F483375

General Info

Members Datasets Scaffolds Average Seq Length
848 513 1696 262

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0154630|Ga0495586_0154630_64_999
Length 311
Sequence VSLPPEGAAGRLGAARRRPEFRFFTGRAAACRGGRAVPTTFAAMFTDSHCHLTFPEFADQMPQIRAAMAAAQVDRALCICTTLEEFPAVQALAERHDNFWASVGVHPDNEDILEPTVEGLVQRAALPKVIAIGETGLDYYQMEERKGGRSIADMEWQRERFRVHIRAAQQTRKPLVIHTREASADTLAILREEGETGSGQAAGGVFHCFTETAEVARAALDLGFYISFSGILTFKKAQDLRDVAAFVPLDRMLIETDSPYLAPVPYRGKTNNPSYVPFVAQQIAQLRQLPVEAIAKATSDNFETLFSGVKT

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005473 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
187 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
188 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
189 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
190 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
191 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
216 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
217 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
225 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
233 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
234 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
245 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
246 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
249 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
252 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
253 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
254 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
255 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
256 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
257 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
260 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
261 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
262 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
278 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
355 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
356 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
377 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
378 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
379 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
380 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
381 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
382 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
383 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
384 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
385 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
386 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
387 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
388 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
389 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
390 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
391 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
392 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
393 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
394 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
395 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
396 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
397 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
402 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
405 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
406 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
407 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
408 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
409 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
410 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
411 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
412 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
413 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
414 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
415 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
416 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
417 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
418 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
419 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
420 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
421 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
422 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
423 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
424 2643221658 Variovorax sp. Root411 Isolate Unclassified
425 2643221660 Methylibium sp. Root1272 Isolate Unclassified
426 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
427 2643221672 Variovorax sp. Root434 Isolate Unclassified
428 2643221683 Variovorax sp. Root473 Isolate Unclassified
429 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
430 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
431 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
432 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
433 2738541277 Variovorax sp. GV051 Isolate Unclassified
434 2738541307 Variovorax sp. GV008 Isolate Unclassified
435 2738543013 Variovorax sp. BT01 Isolate Unclassified
436 2738543019 Variovorax sp. GV040 Isolate Unclassified
437 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
438 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
439 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
440 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
441 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
442 2818991446 Variovorax sp. 1180 Isolate Unclassified
443 2818991459 Paenibacillus sp. 597 Isolate Unclassified
444 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
445 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
446 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
447 2842677519 Variovorax sp. R-72495 Isolate Unclassified
448 2842733646 Variovorax sp. R-72446 Isolate Unclassified
449 2842747753 Variovorax sp. R-72060 Isolate Unclassified
450 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
451 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
452 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
453 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
454 2885198086 Variovorax sp. 679 Isolate Unclassified
455 2885211737 Variovorax sp. 553 Isolate Unclassified
456 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
457 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
458 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
459 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
460 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
461 2899924645 Variovorax sp. 369 Isolate Unclassified
462 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
463 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
464 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
465 2904456579 Variovorax sp. 2002 Isolate Unclassified
466 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
467 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
468 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
469 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
470 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
471 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
472 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
473 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
474 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
475 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
476 2928044640 Variovorax sp. 1128 Isolate Unclassified
477 2928051484 Variovorax sp. 1133 Isolate Unclassified
478 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
479 2928070936 Variovorax gossypii 1167 Isolate Unclassified
480 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
481 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
482 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
483 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
484 2929520902 Variovorax beijingensis 502 Isolate Unclassified
485 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
486 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
487 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
488 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
489 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
490 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
491 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
492 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
493 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
494 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
495 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
496 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
497 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
498 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
499 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
500 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
501 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
502 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
503 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
504 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
505 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
506 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
507 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
508 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
509 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
510 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
511 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
512 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
513 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.32
Metatranscriptomes 0.83
Isolates 12.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 19.93
Nodule 0.59
Rhizoplane 2.36
Rhizosphere 63.44
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0154630 3300046535 Bacteria 1292
2 JGI25158J39367_1005379 3300002739 Bacteria 1880
3 JGI25150J39212_1000384 3300002774 Bacteria 21069
4 JGI25159J45721_1000103 3300002987 Bacteria 40372
5 JGI25159J45721_1004784 3300002987 Bacteria 4379
6 JGI25151J46595_10001581 3300003187 Bacteria 15162
7 JGI25151J46595_10053790 3300003187 Bacteria 1341
8 JGI25406J46586_10004609 3300003203 Bacteria 6418
9 JGI25160J50197_1000255 3300003354 Bacteria 40372
10 JGI25160J50197_1006714 3300003354 Bacteria 4620
11 JGI25161J50226_1000393 3300003374 Bacteria 21899
12 JGI25161J50226_1006326 3300003374 Bacteria 2159
13 Ga0006562J51391_1014207 3300003578 Bacteria 1722
14 Ga0006562J51391_1023071 3300003578 Bacteria 2674
15 Ga0006562J51391_1076832 3300003578 Bacteria 2326
16 Ga0055538_1000176 3300003751 Bacteria 41284
17 Ga0055535_1000305 3300003761 Bacteria 49948
18 Ga0055535_1012267 3300003761 Bacteria 1315
19 Ga0055542_1000021 3300003762 Bacteria 331499
20 Ga0055529_1003355 3300003763 Bacteria 2683
21 Ga0055537_1000036 3300003773 Bacteria 96045
22 Ga0055536_1000396 3300003781 Bacteria 31602
23 Ga0055536_1002959 3300003781 Bacteria 9315
24 Ga0055536_1005104 3300003781 Bacteria 6505
25 Ga0055534_1000018 3300003784 Bacteria 138136
26 Ga0055534_1003667 3300003784 Bacteria 4756
27 Ga0055534_1013198 3300003784 Bacteria 1595
28 Ga0055528_1004492 3300003790 Bacteria 6716
29 Ga0055530_10000086 3300003791 Bacteria 80109
30 Ga0055530_10000991 3300003791 Bacteria 22764
31 Ga0055540_1000405 3300003792 Bacteria 34908
32 Ga0055540_1001568 3300003792 Bacteria 13345
33 Ga0055540_1008793 3300003792 Bacteria 3583
34 Ga0055531_10000515 3300003794 Bacteria 34908
35 Ga0055531_10000762 3300003794 Bacteria 26870
36 Ga0055541_1000158 3300003841 Bacteria 33250
37 Ga0058692_1000003 3300003856 Bacteria 435295
38 Ga0055543_1000262 3300004625 Bacteria 39412
39 Ga0065165_1000494 3300005262 Bacteria 60929
40 Ga0065703_1000145 3300005272 Bacteria 90784
41 Ga0065714_10074806 3300005288 Bacteria 2988
42 Ga0070658_10020838 3300005327 Bacteria 5253
43 Ga0070683_100312193 3300005329 Bacteria 1496
44 Ga0070670_100043728 3300005331 Bacteria 3850
45 Ga0070670_100126513 3300005331 Bacteria 2206
46 Ga0070677_10009459 3300005333 Bacteria 3304
47 Ga0068869_100016290 3300005334 Bacteria 5007
48 Ga0068868_100137282 3300005338 Bacteria 2005
49 Ga0070660_100045205 3300005339 Bacteria 3370
50 Ga0070661_100001215 3300005344 Bacteria 18159
51 Ga0070661_100009411 3300005344 Bacteria 6761
52 Ga0070668_100030703 3300005347 Bacteria 4087
53 Ga0070669_100120891 3300005353 Bacteria 1998
54 Ga0070669_100241543 3300005353 Bacteria 1435
55 Ga0070675_100171940 3300005354 Bacteria 1869
56 Ga0070673_100175986 3300005364 Bacteria 1829
57 Ga0070673_100258958 3300005364 Bacteria 1519
58 Ga0070659_100000723 3300005366 Bacteria 23971
59 Ga0070667_100000558 3300005367 Bacteria 36933
60 Ga0070667_100069059 3300005367 Bacteria 3007
61 Ga0070667_100200892 3300005367 Bacteria 1769
62 Ga0070667_100393519 3300005367 Bacteria 1260
63 Ga0070708_100181819 3300005445 Bacteria 1966
64 Ga0070663_100281408 3300005455 Bacteria 1326
65 Ga0070678_100015055 3300005456 Bacteria 4902
66 Ga0070662_100024236 3300005457 Bacteria 4178
67 Ga0070662_100453955 3300005457 Bacteria 1064
68 Ga0070707_100520909 3300005468 Bacteria 1151
69 Ga0074250_12230 3300005473 Bacteria 1671
70 Ga0068853_100018345 3300005539 Bacteria 5790
71 Ga0070672_100151508 3300005543 Bacteria 1918
72 Ga0070696_100009243 3300005546 Bacteria 6599
73 Ga0070665_100088422 3300005548 Bacteria 3104
74 Ga0070665_100248677 3300005548 Bacteria 1779
75 Ga0070665_100839453 3300005548 Bacteria 932
76 Ga0068855_100107378 3300005563 Bacteria 3207
77 Ga0070664_100001692 3300005564 Bacteria 17677
78 Ga0070664_100009223 3300005564 Bacteria 8011
79 Ga0070664_100116433 3300005564 Bacteria 2337
80 Ga0068854_100024384 3300005578 Bacteria 4141
81 Ga0068852_100033408 3300005616 Bacteria 4270
82 Ga0068866_10069945 3300005718 Bacteria 1851
83 Ga0068851_10010148 3300005834 Bacteria 4390
84 Ga0068863_100009589 3300005841 Bacteria 9446
85 Ga0068863_100729575 3300005841 Bacteria 986
86 Ga0068858_100038966 3300005842 Bacteria 4408
87 Ga0068860_100104582 3300005843 Bacteria 2703
88 Ga0068860_100622858 3300005843 Bacteria 1086
89 Ga0081538_10004879 3300005981 Bacteria 12211
90 Ga0075365_10000499 3300006038 Bacteria 14928
91 Ga0075368_10058445 3300006042 Bacteria 1541
92 Ga0075363_100006375 3300006048 Bacteria 5348
93 Ga0075363_100117241 3300006048 Bacteria 1484
94 Ga0075363_100120608 3300006048 Bacteria 1464
95 Ga0075363_100156550 3300006048 Bacteria 1288
96 Ga0075363_100204754 3300006048 Bacteria 1128
97 Ga0075364_10004388 3300006051 Bacteria 8107
98 Ga0075364_10029011 3300006051 Bacteria 3546
99 Ga0075364_10031420 3300006051 Bacteria 3412
100 Ga0075364_10149558 3300006051 Bacteria 1573
101 Ga0070712_100291695 3300006175 Bacteria 1317
102 Ga0075362_10017200 3300006177 Bacteria 2976
103 Ga0075362_10151461 3300006177 Bacteria 1113
104 Ga0075367_10177486 3300006178 Bacteria 1328
105 Ga0075367_10211326 3300006178 Bacteria 1213
106 Ga0075366_10017858 3300006195 Bacteria 4091
107 Ga0075366_10069323 3300006195 Bacteria 2099
108 Ga0075366_10167057 3300006195 Bacteria 1334
109 Ga0097621_100183013 3300006237 Bacteria 1811
110 Ga0097621_100203292 3300006237 Bacteria 1720
111 Ga0075370_10006928 3300006353 Bacteria 5741
112 Ga0075370_10014387 3300006353 Bacteria 4220
113 Ga0075370_10020408 3300006353 Bacteria 3621
114 Ga0075370_10023929 3300006353 Bacteria 3369
115 Ga0075370_10026852 3300006353 Bacteria 3192
116 Ga0068871_100064748 3300006358 Bacteria 2993
117 Ga0075430_100015143 3300006846 Bacteria 6565
118 Ga0075430_100091033 3300006846 Bacteria 2551
119 Ga0075430_100234007 3300006846 Bacteria 1523
120 Ga0075431_100018061 3300006847 Bacteria 7174
121 Ga0075431_100026019 3300006847 Bacteria 5999
122 Ga0075431_100054811 3300006847 Bacteria 4112
123 Ga0075433_10002638 3300006852 Bacteria 13692
124 Ga0075433_10090205 3300006852 Bacteria 2709
125 Ga0075434_100005021 3300006871 Bacteria 12009
126 Ga0075434_100025406 3300006871 Bacteria 5795
127 Ga0075429_100025948 3300006880 Bacteria 5087
128 Ga0075429_100049096 3300006880 Bacteria 3670
129 Ga0099826_10003330 3300006948 Bacteria 10855
130 Ga0099826_10145492 3300006948 Bacteria 1363
131 Ga0075435_100006375 3300007076 Bacteria 8339
132 Ga0105251_10088378 3300009011 Bacteria 1426
133 Ga0105244_10006079 3300009036 Bacteria 7894
134 Ga0105244_10012501 3300009036 Bacteria 5012
135 Ga0105244_10027847 3300009036 Bacteria 3040
136 Ga0105244_10042638 3300009036 Bacteria 2345
137 Ga0105244_10062105 3300009036 Bacteria 1879
138 Ga0105244_10221842 3300009036 Bacteria 886
139 Ga0105244_10232879 3300009036 Bacteria 862
140 Ga0105250_10028905 3300009092 Bacteria 2231
141 Ga0105240_10014478 3300009093 Bacteria 10769
142 Ga0105240_10096400 3300009093 Bacteria 3604
143 Ga0105240_10124319 3300009093 Bacteria 3103
144 Ga0105245_10066112 3300009098 Bacteria 3272
145 Ga0105247_10010556 3300009101 Bacteria 5580
146 Ga0114129_10964067 3300009147 Bacteria 1076
147 Ga0105243_10000005 3300009148 Bacteria 576265
148 Ga0105243_10000481 3300009148 Bacteria 40913
149 Ga0105243_10005911 3300009148 Bacteria 9478
150 Ga0105243_10069193 3300009148 Bacteria 2847
151 Ga0105242_10221796 3300009176 Bacteria 1690
152 Ga0105242_10279982 3300009176 Bacteria 1515
153 Ga0105242_10462811 3300009176 Bacteria 1198
154 Ga0105242_10599796 3300009176 Bacteria 1063
155 Ga0105248_10468699 3300009177 Bacteria 1420
156 Ga0105248_10690665 3300009177 Bacteria 1151
157 Ga0105237_10000296 3300009545 Bacteria 68633
158 Ga0105238_10034295 3300009551 Bacteria 5164
159 Ga0105238_10090160 3300009551 Bacteria 3053
160 Ga0105239_10000250 3300010375 Bacteria 80439
161 Ga0105239_10076230 3300010375 Bacteria 3688
162 Ga0105239_10622341 3300010375 Bacteria 1232
163 Ga0105246_10002991 3300011119 Bacteria 10245
164 Ga0105246_10023702 3300011119 Bacteria 3975
165 Ga0105246_10075113 3300011119 Bacteria 2392
166 Ga0105246_10721820 3300011119 Bacteria 876
167 Ga0157371_10011368 3300013102 Bacteria 6866
168 Ga0157371_10049688 3300013102 Bacteria 2979
169 Ga0157371_10142439 3300013102 Bacteria 1707
170 Ga0157370_10007628 3300013104 Bacteria 11748
171 Ga0157370_10436765 3300013104 Bacteria 1204
172 Ga0157369_10030735 3300013105 Bacteria 5921
173 Ga0157374_10233809 3300013296 Bacteria 1806
174 Ga0157378_10136035 3300013297 Bacteria 2279
175 Ga0163162_10011471 3300013306 Bacteria 8643
176 Ga0157372_10083033 3300013307 Bacteria 3629
177 Ga0157375_10024840 3300013308 Bacteria 5553
178 Ga0182008_10000248 3300014497 Bacteria 41927
179 Ga0182008_10027578 3300014497 Bacteria 2875
180 Ga0182008_10037366 3300014497 Bacteria 2429
181 Ga0182008_10051748 3300014497 Bacteria 2037
182 Ga0157379_10543019 3300014968 Bacteria 1081
183 Ga0157376_10114435 3300014969 Bacteria 2380
184 Ga0182006_1002817 3300015261 Bacteria 9274
185 Ga0182006_1029757 3300015261 Bacteria 2211
186 Ga0182007_10001320 3300015262 Bacteria 13385
187 Ga0182007_10003094 3300015262 Bacteria 8010
188 Ga0182007_10039823 3300015262 Bacteria 1571
189 Ga0183362_10001 3300015683 Bacteria 2046624
190 Ga0163161_10000578 3300017792 Bacteria 29487
191 Ga0163161_10010469 3300017792 Bacteria 6420
192 Ga0163161_10023675 3300017792 Bacteria 4334
193 Ga0163161_10077465 3300017792 Bacteria 2442
194 Ga0163161_10483552 3300017792 Bacteria 1006
195 Ga0213872_10001126 3300021361 Bacteria 18260
196 Ga0213872_10057105 3300021361 Bacteria 1768
197 Ga0213874_10007518 3300021377 Bacteria 2618
198 Ga0209784_100151 3300025224 Bacteria 63336
199 Ga0209566_100196 3300025225 Bacteria 62620
200 Ga0209566_106134 3300025225 Bacteria 1442
201 Ga0209672_102245 3300025228 Bacteria 4977
202 Ga0209147_104170 3300025229 Bacteria 2489
203 Ga0209437_100524 3300025233 Bacteria 26708
204 Ga0209258_100058 3300025242 Bacteria 331567
205 Ga0207425_1000087 3300025245 Bacteria 93219
206 Ga0207425_1000921 3300025245 Bacteria 14021
207 Ga0209148_1000071 3300025254 Bacteria 331551
208 Ga0209129_1000007 3300025258 Bacteria 771325
209 Ga0209129_1016558 3300025258 Bacteria 1476
210 Ga0209129_1019157 3300025258 Bacteria 1299
211 Ga0209565_1000075 3300025263 Bacteria 162259
212 Ga0209565_1001142 3300025263 Bacteria 12781
213 Ga0209455_1000359 3300025272 Bacteria 42537
214 Ga0209673_1000066 3300025273 Bacteria 250037
215 Ga0209673_1000080 3300025273 Bacteria 223503
216 Ga0209673_1002015 3300025273 Bacteria 15619
217 Ga0209130_1000131 3300025284 Bacteria 119977
218 Ga0209130_1000137 3300025284 Bacteria 116784
219 Ga0209675_1000074 3300025291 Bacteria 162260
220 Ga0209675_1000102 3300025291 Bacteria 123742
221 Ga0209675_1001838 3300025291 Bacteria 11553
222 Ga0209675_1001972 3300025291 Bacteria 11021
223 Ga0209675_1014865 3300025291 Bacteria 2344
224 Ga0209676_1000005 3300025292 Bacteria 1076001
225 Ga0209676_1000139 3300025292 Bacteria 177886
226 Ga0209676_1000186 3300025292 Bacteria 142440
227 Ga0209676_1000703 3300025292 Bacteria 46688
228 Ga0209676_1001078 3300025292 Bacteria 30809
229 Ga0209676_1041679 3300025292 Bacteria 1281
230 Ga0209025_1000056 3300025294 Bacteria 316188
231 Ga0209025_1000088 3300025294 Bacteria 255087
232 Ga0209025_1000104 3300025294 Bacteria 226895
233 Ga0209025_1008022 3300025294 Bacteria 7690
234 Ga0209025_1008927 3300025294 Bacteria 7095
235 Ga0209025_1010001 3300025294 Bacteria 6499
236 Ga0209564_1000073 3300025295 Bacteria 288080
237 Ga0209564_1000090 3300025295 Bacteria 249298
238 Ga0209758_1000044 3300025297 Bacteria 398448
239 Ga0209758_1002538 3300025297 Bacteria 18399
240 Ga0209758_1030843 3300025297 Bacteria 2211
241 Ga0209050_1000007 3300025298 Bacteria 1187891
242 Ga0209050_1000250 3300025298 Bacteria 115980
243 Ga0209050_1005618 3300025298 Bacteria 7780
244 Ga0209256_1000020 3300025299 Bacteria 542402
245 Ga0209256_1000022 3300025299 Bacteria 481843
246 Ga0209256_1033560 3300025299 Bacteria 1379
247 Ga0207426_1000001 3300025302 Bacteria 1341301
248 Ga0207426_1000031 3300025302 Bacteria 460699
249 Ga0209051_1000036 3300025303 Bacteria 339863
250 Ga0209051_1000078 3300025303 Bacteria 201965
251 Ga0209051_1000160 3300025303 Bacteria 126473
252 Ga0209051_1000213 3300025303 Bacteria 98755
253 Ga0209051_1000257 3300025303 Bacteria 88842
254 Ga0209051_1011578 3300025303 Bacteria 4342
255 Ga0209051_1028273 3300025303 Bacteria 2217
256 Ga0209257_1000011 3300025304 Bacteria 1112630
257 Ga0209257_1000012 3300025304 Bacteria 1111138
258 Ga0209257_1000116 3300025304 Bacteria 228733
259 Ga0209257_1000222 3300025304 Bacteria 134717
260 Ga0209257_1003620 3300025304 Bacteria 13011
261 Ga0209257_1010150 3300025304 Bacteria 4845
262 Ga0207696_1001081 3300025711 Bacteria 16071
263 Ga0207655_1002033 3300025728 Bacteria 17090
264 Ga0207655_1002576 3300025728 Bacteria 14467
265 Ga0207655_1002672 3300025728 Bacteria 14020
266 Ga0207655_1002703 3300025728 Bacteria 13907
267 Ga0207655_1005759 3300025728 Bacteria 8346
268 Ga0207655_1006420 3300025728 Bacteria 7796
269 Ga0207713_1010478 3300025735 Bacteria 5125
270 Ga0207710_10000172 3300025900 Bacteria 66486
271 Ga0207688_10052548 3300025901 Bacteria 2284
272 Ga0207705_10088474 3300025909 Bacteria 2266
273 Ga0207695_10023858 3300025913 Bacteria 6903
274 Ga0207695_10290833 3300025913 Bacteria 1526
275 Ga0207671_10011355 3300025914 Bacteria 7256
276 Ga0207671_10104987 3300025914 Bacteria 2143
277 Ga0207657_10057735 3300025919 Bacteria 3343
278 Ga0207649_10010047 3300025920 Bacteria 5193
279 Ga0207681_10082402 3300025923 Bacteria 2274
280 Ga0207681_10205550 3300025923 Bacteria 1514
281 Ga0207650_10050473 3300025925 Bacteria 3077
282 Ga0207687_10033564 3300025927 Bacteria 3482
283 Ga0207690_10001849 3300025932 Bacteria 13005
284 Ga0207706_10146369 3300025933 Bacteria 2078
285 Ga0207706_10504022 3300025933 Bacteria 1045
286 Ga0207709_10000001 3300025935 Bacteria 2228154
287 Ga0207709_10000292 3300025935 Bacteria 56565
288 Ga0207709_10002968 3300025935 Bacteria 10339
289 Ga0207709_10034195 3300025935 Bacteria 2993
290 Ga0207691_10128560 3300025940 Bacteria 2239
291 Ga0207691_10162804 3300025940 Bacteria 1956
292 Ga0207691_10224580 3300025940 Bacteria 1628
293 Ga0207711_10049953 3300025941 Bacteria 3581
294 Ga0207711_10297692 3300025941 Bacteria 1488
295 Ga0207689_10015046 3300025942 Bacteria 6560
296 Ga0207661_10064344 3300025944 Bacteria 2973
297 Ga0207679_10000245 3300025945 Bacteria 41439
298 Ga0207651_10160534 3300025960 Bacteria 1762
299 Ga0207640_10038670 3300025981 Bacteria 3013
300 Ga0207658_10000412 3300025986 Bacteria 40643
301 Ga0207658_10050675 3300025986 Bacteria 3056
302 Ga0207703_10006312 3300026035 Bacteria 9473
303 Ga0207639_10102875 3300026041 Bacteria 2313
304 Ga0207639_10255966 3300026041 Bacteria 1529
305 Ga0207702_10160146 3300026078 Bacteria 2055
306 Ga0207641_10009620 3300026088 Bacteria 7967
307 Ga0207641_10204084 3300026088 Bacteria 1824
308 Ga0207676_10325469 3300026095 Bacteria 1413
309 Ga0207674_10297723 3300026116 Bacteria 1562
310 Ga0207683_10005862 3300026121 Bacteria 10536
311 Ga0207683_10018267 3300026121 Bacteria 5982
312 Ga0207683_10034463 3300026121 Bacteria 4399
313 Ga0207683_10128229 3300026121 Bacteria 2281
314 Ga0207698_10069424 3300026142 Bacteria 2786
315 Ga0207698_10121415 3300026142 Bacteria 2212
316 Ga0209371_1000006 3300027312 Bacteria 1055642
317 Ga0209969_1003204 3300027360 Bacteria 2261
318 Ga0209981_1018448 3300027378 Bacteria 988
319 Ga0209995_1004345 3300027471 Bacteria 2266
320 Ga0209282_1000221 3300027666 Bacteria 29591
321 Ga0209282_1120448 3300027666 Bacteria 1313
322 Ga0209971_1006633 3300027682 Bacteria 2740
323 Ga0209966_1023477 3300027695 Bacteria 1212
324 Ga0209974_10006449 3300027876 Bacteria 4096
325 Ga0207428_10025463 3300027907 Bacteria 4952
326 Ga0207428_10025611 3300027907 Bacteria 4936
327 Ga0268266_10023253 3300028379 Bacteria 5277
328 Ga0268266_10564629 3300028379 Bacteria 1091
329 Ga0268265_10055662 3300028380 Bacteria 3006
330 Ga0268264_10111176 3300028381 Bacteria 2400
331 Ga0265337_1053412 3300028556 Bacteria 1132
332 Ga0265334_10000827 3300028573 Bacteria 15475
333 Ga0307517_10004912 3300028786 Bacteria 20370
334 Ga0307515_10000006 3300028794 Bacteria 725810
335 Ga0307515_10000306 3300028794 Bacteria 121448
336 Ga0307515_10057287 3300028794 Bacteria 5642
337 Ga0307515_10292199 3300028794 Bacteria 1324
338 Ga0307515_10294898 3300028794 Bacteria 1313
339 Ga0265338_10010944 3300028800 Bacteria 10545
340 Ga0265338_10011529 3300028800 Bacteria 10196
341 Ga0265338_10042697 3300028800 Bacteria 4218
342 Ga0265324_10024436 3300029957 Bacteria 2146
343 Ga0268256_1000007 3300030500 Bacteria 1055326
344 Ga0307512_10005276 3300030522 Bacteria 13567
345 Ga0316177_1105017 3300030731 Bacteria 5728
346 Ga0314311_1155152 3300030733 Bacteria 3630
347 Ga0316178_1068791 3300030735 Bacteria 3547
348 Ga0316180_1050822 3300030736 Bacteria 2603
349 Ga0316183_1039891 3300030742 Bacteria 7261
350 Ga0316181_1078789 3300030744 Bacteria 1612
351 Ga0316182_1190822 3300030745 Bacteria 3334
352 Ga0265330_10066331 3300031235 Bacteria 1566
353 Ga0265332_10000094 3300031238 Bacteria 77636
354 Ga0265332_10064125 3300031238 Bacteria 1569
355 Ga0265328_10003603 3300031239 Bacteria 6831
356 Ga0265328_10019905 3300031239 Bacteria 2573
357 Ga0265320_10048560 3300031240 Bacteria 2070
358 Ga0265320_10136512 3300031240 Bacteria 1112
359 Ga0265331_10005085 3300031250 Bacteria 8031
360 Ga0265331_10034829 3300031250 Bacteria 2481
361 Ga0265331_10043885 3300031250 Bacteria 2163
362 Ga0265331_10102982 3300031250 Bacteria 1312
363 Ga0265327_10006203 3300031251 Bacteria 9642
364 Ga0265327_10019851 3300031251 Bacteria 4115
365 Ga0265327_10027976 3300031251 Bacteria 3235
366 Ga0265316_10008373 3300031344 Bacteria 9604
367 Ga0265316_10012742 3300031344 Bacteria 7515
368 Ga0265316_10085054 3300031344 Bacteria 2421
369 Ga0265316_10124170 3300031344 Bacteria 1948
370 Ga0307513_10051472 3300031456 Bacteria 4443
371 Ga0307513_10220338 3300031456 Bacteria 1719
372 Ga0307513_10332493 3300031456 Bacteria 1273
373 Ga0307408_100110771 3300031548 Bacteria 2108
374 Ga0307408_100159897 3300031548 Bacteria 1788
375 Ga0307508_10011794 3300031616 Bacteria 7987
376 Ga0316575_10001169 3300031665 Bacteria 8257
377 Ga0265314_10011481 3300031711 Bacteria 7307
378 Ga0265314_10012964 3300031711 Bacteria 6768
379 Ga0265314_10025842 3300031711 Bacteria 4421
380 Ga0265314_10128646 3300031711 Bacteria 1583
381 Ga0265314_10151812 3300031711 Bacteria 1419
382 Ga0265342_10045457 3300031712 Bacteria 2643
383 Ga0316576_10031177 3300031727 Bacteria 3781
384 Ga0316576_10083412 3300031727 Bacteria 2374
385 Ga0316576_10091160 3300031727 Bacteria 2271
386 Ga0316576_10146743 3300031727 Bacteria 1777
387 Ga0316578_10010891 3300031728 Bacteria 4738
388 Ga0307516_10217266 3300031730 Bacteria 1623
389 Ga0307405_10001524 3300031731 Bacteria 9813
390 Ga0316577_10006651 3300031733 Bacteria 6123
391 Ga0316577_10063816 3300031733 Bacteria 2056
392 Ga0316577_10177270 3300031733 Bacteria 1203
393 Ga0307406_10017753 3300031901 Bacteria 4148
394 Ga0307406_10380051 3300031901 Bacteria 1113
395 Ga0307412_10010332 3300031911 Bacteria 5376
396 Ga0307416_100043673 3300032002 Bacteria 3512
397 Ga0307416_100126598 3300032002 Bacteria 2289
398 Ga0307411_10037176 3300032005 Bacteria 3058
399 Ga0307411_10199074 3300032005 Bacteria 1537
400 Ga0307411_10217608 3300032005 Bacteria 1479
401 Ga0307411_10282556 3300032005 Bacteria 1322
402 Ga0307411_10310685 3300032005 Bacteria 1268
403 Ga0307415_100121710 3300032126 Bacteria 1958
404 Ga0316585_10080829 3300032137 Bacteria 1058
405 Ga0316580_10015636 3300032139 Bacteria 2323
406 Ga0316593_10001705 3300032168 Bacteria 4961
407 Ga0316593_10014207 3300032168 Bacteria 2370
408 Ga0307510_10041814 3300033180 Bacteria 5004
409 Ga0307510_10177388 3300033180 Bacteria 1699
410 Ga0316587_1011069 3300033529 Bacteria 1452
411 Ga0316596_1018021 3300033541 Bacteria 1781
412 Ga0373943_0081189 3300035170 Bacteria 1663
413 Ga0373955_0073008 3300035172 Bacteria 1923
414 Ga0316574_0206237 3300035398 Bacteria 1262
415 Ga0316582_0045365 3300036647 Bacteria 2767
416 Ga0316582_0176261 3300036647 Bacteria 1453
417 Ga0316584_0005970 3300036712 Bacteria 8225
418 Ga0316584_0021546 3300036712 Bacteria 4685
419 Ga0316584_0086613 3300036712 Bacteria 2344
420 Ga0373925_0162515 3300037068 Bacteria 1760
421 Ga0395899_0023506 3300037312 Bacteria 4667
422 Ga0395899_0027560 3300037312 Bacteria 4282
423 Ga0395899_0098060 3300037312 Bacteria 2118
424 Ga0395900_0000063 3300037418 Bacteria 201374
425 Ga0395900_0061938 3300037418 Bacteria 3846
426 Ga0395900_0108516 3300037418 Bacteria 2851
427 Ga0395900_0157926 3300037418 Bacteria 2315
428 Ga0395898_0006380 3300037466 Bacteria 12600
429 Ga0395898_0010832 3300037466 Bacteria 9525
430 Ga0395905_0000443 3300037471 Bacteria 58027
431 Ga0395905_0055765 3300037471 Bacteria 3698
432 Ga0395905_0091368 3300037471 Bacteria 2854
433 Ga0395905_0117574 3300037471 Bacteria 2498
434 Ga0395905_0319772 3300037471 Bacteria 1441
435 Ga0395901_0087577 3300038443 Bacteria 3256
436 Ga0395901_0316787 3300038443 Bacteria 1614
437 Ga0395901_0587435 3300038443 Bacteria 1124
438 Ga0400485_05586 3300038735 Bacteria 2194
439 Ga0400488_16420 3300038741 Bacteria 2489
440 Ga0400486_12391 3300038742 Bacteria 3393
441 Ga0436365_0488796 3300039437 Bacteria 2854
442 Ga0436360_0438486 3300039438 Bacteria 9423
443 Ga0436361_0109034 3300039447 Bacteria 1286
444 Ga0436361_0168382 3300039447 Bacteria 1579
445 Ga0436361_0653184 3300039447 Bacteria 36949
446 Ga0436363_1281725 3300039450 Bacteria 8177
447 Ga0439436_0000212 3300041404 Bacteria 14029
448 Ga0439436_0018026 3300041404 Bacteria 2112
449 Ga0439447_013933 3300041407 Bacteria 2269
450 Ga0439465_0001922 3300041413 Bacteria 6811
451 Ga0439465_0132803 3300041413 Bacteria 880
452 Ga0451849_1462899 3300041505 Bacteria 1612
453 Ga0439431_0054515 3300041997 Bacteria 1043
454 Ga0439433_0000802 3300041999 Bacteria 6213
455 Ga0439442_006094 3300042002 Bacteria 2417
456 Ga0439445_0009924 3300042004 Bacteria 2247
457 Ga0439445_0045973 3300042004 Bacteria 1169
458 Ga0439449_0000162 3300042007 Bacteria 22807
459 Ga0439449_0003523 3300042007 Bacteria 6078
460 Ga0439449_0009856 3300042007 Bacteria 3615
461 Ga0439452_000749 3300042010 Bacteria 15562
462 Ga0439455_0027801 3300042012 Bacteria 1388
463 Ga0439462_0026231 3300042015 Bacteria 1535
464 Ga0439463_010290 3300042016 Bacteria 2299
465 Ga0450920_020777 3300042122 Bacteria 1266
466 Ga0450890_011543 3300042127 Bacteria 1142
467 Ga0450907_004002 3300042146 Bacteria 2563
468 Ga0439446_0013796 3300042156 Bacteria 2223
469 Ga0439458_0003995 3300042157 Bacteria 3408
470 Ga0439458_0019659 3300042157 Bacteria 1555
471 Ga0450908_014546 3300042184 Bacteria 1413
472 Ga0439434_0004673 3300042435 Bacteria 4012
473 Ga0439434_0019589 3300042435 Bacteria 2029
474 Ga0439460_0071563 3300042461 Bacteria 1075
475 Ga0450916_005301 3300042530 Bacteria 1487
476 Ga0450918_001383 3300042531 Bacteria 4855
477 Ga0450893_0000684 3300042532 Bacteria 4895
478 Ga0450893_0012365 3300042532 Bacteria 1417
479 Ga0451577_0023778 3300042876 Bacteria 5582
480 Ga0451577_0094965 3300042876 Bacteria 2662
481 Ga0451577_0523177 3300042876 Bacteria 1077
482 Ga0439440_0026087 3300042993 Bacteria 1350
483 Ga0466969_0042909 3300044656 Bacteria 2255
484 Ga0466969_0043578 3300044656 Bacteria 2235
485 Ga0453683_0002359 3300044673 Bacteria 14773
486 Ga0466965_0038070 3300044683 Bacteria 2362
487 Ga0466965_0207724 3300044683 Bacteria 1040
488 Ga0466966_0014971 3300044684 Bacteria 5131
489 Ga0466966_0197596 3300044684 Bacteria 1217
490 Ga0466961_0011090 3300044693 Bacteria 5761
491 Ga0466961_0073364 3300044693 Bacteria 2170
492 Ga0453684_0041347 3300044712 Bacteria 6237
493 Ga0453684_0044822 3300044712 Bacteria 5911
494 Ga0453684_0904711 3300044712 Bacteria 945
495 Ga0466957_0101181 3300044842 Bacteria 1817
496 Ga0466959_0032340 3300045049 Bacteria 3872
497 Ga0451576_0001973 3300045051 Bacteria 32632
498 Ga0451576_0005477 3300045051 Bacteria 15899
499 Ga0451576_0007413 3300045051 Bacteria 13122
500 Ga0451576_0062335 3300045051 Bacteria 3887
501 Ga0451576_0461438 3300045051 Bacteria 1334
502 Ga0451576_0888064 3300045051 Bacteria 935
503 Ga0466967_0984494 3300045976 Bacteria 840
504 Ga0495627_004409 3300046453 Bacteria 5896
505 Ga0495627_028567 3300046453 Bacteria 1781
506 Ga0495592_0000478 3300046454 Bacteria 29353
507 Ga0495592_0155355 3300046454 Bacteria 1579
508 Ga0495590_0005550 3300046457 Bacteria 4992
509 Ga0495591_039412 3300046458 Bacteria 1354
510 Ga0495638_0099749 3300046460 Bacteria 1737
511 Ga0495653_0065406 3300046463 Bacteria 2737
512 Ga0495639_0071286 3300046475 Bacteria 1605
513 Ga0495608_0052256 3300046511 Unclassified 2705
514 Ga0495616_0001622 3300046513 Bacteria 15416
515 Ga0495620_0106301 3300046515 Bacteria 1115
516 Ga0495631_0003611 3300046518 Bacteria 8442
517 Ga0495663_0085826 3300046525 Bacteria 1020
518 Ga0495642_0025051 3300046528 Bacteria 2363
519 Ga0495652_0474842 3300046529 Bacteria 871
520 Ga0495640_0192496 3300046533 Bacteria 1296
521 Ga0495621_0108121 3300046539 Bacteria 1064
522 Ga0495622_0043947 3300046557 Bacteria 2077
523 Ga0495667_0148430 3300046559 Unclassified 1510
524 Ga0495656_0000193 3300046615 Bacteria 21880
525 Ga0495625_0000057 3300046660 Bacteria 181623
526 Ga0495588_0067289 3300046674 Bacteria 1859
527 Ga0495588_0073967 3300046674 Bacteria 1774
528 Ga0495657_0322063 3300046675 Bacteria 918
529 Ga0495658_0006263 3300046683 Bacteria 5849
530 Ga0495670_0272336 3300046691 Bacteria 905
531 Ga0495660_0004595 3300046810 Bacteria 8328
532 Ga0495581_0137626 3300047315 Bacteria 1424
533 Ga0495604_0061684 3300047317 Bacteria 2867
534 Ga0495676_0233490 3300047321 Bacteria 1262
535 Ga0495614_0064795 3300048089 Bacteria 1571
536 Ga0496100_0599137 3300048903 Bacteria 855
537 Ga0496101_0003661 3300048904 Bacteria 9588
538 Ga0496102_0020130 3300048905 Bacteria 5891
539 Ga0496103_0028975 3300048906 Bacteria 3363
540 Ga0496104_0001081 3300048907 Bacteria 23265
541 Ga0496105_0025976 3300048908 Bacteria 4772
542 Ga0496106_0123914 3300048909 Bacteria 2022
543 Ga0496107_0423469 3300048910 Bacteria 990
544 Ga0496108_0412522 3300048911 Bacteria 1180
545 Ga0496110_0067898 3300048913 Bacteria 3155
546 Ga0496110_0072369 3300048913 Bacteria 3058
547 Ga0496110_0287222 3300048913 Bacteria 1498
548 Ga0496111_0137037 3300048914 Bacteria 1813
549 Ga0496111_0172463 3300048914 Bacteria 1607
550 Ga0496114_0072792 3300048917 Bacteria 2891
551 Ga0496115_0004095 3300048918 Bacteria 10527
552 Ga0496116_0000596 3300048919 Bacteria 48028
553 Ga0496116_0010830 3300048919 Bacteria 7606
554 Ga0496116_0030387 3300048919 Bacteria 3881
555 Ga0496116_0108081 3300048919 Bacteria 1643
556 Ga0496116_0135126 3300048919 Bacteria 1398
557 Ga0496117_0028533 3300048920 Bacteria 4320
558 Ga0496117_0223145 3300048920 Bacteria 1047
559 Ga0496118_0004128 3300048921 Bacteria 17573
560 Ga0496118_0016121 3300048921 Bacteria 6872
561 Ga0496118_0047711 3300048921 Bacteria 3316
562 Ga0496119_0000682 3300048922 Bacteria 45362
563 Ga0496119_0006105 3300048922 Bacteria 11283
564 Ga0496119_0092451 3300048922 Bacteria 1716
565 Ga0496120_0000678 3300048923 Bacteria 49988
566 Ga0496120_0010297 3300048923 Bacteria 6538
567 Ga0496120_0084670 3300048923 Bacteria 1708
568 Ga0496121_0269419 3300048924 Bacteria 1171
569 Ga0496121_0270710 3300048924 Bacteria 1167
570 Ga0496121_0322973 3300048924 Bacteria 1038
571 Ga0496122_0017422 3300048925 Bacteria 6718
572 Ga0496122_0044689 3300048925 Bacteria 3453
573 Ga0496122_0053526 3300048925 Bacteria 3042
574 Ga0496122_0077691 3300048925 Bacteria 2329
575 Ga0496122_0138161 3300048925 Bacteria 1531
576 Ga0496122_0223970 3300048925 Bacteria 1076
577 Ga0496123_0000108 3300048926 Bacteria 166102
578 Ga0496123_0082204 3300048926 Bacteria 1954
579 Ga0496124_0000542 3300048927 Bacteria 64211
580 Ga0496124_0008708 3300048927 Bacteria 10546
581 Ga0496124_0048959 3300048927 Bacteria 3607
582 Ga0496124_0198462 3300048927 Bacteria 1528
583 Ga0496124_0222762 3300048927 Bacteria 1417
584 Ga0496124_0344690 3300048927 Bacteria 1056
585 Ga0496125_0000920 3300048928 Bacteria 46265
586 Ga0496125_0008866 3300048928 Bacteria 10448
587 Ga0496125_0059271 3300048928 Bacteria 3086
588 Ga0496125_0117968 3300048928 Bacteria 1902
589 Ga0496125_0187609 3300048928 Bacteria 1369
590 Ga0496125_0225309 3300048928 Bacteria 1204
591 Ga0496126_0005347 3300048929 Bacteria 14684
592 Ga0496126_0012013 3300048929 Bacteria 8899
593 Ga0501032_0007886 3300049569 Bacteria 7756
594 Ga0501033_0053132 3300049570 Bacteria 3001
595 Ga0501034_0046544 3300049571 Bacteria 4382
596 Ga0501034_0131514 3300049571 Bacteria 2485
597 Ga0501034_0180621 3300049571 Unclassified 2075
598 Ga0501036_0002624 3300049572 Bacteria 14176
599 Ga0501036_0103759 3300049572 Bacteria 2404
600 Ga0501036_0114526 3300049572 Bacteria 2279
601 Ga0501036_0264858 3300049572 Bacteria 1439
602 Ga0501036_0422520 3300049572 Bacteria 1111
603 Ga0501037_0066636 3300049573 Bacteria 2622
604 Ga0501037_0263019 3300049573 Bacteria 1205
605 Ga0501037_0294303 3300049573 Bacteria 1128
606 Ga0501038_0006635 3300049574 Bacteria 10705
607 Ga0501038_0092190 3300049574 Bacteria 2537
608 Ga0501038_0560320 3300049574 Bacteria 868
609 Ga0501039_0012059 3300049575 Bacteria 6589
610 Ga0501039_0208127 3300049575 Bacteria 1538
611 Ga0501039_0331964 3300049575 Bacteria 1195
612 Ga0501039_0589796 3300049575 Bacteria 871
613 Ga0501039_0753478 3300049575 Bacteria 760
614 Ga0501042_0008784 3300049578 Bacteria 6699
615 Ga0501042_0199012 3300049578 Bacteria 1445
616 Ga0501043_0007806 3300049579 Bacteria 8458
617 Ga0501043_0399674 3300049579 Bacteria 1038
618 Ga0501046_0005506 3300049580 Bacteria 11310
619 Ga0501046_0034919 3300049580 Bacteria 4055
620 Ga0501047_0000522 3300049581 Bacteria 41607
621 Ga0501047_0005585 3300049581 Bacteria 11841
622 Ga0501047_0064631 3300049581 Bacteria 3529
623 Ga0501047_0398911 3300049581 Bacteria 1208
624 Ga0501047_0644984 3300049581 Bacteria 878
625 Ga0501048_0078533 3300049582 Bacteria 2329
626 Ga0501048_0325780 3300049582 Bacteria 1094
627 Ga0501048_0381736 3300049582 Bacteria 1006
628 Ga0501048_0386765 3300049582 Bacteria 999
629 Ga0501067_0016902 3300049583 Bacteria 4030
630 Ga0501067_0091580 3300049583 Bacteria 1688
631 Ga0501067_0195615 3300049583 Bacteria 1126
632 Ga0501067_0249256 3300049583 Bacteria 988
633 Ga0501069_0081821 3300049585 Bacteria 1819
634 Ga0501069_0105371 3300049585 Bacteria 1602
635 Ga0501071_0044932 3300049587 Bacteria 3170
636 Ga0501071_0120585 3300049587 Bacteria 1944
637 Ga0501072_0089875 3300049588 Bacteria 2438
638 Ga0501072_0153936 3300049588 Bacteria 1833
639 Ga0501072_0429803 3300049588 Bacteria 1046
640 Ga0501073_0015241 3300049589 Bacteria 5576
641 Ga0501073_0028689 3300049589 Bacteria 3976
642 Ga0501073_0049769 3300049589 Bacteria 2937
643 Ga0501073_0097478 3300049589 Bacteria 2042
644 Ga0501073_0114704 3300049589 Bacteria 1868
645 Ga0501073_0339735 3300049589 Bacteria 1036
646 Ga0501075_0155825 3300049591 Bacteria 1741
647 Ga0501076_0011770 3300049592 Bacteria 6532
648 Ga0501225_0007216 3300049705 Bacteria 3225
649 Ga0501080_0192021 3300049742 Bacteria 1876
650 Ga0501080_0313276 3300049742 Bacteria 1422
651 Ga0501080_0672822 3300049742 Bacteria 914
652 Ga0501083_0006222 3300049744 Bacteria 8467
653 Ga0501083_0081008 3300049744 Bacteria 2152
654 Ga0501083_0187637 3300049744 Bacteria 1349
655 Ga0501262_000418 3300049759 Bacteria 5128
656 Ga0501035_0116026 3300049822 Bacteria 2343
657 Ga0501044_0000183 3300049823 Bacteria 77954
658 Ga0501044_0007969 3300049823 Bacteria 11637
659 Ga0501044_0218839 3300049823 Bacteria 1855
660 Ga0501045_0085194 3300049824 Bacteria 2332
661 nmdc:mga03683_1803_c1 3300050489 Bacteria 6494
662 nmdc:mga03n38_252897_c1 3300050490 Bacteria 931
663 nmdc:mga03n38_87449_c1 3300050490 Bacteria 1477
664 nmdc:mga00v17_117111_c1 3300050491 Bacteria 1694
665 nmdc:mga00v17_30760_c1 3300050491 Bacteria 3160
666 nmdc:mga0k408_41463_c1 3300050493 Bacteria 2650
667 nmdc:mga0k408_44683_c1 3300050493 Bacteria 2555
668 nmdc:mga06z11_114667_c1 3300050494 Bacteria 1496
669 nmdc:mga06z11_123977_c1 3300050494 Bacteria 1444
670 nmdc:mga07m45_22269_c1 3300050496 Bacteria 3458
671 nmdc:mga07m45_3731_c1 3300050496 Bacteria 7374
672 nmdc:mga07m45_69128_c1 3300050496 Bacteria 2008
673 nmdc:mga07m45_72022_c1 3300050496 Bacteria 1967
674 nmdc:mga05p37_777838_c1 3300050507 Bacteria 1051
675 nmdc:mga09592_7151_c1 3300050508 Bacteria 9071
676 nmdc:mga0qj67_22757_c1 3300050509 Bacteria 4814
677 nmdc:mga0qj67_317379_c1 3300050509 Bacteria 1261
678 nmdc:mga0qj67_37458_c1 3300050509 Bacteria 3799
679 nmdc:mga06r32_487803_c1 3300050510 Bacteria 1210
680 nmdc:mga06r32_83805_c1 3300050510 Bacteria 3107
681 nmdc:mga08y16_1000_c1 3300050511 Bacteria 27606
682 nmdc:mga08y16_346177_c1 3300050511 Bacteria 1527
683 nmdc:mga0n895_29647_c1 3300050512 Bacteria 5222
684 nmdc:mga0n895_4457_c1 3300050512 Bacteria 11505
685 nmdc:mga0rr50_4295_c1 3300050513 Bacteria 8344
686 nmdc:mga0a205_21378_c1 3300050515 Bacteria 6122
687 nmdc:mga0a205_725_c1 3300050515 Bacteria 26539
688 Ga0495601_0010487 3300053077 Bacteria 5517
689 Ga0500610_0037924 3300053079 Bacteria 2482
690 Ga0500610_0040179 3300053079 Bacteria 2416
691 Ga0495655_0091867 3300053083 Bacteria 885
692 Ga0495619_0040142 3300053085 Bacteria 3059
693 Ga0500643_003606 3300053087 Bacteria 7353
694 Ga0500646_0134545 3300053090 Bacteria 806
695 Ga0500651_0000090 3300053093 Bacteria 58811
696 Ga0500566_0031058 3300053094 Bacteria 3115
697 Ga0500641_0035978 3300053096 Bacteria 1979
698 Ga0500571_000014 3300053110 Bacteria 67097
699 Ga0500572_006241 3300053111 Bacteria 2726
700 Ga0500593_001335 3300053117 Bacteria 8884
701 Ga0500594_0000375 3300053118 Bacteria 9973
702 Ga0500594_0001172 3300053118 Bacteria 5659
703 Ga0500607_000328 3300053121 Bacteria 44883
704 Ga0500608_003138 3300053122 Bacteria 6133
705 Ga0500608_055924 3300053122 Bacteria 1891
706 Ga0500618_013715 3300053125 Bacteria 2088
707 Ga0500655_000075 3300053133 Bacteria 26773
708 Ga0500658_0000018 3300053134 Bacteria 141217
709 Ga0500658_0000322 3300053134 Bacteria 21148
710 Ga0500559_0000011 3300053136 Bacteria 164751
711 Ga0500559_0009178 3300053136 Bacteria 4294
712 Ga0500559_0010108 3300053136 Bacteria 4061
713 Ga0500559_0011930 3300053136 Bacteria 3703
714 Ga0500568_0049088 3300053139 Bacteria 1666
715 Ga0500573_0013759 3300053140 Bacteria 4567
716 Ga0500574_016421 3300053141 Bacteria 1788
717 Ga0500604_0068011 3300053151 Bacteria 1131
718 Ga0500616_0122204 3300053153 Bacteria 1242
719 Ga0500622_0002568 3300053156 Bacteria 13011
720 Ga0500622_0027911 3300053156 Bacteria 2974
721 Ga0500627_0001126 3300053158 Bacteria 7324
722 Ga0500634_0043273 3300053161 Bacteria 2441
723 Ga0500638_007322 3300053162 Bacteria 4606
724 Ga0500565_001028 3300053734 Bacteria 1747
725 Ga0500587_000071 3300053739 Bacteria 8323
726 Ga0501084_0011445 3300054114 Bacteria 7346
727 Ga0501084_0050809 3300054114 Bacteria 3469
728 Ga0501084_0107602 3300054114 Bacteria 2342
729 Ga0501084_0150072 3300054114 Bacteria 1964
730 Ga0590071_000671 3300059421 Bacteria 9700
731 Ga0590074_001247 3300059423 Bacteria 4036
732 Ga0590075_000135 3300059424 Bacteria 19348
733 Ga0590077_000917 3300059426 Bacteria 7505
734 Ga0501082_0007506 3300060353 Bacteria 9412
735 Ga0501082_0009486 3300060353 Bacteria 8379
736 Ga0501082_0093551 3300060353 Bacteria 2597
737 Ga0501082_0190467 3300060353 Bacteria 1784
738 Ga0501082_0327616 3300060353 Bacteria 1334
739 Ga0466962_0035738 3300061719 Bacteria 2377
740 2513226423 2513020051 Bacteria 6053213
741 2550903433 2548877040 Bacteria 7507281
742 2552749147 2551306352 Bacteria 3873115
743 2556066060 2554235469 Bacteria 3590176
744 2563930593 2563366752 Bacteria 4961801
745 2571530876 2571042143 Bacteria 6986194
746 2573041707 2571042588 Bacteria 5045676
747 2578334537 2576861424 Bacteria 5270569
748 2580930452 2579778775 Bacteria 5360914
749 2599626497 2599185214 Bacteria 8209958
750 2599675561 2599185226 Bacteria 8233575
751 2599684034 2599185227 Bacteria 8246414
752 2599696048 2599185229 Bacteria 8216126
753 2601636910 2600255286 Bacteria 5390125
754 2621272563 2619619294 Bacteria 5575484
755 2640734095 2639762793 Bacteria 3943681
756 2643738691 2643221543 Bacteria 6628015
757 2644163328 2643221628 Bacteria 5745828
758 2644304722 2643221654 Bacteria 5273570
759 2644327811 2643221658 Bacteria 6064537
760 2644337860 2643221660 Bacteria 4208257
761 2644361228 2643221665 Bacteria 4699229
762 2644400506 2643221672 Bacteria 6322190
763 2644468394 2643221683 Bacteria 5749203
764 2678231069 2675903507 Bacteria 3737791
765 2723601374 2721755693 Bacteria 6126117
766 2728529743 2728368933 Bacteria 7044283
767 2730137497 2728369359 Bacteria 5621728
768 2738717922 2738541277 Bacteria 7458140
769 2738879579 2738541307 Bacteria 8606193
770 2739250274 2738543013 Bacteria 5618633
771 2739278608 2738543019 Bacteria 7459457
772 2745160193 2744054655 Bacteria 3552603
773 2753812984 2751185905 Bacteria 6142767
774 2774388382 2773857761 Bacteria 3837365
775 2774437584 2773857770 Bacteria 3911866
776 2802440567 2802428803 Bacteria 5806948
777 2819597451 2818991446 Bacteria 7757362
778 2819676046 2818991459 Bacteria 8736032
779 2821118263 2821111986 Bacteria 6894338
780 2831266629 2831265667 Bacteria 7184833
781 2838057292 2838054893 Bacteria 7451788
782 2842679567 2842677519 Bacteria 5615038
783 2842734864 2842733646 Bacteria 5716726
784 2842751528 2842747753 Bacteria 5578255
785 2864738816 2864733723 Bacteria 6770668
786 2881101980 2881101125 Bacteria 4590519
787 2881639589 2881636855 Bacteria 5205297
788 2885192573 2885192300 Bacteria 5882526
789 2885201348 2885198086 Bacteria 7212419
790 2885214970 2885211737 Bacteria 7212420
791 2885529778 2885526491 Bacteria 7164189
792 2888578955 2888578766 Bacteria 6743310
793 2889042475 2889042446 Bacteria 7618936
794 2889052511 2889049205 Bacteria 7524325
795 2889277467 2889276214 Bacteria 5979355
796 2899924961 2899924645 Bacteria 7487985
797 2904119525 2904113452 Bacteria 7796941
798 2904167383 2904162308 Bacteria 7086713
799 2904455666 2904449895 Bacteria 6927402
800 2904462824 2904456579 Bacteria 6819253
801 2904482562 2904479285 Bacteria 5073931
802 2904496856 2904490793 Bacteria 7046938
803 2904544913 2904541872 Bacteria 8915136
804 2904601013 2904595352 Bacteria 6124848
805 2904758162 2904755435 Bacteria 7986759
806 2907205061 2907202186 Bacteria 6632024
807 2916702080 2916699645 Bacteria 3568996
808 2919183981 2919182534 Bacteria 3907101
809 2919467337 2919462493 Bacteria 5817112
810 2919507812 2919506607 Bacteria 3392955
811 2928045480 2928044640 Bacteria 7271509
812 2928058377 2928051484 Bacteria 7773759
813 2928064042 2928064002 Bacteria 7419480
814 2928071415 2928070936 Bacteria 8062541
815 2928084644 2928084124 Bacteria 7159212
816 2928518123 2928515477 Bacteria 4448421
817 2929163417 2929160207 Bacteria 9075316
818 2929207110 2929206907 Bacteria 5918291
819 2929522654 2929520902 Bacteria 6765052
820 2931385900 2931384279 Bacteria 7299545
821 2938653451 2938649242 Bacteria 7118381
822 2939631833 2939631187 Bacteria 6118131
823 2939685029 2939679117 Bacteria 6921672
824 2939706830 2939702853 Bacteria 5139229
825 2945912118 2945909444 Bacteria 7065066
826 2945947821 2945945610 Bacteria 5951079
827 2945977334 2945972063 Bacteria 6086495
828 2945985597 2945984333 Bacteria 7358892
829 2945995497 2945991243 Bacteria 7008369
830 2946058204 2946053406 Bacteria 6978655
831 2968562218 2968558590 Bacteria 6956864
832 2971406907 2971403814 Bacteria 7370929
833 2971513844 2971511577 Bacteria 5404012
834 2980179565 2980176882 Bacteria 5397533
835 2984531980 2984527788 Bacteria 5288478
836 2984533234 2984532647 Bacteria 5288506
837 2984570157 2984568884 Bacteria 3884413
838 2988230062 2988225383 Bacteria 7221625
839 2996637389 2996632988 Bacteria 6921523
840 2996711041 2996706504 Bacteria 5757485
841 648167958 648028048 Bacteria 5394884
842 8002394423 8002392321 Bacteria 4159911
843 8033232739 8033232454 Bacteria 3202805
844 8048749310 8048746797 Bacteria 3557226
845 8054468521 8054465665 Bacteria 7323556
846 8055228117 8055225921 Bacteria 3341787
847 8057735771 8057733483 Bacteria 6578323
848 8057979760 8057977335 Bacteria 5694872
849 Ga0495586_0154630
850 JGI25158J39367_1005379
851 JGI25150J39212_1000384
852 JGI25159J45721_1000103
853 JGI25159J45721_1004784
854 JGI25151J46595_10001581
855 JGI25151J46595_10053790
856 JGI25406J46586_10004609
857 JGI25160J50197_1000255
858 JGI25160J50197_1006714
859 JGI25161J50226_1000393
860 JGI25161J50226_1006326
861 Ga0006562J51391_1014207
862 Ga0006562J51391_1023071
863 Ga0006562J51391_1076832
864 Ga0055538_1000176
865 Ga0055535_1000305
866 Ga0055535_1012267
867 Ga0055542_1000021
868 Ga0055529_1003355
869 Ga0055537_1000036
870 Ga0055536_1000396
871 Ga0055536_1002959
872 Ga0055536_1005104
873 Ga0055534_1000018
874 Ga0055534_1003667
875 Ga0055534_1013198
876 Ga0055528_1004492
877 Ga0055530_10000086
878 Ga0055530_10000991
879 Ga0055540_1000405
880 Ga0055540_1001568
881 Ga0055540_1008793
882 Ga0055531_10000515
883 Ga0055531_10000762
884 Ga0055541_1000158
885 Ga0058692_1000003
886 Ga0055543_1000262
887 Ga0065165_1000494
888 Ga0065703_1000145
889 Ga0065714_10074806
890 Ga0070658_10020838
891 Ga0070683_100312193
892 Ga0070670_100043728
893 Ga0070670_100126513
894 Ga0070677_10009459
895 Ga0068869_100016290
896 Ga0068868_100137282
897 Ga0070660_100045205
898 Ga0070661_100001215
899 Ga0070661_100009411
900 Ga0070668_100030703
901 Ga0070669_100120891
902 Ga0070669_100241543
903 Ga0070675_100171940
904 Ga0070673_100175986
905 Ga0070673_100258958
906 Ga0070659_100000723
907 Ga0070667_100000558
908 Ga0070667_100069059
909 Ga0070667_100200892
910 Ga0070667_100393519
911 Ga0070708_100181819
912 Ga0070663_100281408
913 Ga0070678_100015055
914 Ga0070662_100024236
915 Ga0070662_100453955
916 Ga0070707_100520909
917 Ga0074250_12230
918 Ga0068853_100018345
919 Ga0070672_100151508
920 Ga0070696_100009243
921 Ga0070665_100088422
922 Ga0070665_100248677
923 Ga0070665_100839453
924 Ga0068855_100107378
925 Ga0070664_100001692
926 Ga0070664_100009223
927 Ga0070664_100116433
928 Ga0068854_100024384
929 Ga0068852_100033408
930 Ga0068866_10069945
931 Ga0068851_10010148
932 Ga0068863_100009589
933 Ga0068863_100729575
934 Ga0068858_100038966
935 Ga0068860_100104582
936 Ga0068860_100622858
937 Ga0081538_10004879
938 Ga0075365_10000499
939 Ga0075368_10058445
940 Ga0075363_100006375
941 Ga0075363_100117241
942 Ga0075363_100120608
943 Ga0075363_100156550
944 Ga0075363_100204754
945 Ga0075364_10004388
946 Ga0075364_10029011
947 Ga0075364_10031420
948 Ga0075364_10149558
949 Ga0070712_100291695
950 Ga0075362_10017200
951 Ga0075362_10151461
952 Ga0075367_10177486
953 Ga0075367_10211326
954 Ga0075366_10017858
955 Ga0075366_10069323
956 Ga0075366_10167057
957 Ga0097621_100183013
958 Ga0097621_100203292
959 Ga0075370_10006928
960 Ga0075370_10014387
961 Ga0075370_10020408
962 Ga0075370_10023929
963 Ga0075370_10026852
964 Ga0068871_100064748
965 Ga0075430_100015143
966 Ga0075430_100091033
967 Ga0075430_100234007
968 Ga0075431_100018061
969 Ga0075431_100026019
970 Ga0075431_100054811
971 Ga0075433_10002638
972 Ga0075433_10090205
973 Ga0075434_100005021
974 Ga0075434_100025406
975 Ga0075429_100025948
976 Ga0075429_100049096
977 Ga0099826_10003330
978 Ga0099826_10145492
979 Ga0075435_100006375
980 Ga0105251_10088378
981 Ga0105244_10006079
982 Ga0105244_10012501
983 Ga0105244_10027847
984 Ga0105244_10042638
985 Ga0105244_10062105
986 Ga0105244_10221842
987 Ga0105244_10232879
988 Ga0105250_10028905
989 Ga0105240_10014478
990 Ga0105240_10096400
991 Ga0105240_10124319
992 Ga0105245_10066112
993 Ga0105247_10010556
994 Ga0114129_10964067
995 Ga0105243_10000005
996 Ga0105243_10000481
997 Ga0105243_10005911
998 Ga0105243_10069193
999 Ga0105242_10221796
1000 Ga0105242_10279982
1001 Ga0105242_10462811
1002 Ga0105242_10599796
1003 Ga0105248_10468699
1004 Ga0105248_10690665
1005 Ga0105237_10000296
1006 Ga0105238_10034295
1007 Ga0105238_10090160
1008 Ga0105239_10000250
1009 Ga0105239_10076230
1010 Ga0105239_10622341
1011 Ga0105246_10002991
1012 Ga0105246_10023702
1013 Ga0105246_10075113
1014 Ga0105246_10721820
1015 Ga0157371_10011368
1016 Ga0157371_10049688
1017 Ga0157371_10142439
1018 Ga0157370_10007628
1019 Ga0157370_10436765
1020 Ga0157369_10030735
1021 Ga0157374_10233809
1022 Ga0157378_10136035
1023 Ga0163162_10011471
1024 Ga0157372_10083033
1025 Ga0157375_10024840
1026 Ga0182008_10000248
1027 Ga0182008_10027578
1028 Ga0182008_10037366
1029 Ga0182008_10051748
1030 Ga0157379_10543019
1031 Ga0157376_10114435
1032 Ga0182006_1002817
1033 Ga0182006_1029757
1034 Ga0182007_10001320
1035 Ga0182007_10003094
1036 Ga0182007_10039823
1037 Ga0183362_10001
1038 Ga0163161_10000578
1039 Ga0163161_10010469
1040 Ga0163161_10023675
1041 Ga0163161_10077465
1042 Ga0163161_10483552
1043 Ga0213872_10001126
1044 Ga0213872_10057105
1045 Ga0213874_10007518
1046 Ga0209784_100151
1047 Ga0209566_100196
1048 Ga0209566_106134
1049 Ga0209672_102245
1050 Ga0209147_104170
1051 Ga0209437_100524
1052 Ga0209258_100058
1053 Ga0207425_1000087
1054 Ga0207425_1000921
1055 Ga0209148_1000071
1056 Ga0209129_1000007
1057 Ga0209129_1016558
1058 Ga0209129_1019157
1059 Ga0209565_1000075
1060 Ga0209565_1001142
1061 Ga0209455_1000359
1062 Ga0209673_1000066
1063 Ga0209673_1000080
1064 Ga0209673_1002015
1065 Ga0209130_1000131
1066 Ga0209130_1000137
1067 Ga0209675_1000074
1068 Ga0209675_1000102
1069 Ga0209675_1001838
1070 Ga0209675_1001972
1071 Ga0209675_1014865
1072 Ga0209676_1000005
1073 Ga0209676_1000139
1074 Ga0209676_1000186
1075 Ga0209676_1000703
1076 Ga0209676_1001078
1077 Ga0209676_1041679
1078 Ga0209025_1000056
1079 Ga0209025_1000088
1080 Ga0209025_1000104
1081 Ga0209025_1008022
1082 Ga0209025_1008927
1083 Ga0209025_1010001
1084 Ga0209564_1000073
1085 Ga0209564_1000090
1086 Ga0209758_1000044
1087 Ga0209758_1002538
1088 Ga0209758_1030843
1089 Ga0209050_1000007
1090 Ga0209050_1000250
1091 Ga0209050_1005618
1092 Ga0209256_1000020
1093 Ga0209256_1000022
1094 Ga0209256_1033560
1095 Ga0207426_1000001
1096 Ga0207426_1000031
1097 Ga0209051_1000036
1098 Ga0209051_1000078
1099 Ga0209051_1000160
1100 Ga0209051_1000213
1101 Ga0209051_1000257
1102 Ga0209051_1011578
1103 Ga0209051_1028273
1104 Ga0209257_1000011
1105 Ga0209257_1000012
1106 Ga0209257_1000116
1107 Ga0209257_1000222
1108 Ga0209257_1003620
1109 Ga0209257_1010150
1110 Ga0207696_1001081
1111 Ga0207655_1002033
1112 Ga0207655_1002576
1113 Ga0207655_1002672
1114 Ga0207655_1002703
1115 Ga0207655_1005759
1116 Ga0207655_1006420
1117 Ga0207713_1010478
1118 Ga0207710_10000172
1119 Ga0207688_10052548
1120 Ga0207705_10088474
1121 Ga0207695_10023858
1122 Ga0207695_10290833
1123 Ga0207671_10011355
1124 Ga0207671_10104987
1125 Ga0207657_10057735
1126 Ga0207649_10010047
1127 Ga0207681_10082402
1128 Ga0207681_10205550
1129 Ga0207650_10050473
1130 Ga0207687_10033564
1131 Ga0207690_10001849
1132 Ga0207706_10146369
1133 Ga0207706_10504022
1134 Ga0207709_10000001
1135 Ga0207709_10000292
1136 Ga0207709_10002968
1137 Ga0207709_10034195
1138 Ga0207691_10128560
1139 Ga0207691_10162804
1140 Ga0207691_10224580
1141 Ga0207711_10049953
1142 Ga0207711_10297692
1143 Ga0207689_10015046
1144 Ga0207661_10064344
1145 Ga0207679_10000245
1146 Ga0207651_10160534
1147 Ga0207640_10038670
1148 Ga0207658_10000412
1149 Ga0207658_10050675
1150 Ga0207703_10006312
1151 Ga0207639_10102875
1152 Ga0207639_10255966
1153 Ga0207702_10160146
1154 Ga0207641_10009620
1155 Ga0207641_10204084
1156 Ga0207676_10325469
1157 Ga0207674_10297723
1158 Ga0207683_10005862
1159 Ga0207683_10018267
1160 Ga0207683_10034463
1161 Ga0207683_10128229
1162 Ga0207698_10069424
1163 Ga0207698_10121415
1164 Ga0209371_1000006
1165 Ga0209969_1003204
1166 Ga0209981_1018448
1167 Ga0209995_1004345
1168 Ga0209282_1000221
1169 Ga0209282_1120448
1170 Ga0209971_1006633
1171 Ga0209966_1023477
1172 Ga0209974_10006449
1173 Ga0207428_10025463
1174 Ga0207428_10025611
1175 Ga0268266_10023253
1176 Ga0268266_10564629
1177 Ga0268265_10055662
1178 Ga0268264_10111176
1179 Ga0265337_1053412
1180 Ga0265334_10000827
1181 Ga0307517_10004912
1182 Ga0307515_10000006
1183 Ga0307515_10000306
1184 Ga0307515_10057287
1185 Ga0307515_10292199
1186 Ga0307515_10294898
1187 Ga0265338_10010944
1188 Ga0265338_10011529
1189 Ga0265338_10042697
1190 Ga0265324_10024436
1191 Ga0268256_1000007
1192 Ga0307512_10005276
1193 Ga0316177_1105017
1194 Ga0314311_1155152
1195 Ga0316178_1068791
1196 Ga0316180_1050822
1197 Ga0316183_1039891
1198 Ga0316181_1078789
1199 Ga0316182_1190822
1200 Ga0265330_10066331
1201 Ga0265332_10000094
1202 Ga0265332_10064125
1203 Ga0265328_10003603
1204 Ga0265328_10019905
1205 Ga0265320_10048560
1206 Ga0265320_10136512
1207 Ga0265331_10005085
1208 Ga0265331_10034829
1209 Ga0265331_10043885
1210 Ga0265331_10102982
1211 Ga0265327_10006203
1212 Ga0265327_10019851
1213 Ga0265327_10027976
1214 Ga0265316_10008373
1215 Ga0265316_10012742
1216 Ga0265316_10085054
1217 Ga0265316_10124170
1218 Ga0307513_10051472
1219 Ga0307513_10220338
1220 Ga0307513_10332493
1221 Ga0307408_100110771
1222 Ga0307408_100159897
1223 Ga0307508_10011794
1224 Ga0316575_10001169
1225 Ga0265314_10011481
1226 Ga0265314_10012964
1227 Ga0265314_10025842
1228 Ga0265314_10128646
1229 Ga0265314_10151812
1230 Ga0265342_10045457
1231 Ga0316576_10031177
1232 Ga0316576_10083412
1233 Ga0316576_10091160
1234 Ga0316576_10146743
1235 Ga0316578_10010891
1236 Ga0307516_10217266
1237 Ga0307405_10001524
1238 Ga0316577_10006651
1239 Ga0316577_10063816
1240 Ga0316577_10177270
1241 Ga0307406_10017753
1242 Ga0307406_10380051
1243 Ga0307412_10010332
1244 Ga0307416_100043673
1245 Ga0307416_100126598
1246 Ga0307411_10037176
1247 Ga0307411_10199074
1248 Ga0307411_10217608
1249 Ga0307411_10282556
1250 Ga0307411_10310685
1251 Ga0307415_100121710
1252 Ga0316585_10080829
1253 Ga0316580_10015636
1254 Ga0316593_10001705
1255 Ga0316593_10014207
1256 Ga0307510_10041814
1257 Ga0307510_10177388
1258 Ga0316587_1011069
1259 Ga0316596_1018021
1260 Ga0373943_0081189
1261 Ga0373955_0073008
1262 Ga0316574_0206237
1263 Ga0316582_0045365
1264 Ga0316582_0176261
1265 Ga0316584_0005970
1266 Ga0316584_0021546
1267 Ga0316584_0086613
1268 Ga0373925_0162515
1269 Ga0395899_0023506
1270 Ga0395899_0027560
1271 Ga0395899_0098060
1272 Ga0395900_0000063
1273 Ga0395900_0061938
1274 Ga0395900_0108516
1275 Ga0395900_0157926
1276 Ga0395898_0006380
1277 Ga0395898_0010832
1278 Ga0395905_0000443
1279 Ga0395905_0055765
1280 Ga0395905_0091368
1281 Ga0395905_0117574
1282 Ga0395905_0319772
1283 Ga0395901_0087577
1284 Ga0395901_0316787
1285 Ga0395901_0587435
1286 Ga0400485_05586
1287 Ga0400488_16420
1288 Ga0400486_12391
1289 Ga0436365_0488796
1290 Ga0436360_0438486
1291 Ga0436361_0109034
1292 Ga0436361_0168382
1293 Ga0436361_0653184
1294 Ga0436363_1281725
1295 Ga0439436_0000212
1296 Ga0439436_0018026
1297 Ga0439447_013933
1298 Ga0439465_0001922
1299 Ga0439465_0132803
1300 Ga0451849_1462899
1301 Ga0439431_0054515
1302 Ga0439433_0000802
1303 Ga0439442_006094
1304 Ga0439445_0009924
1305 Ga0439445_0045973
1306 Ga0439449_0000162
1307 Ga0439449_0003523
1308 Ga0439449_0009856
1309 Ga0439452_000749
1310 Ga0439455_0027801
1311 Ga0439462_0026231
1312 Ga0439463_010290
1313 Ga0450920_020777
1314 Ga0450890_011543
1315 Ga0450907_004002
1316 Ga0439446_0013796
1317 Ga0439458_0003995
1318 Ga0439458_0019659
1319 Ga0450908_014546
1320 Ga0439434_0004673
1321 Ga0439434_0019589
1322 Ga0439460_0071563
1323 Ga0450916_005301
1324 Ga0450918_001383
1325 Ga0450893_0000684
1326 Ga0450893_0012365
1327 Ga0451577_0023778
1328 Ga0451577_0094965
1329 Ga0451577_0523177
1330 Ga0439440_0026087
1331 Ga0466969_0042909
1332 Ga0466969_0043578
1333 Ga0453683_0002359
1334 Ga0466965_0038070
1335 Ga0466965_0207724
1336 Ga0466966_0014971
1337 Ga0466966_0197596
1338 Ga0466961_0011090
1339 Ga0466961_0073364
1340 Ga0453684_0041347
1341 Ga0453684_0044822
1342 Ga0453684_0904711
1343 Ga0466957_0101181
1344 Ga0466959_0032340
1345 Ga0451576_0001973
1346 Ga0451576_0005477
1347 Ga0451576_0007413
1348 Ga0451576_0062335
1349 Ga0451576_0461438
1350 Ga0451576_0888064
1351 Ga0466967_0984494
1352 Ga0495627_004409
1353 Ga0495627_028567
1354 Ga0495592_0000478
1355 Ga0495592_0155355
1356 Ga0495590_0005550
1357 Ga0495591_039412
1358 Ga0495638_0099749
1359 Ga0495653_0065406
1360 Ga0495639_0071286
1361 Ga0495608_0052256
1362 Ga0495616_0001622
1363 Ga0495620_0106301
1364 Ga0495631_0003611
1365 Ga0495663_0085826
1366 Ga0495642_0025051
1367 Ga0495652_0474842
1368 Ga0495640_0192496
1369 Ga0495621_0108121
1370 Ga0495622_0043947
1371 Ga0495667_0148430
1372 Ga0495656_0000193
1373 Ga0495625_0000057
1374 Ga0495588_0067289
1375 Ga0495588_0073967
1376 Ga0495657_0322063
1377 Ga0495658_0006263
1378 Ga0495670_0272336
1379 Ga0495660_0004595
1380 Ga0495581_0137626
1381 Ga0495604_0061684
1382 Ga0495676_0233490
1383 Ga0495614_0064795
1384 Ga0496100_0599137
1385 Ga0496101_0003661
1386 Ga0496102_0020130
1387 Ga0496103_0028975
1388 Ga0496104_0001081
1389 Ga0496105_0025976
1390 Ga0496106_0123914
1391 Ga0496107_0423469
1392 Ga0496108_0412522
1393 Ga0496110_0067898
1394 Ga0496110_0072369
1395 Ga0496110_0287222
1396 Ga0496111_0137037
1397 Ga0496111_0172463
1398 Ga0496114_0072792
1399 Ga0496115_0004095
1400 Ga0496116_0000596
1401 Ga0496116_0010830
1402 Ga0496116_0030387
1403 Ga0496116_0108081
1404 Ga0496116_0135126
1405 Ga0496117_0028533
1406 Ga0496117_0223145
1407 Ga0496118_0004128
1408 Ga0496118_0016121
1409 Ga0496118_0047711
1410 Ga0496119_0000682
1411 Ga0496119_0006105
1412 Ga0496119_0092451
1413 Ga0496120_0000678
1414 Ga0496120_0010297
1415 Ga0496120_0084670
1416 Ga0496121_0269419
1417 Ga0496121_0270710
1418 Ga0496121_0322973
1419 Ga0496122_0017422
1420 Ga0496122_0044689
1421 Ga0496122_0053526
1422 Ga0496122_0077691
1423 Ga0496122_0138161
1424 Ga0496122_0223970
1425 Ga0496123_0000108
1426 Ga0496123_0082204
1427 Ga0496124_0000542
1428 Ga0496124_0008708
1429 Ga0496124_0048959
1430 Ga0496124_0198462
1431 Ga0496124_0222762
1432 Ga0496124_0344690
1433 Ga0496125_0000920
1434 Ga0496125_0008866
1435 Ga0496125_0059271
1436 Ga0496125_0117968
1437 Ga0496125_0187609
1438 Ga0496125_0225309
1439 Ga0496126_0005347
1440 Ga0496126_0012013
1441 Ga0501032_0007886
1442 Ga0501033_0053132
1443 Ga0501034_0046544
1444 Ga0501034_0131514
1445 Ga0501034_0180621
1446 Ga0501036_0002624
1447 Ga0501036_0103759
1448 Ga0501036_0114526
1449 Ga0501036_0264858
1450 Ga0501036_0422520
1451 Ga0501037_0066636
1452 Ga0501037_0263019
1453 Ga0501037_0294303
1454 Ga0501038_0006635
1455 Ga0501038_0092190
1456 Ga0501038_0560320
1457 Ga0501039_0012059
1458 Ga0501039_0208127
1459 Ga0501039_0331964
1460 Ga0501039_0589796
1461 Ga0501039_0753478
1462 Ga0501042_0008784
1463 Ga0501042_0199012
1464 Ga0501043_0007806
1465 Ga0501043_0399674
1466 Ga0501046_0005506
1467 Ga0501046_0034919
1468 Ga0501047_0000522
1469 Ga0501047_0005585
1470 Ga0501047_0064631
1471 Ga0501047_0398911
1472 Ga0501047_0644984
1473 Ga0501048_0078533
1474 Ga0501048_0325780
1475 Ga0501048_0381736
1476 Ga0501048_0386765
1477 Ga0501067_0016902
1478 Ga0501067_0091580
1479 Ga0501067_0195615
1480 Ga0501067_0249256
1481 Ga0501069_0081821
1482 Ga0501069_0105371
1483 Ga0501071_0044932
1484 Ga0501071_0120585
1485 Ga0501072_0089875
1486 Ga0501072_0153936
1487 Ga0501072_0429803
1488 Ga0501073_0015241
1489 Ga0501073_0028689
1490 Ga0501073_0049769
1491 Ga0501073_0097478
1492 Ga0501073_0114704
1493 Ga0501073_0339735
1494 Ga0501075_0155825
1495 Ga0501076_0011770
1496 Ga0501225_0007216
1497 Ga0501080_0192021
1498 Ga0501080_0313276
1499 Ga0501080_0672822
1500 Ga0501083_0006222
1501 Ga0501083_0081008
1502 Ga0501083_0187637
1503 Ga0501262_000418
1504 Ga0501035_0116026
1505 Ga0501044_0000183
1506 Ga0501044_0007969
1507 Ga0501044_0218839
1508 Ga0501045_0085194
1509 nmdc:mga03683_1803_c1
1510 nmdc:mga03n38_252897_c1
1511 nmdc:mga03n38_87449_c1
1512 nmdc:mga00v17_117111_c1
1513 nmdc:mga00v17_30760_c1
1514 nmdc:mga0k408_41463_c1
1515 nmdc:mga0k408_44683_c1
1516 nmdc:mga06z11_114667_c1
1517 nmdc:mga06z11_123977_c1
1518 nmdc:mga07m45_22269_c1
1519 nmdc:mga07m45_3731_c1
1520 nmdc:mga07m45_69128_c1
1521 nmdc:mga07m45_72022_c1
1522 nmdc:mga05p37_777838_c1
1523 nmdc:mga09592_7151_c1
1524 nmdc:mga0qj67_22757_c1
1525 nmdc:mga0qj67_317379_c1
1526 nmdc:mga0qj67_37458_c1
1527 nmdc:mga06r32_487803_c1
1528 nmdc:mga06r32_83805_c1
1529 nmdc:mga08y16_1000_c1
1530 nmdc:mga08y16_346177_c1
1531 nmdc:mga0n895_29647_c1
1532 nmdc:mga0n895_4457_c1
1533 nmdc:mga0rr50_4295_c1
1534 nmdc:mga0a205_21378_c1
1535 nmdc:mga0a205_725_c1
1536 Ga0495601_0010487
1537 Ga0500610_0037924
1538 Ga0500610_0040179
1539 Ga0495655_0091867
1540 Ga0495619_0040142
1541 Ga0500643_003606
1542 Ga0500646_0134545
1543 Ga0500651_0000090
1544 Ga0500566_0031058
1545 Ga0500641_0035978
1546 Ga0500571_000014
1547 Ga0500572_006241
1548 Ga0500593_001335
1549 Ga0500594_0000375
1550 Ga0500594_0001172
1551 Ga0500607_000328
1552 Ga0500608_003138
1553 Ga0500608_055924
1554 Ga0500618_013715
1555 Ga0500655_000075
1556 Ga0500658_0000018
1557 Ga0500658_0000322
1558 Ga0500559_0000011
1559 Ga0500559_0009178
1560 Ga0500559_0010108
1561 Ga0500559_0011930
1562 Ga0500568_0049088
1563 Ga0500573_0013759
1564 Ga0500574_016421
1565 Ga0500604_0068011
1566 Ga0500616_0122204
1567 Ga0500622_0002568
1568 Ga0500622_0027911
1569 Ga0500627_0001126
1570 Ga0500634_0043273
1571 Ga0500638_007322
1572 Ga0500565_001028
1573 Ga0500587_000071
1574 Ga0501084_0011445
1575 Ga0501084_0050809
1576 Ga0501084_0107602
1577 Ga0501084_0150072
1578 Ga0590071_000671
1579 Ga0590074_001247
1580 Ga0590075_000135
1581 Ga0590077_000917
1582 Ga0501082_0007506
1583 Ga0501082_0009486
1584 Ga0501082_0093551
1585 Ga0501082_0190467
1586 Ga0501082_0327616
1587 Ga0466962_0035738
1588 2513226423
1589 2550903433
1590 2552749147
1591 2556066060
1592 2563930593
1593 2571530876
1594 2573041707
1595 2578334537
1596 2580930452
1597 2599626497
1598 2599675561
1599 2599684034
1600 2599696048
1601 2601636910
1602 2621272563
1603 2640734095
1604 2643738691
1605 2644163328
1606 2644304722
1607 2644327811
1608 2644337860
1609 2644361228
1610 2644400506
1611 2644468394
1612 2678231069
1613 2723601374
1614 2728529743
1615 2730137497
1616 2738717922
1617 2738879579
1618 2739250274
1619 2739278608
1620 2745160193
1621 2753812984
1622 2774388382
1623 2774437584
1624 2802440567
1625 2819597451
1626 2819676046
1627 2821118263
1628 2831266629
1629 2838057292
1630 2842679567
1631 2842734864
1632 2842751528
1633 2864738816
1634 2881101980
1635 2881639589
1636 2885192573
1637 2885201348
1638 2885214970
1639 2885529778
1640 2888578955
1641 2889042475
1642 2889052511
1643 2889277467
1644 2899924961
1645 2904119525
1646 2904167383
1647 2904455666
1648 2904462824
1649 2904482562
1650 2904496856
1651 2904544913
1652 2904601013
1653 2904758162
1654 2907205061
1655 2916702080
1656 2919183981
1657 2919467337
1658 2919507812
1659 2928045480
1660 2928058377
1661 2928064042
1662 2928071415
1663 2928084644
1664 2928518123
1665 2929163417
1666 2929207110
1667 2929522654
1668 2931385900
1669 2938653451
1670 2939631833
1671 2939685029
1672 2939706830
1673 2945912118
1674 2945947821
1675 2945977334
1676 2945985597
1677 2945995497
1678 2946058204
1679 2968562218
1680 2971406907
1681 2971513844
1682 2980179565
1683 2984531980
1684 2984533234
1685 2984570157
1686 2988230062
1687 2996637389
1688 2996711041
1689 648167958
1690 8002394423
1691 8033232739
1692 8048749310
1693 8054468521
1694 8055228117
1695 8057735771
1696 8057979760

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

46

307

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.9301 1 253
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.9125 1 253
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9044 3 252
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9038 3 253
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.9013 2 253
ID Description Score Start End Superfamily
af_P0AFQ7_2_265_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9256 1 253 3.20.20.140
af_P0AFQ7_2_265_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.908 1 253 3.20.20.140
af_P39408_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.907 2 253 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9038 3 253 3.20.20.140
af_P90989_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9036 3 253 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A257P9D9-F1-model_v4 DNAase 0.9945 107 252 GO:0005829
GO:0016788
AF-A0A7V8K041-F1-model_v4 Putative metal-dependent hydrolase YcfH 0.9939 1 254 GO:0004536
GO:0005829
AF-A0A519IQI9-F1-model_v4 TatD family deoxyribonuclease 0.9891 1 257 GO:0004536
GO:0005829
GO:0046872
AF-A0A2N3AUL3-F1-model_v4 LuxR family transcriptional regulator 0.9865 129 254 GO:0005829
GO:0016788
AF-A0A520JB74-F1-model_v4 TatD family deoxyribonuclease 0.9864 109 254 GO:0005829
GO:0016788

Map