180132 3300013307 Bacteria 2446
199 Ga0157372_10193061 3300013307 Bacteria 2358
200 Ga0157372_11073813 3300013307 Bacteria 932
201 Ga0157375_10018510 3300013308 Bacteria 6319
202 Ga0157375_10018656 3300013308 Bacteria 6296
203 Ga0157375_10024111 3300013308 Bacteria 5626
204 Ga0157375_10277881 3300013308 Bacteria 1838
205 Ga0157375_10523789 3300013308 Bacteria 1348
206 Ga0163163_10421254 3300014325 Bacteria 1394
207 Ga0157380_10042412 3300014326 Bacteria 3557
208 Ga0157380_10126963 3300014326 Bacteria 2169
209 Ga0182008_10058280 3300014497 Bacteria 1907
210 Ga0182008_10068675 3300014497 Bacteria 1744
211 Ga0182008_10110002 3300014497 Bacteria 1365
212 Ga0157379_10024447 3300014968 Bacteria 5363
213 Ga0157379_10238113 3300014968 Bacteria 1650
214 Ga0157379_10384982 3300014968 Bacteria 1287
215 Ga0157376_10004616 3300014969 Bacteria 9595
216 Ga0157376_10041150 3300014969 Bacteria 3782
217 Ga0157376_10124832 3300014969 Bacteria 2287
218 Ga0182006_1000070 3300015261 Bacteria 137793
219 Ga0182006_1006020 3300015261 Bacteria 5681
220 Ga0182006_1028006 3300015261 Bacteria 2295
221 Ga0182007_10061903 3300015262 Bacteria 1227
222 Ga0182007_10093832 3300015262 Bacteria 990
223 Ga0182005_1000003 3300015265 Bacteria 683269
224 Ga0183369_1004 3300015685 Bacteria 539301
225 Ga0183361_13646 3300016635 Bacteria 841
226 Ga0163161_10018024 3300017792 Bacteria 4949
227 Ga0206356_11593915 3300020070 Bacteria 2864
228 Ga0206353_10169809 3300020082 Bacteria 2833
229 Ga0213872_10000252 3300021361 Bacteria 46619
230 Ga0213872_10004097 3300021361 Bacteria 7842
231 Ga0213872_10007564 3300021361 Bacteria 5336
232 Ga0213872_10019215 3300021361 Bacteria 3147
233 Ga0213872_10030430 3300021361 Bacteria 2474
234 Ga0213874_10036041 3300021377 Bacteria 1456
235 Ga0209436_108716 3300025208 Bacteria 1993
236 Ga0209674_102244 3300025226 Bacteria 4277
237 Ga0209563_100015 3300025230 Bacteria 879901
238 Ga0207427_100068 3300025231 Bacteria 164460
239 Ga0207427_100143 3300025231 Bacteria 82800
240 Ga0209437_100005 3300025233 Bacteria 1071596
241 Ga0209437_100255 3300025233 Bacteria 82963
242 Ga0207425_1000377 3300025245 Bacteria 30541
243 Ga0207425_1000417 3300025245 Bacteria 28632
244 Ga0209646_1000114 3300025246 Bacteria 152958
245 Ga0209646_1004778 3300025246 Bacteria 2435
246 Ga0209026_1013458 3300025250 Bacteria 1393
247 Ga0209677_101945 3300025253 Bacteria 8248
248 Ga0209148_1000413 3300025254 Bacteria 48939
249 Ga0209129_1000062 3300025258 Bacteria 240655
250 Ga0209233_1000011 3300025261 Bacteria 1071611
251 Ga0209233_1000172 3300025261 Bacteria 146504
252 Ga0209233_1008135 3300025261 Bacteria 3274
253 Ga0209565_1000006 3300025263 Bacteria 897294
254 Ga0209565_1004370 3300025263 Bacteria 4311
255 Ga0209455_1000063 3300025272 Bacteria 333019
256 Ga0209455_1000267 3300025272 Bacteria 58711
257 Ga0209673_1000004 3300025273 Bacteria 896155
258 Ga0209673_1003916 3300025273 Bacteria 8353
259 Ga0209673_1005396 3300025273 Bacteria 6443
260 Ga0209673_1008906 3300025273 Bacteria 4414
261 Ga0209673_1034950 3300025273 Bacteria 1511
262 Ga0209130_1000223 3300025284 Bacteria 74374
263 Ga0209675_1000224 3300025291 Bacteria 57961
264 Ga0209675_1010149 3300025291 Bacteria 3245
265 Ga0209025_1002210 3300025294 Bacteria 21466
266 Ga0209564_1000003 3300025295 Bacteria 1585848
267 Ga0209564_1000006 3300025295 Bacteria 1100927
268 Ga0209564_1000014 3300025295 Bacteria 621501
269 Ga0209564_1000026 3300025295 Bacteria 519154
270 Ga0209564_1000102 3300025295 Bacteria 222597
271 Ga0209758_1000129 3300025297 Bacteria 185022
272 Ga0209758_1000372 3300025297 Bacteria 78825
273 Ga0209050_1000118 3300025298 Bacteria 202586
274 Ga0209050_1005818 3300025298 Bacteria 7564
275 Ga0209050_1014918 3300025298 Bacteria 3305
276 Ga0209256_1000013 3300025299 Bacteria 689442
277 Ga0209256_1000015 3300025299 Bacteria 622953
278 Ga0209256_1000495 3300025299 Bacteria 57952
279 Ga0209256_1000692 3300025299 Bacteria 44918
280 Ga0209051_1001168 3300025303 Bacteria 23858
281 Ga0209051_1030031 3300025303 Bacteria 2116
282 Ga0209257_1000117 3300025304 Bacteria 227328
283 Ga0209257_1001528 3300025304 Bacteria 26973
284 Ga0209257_1001538 3300025304 Bacteria 26872
285 Ga0209257_1020069 3300025304 Bacteria 2487
286 Ga0207697_10043402 3300025315 Bacteria 1849
287 Ga0207656_10038281 3300025321 Bacteria 2023
288 Ga0207656_10113164 3300025321 Bacteria 1256
289 Ga0207655_1003166 3300025728 Bacteria 12424
290 Ga0207713_1000124 3300025735 Bacteria 122014
291 Ga0207682_10009795 3300025893 Bacteria 3773
292 Ga0207688_10240524 3300025901 Bacteria 1095
293 Ga0207688_10325516 3300025901 Bacteria 944
294 Ga0207680_10291248 3300025903 Bacteria 1136
295 Ga0207647_10022066 3300025904 Bacteria 4235
296 Ga0207647_10041071 3300025904 Bacteria 2910
297 Ga0207645_10040703 3300025907 Bacteria 2976
298 Ga0207645_10218636 3300025907 Bacteria 1255
299 Ga0207643_10012674 3300025908 Bacteria 4555
300 Ga0207643_10022318 3300025908 Bacteria 3483
301 Ga0207705_10492104 3300025909 Bacteria 952
302 Ga0207707_10002503 3300025912 Bacteria 16541
303 Ga0207695_10004771 3300025913 Bacteria 18334
304 Ga0207695_10094068 3300025913 Bacteria 3005
305 Ga0207695_10793370 3300025913 Bacteria 827
306 Ga0207671_10000444 3300025914 Bacteria 57054
307 Ga0207693_10720308 3300025915 Bacteria 772
308 Ga0207660_10193810 3300025917 Bacteria 1584
309 Ga0207660_10737365 3300025917 Bacteria 804
310 Ga0207662_10064683 3300025918 Bacteria 2201
311 Ga0207657_10017943 3300025919 Bacteria 6771
312 Ga0207649_10241217 3300025920 Bacteria 1297
313 Ga0207681_10023866 3300025923 Bacteria 3917
314 Ga0207694_10121432 3300025924 Bacteria 2086
315 Ga0207650_10000947 3300025925 Bacteria 21819
316 Ga0207650_10028326 3300025925 Bacteria 4015
317 Ga0207659_10030033 3300025926 Bacteria 3709
318 Ga0207664_10000304 3300025929 Bacteria 36524
319 Ga0207664_10014781 3300025929 Bacteria 5650
320 Ga0207644_10008831 3300025931 Bacteria 6598
321 Ga0207644_10019133 3300025931 Bacteria 4643
322 Ga0207690_10000635 3300025932 Bacteria 22536
323 Ga0207690_10332993 3300025932 Bacteria 1196
324 Ga0207706_10003077 3300025933 Bacteria 16029
325 Ga0207706_10115347 3300025933 Bacteria 2362
326 Ga0207670_10465081 3300025936 Bacteria 1022
327 Ga0207669_10018495 3300025937 Bacteria 3604
328 Ga0207669_10037038 3300025937 Bacteria 2794
329 Ga0207669_10275096 3300025937 Bacteria 1267
330 Ga0207704_10059001 3300025938 Bacteria 2366
331 Ga0207704_10482629 3300025938 Bacteria 995
332 Ga0207691_10044273 3300025940 Bacteria 4098
333 Ga0207691_10599609 3300025940 Bacteria 932
334 Ga0207711_10019344 3300025941 Bacteria 5670
335 Ga0207711_10055565 3300025941 Bacteria 3399
336 Ga0207689_10124160 3300025942 Bacteria 2124
337 Ga0207679_10074470 3300025945 Bacteria 2573
338 Ga0207679_10173370 3300025945 Bacteria 1778
339 Ga0207667_10008182 3300025949 Bacteria 12442
340 Ga0207667_10012870 3300025949 Bacteria 9612
341 Ga0207667_10036374 3300025949 Bacteria 5277
342 Ga0207667_10062370 3300025949 Bacteria 3898
343 Ga0207667_10247540 3300025949 Bacteria 1824
344 Ga0207667_10320002 3300025949 Bacteria 1584
345 Ga0207651_10011963 3300025960 Bacteria 4883
346 Ga0207651_10040569 3300025960 Bacteria 3081
347 Ga0207712_10226793 3300025961 Bacteria 1497
348 Ga0207658_10007237 3300025986 Bacteria 7567
349 Ga0207658_10019536 3300025986 Bacteria 4686
350 Ga0207677_10091223 3300026023 Bacteria 2216
351 Ga0207677_10149692 3300026023 Bacteria 1799
352 Ga0207677_10270493 3300026023 Bacteria 1390
353 Ga0207703_10003934 3300026035 Bacteria 12326
354 Ga0207639_10004454 3300026041 Bacteria 9452
355 Ga0207639_10015334 3300026041 Bacteria 5405
356 Ga0207639_10182723 3300026041 Bacteria 1785
357 Ga0207639_10561474 3300026041 Bacteria 1049
358 Ga0207678_10005945 3300026067 Bacteria 10866
359 Ga0207678_10358281 3300026067 Bacteria 1259
360 Ga0207678_10628500 3300026067 Bacteria 942
361 Ga0207702_10000969 3300026078 Bacteria 29407
362 Ga0207702_10134423 3300026078 Bacteria 2229
363 Ga0207641_10073299 3300026088 Bacteria 2950
364 Ga0207641_10108531 3300026088 Bacteria 2457
365 Ga0207648_10026012 3300026089 Bacteria 5204
366 Ga0207648_10059863 3300026089 Bacteria 3321
367 Ga0207648_10303461 3300026089 Bacteria 1432
368 Ga0207648_10371027 3300026089 Bacteria 1293
369 Ga0207648_10408466 3300026089 Bacteria 1231
370 Ga0207648_10510719 3300026089 Bacteria 1100
371 Ga0207674_10010203 3300026116 Bacteria 10668
372 Ga0207683_10043196 3300026121 Bacteria 3939
373 Ga0207683_10056241 3300026121 Bacteria 3450
374 Ga0207698_10059284 3300026142 Bacteria 2971
375 Ga0207698_10335283 3300026142 Bacteria 1422
376 Ga0207698_10437086 3300026142 Bacteria 1260
377 Ga0207698_10755346 3300026142 Bacteria 972
378 Ga0209281_1000537 3300027111 Bacteria 47794
379 Ga0209281_1002628 3300027111 Bacteria 6895
380 Ga0209371_1000354 3300027312 Bacteria 49531
381 Ga0209371_1019741 3300027312 Bacteria 1675
382 Ga0209282_1000002 3300027666 Bacteria 1067825
383 Ga0268266_10055996 3300028379 Bacteria 3391
384 Ga0268266_10572636 3300028379 Bacteria 1083
385 Ga0307515_10000006 3300028794 Bacteria 725810
386 Ga0307515_10038987 3300028794 Bacteria 7575
387 Ga0307515_10091447 3300028794 Bacteria 3802
388 Ga0307515_10099185 3300028794 Bacteria 3539
389 Ga0307515_10265279 3300028794 Bacteria 1447
390 Ga0268256_1000456 3300030500 Bacteria 36006
391 Ga0268256_1022108 3300030500 Bacteria 1675
392 Ga0307512_10168398 3300030522 Bacteria 1263
393 Ga0316177_1018288 3300030731 Bacteria 2104
394 Ga0316181_1288529 3300030744 Bacteria 1727
395 Ga0265330_10000045 3300031235 Bacteria 109977
396 Ga0265332_10000031 3300031238 Bacteria 162330
397 Ga0265332_10127467 3300031238 Bacteria 1068
398 Ga0265320_10160127 3300031240 Bacteria 1013
399 Ga0265325_10007282 3300031241 Bacteria 6643
400 Ga0265340_10011412 3300031247 Bacteria 4720
401 Ga0307513_10000129 3300031456 Bacteria 106759
402 Ga0307513_10004878 3300031456 Bacteria 17804
403 Ga0307513_10265747 3300031456 Bacteria 1502
404 Ga0307509_10007193 3300031507 Bacteria 14652
405 Ga0307509_10305316 3300031507 Bacteria 1337
406 Ga0307509_10342293 3300031507 Bacteria 1222
407 Ga0307509_10353357 3300031507 Bacteria 1192
408 Ga0307408_100107184 3300031548 Bacteria 2139
409 Ga0307508_10001047 3300031616 Bacteria 32004
410 Ga0265314_10000095 3300031711 Bacteria 134372
411 Ga0265314_10014237 3300031711 Bacteria 6377
412 Ga0265314_10204217 3300031711 Bacteria 1165
413 Ga0307516_10000058 3300031730 Bacteria 121424
414 Ga0307516_10005218 3300031730 Bacteria 15647
415 Ga0307410_10319187 3300031852 Bacteria 1232
416 Ga0307412_10387866 3300031911 Bacteria 1133
417 Ga0307409_100598857 3300031995 Bacteria 1089
418 Ga0307416_100037238 3300032002 Bacteria 3741
419 Ga0307414_10017280 3300032004 Bacteria 4410
420 Ga0307414_10044761 3300032004 Bacteria 3026
421 Ga0307414_10922041 3300032004 Bacteria 801
422 Ga0307411_10000118 3300032005 Bacteria 24745
423 Ga0307411_10454819 3300032005 Bacteria 1072
424 Ga0307510_10083804 3300033180 Bacteria 3074
425 Ga0373949_0067717 3300035090 Bacteria 930
426 Ga0373952_0060254 3300035092 Bacteria 926
427 Ga0373953_0025873 3300035117 Bacteria 2245
428 Ga0373954_0000008 3300035118 Bacteria 79963
429 Ga0373956_0035097 3300035119 Bacteria 2211
430 Ga0316574_0023388 3300035398 Bacteria 3689
431 Ga0373924_0020707 3300035410 Bacteria 2559
432 Ga0373931_0003625 3300035691 Bacteria 6975
433 Ga0373933_0002915 3300035724 Bacteria 9553
434 Ga0373933_0042458 3300035724 Bacteria 2688
435 Ga0373937_0000418 3300036401 Bacteria 39714
436 Ga0373937_0005397 3300036401 Bacteria 10937
437 Ga0373937_0263051 3300036401 Bacteria 1627
438 Ga0316582_0059583 3300036647 Bacteria 2445
439 Ga0316584_0374206 3300036712 Bacteria 1019
440 Ga0373925_0010207 3300037068 Bacteria 6817
441 Ga0395899_0026523 3300037312 Bacteria 4372
442 Ga0395899_0145193 3300037312 Bacteria 1685
443 Ga0395900_0002543 3300037418 Bacteria 19971
444 Ga0395900_0016606 3300037418 Bacteria 7507
445 Ga0395900_0146826 3300037418 Bacteria 2411
446 Ga0395900_0254146 3300037418 Bacteria 1757
447 Ga0395900_0316444 3300037418 Bacteria 1542
448 Ga0395898_0031337 3300037466 Bacteria 5314
449 Ga0395898_0318961 3300037466 Bacteria 1482
450 Ga0395905_0001119 3300037471 Bacteria 33615
451 Ga0395905_0113009 3300037471 Bacteria 2551
452 Ga0395905_0348412 3300037471 Bacteria 1373
453 Ga0395905_0705607 3300037471 Bacteria 911
454 Ga0395901_0003072 3300038443 Bacteria 16814
455 Ga0400483_231697 3300039062 Unclassified 1102
456 Ga0436361_0046720 3300039447 Bacteria 3436
457 Ga0436361_0110138 3300039447 Bacteria 798
458 Ga0436361_0143359 3300039447 Bacteria 4239
459 Ga0436361_0480035 3300039447 Bacteria 16007
460 Ga0436361_0621348 3300039447 Bacteria 2420
461 Ga0436361_0704499 3300039447 Bacteria 2331
462 Ga0436361_0712205 3300039447 Bacteria 2312
463 Ga0436363_0050228 3300039450 Bacteria 2785
464 Ga0451791_0735107 3300041451 Bacteria 794
465 Ga0451839_0483013 3300041496 Bacteria 1037
466 Ga0439452_111879 3300042010 Bacteria 583
467 Ga0439455_0029293 3300042012 Bacteria 1360
468 Ga0450890_003158 3300042127 Bacteria 2205
469 Ga0450896_014994 3300042133 Bacteria 1108
470 Ga0450910_010661 3300042147 Bacteria 1312
471 Ga0439458_0015559 3300042157 Bacteria 1725
472 Ga0439459_0000200 3300042438 Bacteria 6650
473 Ga0439464_0012200 3300042439 Bacteria 2285
474 Ga0450893_0010007 3300042532 Bacteria 1554
475 Ga0451577_0005639 3300042876 Bacteria 12718
476 Ga0451577_0023898 3300042876 Bacteria 5568
477 Ga0451577_0249607 3300042876 Bacteria 1606
478 Ga0451577_0352660 3300042876 Bacteria 1335
479 Ga0466969_0017796 3300044656 Bacteria 3707
480 Ga0466969_0035292 3300044656 Bacteria 2529
481 Ga0466969_0091850 3300044656 Bacteria 1438
482 Ga0466969_0134684 3300044656 Bacteria 1144
483 Ga0466972_0005121 3300044658 Bacteria 6564
484 Ga0466965_0154252 3300044683 Bacteria 1201
485 Ga0466966_0004520 3300044684 Bacteria 9176
486 Ga0466966_0039415 3300044684 Bacteria 3042
487 Ga0466966_0080004 3300044684 Bacteria 2036
488 Ga0466966_0175957 3300044684 Bacteria 1299
489 Ga0466961_0179108 3300044693 Bacteria 1316
490 Ga0466963_0159812 3300044694 Bacteria 1568
491 Ga0466971_0086184 3300044719 Bacteria 1435
492 Ga0466968_0003741 3300044735 Bacteria 5640
493 Ga0466970_0059449 3300044765 Bacteria 2047
494 Ga0466970_0114750 3300044765 Bacteria 1472
495 Ga0466957_0008881 3300044842 Bacteria 5725
496 Ga0466957_0021671 3300044842 Bacteria 3787
497 Ga0466957_0267571 3300044842 Bacteria 1140
498 Ga0466959_0005781 3300045049 Bacteria 8518
499 Ga0466959_0021417 3300045049 Bacteria 4767
500 Ga0466959_0209658 3300045049 Bacteria 1354
501 Ga0451576_0166000 3300045051 Bacteria 2304
502 Ga0451576_0426006 3300045051 Bacteria 1392
503 Ga0451576_0604757 3300045051 Bacteria 1152
504 Ga0466958_0025649 3300045836 Bacteria 3477
505 Ga0466958_0036091 3300045836 Bacteria 2957
506 Ga0466967_0017711 3300045976 Bacteria 5667
507 Ga0495617_000048 3300046452 Bacteria 113357
508 Ga0495627_000046 3300046453 Bacteria 176186
509 Ga0495590_0000030 3300046457 Bacteria 146237
510 Ga0495590_0003180 3300046457 Bacteria 6715
511 Ga0495590_0010511 3300046457 Bacteria 3478
512 Ga0495590_0032233 3300046457 Bacteria 1832
513 Ga0495590_0036580 3300046457 Bacteria 1712
514 Ga0495638_0000105 3300046460 Bacteria 134384
515 Ga0495638_0058485 3300046460 Bacteria 2388
516 Ga0495638_0070592 3300046460 Bacteria 2138
517 Ga0495653_0000018 3300046463 Bacteria 185787
518 Ga0495650_0000024 3300046471 Bacteria 496674
519 Ga0495650_0000099 3300046471 Bacteria 215347
520 Ga0495650_0000173 3300046471 Bacteria 142734
521 Ga0495650_0000212 3300046471 Bacteria 124622
522 Ga0495650_0000227 3300046471 Bacteria 114662
523 Ga0495650_0000712 3300046471 Bacteria 42514
524 Ga0495650_0005060 3300046471 Bacteria 8727
525 Ga0495650_0010147 3300046471 Bacteria 5281
526 Ga0495605_0000005 3300046474 Bacteria 376973
527 Ga0495605_0000369 3300046474 Bacteria 42654
528 Ga0495605_0015267 3300046474 Bacteria 4182
529 Ga0495584_0001010 3300046491 Bacteria 17589
530 Ga0495584_0003947 3300046491 Bacteria 8014
531 Ga0495584_0015004 3300046491 Bacteria 3948
532 Ga0495585_0009467 3300046492 Bacteria 5842
533 Ga0495585_0105031 3300046492 Bacteria 1507
534 Ga0495594_0015942 3300046499 Bacteria 3954
535 Ga0495607_0002843 3300046501 Bacteria 13728
536 Ga0495607_0003287 3300046501 Bacteria 12419
537 Ga0495607_0006164 3300046501 Bacteria 8477
538 Ga0495607_0010691 3300046501 Bacteria 6151
539 Ga0495607_0018115 3300046501 Bacteria 4498
540 Ga0495607_0145112 3300046501 Bacteria 1220
541 Ga0495583_0006407 3300046506 Bacteria 7702
542 Ga0495606_0000204 3300046507 Bacteria 103880
543 Ga0495606_0002863 3300046507 Bacteria 19091
544 Ga0495606_0002941 3300046507 Bacteria 18816
545 Ga0495606_0006368 3300046507 Bacteria 10911
546 Ga0495606_0029567 3300046507 Bacteria 3843
547 Ga0495606_0053631 3300046507 Bacteria 2615
548 Ga0495606_0209996 3300046507 Bacteria 1103
549 Ga0495610_0000021 3300046512 Bacteria 336300
550 Ga0495610_0001557 3300046512 Bacteria 20196
551 Ga0495610_0004255 3300046512 Bacteria 10653
552 Ga0495610_0025294 3300046512 Bacteria 3188
553 Ga0495610_0027618 3300046512 Bacteria 3013
554 Ga0495616_0007249 3300046513 Bacteria 6639
555 Ga0495616_0012205 3300046513 Bacteria 4887
556 Ga0495616_0013958 3300046513 Bacteria 4513
557 Ga0495620_0041900 3300046515 Bacteria 2004
558 Ga0495630_0077734 3300046517 Bacteria 2502
559 Ga0495630_0584065 3300046517 Bacteria 857
560 Ga0495630_0724477 3300046517 Bacteria 761
561 Ga0495632_0003710 3300046519 Bacteria 10704
562 Ga0495637_0200457 3300046520 Bacteria 733
563 Ga0495643_0000181 3300046522 Bacteria 100368
564 Ga0495643_0000460 3300046522 Bacteria 51847
565 Ga0495643_0000770 3300046522 Bacteria 35800
566 Ga0495643_0001670 3300046522 Bacteria 19438
567 Ga0495643_0011341 3300046522 Bacteria 5432
568 Ga0495643_0019107 3300046522 Bacteria 3968
569 Ga0495643_0046669 3300046522 Bacteria 2347
570 Ga0495644_0006659 3300046523 Bacteria 4474
571 Ga0495644_0182287 3300046523 Bacteria 807
572 Ga0495648_0000008 3300046524 Bacteria 336584
573 Ga0495648_0007580 3300046524 Bacteria 8669
574 Ga0495648_0008182 3300046524 Bacteria 8253
575 Ga0495648_0023986 3300046524 Bacteria 4165
576 Ga0495648_0027411 3300046524 Bacteria 3813
577 Ga0495663_0002864 3300046525 Bacteria 5100
578 Ga0495666_0084158 3300046526 Bacteria 1503
579 Ga0495642_0000298 3300046528 Bacteria 27999
580 Ga0495642_0011021 3300046528 Bacteria 3467
581 Ga0495642_0045332 3300046528 Bacteria 1797
582 Ga0495642_0175103 3300046528 Bacteria 933
583 Ga0495654_0021794 3300046530 Bacteria 3332
584 Ga0495654_0069960 3300046530 Bacteria 1665
585 Ga0495598_0000562 3300046537 Bacteria 6973
586 Ga0495609_0000028 3300046538 Bacteria 219908
587 Ga0495609_0001266 3300046538 Bacteria 17276
588 Ga0495609_0007541 3300046538 Bacteria 5412
589 Ga0495609_0019216 3300046538 Bacteria 3163
590 Ga0495609_0141565 3300046538 Bacteria 1026
591 Ga0495597_0002738 3300046542 Bacteria 10872
592 Ga0495597_0006184 3300046542 Bacteria 6218
593 Ga0495597_0008660 3300046542 Bacteria 5086
594 Ga0495597_0012227 3300046542 Bacteria 4147
595 Ga0495645_0305939 3300046543 Bacteria 1037
596 Ga0495622_0000560 3300046557 Bacteria 22348
597 Ga0495622_0012508 3300046557 Bacteria 3930
598 Ga0495622_0036767 3300046557 Bacteria 2282
599 Ga0495633_0000409 3300046558 Bacteria 44723
600 Ga0495633_0000810 3300046558 Bacteria 27687
601 Ga0495633_0002477 3300046558 Bacteria 13017
602 Ga0495633_0032619 3300046558 Bacteria 2515
603 Ga0495633_0032907 3300046558 Bacteria 2502
604 Ga0495633_0163771 3300046558 Bacteria 1026
605 Ga0495656_0149887 3300046615 Bacteria 1126
606 Ga0495668_0000008 3300046616 Bacteria 498364
607 Ga0495668_0001106 3300046616 Bacteria 27873
608 Ga0495668_0002762 3300046616 Bacteria 14038
609 Ga0495668_0002817 3300046616 Bacteria 13834
610 Ga0495668_0004418 3300046616 Bacteria 9992
611 Ga0495668_0004836 3300046616 Bacteria 9371
612 Ga0495668_0042149 3300046616 Bacteria 2542
613 Ga0495625_0000278 3300046660 Bacteria 79607
614 Ga0495625_0001449 3300046660 Bacteria 28796
615 Ga0495625_0046422 3300046660 Bacteria 3135
616 Ga0495625_0122748 3300046660 Bacteria 1766
617 Ga0495625_0132826 3300046660 Bacteria 1685
618 Ga0495625_0227388 3300046660 Bacteria 1220
619 Ga0495659_0001151 3300046664 Bacteria 9180
620 Ga0495661_0000157 3300046665 Bacteria 80637
621 Ga0495661_0000710 3300046665 Bacteria 32881
622 Ga0495661_0023731 3300046665 Bacteria 3976
623 Ga0495661_0036356 3300046665 Bacteria 3085
624 Ga0495661_0037025 3300046665 Bacteria 3048
625 Ga0495661_0043493 3300046665 Bacteria 2760
626 Ga0495588_0000113 3300046674 Bacteria 137279
627 Ga0495599_0078529 3300046678 Bacteria 2061
628 Ga0495623_0279686 3300046679 Bacteria 929
629 Ga0495669_0030634 3300046684 Bacteria 2361
630 Ga0495671_0000343 3300046692 Bacteria 38705
631 Ga0495671_0000442 3300046692 Bacteria 32850
632 Ga0495671_0050325 3300046692 Bacteria 2074
633 Ga0495671_0360082 3300046692 Bacteria 697
634 Ga0495649_0000725 3300046694 Bacteria 26788
635 Ga0495649_0026199 3300046694 Bacteria 3245
636 Ga0495649_0077498 3300046694 Bacteria 1779
637 Ga0495649_0108955 3300046694 Bacteria 1469
638 Ga0495649_0177676 3300046694 Bacteria 1111
639 Ga0495649_0177690 3300046694 Bacteria 1111
640 Ga0495589_0000098 3300046794 Bacteria 83860
641 Ga0495589_0000117 3300046794 Bacteria 75549
642 Ga0495589_0001522 3300046794 Bacteria 13335
643 Ga0495660_0001411 3300046810 Bacteria 16475
644 Ga0495660_0005422 3300046810 Bacteria 7636
645 Ga0495660_0005755 3300046810 Bacteria 7402
646 Ga0495660_0029510 3300046810 Bacteria 3093
647 Ga0495660_0037420 3300046810 Bacteria 2702
648 Ga0495660_0072660 3300046810 Bacteria 1821
649 Ga0495636_0004214 3300047318 Bacteria 5648
650 Ga0495672_0000410 3300047320 Bacteria 51954
651 Ga0495672_0000423 3300047320 Bacteria 50688
652 Ga0495672_0018201 3300047320 Bacteria 4675
653 Ga0495672_0174514 3300047320 Bacteria 1093
654 Ga0495676_0151576 3300047321 Bacteria 1649
655 Ga0495680_0159771 3300047322 Bacteria 1637
656 Ga0495683_0006508 3300047323 Bacteria 6381
657 Ga0495683_0009385 3300047323 Bacteria 5214
658 Ga0495683_0066318 3300047323 Bacteria 1779
659 Ga0495687_000054 3300047443 Bacteria 194607
660 Ga0495687_000410 3300047443 Bacteria 53080
661 Ga0495687_001444 3300047443 Bacteria 21817
662 Ga0495687_002747 3300047443 Bacteria 13641
663 Ga0495687_066854 3300047443 Bacteria 1457
664 Ga0495677_0000012 3300047445 Bacteria 146763
665 Ga0495677_0000859 3300047445 Bacteria 12291
666 Ga0495677_0003598 3300047445 Bacteria 6010
667 Ga0495677_0036168 3300047445 Bacteria 1803
668 Ga0495679_052618 3300047446 Bacteria 1217
669 Ga0495685_005610 3300047447 Bacteria 4100
670 Ga0495685_063798 3300047447 Bacteria 1240
671 Ga0495673_0000150 3300047469 Bacteria 122768
672 Ga0495681_0009383 3300047470 Bacteria 6035
673 Ga0495681_0012911 3300047470 Bacteria 4883
674 Ga0495681_0136157 3300047470 Bacteria 1041
675 Ga0495686_0000219 3300047472 Bacteria 105435
676 Ga0495686_0002068 3300047472 Bacteria 19737
677 Ga0495686_0002299 3300047472 Bacteria 18281
678 Ga0495686_0010880 3300047472 Bacteria 6442
679 Ga0495686_0037529 3300047472 Bacteria 3103
680 Ga0495686_0166351 3300047472 Bacteria 1285
681 Ga0495593_0015123 3300047673 Bacteria 4382
682 Ga0495626_0000036 3300048091 Bacteria 180464
683 Ga0495626_0000940 3300048091 Bacteria 25330
684 Ga0495626_0156728 3300048091 Bacteria 957
685 Ga0496103_0030455 3300048906 Bacteria 3284
686 Ga0496108_0276173 3300048911 Bacteria 1463
687 Ga0496109_0017381 3300048912 Bacteria 6305
688 Ga0496110_0011602 3300048913 Bacteria 7223
689 Ga0496110_0818425 3300048913 Bacteria 836
690 Ga0496111_0528157 3300048914 Bacteria 867
691 Ga0496113_0012625 3300048916 Bacteria 5684
692 Ga0496113_0066150 3300048916 Bacteria 2737
693 Ga0496113_0434897 3300048916 Bacteria 1054
694 Ga0496114_0027737 3300048917 Bacteria 4641
695 Ga0496116_0027600 3300048919 Bacteria 4131
696 Ga0496116_0031928 3300048919 Bacteria 3760
697 Ga0496121_0074129 3300048924 Bacteria 2724
698 Ga0496122_0000083 3300048925 Bacteria 208744
699 Ga0496122_0016147 3300048925 Bacteria 7092
700 Ga0496122_0020729 3300048925 Bacteria 5920
701 Ga0496122_0091872 3300048925 Bacteria 2065
702 Ga0496122_0099395 3300048925 Bacteria 1951
703 Ga0496122_0205589 3300048925 Bacteria 1146
704 Ga0496123_0000356 3300048926 Bacteria 85832
705 Ga0496123_0008423 3300048926 Bacteria 9474
706 Ga0496123_0045609 3300048926 Bacteria 2984
707 Ga0496123_0267527 3300048926 Bacteria 834
708 Ga0496124_0009703 3300048927 Bacteria 9853
709 Ga0496124_0019323 3300048927 Bacteria 6344
710 Ga0496124_0022774 3300048927 Bacteria 5735
711 Ga0496124_0046979 3300048927 Bacteria 3695
712 Ga0496124_0175363 3300048927 Bacteria 1655
713 Ga0496124_0283189 3300048927 Bacteria 1207
714 Ga0496125_0009768 3300048928 Bacteria 9790
715 Ga0496125_0011420 3300048928 Bacteria 8885
716 Ga0496125_0020289 3300048928 Bacteria 6239
717 Ga0496125_0128747 3300048928 Bacteria 1787
718 Ga0496126_0016636 3300048929 Bacteria 7350
719 Ga0496126_0119777 3300048929 Bacteria 2284
720 Ga0496126_0119976 3300048929 Bacteria 2282
721 Ga0496126_0561053 3300048929 Bacteria 905
722 Ga0495678_000076 3300049459 Bacteria 125077
723 Ga0495678_000780 3300049459 Bacteria 28573
724 Ga0495678_001241 3300049459 Bacteria 20760
725 Ga0495678_009738 3300049459 Bacteria 4722
726 Ga0495678_015957 3300049459 Bacteria 3447
727 Ga0495682_0042830 3300049460 Bacteria 1659
728 Ga0495682_0047290 3300049460 Bacteria 1570
729 Ga0501295_003868 3300049518 Bacteria 1890
730 Ga0501032_0030990 3300049569 Bacteria 3668
731 Ga0501033_0026581 3300049570 Bacteria 4354
732 Ga0501034_0036134 3300049571 Bacteria 5007
733 Ga0501034_0170966 3300049571 Bacteria 2140
734 Ga0501034_0204448 3300049571 Bacteria 1931
735 Ga0501036_0067039 3300049572 Bacteria 3037
736 Ga0501036_0220855 3300049572 Bacteria 1591
737 Ga0501037_0019833 3300049573 Bacteria 4961
738 Ga0501037_0040470 3300049573 Bacteria 3430
739 Ga0501038_0259465 3300049574 Bacteria 1374
740 Ga0501038_0487033 3300049574 Bacteria 944
741 Ga0501043_0000112 3300049579 Bacteria 76249
742 Ga0501043_0052256 3300049579 Bacteria 3210
743 Ga0501043_0063364 3300049579 Bacteria 2903
744 Ga0501043_0409350 3300049579 Bacteria 1024
745 Ga0501043_0580821 3300049579 Bacteria 830
746 Ga0501046_0000146 3300049580 Bacteria 74204
747 Ga0501046_0005311 3300049580 Bacteria 11522
748 Ga0501046_0080023 3300049580 Bacteria 2526
749 Ga0501046_0154907 3300049580 Bacteria 1727
750 Ga0501046_0261657 3300049580 Bacteria 1271
751 Ga0501047_0000192 3300049581 Bacteria 74300
752 Ga0501047_0015361 3300049581 Bacteria 7295
753 Ga0501047_0121379 3300049581 Bacteria 2495
754 Ga0501047_0335048 3300049581 Bacteria 1351
755 Ga0501048_0220145 3300049582 Bacteria 1346
756 Ga0501068_0100090 3300049584 Bacteria 1796
757 Ga0501072_0246343 3300049588 Bacteria 1423
758 Ga0501073_0008559 3300049589 Bacteria 7586
759 Ga0501074_0301275 3300049590 Bacteria 1138
760 Ga0501222_006895 3300049662 Bacteria 1521
761 Ga0501223_039896 3300049663 Bacteria 911
762 Ga0501227_000801 3300049665 Bacteria 6864
763 Ga0501227_025235 3300049665 Bacteria 1393
764 Ga0501230_000883 3300049667 Bacteria 3351
765 Ga0501238_029578 3300049671 Bacteria 790
766 Ga0501080_0000748 3300049742 Bacteria 26257
767 Ga0501080_0251991 3300049742 Bacteria 1610
768 Ga0501083_0123437 3300049744 Bacteria 1698
769 Ga0501269_000253 3300049766 Bacteria 15243
770 Ga0501279_011672 3300049775 Bacteria 1190
771 Ga0501035_0077228 3300049822 Bacteria 2943
772 Ga0501035_0176028 3300049822 Bacteria 1845
773 Ga0501035_0194553 3300049822 Bacteria 1742
774 Ga0501044_0006039 3300049823 Bacteria 13368
775 Ga0501044_0276567 3300049823 Bacteria 1614
776 Ga0501045_0027653 3300049824 Bacteria 4089
777 nmdc:mga03683_158940_c1 3300050489 Bacteria 1023
778 nmdc:mga03683_2428_c1 3300050489 Bacteria 5785
779 nmdc:mga0k408_134510_c1 3300050493 Bacteria 1468
780 nmdc:mga0k408_15821_c1 3300050493 Bacteria 4176
781 nmdc:mga0k408_78517_c1 3300050493 Bacteria 1931
782 nmdc:mga07m45_131019_c1 3300050496 Bacteria 1451
783 nmdc:mga07m45_205757_c1 3300050496 Bacteria 1145
784 nmdc:mga07m45_51108_c1 3300050496 Bacteria 2330
785 nmdc:mga07m45_6354_c1 3300050496 Bacteria 5967
786 nmdc:mga05p37_103_c1 3300050507 Bacteria 76610
787 nmdc:mga09592_9_c1 3300050508 Bacteria 108110
788 nmdc:mga06r32_2368_c2 3300050510 Bacteria 15697
789 nmdc:mga08y16_127494_c1 3300050511 Bacteria 2647
790 nmdc:mga08y16_798620_c1 3300050511 Bacteria 937
791 nmdc:mga0n895_509021_c1 3300050512 Bacteria 1212
792 nmdc:mga0rr50_331_c1 3300050513 Bacteria 25779
793 nmdc:mga08x19_64439_c1 3300050514 Bacteria 2379
794 nmdc:mga0a205_68568_c1 3300050515 Bacteria 3425
795 Ga0500646_0001035 3300053090 Bacteria 7594
796 Ga0500583_0034343 3300053092 Bacteria 2254
797 Ga0500651_0055508 3300053093 Bacteria 2481
798 Ga0500651_0066333 3300053093 Bacteria 2248
799 Ga0500641_0192660 3300053096 Bacteria 872
800 Ga0500617_070568 3300053124 Bacteria 1531
801 Ga0500618_001000 3300053125 Bacteria 14271
802 Ga0500658_0029991 3300053134 Bacteria 2119
803 Ga0500561_0006787 3300053137 Bacteria 2201
804 Ga0500577_0120146 3300053142 Bacteria 1093
805 Ga0500622_0006099 3300053156 Bacteria 7077
806 Ga0500627_0050687 3300053158 Bacteria 1808
807 Ga0500584_025872 3300053726 Bacteria 2728
808 Ga0501082_0005598 3300060353 Bacteria 10910
809 2538833722 2537561836 Bacteria 3910579
810 2587725414 2585428057 Bacteria 6737412
811 2588289989 2588253510 Bacteria 6901809
812 2643800442 2643221556 Bacteria 7251154
813 2643829043 2643221562 Bacteria 4048635
814 2643882776 2643221574 Bacteria 2789653
815 2643896536 2643221577 Bacteria 3710843
816 2644058742 2643221609 Bacteria 6756331
817 2644070984 2643221611 Bacteria 6820941
818 2644255590 2643221646 Bacteria 6433402
819 2644302838 2643221654 Bacteria 5273570
820 2644353019 2643221663 Bacteria 3425771
821 2644470351 2643221684 Bacteria 7145183
822 2644478707 2643221685 Bacteria 3673288
823 2644549791 2643221699 Bacteria 5731501
824 2644550301 2643221699 Bacteria 5731501
825 2738825933 2738541297 Bacteria 6549566
826 2739149730 2738541357 Bacteria 6549408
827 2739191649 2738543003 Bacteria 6549560
828 2739245251 2738543012 Bacteria 7115078
829 2739285939 2738543020 Bacteria 5718238
830 2739291252 2738543021 Bacteria 5718241
831 2739318126 2738543026 Bacteria 6549408
832 2739336367 2738543029 Bacteria 6549249
833 2765570187 2765235838 Bacteria 5445269
834 2816471587 2816332133 Bacteria 7249298
835 2821135575 2821131069 Bacteria 6108407
836 2831866447 2831864461 Bacteria 6502356
837 2839096871 2839094727 Bacteria 5534556
838 2842714005 2842711865 Bacteria 7155354
839 2842807695 2842805378 Bacteria 5385175
840 2857555051 2857553236 Bacteria 6166726
841 2885084469 2885080285 Bacteria 6355622
842 2886848903 2886848708 Bacteria 5632523
843 2895396038 2895395659 Bacteria 3983269
844 2939613208 2939611941 Bacteria 3892017
845 2939636048 2939631187 Bacteria 6118131
846 3007256287 3007252601 Bacteria 4559114
847 3007319487 3007315729 Bacteria 5076637
848 8047678741 8047673197 Bacteria 7395230
849 Ga0373937_0096810
850 JGI24735J21928_10004421
851 JGI25162J39368_1001721
852 JGI25162J39368_1001834
853 JGI25154J39366_1000670
854 JGI25157J39369_1007623
855 JGI25164J39214_1000843
856 JGI25164J39214_1000904
857 JGI25152J39213_1000333
858 JGI25150J39212_1006368
859 JGI25159J45721_1003741
860 JGI25165J46597_1001628
861 JGI25165J46597_1002627
862 JGI25153J46596_10030568
863 rootH1_10036074
864 rootH2_10035007
865 rootL2_10002558
866 rootL2_10003205
867 rootL2_10028022
868 rootL2_10033379
869 rootH1_10004792
870 rootH1_10012636
871 rootH1_10078746
872 Ga0055525_1000081
873 Ga0055529_1000565
874 Ga0055526_1000230
875 Ga0055526_1000258
876 Ga0055526_1000442
877 Ga0055526_1002405
878 Ga0055526_1006039
879 Ga0055526_1010482
880 Ga0055537_1000128
881 Ga0055537_1002789
882 Ga0055524_1000026
883 Ga0055524_1000528
884 Ga0055524_1002759
885 Ga0055524_1020729
886 Ga0055534_1000120
887 Ga0055528_1000069
888 Ga0055530_10034349
889 Ga0055531_10000154
890 Ga0055531_10003023
891 Ga0055531_10022807
892 Ga0055543_1001084
893 Ga0055543_1003994
894 Ga0065165_1000067
895 Ga0065165_1000276
896 Ga0065165_1068932
897 Ga0070658_10634896
898 Ga0070676_10005140
899 Ga0070670_100001478
900 Ga0070670_100016429
901 Ga0070677_10007765
902 Ga0068869_100051042
903 Ga0068869_100479008
904 Ga0070666_10209107
905 Ga0070682_100001469
906 Ga0070682_100003106
907 Ga0070682_100027600
908 Ga0068868_100114348
909 Ga0068868_100124649
910 Ga0070660_100100606
911 Ga0070660_100122047
912 Ga0070661_100016629
913 Ga0070692_10035255
914 Ga0070692_10068906
915 Ga0070669_100025994
916 Ga0070675_100000072
917 Ga0070671_100093203
918 Ga0070671_100184736
919 Ga0070671_100340791
920 Ga0070674_100049783
921 Ga0070674_100182901
922 Ga0070673_100019834
923 Ga0070673_100180283
924 Ga0070673_100293374
925 Ga0070688_100151446
926 Ga0070659_100002090
927 Ga0070659_100008903
928 Ga0070667_100035426
929 Ga0070667_100082453
930 Ga0070714_100007085
931 Ga0070714_100047437
932 Ga0070710_10058042
933 Ga0070711_101038961
934 Ga0070700_100236610
935 Ga0070694_100183425
936 Ga0070694_100251056
937 Ga0070663_100048646
938 Ga0070678_100098412
939 Ga0070678_100265257
940 Ga0070662_100067706
941 Ga0070681_10002635
942 Ga0068867_100323978
943 Ga0068867_100341982
944 Ga0070684_100163045
945 Ga0068853_100001001
946 Ga0068853_100046622
947 Ga0070672_100009439
948 Ga0070672_100010736
949 Ga0070672_100040865
950 Ga0070696_100116171
951 Ga0070693_100050195
952 Ga0070665_100013753
953 Ga0070665_100071893
954 Ga0070704_100002816
955 Ga0070704_100963861
956 Ga0068855_100017967
957 Ga0068855_100046260
958 Ga0068855_100148866
959 Ga0068855_100249067
960 Ga0068855_100626652
961 Ga0070664_100209471
962 Ga0070664_100318999
963 Ga0068857_100093646
964 Ga0068854_100141076
965 Ga0068856_100000088
966 Ga0068856_100005127
967 Ga0068856_100056334
968 Ga0068856_100142457
969 Ga0068852_100076538
970 Ga0068859_100005367
971 Ga0068859_100017147
972 Ga0068859_100037413
973 Ga0068859_100436241
974 Ga0068864_100015249
975 Ga0068864_100147585
976 Ga0068864_100172136
977 Ga0068866_10238336
978 Ga0068866_10275532
979 Ga0068870_10143865
980 Ga0068863_100057083
981 Ga0068863_100545074
982 Ga0068858_100007339
983 Ga0068860_100018631
984 Ga0068860_100095772
985 Ga0075366_10004937
986 Ga0075366_10028699
987 Ga0075366_10053845
988 Ga0097621_100137407
989 Ga0075370_10017358
990 Ga0075370_10017940
991 Ga0075370_10069391
992 Ga0068871_100008131
993 Ga0068871_100263298
994 Ga0075431_100000781
995 Ga0075433_10301891
996 Ga0075434_100000002
997 Ga0075429_100000009
998 Ga0068865_100566626
999 Ga0075436_100067212
1000 Ga0097620_100005367
1001 Ga0097620_100017146
1002 Ga0097620_100037413
1003 Ga0097620_100436250
1004 Ga0099823_1000213
1005 Ga0079104_1000001
1006 Ga0099826_10000003
1007 Ga0075435_100002074
1008 Ga0075435_100052352
1009 Ga0105244_10002049
1010 Ga0105244_10080443
1011 Ga0105244_10113502
1012 Ga0105240_10011045
1013 Ga0114129_10039159
1014 Ga0105243_10481077
1015 Ga0105243_11075959
1016 Ga0105248_10036982
1017 Ga0105248_10086635
1018 Ga0105248_10370608
1019 Ga0105237_10000147
1020 Ga0105238_10003207
1021 Ga0105238_10066617
1022 Ga0105238_10395691
1023 Ga0105238_10722614
1024 Ga0105249_10013764
1025 Ga0157319_1000023
1026 Ga0157373_10001548
1027 Ga0157373_10407845
1028 Ga0157371_10010197
1029 Ga0157371_10086459
1030 Ga0157371_10370660
1031 Ga0157370_10000264
1032 Ga0157370_10005082
1033 Ga0157370_10026839
1034 Ga0157370_10047067
1035 Ga0157370_10112844
1036 Ga0157370_10249704
1037 Ga0157369_10143402
1038 Ga0157369_10230275
1039 Ga0157369_10561575
1040 Ga0157369_11275860
1041 Ga0157374_10555533
1042 Ga0157378_10000033
1043 Ga0157378_10248252
1044 Ga0157372_10030731
1045 Ga0157372_10155933
1046 Ga0157372_10180132
1047 Ga0157372_10193061
1048 Ga0157372_11073813
1049 Ga0157375_10018510
1050 Ga0157375_10018656
1051 Ga0157375_10024111
1052 Ga0157375_10277881
1053 Ga0157375_10523789
1054 Ga0163163_10421254
1055 Ga0157380_10042412
1056 Ga0157380_10126963
1057 Ga0182008_10058280
1058 Ga0182008_10068675
1059 Ga0182008_10110002
1060 Ga0157379_10024447
1061 Ga0157379_10238113
1062 Ga0157379_10384982
1063 Ga0157376_10004616
1064 Ga0157376_10041150
1065 Ga0157376_10124832
1066 Ga0182006_1000070
1067 Ga0182006_1006020
1068 Ga0182006_1028006
1069 Ga0182007_10061903
1070 Ga0182007_10093832
1071 Ga0182005_1000003
1072 Ga0183369_1004
1073 Ga0183361_13646
1074 Ga0163161_10018024
1075 Ga0206356_11593915
1076 Ga0206353_10169809
1077 Ga0213872_10000252
1078 Ga0213872_10004097
1079 Ga0213872_10007564
1080 Ga0213872_10019215
1081 Ga0213872_10030430
1082 Ga0213874_10036041
1083 Ga0209436_108716
1084 Ga0209674_102244
1085 Ga0209563_100015
1086 Ga0207427_100068
1087 Ga0207427_100143
1088 Ga0209437_100005
1089 Ga0209437_100255
1090 Ga0207425_1000377
1091 Ga0207425_1000417
1092 Ga0209646_1000114
1093 Ga0209646_1004778
1094 Ga0209026_1013458
1095 Ga0209677_101945
1096 Ga0209148_1000413
1097 Ga0209129_1000062
1098 Ga0209233_1000011
1099 Ga0209233_1000172
1100 Ga0209233_1008135
1101 Ga0209565_1000006
1102 Ga0209565_1004370
1103 Ga0209455_1000063
1104 Ga0209455_1000267
1105 Ga0209673_1000004
1106 Ga0209673_1003916
1107 Ga0209673_1005396
1108 Ga0209673_1008906
1109 Ga0209673_1034950
1110 Ga0209130_1000223
1111 Ga0209675_1000224
1112 Ga0209675_1010149
1113 Ga0209025_1002210
1114 Ga0209564_1000003
1115 Ga0209564_1000006
1116 Ga0209564_1000014
1117 Ga0209564_1000026
1118 Ga0209564_1000102
1119 Ga0209758_1000129
1120 Ga0209758_1000372
1121 Ga0209050_1000118
1122 Ga0209050_1005818
1123 Ga0209050_1014918
1124 Ga0209256_1000013
1125 Ga0209256_1000015
1126 Ga0209256_1000495
1127 Ga0209256_1000692
1128 Ga0209051_1001168
1129 Ga0209051_1030031
1130 Ga0209257_1000117
1131 Ga0209257_1001528
1132 Ga0209257_1001538
1133 Ga0209257_1020069
1134 Ga0207697_10043402
1135 Ga0207656_10038281
1136 Ga0207656_10113164
1137 Ga0207655_1003166
1138 Ga0207713_1000124
1139 Ga0207682_10009795
1140 Ga0207688_10240524
1141 Ga0207688_10325516
1142 Ga0207680_10291248
1143 Ga0207647_10022066
1144 Ga0207647_10041071
1145 Ga0207645_10040703
1146 Ga0207645_10218636
1147 Ga0207643_10012674
1148 Ga0207643_10022318
1149 Ga0207705_10492104
1150 Ga0207707_10002503
1151 Ga0207695_10004771
1152 Ga0207695_10094068
1153 Ga0207695_10793370
1154 Ga0207671_10000444
1155 Ga0207693_10720308
1156 Ga0207660_10193810
1157 Ga0207660_10737365
1158 Ga0207662_10064683
1159 Ga0207657_10017943
1160 Ga0207649_10241217
1161 Ga0207681_10023866
1162 Ga0207694_10121432
1163 Ga0207650_10000947
1164 Ga0207650_10028326
1165 Ga0207659_10030033
1166 Ga0207664_10000304
1167 Ga0207664_10014781
1168 Ga0207644_10008831
1169 Ga0207644_10019133
1170 Ga0207690_10000635
1171 Ga0207690_10332993
1172 Ga0207706_10003077
1173 Ga0207706_10115347
1174 Ga0207670_10465081
1175 Ga0207669_10018495
1176 Ga0207669_10037038
1177 Ga0207669_10275096
1178 Ga0207704_10059001
1179 Ga0207704_10482629
1180 Ga0207691_10044273
1181 Ga0207691_10599609
1182 Ga0207711_10019344
1183 Ga0207711_10055565
1184 Ga0207689_10124160
1185 Ga0207679_10074470
1186 Ga0207679_10173370
1187 Ga0207667_10008182
1188 Ga0207667_10012870
1189 Ga0207667_10036374
1190 Ga0207667_10062370
1191 Ga0207667_10247540
1192 Ga0207667_10320002
1193 Ga0207651_10011963
1194 Ga0207651_10040569
1195 Ga0207712_10226793
1196 Ga0207658_10007237
1197 Ga0207658_10019536
1198 Ga0207677_10091223
1199 Ga0207677_10149692
1200 Ga0207677_10270493
1201 Ga0207703_10003934
1202 Ga0207639_10004454
1203 Ga0207639_10015334
1204 Ga0207639_10182723
1205 Ga0207639_10561474
1206 Ga0207678_10005945
1207 Ga0207678_10358281
1208 Ga0207678_10628500
1209 Ga0207702_10000969
1210 Ga0207702_10134423
1211 Ga0207641_10073299
1212 Ga0207641_10108531
1213 Ga0207648_10026012
1214 Ga0207648_10059863
1215 Ga0207648_10303461
1216 Ga0207648_10371027
1217 Ga0207648_10408466
1218 Ga0207648_10510719
1219 Ga0207674_10010203
1220 Ga0207683_10043196
1221 Ga0207683_10056241
1222 Ga0207698_10059284
1223 Ga0207698_10335283
1224 Ga0207698_10437086
1225 Ga0207698_10755346
1226 Ga0209281_1000537
1227 Ga0209281_1002628
1228 Ga0209371_1000354
1229 Ga0209371_1019741
1230 Ga0209282_1000002
1231 Ga0268266_10055996
1232 Ga0268266_10572636
1233 Ga0307515_10000006
1234 Ga0307515_10038987
1235 Ga0307515_10091447
1236 Ga0307515_10099185
1237 Ga0307515_10265279
1238 Ga0268256_1000456
1239 Ga0268256_1022108
1240 Ga0307512_10168398
1241 Ga0316177_1018288
1242 Ga0316181_1288529
1243 Ga0265330_10000045
1244 Ga0265332_10000031
1245 Ga0265332_10127467
1246 Ga0265320_10160127
1247 Ga0265325_10007282
1248 Ga0265340_10011412
1249 Ga0307513_10000129
1250 Ga0307513_10004878
1251 Ga0307513_10265747
1252 Ga0307509_10007193
1253 Ga0307509_10305316
1254 Ga0307509_10342293
1255 Ga0307509_10353357
1256 Ga0307408_100107184
1257 Ga0307508_10001047
1258 Ga0265314_10000095
1259 Ga0265314_10014237
1260 Ga0265314_10204217
1261 Ga0307516_10000058
1262 Ga0307516_10005218
1263 Ga0307410_10319187
1264 Ga0307412_10387866
1265 Ga0307409_100598857
1266 Ga0307416_100037238
1267 Ga0307414_10017280
1268 Ga0307414_10044761
1269 Ga0307414_10922041
1270 Ga0307411_10000118
1271 Ga0307411_10454819
1272 Ga0307510_10083804
1273 Ga0373949_0067717
1274 Ga0373952_0060254
1275 Ga0373953_0025873
1276 Ga0373954_0000008
1277 Ga0373956_0035097
1278 Ga0316574_0023388
1279 Ga0373924_0020707
1280 Ga0373931_0003625
1281 Ga0373933_0002915
1282 Ga0373933_0042458
1283 Ga0373937_0000418
1284 Ga0373937_0005397
1285 Ga0373937_0263051
1286 Ga0316582_0059583
1287 Ga0316584_0374206
1288 Ga0373925_0010207
1289 Ga0395899_0026523
1290 Ga0395899_0145193
1291 Ga0395900_0002543
1292 Ga0395900_0016606
1293 Ga0395900_0146826
1294 Ga0395900_0254146
1295 Ga0395900_0316444
1296 Ga0395898_0031337
1297 Ga0395898_0318961
1298 Ga0395905_0001119
1299 Ga0395905_0113009
1300 Ga0395905_0348412
1301 Ga0395905_0705607
1302 Ga0395901_0003072
1303 Ga0400483_231697
1304 Ga0436361_0046720
1305 Ga0436361_0110138
1306 Ga0436361_0143359
1307 Ga0436361_0480035
1308 Ga0436361_0621348
1309 Ga0436361_0704499
1310 Ga0436361_0712205
1311 Ga0436363_0050228
1312 Ga0451791_0735107
1313 Ga0451839_0483013
1314 Ga0439452_111879
1315 Ga0439455_0029293
1316 Ga0450890_003158
1317 Ga0450896_014994
1318 Ga0450910_010661
1319 Ga0439458_0015559
1320 Ga0439459_0000200
1321 Ga0439464_0012200
1322 Ga0450893_0010007
1323 Ga0451577_0005639
1324 Ga0451577_0023898
1325 Ga0451577_0249607
1326 Ga0451577_0352660
1327 Ga0466969_0017796
1328 Ga0466969_0035292
1329 Ga0466969_0091850
1330 Ga0466969_0134684
1331 Ga0466972_0005121
1332 Ga0466965_0154252
1333 Ga0466966_0004520
1334 Ga0466966_0039415
1335 Ga0466966_0080004
1336 Ga0466966_0175957
1337 Ga0466961_0179108
1338 Ga0466963_0159812
1339 Ga0466971_0086184
1340 Ga0466968_0003741
1341 Ga0466970_0059449
1342 Ga0466970_0114750
1343 Ga0466957_0008881
1344 Ga0466957_0021671
1345 Ga0466957_0267571
1346 Ga0466959_0005781
1347 Ga0466959_0021417
1348 Ga0466959_0209658
1349 Ga0451576_0166000
1350 Ga0451576_0426006
1351 Ga0451576_0604757
1352 Ga0466958_0025649
1353 Ga0466958_0036091
1354 Ga0466967_0017711
1355 Ga0495617_000048
1356 Ga0495627_000046
1357 Ga0495590_0000030
1358 Ga0495590_0003180
1359 Ga0495590_0010511
1360 Ga0495590_0032233
1361 Ga0495590_0036580
1362 Ga0495638_0000105
1363 Ga0495638_0058485
1364 Ga0495638_0070592
1365 Ga0495653_0000018
1366 Ga0495650_0000024
1367 Ga0495650_0000099
1368 Ga0495650_0000173
1369 Ga0495650_0000212
1370 Ga0495650_0000227
1371 Ga0495650_0000712
1372 Ga0495650_0005060
1373 Ga0495650_0010147
1374 Ga0495605_0000005
1375 Ga0495605_0000369
1376 Ga0495605_0015267
1377 Ga0495584_0001010
1378 Ga0495584_0003947
1379 Ga0495584_0015004
1380 Ga0495585_0009467
1381 Ga0495585_0105031
1382 Ga0495594_0015942
1383 Ga0495607_0002843
1384 Ga0495607_0003287
1385 Ga0495607_0006164
1386 Ga0495607_0010691
1387 Ga0495607_0018115
1388 Ga0495607_0145112
1389 Ga0495583_0006407
1390 Ga0495606_0000204
1391 Ga0495606_0002863
1392 Ga0495606_0002941
1393 Ga0495606_0006368
1394 Ga0495606_0029567
1395 Ga0495606_0053631
1396 Ga0495606_0209996
1397 Ga0495610_0000021
1398 Ga0495610_0001557
1399 Ga0495610_0004255
1400 Ga0495610_0025294
1401 Ga0495610_0027618
1402 Ga0495616_0007249
1403 Ga0495616_0012205
1404 Ga0495616_0013958
1405 Ga0495620_0041900
1406 Ga0495630_0077734
1407 Ga0495630_0584065
1408 Ga0495630_0724477
1409 Ga0495632_0003710
1410 Ga0495637_0200457
1411 Ga0495643_0000181
1412 Ga0495643_0000460
1413 Ga0495643_0000770
1414 Ga0495643_0001670
1415 Ga0495643_0011341
1416 Ga0495643_0019107
1417 Ga0495643_0046669
1418 Ga0495644_0006659
1419 Ga0495644_0182287
1420 Ga0495648_0000008
1421 Ga0495648_0007580
1422 Ga0495648_0008182
1423 Ga0495648_0023986
1424 Ga0495648_0027411
1425 Ga0495663_0002864
1426 Ga0495666_0084158
1427 Ga0495642_0000298
1428 Ga0495642_0011021
1429 Ga0495642_0045332
1430 Ga0495642_0175103
1431 Ga0495654_0021794
1432 Ga0495654_0069960
1433 Ga0495598_0000562
1434 Ga0495609_0000028
1435 Ga0495609_0001266
1436 Ga0495609_0007541
1437 Ga0495609_0019216
1438 Ga0495609_0141565
1439 Ga0495597_0002738
1440 Ga0495597_0006184
1441 Ga0495597_0008660
1442 Ga0495597_0012227
1443 Ga0495645_0305939
1444 Ga0495622_0000560
1445 Ga0495622_0012508
1446 Ga0495622_0036767
1447 Ga0495633_0000409
1448 Ga0495633_0000810
1449 Ga0495633_0002477
1450 Ga0495633_0032619
1451 Ga0495633_0032907
1452 Ga0495633_0163771
1453 Ga0495656_0149887
1454 Ga0495668_0000008
1455 Ga0495668_0001106
1456 Ga0495668_0002762
1457 Ga0495668_0002817
1458 Ga0495668_0004418
1459 Ga0495668_0004836
1460 Ga0495668_0042149
1461 Ga0495625_0000278
1462 Ga0495625_0001449
1463 Ga0495625_0046422
1464 Ga0495625_0122748
1465 Ga0495625_0132826
1466 Ga0495625_0227388
1467 Ga0495659_0001151
1468 Ga0495661_0000157
1469 Ga0495661_0000710
1470 Ga0495661_0023731
1471 Ga0495661_0036356
1472 Ga0495661_0037025
1473 Ga0495661_0043493
1474 Ga0495588_0000113
1475 Ga0495599_0078529
1476 Ga0495623_0279686
1477 Ga0495669_0030634
1478 Ga0495671_0000343
1479 Ga0495671_0000442
1480 Ga0495671_0050325
1481 Ga0495671_0360082
1482 Ga0495649_0000725
1483 Ga0495649_0026199
1484 Ga0495649_0077498
1485 Ga0495649_0108955
1486 Ga0495649_0177676
1487 Ga0495649_0177690
1488 Ga0495589_0000098
1489 Ga0495589_0000117
1490 Ga0495589_0001522
1491 Ga0495660_0001411
1492 Ga0495660_0005422
1493 Ga0495660_0005755
1494 Ga0495660_0029510
1495 Ga0495660_0037420
1496 Ga0495660_0072660
1497 Ga0495636_0004214
1498 Ga0495672_0000410
1499 Ga0495672_0000423
1500 Ga0495672_0018201
1501 Ga0495672_0174514
1502 Ga0495676_0151576
1503 Ga0495680_0159771
1504 Ga0495683_0006508
1505 Ga0495683_0009385
1506 Ga0495683_0066318
1507 Ga0495687_000054
1508 Ga0495687_000410
1509 Ga0495687_001444
1510 Ga0495687_002747
1511 Ga0495687_066854
1512 Ga0495677_0000012
1513 Ga0495677_0000859
1514 Ga0495677_0003598
1515 Ga0495677_0036168
1516 Ga0495679_052618
1517 Ga0495685_005610
1518 Ga0495685_063798
1519 Ga0495673_0000150
1520 Ga0495681_0009383
1521 Ga0495681_0012911
1522 Ga0495681_0136157
1523 Ga0495686_0000219
1524 Ga0495686_0002068
1525 Ga0495686_0002299
1526 Ga0495686_0010880
1527 Ga0495686_0037529
1528 Ga0495686_0166351
1529 Ga0495593_0015123
1530 Ga0495626_0000036
1531 Ga0495626_0000940
1532 Ga0495626_0156728
1533 Ga0496103_0030455
1534 Ga0496108_0276173
1535 Ga0496109_0017381
1536 Ga0496110_0011602
1537 Ga0496110_0818425
1538 Ga0496111_0528157
1539 Ga0496113_0012625
1540 Ga0496113_0066150
1541 Ga0496113_0434897
1542 Ga0496114_0027737
1543 Ga0496116_0027600
1544 Ga0496116_0031928
1545 Ga0496121_0074129
1546 Ga0496122_0000083
1547 Ga0496122_0016147
1548 Ga0496122_0020729
1549 Ga0496122_0091872
1550 Ga0496122_0099395
1551 Ga0496122_0205589
1552 Ga0496123_0000356
1553 Ga0496123_0008423
1554 Ga0496123_0045609
1555 Ga0496123_0267527
1556 Ga0496124_0009703
1557 Ga0496124_0019323
1558 Ga0496124_0022774
1559 Ga0496124_0046979
1560 Ga0496124_0175363
1561 Ga0496124_0283189
1562 Ga0496125_0009768
1563 Ga0496125_0011420
1564 Ga0496125_0020289
1565 Ga0496125_0128747
1566 Ga0496126_0016636
1567 Ga0496126_0119777
1568 Ga0496126_0119976
1569 Ga0496126_0561053
1570 Ga0495678_000076
1571 Ga0495678_000780
1572 Ga0495678_001241
1573 Ga0495678_009738
1574 Ga0495678_015957
1575 Ga0495682_0042830
1576 Ga0495682_0047290
1577 Ga0501295_003868
1578 Ga0501032_0030990
1579 Ga0501033_0026581
1580 Ga0501034_0036134
1581 Ga0501034_0170966
1582 Ga0501034_0204448
1583 Ga0501036_0067039
1584 Ga0501036_0220855
1585 Ga0501037_0019833
1586 Ga0501037_0040470
1587 Ga0501038_0259465
1588 Ga0501038_0487033
1589 Ga0501043_0000112
1590 Ga0501043_0052256
1591 Ga0501043_0063364
1592 Ga0501043_0409350
1593 Ga0501043_0580821
1594 Ga0501046_0000146
1595 Ga0501046_0005311
1596 Ga0501046_0080023
1597 Ga0501046_0154907
1598 Ga0501046_0261657
1599 Ga0501047_0000192
1600 Ga0501047_0015361
1601 Ga0501047_0121379
1602 Ga0501047_0335048
1603 Ga0501048_0220145
1604 Ga0501068_0100090
1605 Ga0501072_0246343
1606 Ga0501073_0008559
1607 Ga0501074_0301275
1608 Ga0501222_006895
1609 Ga0501223_039896
1610 Ga0501227_000801
1611 Ga0501227_025235
1612 Ga0501230_000883
1613 Ga0501238_029578
1614 Ga0501080_0000748
1615 Ga0501080_0251991
1616 Ga0501083_0123437
1617 Ga0501269_000253
1618 Ga0501279_011672
1619 Ga0501035_0077228
1620 Ga0501035_0176028
1621 Ga0501035_0194553
1622 Ga0501044_0006039
1623 Ga0501044_0276567
1624 Ga0501045_0027653
1625 nmdc:mga03683_158940_c1
1626 nmdc:mga03683_2428_c1
1627 nmdc:mga0k408_134510_c1
1628 nmdc:mga0k408_15821_c1
1629 nmdc:mga0k408_78517_c1
1630 nmdc:mga07m45_131019_c1
1631 nmdc:mga07m45_205757_c1
1632 nmdc:mga07m45_51108_c1
1633 nmdc:mga07m45_6354_c1
1634 nmdc:mga05p37_103_c1
1635 nmdc:mga09592_9_c1
1636 nmdc:mga06r32_2368_c2
1637 nmdc:mga08y16_127494_c1
1638 nmdc:mga08y16_798620_c1
1639 nmdc:mga0n895_509021_c1
1640 nmdc:mga0rr50_331_c1
1641 nmdc:mga08x19_64439_c1
1642 nmdc:mga0a205_68568_c1
1643 Ga0500646_0001035
1644 Ga0500583_0034343
1645 Ga0500651_0055508
1646 Ga0500651_0066333
1647 Ga0500641_0192660
1648 Ga0500617_070568
1649 Ga0500618_001000
1650 Ga0500658_0029991
1651 Ga0500561_0006787
1652 Ga0500577_0120146
1653 Ga0500622_0006099
1654 Ga0500627_0050687
1655 Ga0500584_025872
1656 Ga0501082_0005598
1657 2538833722
1658 2587725414
1659 2588289989
1660 2643800442
1661 2643829043
1662 2643882776
1663 2643896536
1664 2644058742
1665 2644070984
1666 2644255590
1667 2644302838
1668 2644353019
1669 2644470351
1670 2644478707
1671 2644549791
1672 2644550301
1673 2738825933
1674 2739149730
1675 2739191649
1676 2739245251
1677 2739285939
1678 2739291252
1679 2739318126
1680 2739336367
1681 2765570187
1682 2816471587
1683 2821135575
1684 2831866447
1685 2839096871
1686 2842714005
1687 2842807695
1688 2857555051
1689 2885084469
1690 2886848903
1691 2895396038
1692 2939613208
1693 2939636048
1694 3007256287
1695 3007319487
1696 8047678741

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

56

122

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

45

121

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

181

247

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

50

127

0.92

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

164

252

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hz4-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase b4xh91 (target efi-501787) from actinobacillus pleuropneumoniae 0.8876 1 204
1v2a-assembly1.cif.gz_B glutathione s-transferase 1-6 from anopheles dirus species b 0.8552 3 199
8aib-assembly1.cif.gz_B r11a variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8471 1 197
3qav-assembly1.cif.gz_A crystal structure of a glutathione s-transferase from antarctic clam laternula elliptica 0.8452 2 196
8ai8-assembly1.cif.gz_B crystal structure of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8444 1 197
ID Description Score Start End Superfamily
af_Q9P6M1_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9016 1 80 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8919 1 84 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8815 1 84 3.40.30.10
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8813 91 198 1.20.1050.130
4hz4A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8798 84 195 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A519KNR3-F1-model_v4 Glutathione S-transferase 0.9549 1 166 GO:0016740
AF-A0A519EWL6-F1-model_v4 Glutathione S-transferase 0.9521 29 206 GO:0016740
AF-A0A1G4PCU8-F1-model_v4 Glutathione S-transferase 0.952 1 205 GO:0016740
AF-A0A2M8ZT25-F1-model_v4 deleted 0.9519 1 204
AF-A0A5S9INC3-F1-model_v4 Glutathione S-transferase 0.9504 1 202 GO:0016740

Map