F483373

General Info

Members Datasets Scaffolds Average Seq Length
848 253 1696 71

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0394845|Ga0466960_0394845_443_694
Length 83
Sequence MTPRPRLLAAAMLIPACTGCISVKTPEKPIEINLNVAIRQEVLVRMQRDVENLINQNPDAFPQGQQPAATRPAQPARTPGSSR

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
93 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
190 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
191 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
192 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
193 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
194 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
232 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
233 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
236 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
237 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
240 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
244 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
245 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
246 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 4.83
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0394845 3300044901 Bacteria 796
2 CNAas_1009794 3300000532 Bacteria 637
3 JGI24736J21556_1063138 3300001904 Bacteria 574
4 JGI24740J21852_10136104 3300001979 Bacteria 612
5 JGI24739J22299_10153601 3300001989 Unclassified 680
6 JGI24737J22298_10032027 3300001990 Bacteria 1640
7 JGI24737J22298_10246022 3300001990 Bacteria 528
8 JGI24735J21928_10008884 3300002067 Bacteria 3241
9 JGI24735J21928_10018161 3300002067 Bacteria 2170
10 rootH1_10233400 3300003323 Unclassified 1727
11 Ga0070658_10048462 3300005327 Bacteria 3441
12 Ga0070658_10139741 3300005327 Bacteria 2023
13 Ga0070658_10374215 3300005327 Bacteria 1221
14 Ga0070658_10712416 3300005327 Bacteria 871
15 Ga0070658_10756568 3300005327 Bacteria 844
16 Ga0070658_11312374 3300005327 Bacteria 628
17 Ga0070676_10000509 3300005328 Bacteria 18636
18 Ga0070676_10018872 3300005328 Bacteria 3829
19 Ga0070676_10104474 3300005328 Bacteria 1755
20 Ga0070676_10224342 3300005328 Bacteria 1243
21 Ga0070676_10348171 3300005328 Bacteria 1018
22 Ga0070683_100096580 3300005329 Bacteria 2779
23 Ga0070683_100697847 3300005329 Bacteria 972
24 Ga0070683_101118406 3300005329 Bacteria 757
25 Ga0070690_100557112 3300005330 Bacteria 865
26 Ga0070690_100987582 3300005330 Bacteria 663
27 Ga0070670_100008324 3300005331 Bacteria 8840
28 Ga0070670_100090749 3300005331 Bacteria 2626
29 Ga0070670_100116328 3300005331 Bacteria 2306
30 Ga0070670_100257627 3300005331 Bacteria 1520
31 Ga0070670_100831531 3300005331 Bacteria 835
32 Ga0070670_101999614 3300005331 Bacteria 534
33 Ga0070677_10555225 3300005333 Bacteria 630
34 Ga0070677_10602858 3300005333 Bacteria 608
35 Ga0070677_10721637 3300005333 Bacteria 563
36 Ga0068869_100028374 3300005334 Bacteria 3910
37 Ga0068869_100075541 3300005334 Bacteria 2504
38 Ga0068869_100567022 3300005334 Bacteria 956
39 Ga0070666_10275760 3300005335 Bacteria 1195
40 Ga0070666_10532349 3300005335 Bacteria 854
41 Ga0070666_11227282 3300005335 Bacteria 559
42 Ga0070680_100260887 3300005336 Bacteria 1466
43 Ga0070680_100324275 3300005336 Bacteria 1307
44 Ga0070680_101666829 3300005336 Bacteria 552
45 Ga0070682_100056000 3300005337 Bacteria 2478
46 Ga0070682_100203586 3300005337 Bacteria 1398
47 Ga0070682_100354453 3300005337 Bacteria 1095
48 Ga0068868_100616083 3300005338 Bacteria 963
49 Ga0070660_100059424 3300005339 Bacteria 2964
50 Ga0070660_100075646 3300005339 Bacteria 2636
51 Ga0070660_100078186 3300005339 Bacteria 2594
52 Ga0070660_100212206 3300005339 Bacteria 1572
53 Ga0070660_100358965 3300005339 Bacteria 1201
54 Ga0070660_100574384 3300005339 Bacteria 941
55 Ga0070660_101366808 3300005339 Bacteria 601
56 Ga0070691_10114126 3300005341 Bacteria 1354
57 Ga0070687_100769781 3300005343 Bacteria 679
58 Ga0070661_100009966 3300005344 Bacteria 6592
59 Ga0070661_100147216 3300005344 Bacteria 1779
60 Ga0070661_100243216 3300005344 Bacteria 1386
61 Ga0070661_100296444 3300005344 Bacteria 1258
62 Ga0070661_100876166 3300005344 Bacteria 740
63 Ga0070661_100980028 3300005344 Bacteria 701
64 Ga0070692_10043292 3300005345 Bacteria 2314
65 Ga0070692_11177350 3300005345 Bacteria 545
66 Ga0070668_100004342 3300005347 Bacteria 10512
67 Ga0070668_100112350 3300005347 Bacteria 2170
68 Ga0070668_100136264 3300005347 Bacteria 1975
69 Ga0070669_100016249 3300005353 Bacteria 5308
70 Ga0070669_100091495 3300005353 Bacteria 2281
71 Ga0070675_100499029 3300005354 Bacteria 1096
72 Ga0070675_101475654 3300005354 Bacteria 627
73 Ga0070675_102013202 3300005354 Bacteria 533
74 Ga0070671_100002896 3300005355 Bacteria 13357
75 Ga0070671_100003087 3300005355 Bacteria 12960
76 Ga0070671_100027435 3300005355 Bacteria 4688
77 Ga0070671_100059138 3300005355 Bacteria 3189
78 Ga0070671_100059877 3300005355 Bacteria 3169
79 Ga0070671_100066201 3300005355 Bacteria 3011
80 Ga0070671_100178201 3300005355 Bacteria 1799
81 Ga0070671_100313495 3300005355 Bacteria 1336
82 Ga0070671_100380928 3300005355 Bacteria 1206
83 Ga0070671_101299618 3300005355 Unclassified 641
84 Ga0070674_100011647 3300005356 Bacteria 5361
85 Ga0070674_100081176 3300005356 Bacteria 2317
86 Ga0070674_100097187 3300005356 Bacteria 2138
87 Ga0070674_100119938 3300005356 Bacteria 1946
88 Ga0070674_100339870 3300005356 Bacteria 1209
89 Ga0070674_101731501 3300005356 Bacteria 566
90 Ga0070673_100011053 3300005364 Bacteria 6149
91 Ga0070673_100022961 3300005364 Bacteria 4551
92 Ga0070673_100104094 3300005364 Bacteria 2343
93 Ga0070673_100371344 3300005364 Bacteria 1274
94 Ga0070673_100696162 3300005364 Bacteria 933
95 Ga0070673_101392564 3300005364 Bacteria 660
96 Ga0070673_102318906 3300005364 Bacteria 510
97 Ga0070659_100006023 3300005366 Bacteria 8743
98 Ga0070659_100014006 3300005366 Bacteria 5985
99 Ga0070659_100015331 3300005366 Bacteria 5740
100 Ga0070659_100030454 3300005366 Bacteria 4177
101 Ga0070659_100174859 3300005366 Bacteria 1760
102 Ga0070659_100223854 3300005366 Bacteria 1554
103 Ga0070659_100551485 3300005366 Bacteria 987
104 Ga0070659_101140756 3300005366 Bacteria 688
105 Ga0070667_100011528 3300005367 Bacteria 7308
106 Ga0070667_100116248 3300005367 Bacteria 2323
107 Ga0070667_100319020 3300005367 Bacteria 1402
108 Ga0070667_100415702 3300005367 Bacteria 1225
109 Ga0070667_100795898 3300005367 Bacteria 878
110 Ga0070667_101816406 3300005367 Unclassified 574
111 Ga0070703_10528058 3300005406 Bacteria 535
112 Ga0070714_100038969 3300005435 Bacteria 3999
113 Ga0070713_102276255 3300005436 Bacteria 524
114 Ga0070705_100248088 3300005440 Bacteria 1248
115 Ga0070700_100484158 3300005441 Bacteria 948
116 Ga0070663_100030392 3300005455 Bacteria 3701
117 Ga0070663_100080310 3300005455 Bacteria 2395
118 Ga0070663_100138281 3300005455 Bacteria 1857
119 Ga0070663_100138820 3300005455 Bacteria 1853
120 Ga0070663_100492254 3300005455 Bacteria 1017
121 Ga0070663_100568611 3300005455 Bacteria 950
122 Ga0070663_100587933 3300005455 Bacteria 935
123 Ga0070663_100828172 3300005455 Bacteria 795
124 Ga0070663_101177204 3300005455 Bacteria 673
125 Ga0070678_100003214 3300005456 Bacteria 9068
126 Ga0070678_100052107 3300005456 Bacteria 2970
127 Ga0070678_100763206 3300005456 Bacteria 875
128 Ga0070662_100008232 3300005457 Bacteria 6790
129 Ga0070662_100027862 3300005457 Bacteria 3928
130 Ga0070662_100047133 3300005457 Bacteria 3099
131 Ga0070662_100050854 3300005457 Bacteria 2990
132 Ga0070662_100116544 3300005457 Bacteria 2042
133 Ga0070662_100127093 3300005457 Bacteria 1961
134 Ga0070662_100149126 3300005457 Bacteria 1819
135 Ga0070662_100469831 3300005457 Bacteria 1046
136 Ga0070662_100753904 3300005457 Bacteria 826
137 Ga0070662_100955457 3300005457 Bacteria 733
138 Ga0070662_100957471 3300005457 Bacteria 732
139 Ga0070662_101449773 3300005457 Bacteria 592
140 Ga0070681_10034249 3300005458 Bacteria 5101
141 Ga0070681_10216233 3300005458 Bacteria 1832
142 Ga0070681_10244658 3300005458 Bacteria 1707
143 Ga0068867_100003727 3300005459 Bacteria 10724
144 Ga0068867_100009758 3300005459 Bacteria 6765
145 Ga0068867_100011300 3300005459 Bacteria 6298
146 Ga0068867_100301555 3300005459 Bacteria 1321
147 Ga0068867_100500657 3300005459 Bacteria 1044
148 Ga0070706_100209129 3300005467 Bacteria 1822
149 Ga0070679_100336185 3300005530 Bacteria 1458
150 Ga0070679_100582314 3300005530 Bacteria 1063
151 Ga0070679_100974055 3300005530 Bacteria 792
152 Ga0070679_101247843 3300005530 Bacteria 689
153 Ga0070679_101520204 3300005530 Bacteria 616
154 Ga0070684_100433456 3300005535 Bacteria 1214
155 Ga0068853_100050171 3300005539 Bacteria 3589
156 Ga0068853_100487239 3300005539 Bacteria 1163
157 Ga0068853_100888068 3300005539 Bacteria 856
158 Ga0068853_101672803 3300005539 Unclassified 617
159 Ga0070672_100052655 3300005543 Bacteria 3179
160 Ga0070672_100431764 3300005543 Bacteria 1133
161 Ga0070672_100476246 3300005543 Bacteria 1078
162 Ga0070672_100866842 3300005543 Bacteria 797
163 Ga0070695_100011170 3300005545 Bacteria 5370
164 Ga0070696_100004394 3300005546 Bacteria 9405
165 Ga0070696_100020112 3300005546 Bacteria 4526
166 Ga0070696_100222395 3300005546 Bacteria 1417
167 Ga0070696_101372408 3300005546 Bacteria 602
168 Ga0070693_100017586 3300005547 Bacteria 3720
169 Ga0070693_100092633 3300005547 Bacteria 1825
170 Ga0070693_100118954 3300005547 Bacteria 1636
171 Ga0070665_100000785 3300005548 Bacteria 41798
172 Ga0070665_100079619 3300005548 Bacteria 3282
173 Ga0070665_100374571 3300005548 Bacteria 1431
174 Ga0070665_101738469 3300005548 Bacteria 631
175 Ga0070665_102224485 3300005548 Bacteria 552
176 Ga0068855_100229792 3300005563 Bacteria 2078
177 Ga0068855_100394417 3300005563 Bacteria 1518
178 Ga0068855_100429950 3300005563 Bacteria 1443
179 Ga0068855_101975258 3300005563 Bacteria 590
180 Ga0068855_102509242 3300005563 Bacteria 513
181 Ga0070664_100003416 3300005564 Bacteria 12825
182 Ga0070664_100005620 3300005564 Bacteria 10089
183 Ga0070664_100007027 3300005564 Bacteria 9084
184 Ga0070664_100100671 3300005564 Bacteria 2512
185 Ga0070664_100162660 3300005564 Bacteria 1975
186 Ga0070664_100215194 3300005564 Bacteria 1718
187 Ga0070664_100358586 3300005564 Bacteria 1327
188 Ga0070664_100534784 3300005564 Bacteria 1083
189 Ga0070664_100662015 3300005564 Bacteria 971
190 Ga0070664_100734325 3300005564 Bacteria 921
191 Ga0070664_101595611 3300005564 Bacteria 618
192 Ga0068857_100006626 3300005577 Bacteria 9948
193 Ga0068857_100010757 3300005577 Bacteria 7963
194 Ga0068857_100033123 3300005577 Bacteria 4569
195 Ga0068857_100213748 3300005577 Bacteria 1760
196 Ga0068854_100035685 3300005578 Bacteria 3482
197 Ga0068854_100046422 3300005578 Bacteria 3092
198 Ga0068854_100136917 3300005578 Bacteria 1875
199 Ga0068854_100787303 3300005578 Bacteria 828
200 Ga0068854_102132559 3300005578 Bacteria 518
201 Ga0068856_100134549 3300005614 Bacteria 2477
202 Ga0068856_100758017 3300005614 Bacteria 991
203 Ga0068856_101175507 3300005614 Bacteria 784
204 Ga0070702_100496965 3300005615 Bacteria 895
205 Ga0068852_100122539 3300005616 Bacteria 2383
206 Ga0068852_100323390 3300005616 Bacteria 1498
207 Ga0068852_100330037 3300005616 Bacteria 1484
208 Ga0068852_100984474 3300005616 Bacteria 862
209 Ga0068859_100031616 3300005617 Bacteria 5315
210 Ga0068859_100162511 3300005617 Bacteria 2312
211 Ga0068859_100243984 3300005617 Bacteria 1886
212 Ga0068859_101729035 3300005617 Bacteria 691
213 Ga0068859_101913516 3300005617 Bacteria 655
214 Ga0068864_100015969 3300005618 Bacteria 6247
215 Ga0068864_100025846 3300005618 Bacteria 4947
216 Ga0068864_100253660 3300005618 Bacteria 1634
217 Ga0068864_100271429 3300005618 Bacteria 1581
218 Ga0068864_100314354 3300005618 Bacteria 1469
219 Ga0068864_100544848 3300005618 Bacteria 1121
220 Ga0068864_100733877 3300005618 Bacteria 967
221 Ga0068864_101207447 3300005618 Bacteria 755
222 Ga0068866_10098353 3300005718 Bacteria 1609
223 Ga0068861_100630403 3300005719 Bacteria 988
224 Ga0068851_10009479 3300005834 Bacteria 4529
225 Ga0068851_10042686 3300005834 Bacteria 2284
226 Ga0068851_10084160 3300005834 Bacteria 1665
227 Ga0068851_10118403 3300005834 Bacteria 1421
228 Ga0068851_10357712 3300005834 Bacteria 851
229 Ga0068863_100003894 3300005841 Bacteria 14746
230 Ga0068863_100035175 3300005841 Bacteria 4772
231 Ga0068863_100282732 3300005841 Bacteria 1608
232 Ga0068863_101019038 3300005841 Bacteria 831
233 Ga0068863_101286743 3300005841 Bacteria 738
234 Ga0068858_100020526 3300005842 Bacteria 6174
235 Ga0068858_100433525 3300005842 Bacteria 1265
236 Ga0068858_100589575 3300005842 Bacteria 1078
237 Ga0068858_101391846 3300005842 Bacteria 691
238 Ga0068860_100027502 3300005843 Bacteria 5478
239 Ga0068860_100194469 3300005843 Bacteria 1964
240 Ga0068860_100283493 3300005843 Bacteria 1620
241 Ga0068860_102115491 3300005843 Bacteria 584
242 Ga0068862_100011622 3300005844 Bacteria 7264
243 Ga0068862_100025302 3300005844 Bacteria 4983
244 Ga0068862_100041195 3300005844 Bacteria 3930
245 Ga0068862_100516465 3300005844 Bacteria 1136
246 Ga0068862_100638174 3300005844 Bacteria 1026
247 Ga0068862_101360095 3300005844 Bacteria 713
248 Ga0068862_102707587 3300005844 Unclassified 507
249 Ga0081539_10024274 3300005985 Bacteria 3939
250 Ga0081539_10111840 3300005985 Bacteria 1373
251 Ga0081539_10215398 3300005985 Bacteria 877
252 Ga0070717_10089264 3300006028 Bacteria 2599
253 Ga0070715_10502398 3300006163 Bacteria 694
254 Ga0070716_100392697 3300006173 Bacteria 995
255 Ga0075369_10166144 3300006186 Unclassified 1012
256 Ga0097621_100012388 3300006237 Bacteria 6319
257 Ga0097621_100017678 3300006237 Bacteria 5422
258 Ga0097621_100751589 3300006237 Bacteria 901
259 Ga0068871_100018700 3300006358 Bacteria 5276
260 Ga0068871_100198259 3300006358 Bacteria 1732
261 Ga0068871_100220973 3300006358 Bacteria 1641
262 Ga0068871_100815928 3300006358 Bacteria 861
263 Ga0068871_101288497 3300006358 Bacteria 687
264 Ga0068871_101368608 3300006358 Bacteria 667
265 Ga0075428_101641064 3300006844 Bacteria 672
266 Ga0075429_100210845 3300006880 Bacteria 1702
267 Ga0068865_100090054 3300006881 Bacteria 2223
268 Ga0068865_100265185 3300006881 Bacteria 1361
269 Ga0068865_100632247 3300006881 Bacteria 908
270 Ga0097620_100031616 3300006931 Bacteria 5315
271 Ga0097620_100162519 3300006931 Bacteria 2312
272 Ga0097620_100243965 3300006931 Bacteria 1886
273 Ga0097620_101728715 3300006931 Bacteria 691
274 Ga0097620_101913692 3300006931 Bacteria 655
275 Ga0105251_10038441 3300009011 Bacteria 2344
276 Ga0111539_10058536 3300009094 Bacteria 4571
277 Ga0105245_12591162 3300009098 Bacteria 560
278 Ga0105247_10115081 3300009101 Bacteria 1735
279 Ga0105247_11764509 3300009101 Bacteria 514
280 Ga0105243_10014560 3300009148 Bacteria 5951
281 Ga0105243_10161300 3300009148 Bacteria 1933
282 Ga0105243_12705856 3300009148 Bacteria 536
283 Ga0105241_10065092 3300009174 Bacteria 2816
284 Ga0105242_10863468 3300009176 Bacteria 902
285 Ga0105242_11004428 3300009176 Bacteria 842
286 Ga0105248_10012350 3300009177 Bacteria 9425
287 Ga0105248_10022027 3300009177 Bacteria 7061
288 Ga0105248_10055018 3300009177 Bacteria 4463
289 Ga0105248_10136957 3300009177 Bacteria 2762
290 Ga0105248_10165154 3300009177 Bacteria 2496
291 Ga0105248_10694864 3300009177 Bacteria 1148
292 Ga0105248_11109947 3300009177 Bacteria 894
293 Ga0105248_11481423 3300009177 Bacteria 768
294 Ga0105248_11529196 3300009177 Bacteria 756
295 Ga0105248_13149114 3300009177 Bacteria 525
296 Ga0105237_10027499 3300009545 Bacteria 5805
297 Ga0105238_10262621 3300009551 Bacteria 1706
298 Ga0105238_10397575 3300009551 Bacteria 1371
299 Ga0105238_10619381 3300009551 Bacteria 1091
300 Ga0105249_10121432 3300009553 Bacteria 2483
301 Ga0105249_10620954 3300009553 Bacteria 1137
302 Ga0105239_12964624 3300010375 Bacteria 553
303 Ga0105246_10485246 3300011119 Bacteria 1046
304 Ga0157319_1021488 3300012497 Bacteria 631
305 Ga0157327_1033179 3300012512 Unclassified 656
306 Ga0157327_1052598 3300012512 Bacteria 584
307 Ga0157373_10115471 3300013100 Bacteria 1887
308 Ga0157373_10127536 3300013100 Bacteria 1789
309 Ga0157373_10281258 3300013100 Bacteria 1179
310 Ga0157373_10291242 3300013100 Bacteria 1158
311 Ga0157373_10606145 3300013100 Bacteria 797
312 Ga0157373_10649093 3300013100 Bacteria 771
313 Ga0157373_10828818 3300013100 Bacteria 683
314 Ga0157373_11073364 3300013100 Bacteria 603
315 Ga0157373_11556013 3300013100 Bacteria 506
316 Ga0157371_10409949 3300013102 Bacteria 992
317 Ga0157371_10487610 3300013102 Bacteria 909
318 Ga0157371_10529056 3300013102 Bacteria 872
319 Ga0157371_10551216 3300013102 Bacteria 855
320 Ga0157371_11300961 3300013102 Bacteria 562
321 Ga0157370_10111211 3300013104 Bacteria 2561
322 Ga0157370_10201071 3300013104 Bacteria 1848
323 Ga0157369_10382418 3300013105 Bacteria 1461
324 Ga0157369_10590332 3300013105 Bacteria 1147
325 Ga0157374_10122097 3300013296 Bacteria 2515
326 Ga0157374_12130581 3300013296 Bacteria 588
327 Ga0163162_10081734 3300013306 Bacteria 3302
328 Ga0163162_10589954 3300013306 Bacteria 1238
329 Ga0163162_10641825 3300013306 Bacteria 1186
330 Ga0163162_11531835 3300013306 Bacteria 760
331 Ga0157372_10142218 3300013307 Bacteria 2765
332 Ga0157372_10196510 3300013307 Bacteria 2336
333 Ga0157372_10935308 3300013307 Bacteria 1005
334 Ga0157372_10961001 3300013307 Bacteria 990
335 Ga0157372_11074758 3300013307 Bacteria 931
336 Ga0157372_11960692 3300013307 Bacteria 673
337 Ga0157372_12610635 3300013307 Unclassified 580
338 Ga0157375_10396925 3300013308 Unclassified 1546
339 Ga0157375_11058544 3300013308 Bacteria 948
340 Ga0163163_10173671 3300014325 Bacteria 2201
341 Ga0163163_10274780 3300014325 Bacteria 1736
342 Ga0157380_10010723 3300014326 Bacteria 6604
343 Ga0182008_10045746 3300014497 Bacteria 2176
344 Ga0157377_10153597 3300014745 Bacteria 1425
345 Ga0157377_10594837 3300014745 Bacteria 788
346 Ga0157377_11726193 3300014745 Unclassified 506
347 Ga0157379_10006649 3300014968 Bacteria 9978
348 Ga0157379_10753369 3300014968 Bacteria 917
349 Ga0157379_10866178 3300014968 Bacteria 855
350 Ga0182006_1202542 3300015261 Bacteria 657
351 Ga0163161_10160190 3300017792 Bacteria 1716
352 Ga0163161_11131492 3300017792 Bacteria 674
353 Ga0213876_10361112 3300021384 Bacteria 772
354 Ga0207697_10034932 3300025315 Bacteria 2057
355 Ga0207697_10112929 3300025315 Bacteria 1164
356 Ga0207697_10392672 3300025315 Bacteria 616
357 Ga0207656_10002893 3300025321 Bacteria 5850
358 Ga0207656_10012184 3300025321 Bacteria 3265
359 Ga0207656_10256000 3300025321 Bacteria 859
360 Ga0207656_10748480 3300025321 Bacteria 501
361 Ga0207713_1207201 3300025735 Bacteria 598
362 Ga0207682_10436197 3300025893 Bacteria 620
363 Ga0207682_10490048 3300025893 Bacteria 582
364 Ga0207682_10518707 3300025893 Bacteria 564
365 Ga0207642_10062750 3300025899 Bacteria 1735
366 Ga0207710_10068091 3300025900 Bacteria 1627
367 Ga0207688_10842127 3300025901 Bacteria 581
368 Ga0207680_10144651 3300025903 Bacteria 1579
369 Ga0207680_10843903 3300025903 Bacteria 657
370 Ga0207647_10026662 3300025904 Bacteria 3777
371 Ga0207647_10046560 3300025904 Bacteria 2702
372 Ga0207647_10089230 3300025904 Bacteria 1840
373 Ga0207647_10328211 3300025904 Unclassified 868
374 Ga0207645_10000896 3300025907 Bacteria 24720
375 Ga0207645_10014320 3300025907 Bacteria 5311
376 Ga0207645_10287122 3300025907 Bacteria 1093
377 Ga0207645_10332604 3300025907 Bacteria 1015
378 Ga0207643_10428470 3300025908 Bacteria 839
379 Ga0207705_10001965 3300025909 Bacteria 16037
380 Ga0207705_10024198 3300025909 Bacteria 4334
381 Ga0207705_10061994 3300025909 Bacteria 2701
382 Ga0207705_10064531 3300025909 Bacteria 2646
383 Ga0207705_10086178 3300025909 Bacteria 2295
384 Ga0207705_10093412 3300025909 Bacteria 2205
385 Ga0207705_10105612 3300025909 Bacteria 2076
386 Ga0207705_10385583 3300025909 Bacteria 1083
387 Ga0207705_10546995 3300025909 Bacteria 900
388 Ga0207705_10924239 3300025909 Bacteria 675
389 Ga0207684_10278038 3300025910 Bacteria 1444
390 Ga0207654_10119268 3300025911 Bacteria 1654
391 Ga0207654_10249995 3300025911 Bacteria 1188
392 Ga0207707_10981200 3300025912 Bacteria 694
393 Ga0207707_10988102 3300025912 Bacteria 691
394 Ga0207707_11599366 3300025912 Bacteria 513
395 Ga0207671_10129455 3300025914 Bacteria 1936
396 Ga0207660_10073102 3300025917 Bacteria 2499
397 Ga0207660_11613543 3300025917 Bacteria 523
398 Ga0207662_10033903 3300025918 Bacteria 2979
399 Ga0207662_10853135 3300025918 Bacteria 643
400 Ga0207657_10007272 3300025919 Bacteria 11370
401 Ga0207657_10024029 3300025919 Bacteria 5659
402 Ga0207657_10044314 3300025919 Bacteria 3911
403 Ga0207657_10159436 3300025919 Bacteria 1833
404 Ga0207657_10809192 3300025919 Bacteria 724
405 Ga0207649_10007872 3300025920 Bacteria 5799
406 Ga0207649_10017923 3300025920 Bacteria 4016
407 Ga0207649_10255400 3300025920 Bacteria 1264
408 Ga0207649_11182494 3300025920 Bacteria 604
409 Ga0207649_11476306 3300025920 Bacteria 538
410 Ga0207652_10195944 3300025921 Bacteria 1817
411 Ga0207652_10539151 3300025921 Bacteria 1049
412 Ga0207681_10005902 3300025923 Bacteria 7509
413 Ga0207681_10065848 3300025923 Bacteria 2506
414 Ga0207681_10091891 3300025923 Bacteria 2169
415 Ga0207681_10399550 3300025923 Bacteria 1110
416 Ga0207681_10732046 3300025923 Bacteria 824
417 Ga0207681_10765765 3300025923 Bacteria 805
418 Ga0207650_10048831 3300025925 Bacteria 3122
419 Ga0207650_10081807 3300025925 Bacteria 2450
420 Ga0207650_10483622 3300025925 Bacteria 1033
421 Ga0207650_10700098 3300025925 Bacteria 856
422 Ga0207650_10858081 3300025925 Bacteria 770
423 Ga0207650_10984972 3300025925 Bacteria 717
424 Ga0207659_10145992 3300025926 Bacteria 1842
425 Ga0207659_10388818 3300025926 Bacteria 1165
426 Ga0207659_11290601 3300025926 Bacteria 627
427 Ga0207659_11579333 3300025926 Bacteria 560
428 Ga0207700_10051185 3300025928 Bacteria 3081
429 Ga0207664_10108634 3300025929 Bacteria 2303
430 Ga0207644_10009935 3300025931 Bacteria 6261
431 Ga0207644_10078292 3300025931 Bacteria 2436
432 Ga0207644_10189458 3300025931 Bacteria 1616
433 Ga0207644_10377694 3300025931 Bacteria 1155
434 Ga0207644_10681091 3300025931 Bacteria 857
435 Ga0207644_11223885 3300025931 Bacteria 631
436 Ga0207644_11260195 3300025931 Unclassified 621
437 Ga0207690_10024491 3300025932 Bacteria 3780
438 Ga0207690_10069444 3300025932 Bacteria 2424
439 Ga0207690_10098069 3300025932 Bacteria 2087
440 Ga0207690_10110271 3300025932 Bacteria 1981
441 Ga0207690_10150582 3300025932 Bacteria 1724
442 Ga0207690_10208131 3300025932 Bacteria 1490
443 Ga0207690_10301700 3300025932 Bacteria 1253
444 Ga0207690_10613980 3300025932 Bacteria 889
445 Ga0207706_10002920 3300025933 Bacteria 16518
446 Ga0207706_10016973 3300025933 Bacteria 6568
447 Ga0207706_10038549 3300025933 Bacteria 4239
448 Ga0207706_10059182 3300025933 Bacteria 3374
449 Ga0207706_10073838 3300025933 Bacteria 2999
450 Ga0207706_10155651 3300025933 Bacteria 2010
451 Ga0207706_10327685 3300025933 Bacteria 1332
452 Ga0207706_10411954 3300025933 Bacteria 1171
453 Ga0207706_11175213 3300025933 Bacteria 638
454 Ga0207706_11265900 3300025933 Bacteria 611
455 Ga0207706_11437268 3300025933 Unclassified 565
456 Ga0207706_11571973 3300025933 Bacteria 534
457 Ga0207709_10110073 3300025935 Bacteria 1840
458 Ga0207709_10290075 3300025935 Bacteria 1212
459 Ga0207669_10043744 3300025937 Bacteria 2625
460 Ga0207669_10090941 3300025937 Bacteria 1986
461 Ga0207669_10399535 3300025937 Bacteria 1076
462 Ga0207704_10360987 3300025938 Bacteria 1134
463 Ga0207704_10380619 3300025938 Unclassified 1108
464 Ga0207704_10485232 3300025938 Bacteria 993
465 Ga0207704_10640618 3300025938 Bacteria 874
466 Ga0207665_10373449 3300025939 Bacteria 1081
467 Ga0207691_10061771 3300025940 Bacteria 3403
468 Ga0207691_10140129 3300025940 Bacteria 2132
469 Ga0207691_10463185 3300025940 Bacteria 1078
470 Ga0207691_10491554 3300025940 Bacteria 1042
471 Ga0207711_10032298 3300025941 Bacteria 4426
472 Ga0207711_10079401 3300025941 Bacteria 2864
473 Ga0207711_10779090 3300025941 Bacteria 891
474 Ga0207711_10782851 3300025941 Bacteria 889
475 Ga0207711_11888227 3300025941 Bacteria 540
476 Ga0207689_10073436 3300025942 Bacteria 2810
477 Ga0207689_10150703 3300025942 Bacteria 1917
478 Ga0207689_10196854 3300025942 Bacteria 1663
479 Ga0207689_11366308 3300025942 Bacteria 594
480 Ga0207661_10546516 3300025944 Bacteria 1061
481 Ga0207661_10799291 3300025944 Bacteria 868
482 Ga0207679_10012302 3300025945 Bacteria 5576
483 Ga0207679_10018820 3300025945 Bacteria 4633
484 Ga0207679_10081752 3300025945 Bacteria 2471
485 Ga0207679_10084641 3300025945 Bacteria 2434
486 Ga0207679_10168770 3300025945 Bacteria 1799
487 Ga0207679_10318644 3300025945 Bacteria 1346
488 Ga0207679_11062291 3300025945 Unclassified 743
489 Ga0207679_11811151 3300025945 Bacteria 558
490 Ga0207679_12066526 3300025945 Bacteria 518
491 Ga0207667_10264237 3300025949 Bacteria 1760
492 Ga0207667_10719321 3300025949 Bacteria 1000
493 Ga0207651_10006856 3300025960 Bacteria 6012
494 Ga0207651_10727003 3300025960 Bacteria 876
495 Ga0207651_10924344 3300025960 Unclassified 777
496 Ga0207651_11100033 3300025960 Bacteria 712
497 Ga0207651_11442595 3300025960 Bacteria 620
498 Ga0207668_10000070 3300025972 Bacteria 78666
499 Ga0207668_10237129 3300025972 Bacteria 1474
500 Ga0207668_11243370 3300025972 Bacteria 670
501 Ga0207668_11263272 3300025972 Bacteria 664
502 Ga0207668_11726148 3300025972 Bacteria 565
503 Ga0207640_10035015 3300025981 Bacteria 3139
504 Ga0207640_10959695 3300025981 Bacteria 750
505 Ga0207658_10004581 3300025986 Bacteria 9596
506 Ga0207658_10035124 3300025986 Bacteria 3588
507 Ga0207658_10044969 3300025986 Bacteria 3216
508 Ga0207658_11081175 3300025986 Bacteria 732
509 Ga0207677_10630678 3300026023 Bacteria 944
510 Ga0207677_12248673 3300026023 Unclassified 507
511 Ga0207703_10146263 3300026035 Bacteria 2056
512 Ga0207703_10163523 3300026035 Bacteria 1951
513 Ga0207639_10166842 3300026041 Bacteria 1861
514 Ga0207639_10305987 3300026041 Bacteria 1407
515 Ga0207639_10655743 3300026041 Bacteria 971
516 Ga0207678_10015045 3300026067 Bacteria 6807
517 Ga0207678_10148222 3300026067 Bacteria 2003
518 Ga0207678_10181273 3300026067 Bacteria 1798
519 Ga0207678_10400274 3300026067 Bacteria 1189
520 Ga0207678_10554615 3300026067 Bacteria 1005
521 Ga0207678_10583045 3300026067 Bacteria 980
522 Ga0207678_10856055 3300026067 Bacteria 803
523 Ga0207702_10005600 3300026078 Bacteria 10963
524 Ga0207702_10809414 3300026078 Bacteria 926
525 Ga0207641_10073932 3300026088 Bacteria 2938
526 Ga0207641_10097779 3300026088 Bacteria 2580
527 Ga0207641_10987317 3300026088 Bacteria 838
528 Ga0207641_11509909 3300026088 Bacteria 673
529 Ga0207641_11602943 3300026088 Bacteria 653
530 Ga0207648_10001147 3300026089 Bacteria 29705
531 Ga0207648_10013848 3300026089 Bacteria 7481
532 Ga0207648_10028525 3300026089 Bacteria 4947
533 Ga0207648_10237468 3300026089 Bacteria 1622
534 Ga0207648_11899547 3300026089 Bacteria 557
535 Ga0207676_10010550 3300026095 Bacteria 6584
536 Ga0207676_10180833 3300026095 Bacteria 1846
537 Ga0207676_10248481 3300026095 Bacteria 1600
538 Ga0207676_11844958 3300026095 Bacteria 603
539 Ga0207676_12231303 3300026095 Bacteria 545
540 Ga0207674_10000308 3300026116 Bacteria 62120
541 Ga0207674_10002878 3300026116 Bacteria 21384
542 Ga0207674_10009470 3300026116 Bacteria 11125
543 Ga0207674_10066032 3300026116 Bacteria 3645
544 Ga0207674_10238069 3300026116 Bacteria 1767
545 Ga0207675_100257119 3300026118 Bacteria 1692
546 Ga0207683_10024070 3300026121 Bacteria 5240
547 Ga0207683_10101882 3300026121 Bacteria 2563
548 Ga0207683_10114046 3300026121 Bacteria 2421
549 Ga0207683_10156523 3300026121 Bacteria 2058
550 Ga0207698_10201097 3300026142 Bacteria 1784
551 Ga0207698_11056276 3300026142 Bacteria 824
552 Ga0207698_11107684 3300026142 Bacteria 805
553 Ga0209974_10083763 3300027876 Bacteria 1100
554 Ga0268266_10000315 3300028379 Bacteria 76532
555 Ga0268266_10732274 3300028379 Bacteria 954
556 Ga0268266_10766762 3300028379 Bacteria 931
557 Ga0268266_10909639 3300028379 Bacteria 851
558 Ga0268266_11579413 3300028379 Bacteria 631
559 Ga0268265_10066103 3300028380 Bacteria 2794
560 Ga0268265_10079746 3300028380 Bacteria 2579
561 Ga0268265_10827079 3300028380 Bacteria 904
562 Ga0268265_10863786 3300028380 Bacteria 886
563 Ga0268264_10066329 3300028381 Bacteria 3043
564 Ga0268264_11786100 3300028381 Bacteria 625
565 Ga0307408_100011889 3300031548 Bacteria 5759
566 Ga0307408_100029310 3300031548 Bacteria 3812
567 Ga0307408_100401901 3300031548 Bacteria 1176
568 Ga0307408_100724948 3300031548 Bacteria 896
569 Ga0307408_101297580 3300031548 Bacteria 682
570 Ga0307405_10065406 3300031731 Bacteria 2314
571 Ga0307405_10173684 3300031731 Bacteria 1540
572 Ga0307405_10382513 3300031731 Bacteria 1096
573 Ga0307405_10400061 3300031731 Bacteria 1075
574 Ga0307405_10526524 3300031731 Bacteria 952
575 Ga0307405_10604455 3300031731 Bacteria 895
576 Ga0307405_11314789 3300031731 Bacteria 629
577 Ga0307413_10008886 3300031824 Bacteria 4773
578 Ga0307413_10018307 3300031824 Bacteria 3672
579 Ga0307413_10041265 3300031824 Bacteria 2700
580 Ga0307413_10060096 3300031824 Bacteria 2338
581 Ga0307413_10062051 3300031824 Bacteria 2310
582 Ga0307413_10068638 3300031824 Bacteria 2221
583 Ga0307413_10090035 3300031824 Bacteria 1995
584 Ga0307413_10093811 3300031824 Bacteria 1963
585 Ga0307413_10094504 3300031824 Bacteria 1957
586 Ga0307413_10140627 3300031824 Bacteria 1667
587 Ga0307413_10214573 3300031824 Bacteria 1400
588 Ga0307413_10460547 3300031824 Bacteria 1011
589 Ga0307413_10494498 3300031824 Bacteria 981
590 Ga0307413_10570072 3300031824 Bacteria 921
591 Ga0307413_11577875 3300031824 Bacteria 582
592 Ga0307413_12193465 3300031824 Bacteria 501
593 Ga0307410_10012027 3300031852 Bacteria 4981
594 Ga0307410_10035962 3300031852 Bacteria 3221
595 Ga0307410_10058215 3300031852 Bacteria 2634
596 Ga0307410_10059315 3300031852 Bacteria 2612
597 Ga0307410_10082864 3300031852 Bacteria 2257
598 Ga0307410_10153595 3300031852 Bacteria 1716
599 Ga0307410_10189258 3300031852 Bacteria 1564
600 Ga0307410_10433732 3300031852 Bacteria 1068
601 Ga0307410_10437324 3300031852 Bacteria 1064
602 Ga0307410_10467600 3300031852 Bacteria 1032
603 Ga0307410_10660891 3300031852 Bacteria 877
604 Ga0307410_11381946 3300031852 Unclassified 618
605 Ga0307410_11670068 3300031852 Bacteria 564
606 Ga0307406_10018474 3300031901 Bacteria 4075
607 Ga0307406_10043702 3300031901 Bacteria 2803
608 Ga0307406_10087952 3300031901 Bacteria 2084
609 Ga0307406_10298540 3300031901 Bacteria 1236
610 Ga0307406_10309011 3300031901 Bacteria 1218
611 Ga0307406_11731092 3300031901 Bacteria 554
612 Ga0307407_10025709 3300031903 Bacteria 3107
613 Ga0307407_10059415 3300031903 Bacteria 2227
614 Ga0307407_10088709 3300031903 Bacteria 1890
615 Ga0307407_10162004 3300031903 Bacteria 1465
616 Ga0307407_10397250 3300031903 Bacteria 988
617 Ga0307412_10133334 3300031911 Bacteria 1808
618 Ga0307412_10172699 3300031911 Bacteria 1617
619 Ga0307412_10374289 3300031911 Unclassified 1151
620 Ga0307412_10714590 3300031911 Bacteria 861
621 Ga0307412_10726617 3300031911 Bacteria 855
622 Ga0307412_11029944 3300031911 Bacteria 729
623 Ga0307412_11176782 3300031911 Bacteria 685
624 Ga0307412_11216157 3300031911 Unclassified 675
625 Ga0307412_11534390 3300031911 Bacteria 606
626 Ga0307409_100166809 3300031995 Bacteria 1933
627 Ga0307409_100188014 3300031995 Bacteria 1835
628 Ga0307409_100215525 3300031995 Bacteria 1729
629 Ga0307409_100216374 3300031995 Bacteria 1726
630 Ga0307409_100316452 3300031995 Bacteria 1459
631 Ga0307409_100342244 3300031995 Bacteria 1408
632 Ga0307409_100432532 3300031995 Bacteria 1265
633 Ga0307409_100662179 3300031995 Bacteria 1039
634 Ga0307409_100698213 3300031995 Bacteria 1013
635 Ga0307409_101211804 3300031995 Bacteria 778
636 Ga0307409_101218245 3300031995 Bacteria 776
637 Ga0307409_101369310 3300031995 Bacteria 733
638 Ga0307409_101459233 3300031995 Bacteria 711
639 Ga0307409_101646304 3300031995 Unclassified 670
640 Ga0307409_101796060 3300031995 Bacteria 642
641 Ga0307409_102175955 3300031995 Bacteria 584
642 Ga0307416_100011951 3300032002 Bacteria 5824
643 Ga0307416_100012629 3300032002 Bacteria 5700
644 Ga0307416_100124183 3300032002 Bacteria 2309
645 Ga0307416_100208353 3300032002 Bacteria 1862
646 Ga0307416_100323553 3300032002 Bacteria 1546
647 Ga0307416_100357784 3300032002 Bacteria 1480
648 Ga0307416_100414379 3300032002 Bacteria 1389
649 Ga0307416_100420958 3300032002 Unclassified 1380
650 Ga0307416_100835229 3300032002 Bacteria 1019
651 Ga0307416_100990658 3300032002 Bacteria 943
652 Ga0307416_102651869 3300032002 Bacteria 598
653 Ga0307416_103085616 3300032002 Unclassified 557
654 Ga0307414_10003689 3300032004 Bacteria 8209
655 Ga0307414_10027762 3300032004 Bacteria 3662
656 Ga0307414_10096978 3300032004 Bacteria 2207
657 Ga0307414_10189122 3300032004 Bacteria 1664
658 Ga0307414_10195532 3300032004 Bacteria 1640
659 Ga0307414_10229875 3300032004 Bacteria 1528
660 Ga0307414_10238328 3300032004 Bacteria 1504
661 Ga0307414_10276398 3300032004 Bacteria 1409
662 Ga0307414_10332344 3300032004 Bacteria 1298
663 Ga0307414_10524743 3300032004 Bacteria 1051
664 Ga0307414_10631204 3300032004 Unclassified 964
665 Ga0307414_11063029 3300032004 Bacteria 746
666 Ga0307414_12070186 3300032004 Bacteria 531
667 Ga0307414_12108842 3300032004 Bacteria 526
668 Ga0307411_10001276 3300032005 Bacteria 10094
669 Ga0307411_10012473 3300032005 Bacteria 4639
670 Ga0307411_10032088 3300032005 Bacteria 3241
671 Ga0307411_10037558 3300032005 Bacteria 3046
672 Ga0307411_10066526 3300032005 Bacteria 2421
673 Ga0307411_10069353 3300032005 Bacteria 2380
674 Ga0307411_10077866 3300032005 Bacteria 2271
675 Ga0307411_10121562 3300032005 Bacteria 1890
676 Ga0307411_10256952 3300032005 Bacteria 1377
677 Ga0307411_10283152 3300032005 Bacteria 1320
678 Ga0307411_10433125 3300032005 Bacteria 1095
679 Ga0307411_10778678 3300032005 Bacteria 840
680 Ga0307411_10801155 3300032005 Bacteria 829
681 Ga0307411_10927361 3300032005 Bacteria 775
682 Ga0307411_11013980 3300032005 Bacteria 744
683 Ga0307411_11017938 3300032005 Bacteria 742
684 Ga0307411_11174542 3300032005 Bacteria 695
685 Ga0307415_100042173 3300032126 Bacteria 3035
686 Ga0307415_100058166 3300032126 Bacteria 2660
687 Ga0307415_100065070 3300032126 Bacteria 2539
688 Ga0307415_100126970 3300032126 Unclassified 1924
689 Ga0307415_100150070 3300032126 Bacteria 1793
690 Ga0307415_100233595 3300032126 Bacteria 1482
691 Ga0307415_100385674 3300032126 Bacteria 1191
692 Ga0307415_100541826 3300032126 Bacteria 1025
693 Ga0307415_101824770 3300032126 Bacteria 589
694 Ga0373959_0140115 3300034820 Bacteria 605
695 Ga0395899_0136060 3300037312 Unclassified 1751
696 Ga0395899_0432078 3300037312 Unclassified 866
697 Ga0395899_0454091 3300037312 Bacteria 839
698 Ga0395899_0585588 3300037312 Bacteria 712
699 Ga0395899_0875507 3300037312 Unclassified 549
700 Ga0395900_0000325 3300037418 Bacteria 70579
701 Ga0395900_0026676 3300037418 Bacteria 5914
702 Ga0395900_0083036 3300037418 Bacteria 3291
703 Ga0395900_0187845 3300037418 Bacteria 2097
704 Ga0395900_0224583 3300037418 Bacteria 1891
705 Ga0395900_0323105 3300037418 Bacteria 1523
706 Ga0395900_0353400 3300037418 Bacteria 1443
707 Ga0395900_0422645 3300037418 Bacteria 1293
708 Ga0395898_0059038 3300037466 Bacteria 3734
709 Ga0395905_0000218 3300037471 Bacteria 87745
710 Ga0395905_0002116 3300037471 Bacteria 22546
711 Ga0395905_0024115 3300037471 Bacteria 5741
712 Ga0395905_0045805 3300037471 Bacteria 4102
713 Ga0395905_0071455 3300037471 Bacteria 3253
714 Ga0395905_0125488 3300037471 Bacteria 2413
715 Ga0395905_0218635 3300037471 Bacteria 1783
716 Ga0395905_0340328 3300037471 Bacteria 1391
717 Ga0395905_0583364 3300037471 Bacteria 1019
718 Ga0395905_0638584 3300037471 Bacteria 966
719 Ga0395905_0775783 3300037471 Bacteria 861
720 Ga0395905_1158123 3300037471 Bacteria 677
721 Ga0395905_1627359 3300037471 Bacteria 551
722 Ga0395901_0000962 3300038443 Bacteria 31358
723 Ga0395901_0059700 3300038443 Bacteria 3968
724 Ga0395901_0114055 3300038443 Unclassified 2838
725 Ga0395901_0163469 3300038443 Bacteria 2337
726 Ga0395901_0280439 3300038443 Bacteria 1731
727 Ga0395901_0356774 3300038443 Bacteria 1508
728 Ga0395901_0449364 3300038443 Bacteria 1318
729 Ga0395901_1247514 3300038443 Bacteria 707
730 Ga0395901_1986034 3300038443 Bacteria 528
731 Ga0436365_1446270 3300039437 Bacteria 1293
732 Ga0439436_0092581 3300041404 Bacteria 842
733 Ga0439436_0263724 3300041404 Bacteria 502
734 Ga0439447_080412 3300041407 Unclassified 753
735 Ga0439461_0113694 3300041410 Bacteria 671
736 Ga0450890_003198 3300042127 Bacteria 2187
737 Ga0450902_080904 3300042137 Bacteria 571
738 Ga0450905_001426 3300042142 Bacteria 3052
739 Ga0450889_001073 3300042144 Bacteria 2870
740 Ga0439464_0001273 3300042439 Bacteria 5861
741 Ga0439460_0285751 3300042461 Bacteria 575
742 Ga0466972_0172332 3300044658 Bacteria 1015
743 Ga0466965_0408229 3300044683 Bacteria 751
744 Ga0466965_0869016 3300044683 Bacteria 525
745 Ga0466957_1102527 3300044842 Bacteria 572
746 Ga0466960_0079354 3300044901 Bacteria 1650
747 Ga0495629_0959256 3300046459 Bacteria 558
748 Ga0495596_0070445 3300046500 Bacteria 1359
749 Ga0495596_0179050 3300046500 Unclassified 824
750 Ga0495663_0030415 3300046525 Bacteria 1600
751 Ga0495663_0043479 3300046525 Bacteria 1372
752 Ga0495663_0065241 3300046525 Bacteria 1150
753 Ga0495663_0097656 3300046525 Bacteria 964
754 Ga0495598_0163450 3300046537 Bacteria 785
755 Ga0495621_0007454 3300046539 Bacteria 3240
756 Ga0495621_0060120 3300046539 Bacteria 1377
757 Ga0495621_0512259 3300046539 Bacteria 518
758 Ga0495633_0006238 3300046558 Bacteria 7118
759 Ga0495656_0776576 3300046615 Bacteria 517
760 Ga0495668_0012970 3300046616 Bacteria 4933
761 Ga0495668_0361688 3300046616 Bacteria 797
762 Ga0495659_0022463 3300046664 Bacteria 2135
763 Ga0495669_0001299 3300046684 Bacteria 10357
764 Ga0495669_0042121 3300046684 Bacteria 2029
765 Ga0495669_0126167 3300046684 Bacteria 1202
766 Ga0495669_0160775 3300046684 Bacteria 1066
767 Ga0495669_0295848 3300046684 Bacteria 780
768 Ga0495670_0015020 3300046691 Bacteria 3810
769 Ga0495670_0102544 3300046691 Bacteria 1474
770 Ga0495670_0466437 3300046691 Bacteria 685
771 Ga0495636_0613997 3300047318 Bacteria 532
772 Ga0495677_0046311 3300047445 Bacteria 1596
773 Ga0495677_0051784 3300047445 Bacteria 1512
774 Ga0495685_197201 3300047447 Bacteria 646
775 Ga0495685_198761 3300047447 Bacteria 643
776 Ga0496100_0099324 3300048903 Bacteria 2003
777 Ga0496100_1105223 3300048903 Bacteria 625
778 Ga0496101_0775627 3300048904 Bacteria 756
779 Ga0496101_0940404 3300048904 Bacteria 680
780 Ga0496102_0116691 3300048905 Bacteria 2491
781 Ga0496102_0565731 3300048905 Bacteria 1059
782 Ga0496103_0007362 3300048906 Bacteria 6560
783 Ga0496103_0209985 3300048906 Bacteria 1252
784 Ga0496103_0254231 3300048906 Bacteria 1131
785 Ga0496104_0166791 3300048907 Bacteria 2112
786 Ga0496104_0623810 3300048907 Bacteria 988
787 Ga0496104_1089069 3300048907 Bacteria 703
788 Ga0496104_1108729 3300048907 Unclassified 695
789 Ga0496105_0251475 3300048908 Bacteria 1432
790 Ga0496105_0787608 3300048908 Bacteria 724
791 Ga0496105_1217246 3300048908 Bacteria 554
792 Ga0496106_0482926 3300048909 Unclassified 995
793 Ga0496107_0043298 3300048910 Bacteria 3234
794 Ga0496107_0149558 3300048910 Bacteria 1727
795 Ga0496107_0488575 3300048910 Bacteria 913
796 Ga0496107_0883511 3300048910 Bacteria 652
797 Ga0496108_0010565 3300048911 Bacteria 7495
798 Ga0496108_0039973 3300048911 Bacteria 3908
799 Ga0496108_0906935 3300048911 Bacteria 756
800 Ga0496109_0008469 3300048912 Bacteria 8743
801 Ga0496109_0045704 3300048912 Bacteria 3974
802 Ga0496109_1858705 3300048912 Bacteria 535
803 Ga0496110_0002515 3300048913 Bacteria 13774
804 Ga0496110_0023537 3300048913 Bacteria 5240
805 Ga0496110_0070841 3300048913 Bacteria 3090
806 Ga0496110_0475117 3300048913 Bacteria 1139
807 Ga0496111_0003916 3300048914 Bacteria 9331
808 Ga0496111_0007201 3300048914 Bacteria 7273
809 Ga0496111_0063305 3300048914 Bacteria 2682
810 Ga0496112_0003787 3300048915 Bacteria 12636
811 Ga0496112_0066201 3300048915 Bacteria 3565
812 Ga0496112_0067093 3300048915 Bacteria 3540
813 Ga0496112_0756531 3300048915 Bacteria 898
814 Ga0496112_0876435 3300048915 Bacteria 820
815 Ga0496112_0940316 3300048915 Bacteria 785
816 Ga0496113_0002425 3300048916 Bacteria 10840
817 Ga0501067_0033983 3300049583 Bacteria 2830
818 Ga0501067_0826484 3300049583 Bacteria 522
819 Ga0501068_0876301 3300049584 Bacteria 590
820 Ga0501069_0486446 3300049585 Bacteria 735
821 Ga0501202_039918 3300049652 Bacteria 1010
822 Ga0501207_106283 3300049654 Bacteria 569
823 Ga0501209_021727 3300049656 Bacteria 1530
824 Ga0501216_191078 3300049660 Bacteria 503
825 Ga0501235_010718 3300049669 Bacteria 2004
826 Ga0501235_037664 3300049669 Bacteria 1101
827 Ga0501242_014640 3300049674 Bacteria 972
828 Ga0501253_123161 3300049683 Bacteria 630
829 Ga0501257_041658 3300049686 Unclassified 1129
830 Ga0501258_061312 3300049687 Bacteria 544
831 Ga0501259_206948 3300049688 Bacteria 504
832 Ga0501221_012393 3300049704 Bacteria 1551
833 Ga0501221_216071 3300049704 Bacteria 539
834 Ga0501225_0041815 3300049705 Bacteria 1265
835 Ga0501225_0345578 3300049705 Bacteria 514
836 Ga0501268_008468 3300049765 Bacteria 1559
837 Ga0501272_023855 3300049769 Bacteria 747
838 Ga0501273_030918 3300049770 Bacteria 762
839 Ga0501279_078600 3300049775 Bacteria 566
840 nmdc:mga05p37_1177585_c1 3300050507 Bacteria 794
841 nmdc:mga09592_161265_c1 3300050508 Bacteria 1937
842 nmdc:mga09592_971207_c1 3300050508 Bacteria 711
843 nmdc:mga08y16_133627_c1 3300050511 Bacteria 2579
844 nmdc:mga08y16_752069_c1 3300050511 Bacteria 971
845 nmdc:mga0n895_1974672_c1 3300050512 Bacteria 541
846 nmdc:mga0rr50_1018523_c1 3300050513 Bacteria 705
847 nmdc:mga0sz30_152865_c1 3300050516 Unclassified 1021
848 Ga0500658_0000041 3300053134 Bacteria 77435
849 Ga0466960_0394845
850 CNAas_1009794
851 JGI24736J21556_1063138
852 JGI24740J21852_10136104
853 JGI24739J22299_10153601
854 JGI24737J22298_10032027
855 JGI24737J22298_10246022
856 JGI24735J21928_10008884
857 JGI24735J21928_10018161
858 rootH1_10233400
859 Ga0070658_10048462
860 Ga0070658_10139741
861 Ga0070658_10374215
862 Ga0070658_10712416
863 Ga0070658_10756568
864 Ga0070658_11312374
865 Ga0070676_10000509
866 Ga0070676_10018872
867 Ga0070676_10104474
868 Ga0070676_10224342
869 Ga0070676_10348171
870 Ga0070683_100096580
871 Ga0070683_100697847
872 Ga0070683_101118406
873 Ga0070690_100557112
874 Ga0070690_100987582
875 Ga0070670_100008324
876 Ga0070670_100090749
877 Ga0070670_100116328
878 Ga0070670_100257627
879 Ga0070670_100831531
880 Ga0070670_101999614
881 Ga0070677_10555225
882 Ga0070677_10602858
883 Ga0070677_10721637
884 Ga0068869_100028374
885 Ga0068869_100075541
886 Ga0068869_100567022
887 Ga0070666_10275760
888 Ga0070666_10532349
889 Ga0070666_11227282
890 Ga0070680_100260887
891 Ga0070680_100324275
892 Ga0070680_101666829
893 Ga0070682_100056000
894 Ga0070682_100203586
895 Ga0070682_100354453
896 Ga0068868_100616083
897 Ga0070660_100059424
898 Ga0070660_100075646
899 Ga0070660_100078186
900 Ga0070660_100212206
901 Ga0070660_100358965
902 Ga0070660_100574384
903 Ga0070660_101366808
904 Ga0070691_10114126
905 Ga0070687_100769781
906 Ga0070661_100009966
907 Ga0070661_100147216
908 Ga0070661_100243216
909 Ga0070661_100296444
910 Ga0070661_100876166
911 Ga0070661_100980028
912 Ga0070692_10043292
913 Ga0070692_11177350
914 Ga0070668_100004342
915 Ga0070668_100112350
916 Ga0070668_100136264
917 Ga0070669_100016249
918 Ga0070669_100091495
919 Ga0070675_100499029
920 Ga0070675_101475654
921 Ga0070675_102013202
922 Ga0070671_100002896
923 Ga0070671_100003087
924 Ga0070671_100027435
925 Ga0070671_100059138
926 Ga0070671_100059877
927 Ga0070671_100066201
928 Ga0070671_100178201
929 Ga0070671_100313495
930 Ga0070671_100380928
931 Ga0070671_101299618
932 Ga0070674_100011647
933 Ga0070674_100081176
934 Ga0070674_100097187
935 Ga0070674_100119938
936 Ga0070674_100339870
937 Ga0070674_101731501
938 Ga0070673_100011053
939 Ga0070673_100022961
940 Ga0070673_100104094
941 Ga0070673_100371344
942 Ga0070673_100696162
943 Ga0070673_101392564
944 Ga0070673_102318906
945 Ga0070659_100006023
946 Ga0070659_100014006
947 Ga0070659_100015331
948 Ga0070659_100030454
949 Ga0070659_100174859
950 Ga0070659_100223854
951 Ga0070659_100551485
952 Ga0070659_101140756
953 Ga0070667_100011528
954 Ga0070667_100116248
955 Ga0070667_100319020
956 Ga0070667_100415702
957 Ga0070667_100795898
958 Ga0070667_101816406
959 Ga0070703_10528058
960 Ga0070714_100038969
961 Ga0070713_102276255
962 Ga0070705_100248088
963 Ga0070700_100484158
964 Ga0070663_100030392
965 Ga0070663_100080310
966 Ga0070663_100138281
967 Ga0070663_100138820
968 Ga0070663_100492254
969 Ga0070663_100568611
970 Ga0070663_100587933
971 Ga0070663_100828172
972 Ga0070663_101177204
973 Ga0070678_100003214
974 Ga0070678_100052107
975 Ga0070678_100763206
976 Ga0070662_100008232
977 Ga0070662_100027862
978 Ga0070662_100047133
979 Ga0070662_100050854
980 Ga0070662_100116544
981 Ga0070662_100127093
982 Ga0070662_100149126
983 Ga0070662_100469831
984 Ga0070662_100753904
985 Ga0070662_100955457
986 Ga0070662_100957471
987 Ga0070662_101449773
988 Ga0070681_10034249
989 Ga0070681_10216233
990 Ga0070681_10244658
991 Ga0068867_100003727
992 Ga0068867_100009758
993 Ga0068867_100011300
994 Ga0068867_100301555
995 Ga0068867_100500657
996 Ga0070706_100209129
997 Ga0070679_100336185
998 Ga0070679_100582314
999 Ga0070679_100974055
1000 Ga0070679_101247843
1001 Ga0070679_101520204
1002 Ga0070684_100433456
1003 Ga0068853_100050171
1004 Ga0068853_100487239
1005 Ga0068853_100888068
1006 Ga0068853_101672803
1007 Ga0070672_100052655
1008 Ga0070672_100431764
1009 Ga0070672_100476246
1010 Ga0070672_100866842
1011 Ga0070695_100011170
1012 Ga0070696_100004394
1013 Ga0070696_100020112
1014 Ga0070696_100222395
1015 Ga0070696_101372408
1016 Ga0070693_100017586
1017 Ga0070693_100092633
1018 Ga0070693_100118954
1019 Ga0070665_100000785
1020 Ga0070665_100079619
1021 Ga0070665_100374571
1022 Ga0070665_101738469
1023 Ga0070665_102224485
1024 Ga0068855_100229792
1025 Ga0068855_100394417
1026 Ga0068855_100429950
1027 Ga0068855_101975258
1028 Ga0068855_102509242
1029 Ga0070664_100003416
1030 Ga0070664_100005620
1031 Ga0070664_100007027
1032 Ga0070664_100100671
1033 Ga0070664_100162660
1034 Ga0070664_100215194
1035 Ga0070664_100358586
1036 Ga0070664_100534784
1037 Ga0070664_100662015
1038 Ga0070664_100734325
1039 Ga0070664_101595611
1040 Ga0068857_100006626
1041 Ga0068857_100010757
1042 Ga0068857_100033123
1043 Ga0068857_100213748
1044 Ga0068854_100035685
1045 Ga0068854_100046422
1046 Ga0068854_100136917
1047 Ga0068854_100787303
1048 Ga0068854_102132559
1049 Ga0068856_100134549
1050 Ga0068856_100758017
1051 Ga0068856_101175507
1052 Ga0070702_100496965
1053 Ga0068852_100122539
1054 Ga0068852_100323390
1055 Ga0068852_100330037
1056 Ga0068852_100984474
1057 Ga0068859_100031616
1058 Ga0068859_100162511
1059 Ga0068859_100243984
1060 Ga0068859_101729035
1061 Ga0068859_101913516
1062 Ga0068864_100015969
1063 Ga0068864_100025846
1064 Ga0068864_100253660
1065 Ga0068864_100271429
1066 Ga0068864_100314354
1067 Ga0068864_100544848
1068 Ga0068864_100733877
1069 Ga0068864_101207447
1070 Ga0068866_10098353
1071 Ga0068861_100630403
1072 Ga0068851_10009479
1073 Ga0068851_10042686
1074 Ga0068851_10084160
1075 Ga0068851_10118403
1076 Ga0068851_10357712
1077 Ga0068863_100003894
1078 Ga0068863_100035175
1079 Ga0068863_100282732
1080 Ga0068863_101019038
1081 Ga0068863_101286743
1082 Ga0068858_100020526
1083 Ga0068858_100433525
1084 Ga0068858_100589575
1085 Ga0068858_101391846
1086 Ga0068860_100027502
1087 Ga0068860_100194469
1088 Ga0068860_100283493
1089 Ga0068860_102115491
1090 Ga0068862_100011622
1091 Ga0068862_100025302
1092 Ga0068862_100041195
1093 Ga0068862_100516465
1094 Ga0068862_100638174
1095 Ga0068862_101360095
1096 Ga0068862_102707587
1097 Ga0081539_10024274
1098 Ga0081539_10111840
1099 Ga0081539_10215398
1100 Ga0070717_10089264
1101 Ga0070715_10502398
1102 Ga0070716_100392697
1103 Ga0075369_10166144
1104 Ga0097621_100012388
1105 Ga0097621_100017678
1106 Ga0097621_100751589
1107 Ga0068871_100018700
1108 Ga0068871_100198259
1109 Ga0068871_100220973
1110 Ga0068871_100815928
1111 Ga0068871_101288497
1112 Ga0068871_101368608
1113 Ga0075428_101641064
1114 Ga0075429_100210845
1115 Ga0068865_100090054
1116 Ga0068865_100265185
1117 Ga0068865_100632247
1118 Ga0097620_100031616
1119 Ga0097620_100162519
1120 Ga0097620_100243965
1121 Ga0097620_101728715
1122 Ga0097620_101913692
1123 Ga0105251_10038441
1124 Ga0111539_10058536
1125 Ga0105245_12591162
1126 Ga0105247_10115081
1127 Ga0105247_11764509
1128 Ga0105243_10014560
1129 Ga0105243_10161300
1130 Ga0105243_12705856
1131 Ga0105241_10065092
1132 Ga0105242_10863468
1133 Ga0105242_11004428
1134 Ga0105248_10012350
1135 Ga0105248_10022027
1136 Ga0105248_10055018
1137 Ga0105248_10136957
1138 Ga0105248_10165154
1139 Ga0105248_10694864
1140 Ga0105248_11109947
1141 Ga0105248_11481423
1142 Ga0105248_11529196
1143 Ga0105248_13149114
1144 Ga0105237_10027499
1145 Ga0105238_10262621
1146 Ga0105238_10397575
1147 Ga0105238_10619381
1148 Ga0105249_10121432
1149 Ga0105249_10620954
1150 Ga0105239_12964624
1151 Ga0105246_10485246
1152 Ga0157319_1021488
1153 Ga0157327_1033179
1154 Ga0157327_1052598
1155 Ga0157373_10115471
1156 Ga0157373_10127536
1157 Ga0157373_10281258
1158 Ga0157373_10291242
1159 Ga0157373_10606145
1160 Ga0157373_10649093
1161 Ga0157373_10828818
1162 Ga0157373_11073364
1163 Ga0157373_11556013
1164 Ga0157371_10409949
1165 Ga0157371_10487610
1166 Ga0157371_10529056
1167 Ga0157371_10551216
1168 Ga0157371_11300961
1169 Ga0157370_10111211
1170 Ga0157370_10201071
1171 Ga0157369_10382418
1172 Ga0157369_10590332
1173 Ga0157374_10122097
1174 Ga0157374_12130581
1175 Ga0163162_10081734
1176 Ga0163162_10589954
1177 Ga0163162_10641825
1178 Ga0163162_11531835
1179 Ga0157372_10142218
1180 Ga0157372_10196510
1181 Ga0157372_10935308
1182 Ga0157372_10961001
1183 Ga0157372_11074758
1184 Ga0157372_11960692
1185 Ga0157372_12610635
1186 Ga0157375_10396925
1187 Ga0157375_11058544
1188 Ga0163163_10173671
1189 Ga0163163_10274780
1190 Ga0157380_10010723
1191 Ga0182008_10045746
1192 Ga0157377_10153597
1193 Ga0157377_10594837
1194 Ga0157377_11726193
1195 Ga0157379_10006649
1196 Ga0157379_10753369
1197 Ga0157379_10866178
1198 Ga0182006_1202542
1199 Ga0163161_10160190
1200 Ga0163161_11131492
1201 Ga0213876_10361112
1202 Ga0207697_10034932
1203 Ga0207697_10112929
1204 Ga0207697_10392672
1205 Ga0207656_10002893
1206 Ga0207656_10012184
1207 Ga0207656_10256000
1208 Ga0207656_10748480
1209 Ga0207713_1207201
1210 Ga0207682_10436197
1211 Ga0207682_10490048
1212 Ga0207682_10518707
1213 Ga0207642_10062750
1214 Ga0207710_10068091
1215 Ga0207688_10842127
1216 Ga0207680_10144651
1217 Ga0207680_10843903
1218 Ga0207647_10026662
1219 Ga0207647_10046560
1220 Ga0207647_10089230
1221 Ga0207647_10328211
1222 Ga0207645_10000896
1223 Ga0207645_10014320
1224 Ga0207645_10287122
1225 Ga0207645_10332604
1226 Ga0207643_10428470
1227 Ga0207705_10001965
1228 Ga0207705_10024198
1229 Ga0207705_10061994
1230 Ga0207705_10064531
1231 Ga0207705_10086178
1232 Ga0207705_10093412
1233 Ga0207705_10105612
1234 Ga0207705_10385583
1235 Ga0207705_10546995
1236 Ga0207705_10924239
1237 Ga0207684_10278038
1238 Ga0207654_10119268
1239 Ga0207654_10249995
1240 Ga0207707_10981200
1241 Ga0207707_10988102
1242 Ga0207707_11599366
1243 Ga0207671_10129455
1244 Ga0207660_10073102
1245 Ga0207660_11613543
1246 Ga0207662_10033903
1247 Ga0207662_10853135
1248 Ga0207657_10007272
1249 Ga0207657_10024029
1250 Ga0207657_10044314
1251 Ga0207657_10159436
1252 Ga0207657_10809192
1253 Ga0207649_10007872
1254 Ga0207649_10017923
1255 Ga0207649_10255400
1256 Ga0207649_11182494
1257 Ga0207649_11476306
1258 Ga0207652_10195944
1259 Ga0207652_10539151
1260 Ga0207681_10005902
1261 Ga0207681_10065848
1262 Ga0207681_10091891
1263 Ga0207681_10399550
1264 Ga0207681_10732046
1265 Ga0207681_10765765
1266 Ga0207650_10048831
1267 Ga0207650_10081807
1268 Ga0207650_10483622
1269 Ga0207650_10700098
1270 Ga0207650_10858081
1271 Ga0207650_10984972
1272 Ga0207659_10145992
1273 Ga0207659_10388818
1274 Ga0207659_11290601
1275 Ga0207659_11579333
1276 Ga0207700_10051185
1277 Ga0207664_10108634
1278 Ga0207644_10009935
1279 Ga0207644_10078292
1280 Ga0207644_10189458
1281 Ga0207644_10377694
1282 Ga0207644_10681091
1283 Ga0207644_11223885
1284 Ga0207644_11260195
1285 Ga0207690_10024491
1286 Ga0207690_10069444
1287 Ga0207690_10098069
1288 Ga0207690_10110271
1289 Ga0207690_10150582
1290 Ga0207690_10208131
1291 Ga0207690_10301700
1292 Ga0207690_10613980
1293 Ga0207706_10002920
1294 Ga0207706_10016973
1295 Ga0207706_10038549
1296 Ga0207706_10059182
1297 Ga0207706_10073838
1298 Ga0207706_10155651
1299 Ga0207706_10327685
1300 Ga0207706_10411954
1301 Ga0207706_11175213
1302 Ga0207706_11265900
1303 Ga0207706_11437268
1304 Ga0207706_11571973
1305 Ga0207709_10110073
1306 Ga0207709_10290075
1307 Ga0207669_10043744
1308 Ga0207669_10090941
1309 Ga0207669_10399535
1310 Ga0207704_10360987
1311 Ga0207704_10380619
1312 Ga0207704_10485232
1313 Ga0207704_10640618
1314 Ga0207665_10373449
1315 Ga0207691_10061771
1316 Ga0207691_10140129
1317 Ga0207691_10463185
1318 Ga0207691_10491554
1319 Ga0207711_10032298
1320 Ga0207711_10079401
1321 Ga0207711_10779090
1322 Ga0207711_10782851
1323 Ga0207711_11888227
1324 Ga0207689_10073436
1325 Ga0207689_10150703
1326 Ga0207689_10196854
1327 Ga0207689_11366308
1328 Ga0207661_10546516
1329 Ga0207661_10799291
1330 Ga0207679_10012302
1331 Ga0207679_10018820
1332 Ga0207679_10081752
1333 Ga0207679_10084641
1334 Ga0207679_10168770
1335 Ga0207679_10318644
1336 Ga0207679_11062291
1337 Ga0207679_11811151
1338 Ga0207679_12066526
1339 Ga0207667_10264237
1340 Ga0207667_10719321
1341 Ga0207651_10006856
1342 Ga0207651_10727003
1343 Ga0207651_10924344
1344 Ga0207651_11100033
1345 Ga0207651_11442595
1346 Ga0207668_10000070
1347 Ga0207668_10237129
1348 Ga0207668_11243370
1349 Ga0207668_11263272
1350 Ga0207668_11726148
1351 Ga0207640_10035015
1352 Ga0207640_10959695
1353 Ga0207658_10004581
1354 Ga0207658_10035124
1355 Ga0207658_10044969
1356 Ga0207658_11081175
1357 Ga0207677_10630678
1358 Ga0207677_12248673
1359 Ga0207703_10146263
1360 Ga0207703_10163523
1361 Ga0207639_10166842
1362 Ga0207639_10305987
1363 Ga0207639_10655743
1364 Ga0207678_10015045
1365 Ga0207678_10148222
1366 Ga0207678_10181273
1367 Ga0207678_10400274
1368 Ga0207678_10554615
1369 Ga0207678_10583045
1370 Ga0207678_10856055
1371 Ga0207702_10005600
1372 Ga0207702_10809414
1373 Ga0207641_10073932
1374 Ga0207641_10097779
1375 Ga0207641_10987317
1376 Ga0207641_11509909
1377 Ga0207641_11602943
1378 Ga0207648_10001147
1379 Ga0207648_10013848
1380 Ga0207648_10028525
1381 Ga0207648_10237468
1382 Ga0207648_11899547
1383 Ga0207676_10010550
1384 Ga0207676_10180833
1385 Ga0207676_10248481
1386 Ga0207676_11844958
1387 Ga0207676_12231303
1388 Ga0207674_10000308
1389 Ga0207674_10002878
1390 Ga0207674_10009470
1391 Ga0207674_10066032
1392 Ga0207674_10238069
1393 Ga0207675_100257119
1394 Ga0207683_10024070
1395 Ga0207683_10101882
1396 Ga0207683_10114046
1397 Ga0207683_10156523
1398 Ga0207698_10201097
1399 Ga0207698_11056276
1400 Ga0207698_11107684
1401 Ga0209974_10083763
1402 Ga0268266_10000315
1403 Ga0268266_10732274
1404 Ga0268266_10766762
1405 Ga0268266_10909639
1406 Ga0268266_11579413
1407 Ga0268265_10066103
1408 Ga0268265_10079746
1409 Ga0268265_10827079
1410 Ga0268265_10863786
1411 Ga0268264_10066329
1412 Ga0268264_11786100
1413 Ga0307408_100011889
1414 Ga0307408_100029310
1415 Ga0307408_100401901
1416 Ga0307408_100724948
1417 Ga0307408_101297580
1418 Ga0307405_10065406
1419 Ga0307405_10173684
1420 Ga0307405_10382513
1421 Ga0307405_10400061
1422 Ga0307405_10526524
1423 Ga0307405_10604455
1424 Ga0307405_11314789
1425 Ga0307413_10008886
1426 Ga0307413_10018307
1427 Ga0307413_10041265
1428 Ga0307413_10060096
1429 Ga0307413_10062051
1430 Ga0307413_10068638
1431 Ga0307413_10090035
1432 Ga0307413_10093811
1433 Ga0307413_10094504
1434 Ga0307413_10140627
1435 Ga0307413_10214573
1436 Ga0307413_10460547
1437 Ga0307413_10494498
1438 Ga0307413_10570072
1439 Ga0307413_11577875
1440 Ga0307413_12193465
1441 Ga0307410_10012027
1442 Ga0307410_10035962
1443 Ga0307410_10058215
1444 Ga0307410_10059315
1445 Ga0307410_10082864
1446 Ga0307410_10153595
1447 Ga0307410_10189258
1448 Ga0307410_10433732
1449 Ga0307410_10437324
1450 Ga0307410_10467600
1451 Ga0307410_10660891
1452 Ga0307410_11381946
1453 Ga0307410_11670068
1454 Ga0307406_10018474
1455 Ga0307406_10043702
1456 Ga0307406_10087952
1457 Ga0307406_10298540
1458 Ga0307406_10309011
1459 Ga0307406_11731092
1460 Ga0307407_10025709
1461 Ga0307407_10059415
1462 Ga0307407_10088709
1463 Ga0307407_10162004
1464 Ga0307407_10397250
1465 Ga0307412_10133334
1466 Ga0307412_10172699
1467 Ga0307412_10374289
1468 Ga0307412_10714590
1469 Ga0307412_10726617
1470 Ga0307412_11029944
1471 Ga0307412_11176782
1472 Ga0307412_11216157
1473 Ga0307412_11534390
1474 Ga0307409_100166809
1475 Ga0307409_100188014
1476 Ga0307409_100215525
1477 Ga0307409_100216374
1478 Ga0307409_100316452
1479 Ga0307409_100342244
1480 Ga0307409_100432532
1481 Ga0307409_100662179
1482 Ga0307409_100698213
1483 Ga0307409_101211804
1484 Ga0307409_101218245
1485 Ga0307409_101369310
1486 Ga0307409_101459233
1487 Ga0307409_101646304
1488 Ga0307409_101796060
1489 Ga0307409_102175955
1490 Ga0307416_100011951
1491 Ga0307416_100012629
1492 Ga0307416_100124183
1493 Ga0307416_100208353
1494 Ga0307416_100323553
1495 Ga0307416_100357784
1496 Ga0307416_100414379
1497 Ga0307416_100420958
1498 Ga0307416_100835229
1499 Ga0307416_100990658
1500 Ga0307416_102651869
1501 Ga0307416_103085616
1502 Ga0307414_10003689
1503 Ga0307414_10027762
1504 Ga0307414_10096978
1505 Ga0307414_10189122
1506 Ga0307414_10195532
1507 Ga0307414_10229875
1508 Ga0307414_10238328
1509 Ga0307414_10276398
1510 Ga0307414_10332344
1511 Ga0307414_10524743
1512 Ga0307414_10631204
1513 Ga0307414_11063029
1514 Ga0307414_12070186
1515 Ga0307414_12108842
1516 Ga0307411_10001276
1517 Ga0307411_10012473
1518 Ga0307411_10032088
1519 Ga0307411_10037558
1520 Ga0307411_10066526
1521 Ga0307411_10069353
1522 Ga0307411_10077866
1523 Ga0307411_10121562
1524 Ga0307411_10256952
1525 Ga0307411_10283152
1526 Ga0307411_10433125
1527 Ga0307411_10778678
1528 Ga0307411_10801155
1529 Ga0307411_10927361
1530 Ga0307411_11013980
1531 Ga0307411_11017938
1532 Ga0307411_11174542
1533 Ga0307415_100042173
1534 Ga0307415_100058166
1535 Ga0307415_100065070
1536 Ga0307415_100126970
1537 Ga0307415_100150070
1538 Ga0307415_100233595
1539 Ga0307415_100385674
1540 Ga0307415_100541826
1541 Ga0307415_101824770
1542 Ga0373959_0140115
1543 Ga0395899_0136060
1544 Ga0395899_0432078
1545 Ga0395899_0454091
1546 Ga0395899_0585588
1547 Ga0395899_0875507
1548 Ga0395900_0000325
1549 Ga0395900_0026676
1550 Ga0395900_0083036
1551 Ga0395900_0187845
1552 Ga0395900_0224583
1553 Ga0395900_0323105
1554 Ga0395900_0353400
1555 Ga0395900_0422645
1556 Ga0395898_0059038
1557 Ga0395905_0000218
1558 Ga0395905_0002116
1559 Ga0395905_0024115
1560 Ga0395905_0045805
1561 Ga0395905_0071455
1562 Ga0395905_0125488
1563 Ga0395905_0218635
1564 Ga0395905_0340328
1565 Ga0395905_0583364
1566 Ga0395905_0638584
1567 Ga0395905_0775783
1568 Ga0395905_1158123
1569 Ga0395905_1627359
1570 Ga0395901_0000962
1571 Ga0395901_0059700
1572 Ga0395901_0114055
1573 Ga0395901_0163469
1574 Ga0395901_0280439
1575 Ga0395901_0356774
1576 Ga0395901_0449364
1577 Ga0395901_1247514
1578 Ga0395901_1986034
1579 Ga0436365_1446270
1580 Ga0439436_0092581
1581 Ga0439436_0263724
1582 Ga0439447_080412
1583 Ga0439461_0113694
1584 Ga0450890_003198
1585 Ga0450902_080904
1586 Ga0450905_001426
1587 Ga0450889_001073
1588 Ga0439464_0001273
1589 Ga0439460_0285751
1590 Ga0466972_0172332
1591 Ga0466965_0408229
1592 Ga0466965_0869016
1593 Ga0466957_1102527
1594 Ga0466960_0079354
1595 Ga0495629_0959256
1596 Ga0495596_0070445
1597 Ga0495596_0179050
1598 Ga0495663_0030415
1599 Ga0495663_0043479
1600 Ga0495663_0065241
1601 Ga0495663_0097656
1602 Ga0495598_0163450
1603 Ga0495621_0007454
1604 Ga0495621_0060120
1605 Ga0495621_0512259
1606 Ga0495633_0006238
1607 Ga0495656_0776576
1608 Ga0495668_0012970
1609 Ga0495668_0361688
1610 Ga0495659_0022463
1611 Ga0495669_0001299
1612 Ga0495669_0042121
1613 Ga0495669_0126167
1614 Ga0495669_0160775
1615 Ga0495669_0295848
1616 Ga0495670_0015020
1617 Ga0495670_0102544
1618 Ga0495670_0466437
1619 Ga0495636_0613997
1620 Ga0495677_0046311
1621 Ga0495677_0051784
1622 Ga0495685_197201
1623 Ga0495685_198761
1624 Ga0496100_0099324
1625 Ga0496100_1105223
1626 Ga0496101_0775627
1627 Ga0496101_0940404
1628 Ga0496102_0116691
1629 Ga0496102_0565731
1630 Ga0496103_0007362
1631 Ga0496103_0209985
1632 Ga0496103_0254231
1633 Ga0496104_0166791
1634 Ga0496104_0623810
1635 Ga0496104_1089069
1636 Ga0496104_1108729
1637 Ga0496105_0251475
1638 Ga0496105_0787608
1639 Ga0496105_1217246
1640 Ga0496106_0482926
1641 Ga0496107_0043298
1642 Ga0496107_0149558
1643 Ga0496107_0488575
1644 Ga0496107_0883511
1645 Ga0496108_0010565
1646 Ga0496108_0039973
1647 Ga0496108_0906935
1648 Ga0496109_0008469
1649 Ga0496109_0045704
1650 Ga0496109_1858705
1651 Ga0496110_0002515
1652 Ga0496110_0023537
1653 Ga0496110_0070841
1654 Ga0496110_0475117
1655 Ga0496111_0003916
1656 Ga0496111_0007201
1657 Ga0496111_0063305
1658 Ga0496112_0003787
1659 Ga0496112_0066201
1660 Ga0496112_0067093
1661 Ga0496112_0756531
1662 Ga0496112_0876435
1663 Ga0496112_0940316
1664 Ga0496113_0002425
1665 Ga0501067_0033983
1666 Ga0501067_0826484
1667 Ga0501068_0876301
1668 Ga0501069_0486446
1669 Ga0501202_039918
1670 Ga0501207_106283
1671 Ga0501209_021727
1672 Ga0501216_191078
1673 Ga0501235_010718
1674 Ga0501235_037664
1675 Ga0501242_014640
1676 Ga0501253_123161
1677 Ga0501257_041658
1678 Ga0501258_061312
1679 Ga0501259_206948
1680 Ga0501221_012393
1681 Ga0501221_216071
1682 Ga0501225_0041815
1683 Ga0501225_0345578
1684 Ga0501268_008468
1685 Ga0501272_023855
1686 Ga0501273_030918
1687 Ga0501279_078600
1688 nmdc:mga05p37_1177585_c1
1689 nmdc:mga09592_161265_c1
1690 nmdc:mga09592_971207_c1
1691 nmdc:mga08y16_133627_c1
1692 nmdc:mga08y16_752069_c1
1693 nmdc:mga0n895_1974672_c1
1694 nmdc:mga0rr50_1018523_c1
1695 nmdc:mga0sz30_152865_c1
1696 Ga0500658_0000041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13617

Lipoprotein_19

YnbE-like lipoprotein

26

59

0.99

Map